3F1PB

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
b'VCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
molecule tags Transcription
source organism Homo sapiens
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
total genus 30
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1pB01
3EEHA 3H7WA 4R70A 3GECA 4HHDA 1S1ZA 4MN5A 2WKQA 1S66L 2M1CA 3NOUC 3CWFA 2OOLA 2V0UA 5F6AA 4GS9A 3FC7A 5F69A 2WKPA 4GHIB 2PR6A 2QJ5A 4MN6A 4R3AA 2JN7A 1UWPX 4BBUA 2V1BA 1OTEA 2V0WA 1DP8A 4XT2A 4EESA 4HH2A 4EXOA 3E4OA 3UMEA 3LIEA 4EERA 4LRXC 3E4QA 1LL8A 2PD8A 3MR0A 4GW9A 2JHEA 4HJ3A 1TS0A 1TS6A 1UWNX 3G6OA 4WN5A 5HWVA 1WA9A 1T1AA 1OT6A 3CAXA 5J4EA 1GSWA 1LSVA 1OJ5A 4HJ4A 3RH8B 1OTAA 1JNUA 1V9YA 2I9VA 3GDIA 1LSWA 3D72A 3NHQA 3ZQ5A 5HDCA 1MZUA 4LRZE 5DKLA 1ODVA 5G4ZA 2YKHA 1P97A 1OJGA 3F1OB 3CLOA 3F1NB 4HP4A 4R38A 5AVEA 1OT9A 1N9NA 1TS8A 2HV1A 2KDKA 3FG8A 4I3JA 1T1BA 4M4XA 4WLAA 4DJ3A 3UB7A 2PYPA 1N9OA 2OWJA 4I3AA 4I39A 2QJ7A 4PKYA 3F1OA 2B02A 5I5LA 1OTIA 3C2WA 3B33A 4K08A 4LPZA 4DJ2A 3F1PA 4I5SA 4HH3A 3IBRA 3LIFA 4I38A 2PHYA 4LRYC 4WF0A 4B9OA 2CMNA 1P0ZA 4HJ6A 1UGUA 3IS2A 5G4YA 2GJ3A 4EQ1A 3K3CA 2ZOIA 3LICA 3MFXA 3UB9A 4NXGA 4HOIA 2YKFA 5HWWA 3LUQA 1NWZA 4KQDA 1OTDA 2PDRA 4HIAA 2INWA 4HNBA 4NXFA 1XJ3A 1F98A 2ZBBA 1DP6A 2L4RA 4BBVA 4HY8A 3K3DA 4HI4A 3T50A 3UMDA 5A8BA 1DP9A 1V9ZA 2KX6A 1D06A 5AVFA 1T1CA 3PYPA 5TBMA 2R78A 3RTYA 3LIBA 3MQQA 4EEUA 1XJ2A 3NJAA 3ULFA 3SW1A 1EW0A 1S4SA 1S67L 2P7JA 3BY8A 3H82A 5HD5A 1XJ6A 3A0RA 4F3LA 3LI9A 3UE6A 4GHIA 4L9GA 3ICYA 1BYWA 4KUOA 2W0NA 2L1MA 5F68A 5TBMB 4PKYG 1XFQA 2EA9A 1OTBA 3PHYA 4L9EA 4XT2B 2W27A 2D02A 2K7SA 1LSXA 3H82B 1DRMA 1XFNA 4JGPA 2V1AA 3H9WA 5EFWA 4YWZA 4HP9A 3LI8A 5HWTA 4E04A 5HDSA 1LT0A 2A24B 4F3LB 4HQAA 1KOUA 4H6JA 5KIZA 3LYXA 2PYRA 2QKPA 5J3WA 3UB8A 1Y28A 1G28A 1T19A 1F9IA 2PR5A 3A0VA 3LIAA 3NOPC 2A24A 3BWLA 3OLOA 5HD3A 3UB6A 3A0SA 4NXEA 4BBTA 4RQ9A 4H6JB 3MJQA 3C8CA 1GSVA 3F1NA 2OWHA 4EW7A 3HJKA 1GSXA 1X0OA 1N9LA 1S4RA 1XJ4A 3HJIA 4NXBA 2BASA 2PD7A 3LIDA 1S1YA 2VV6A 3F1PB 3MQOA 4I3IA 2VV8A 2L0WA 4LLOB 4R6LA 2V9AA 2VEAA 2VLGA 2Z6DA 3E4PA 3BY9A 3KX0X 1VB6A 3IS2B 4KUKA 5F5YA 5HDDA 3VOLA 2QWSA 4EEPA 4JGQA 3MXQA 4GCZA 5DJTA 3VE4A 5HZHA 5DKKA 5IS1A 3P7NA 2Z6CA 5DJUA 3H7WB 4JGOA 1T18A 2H28A 4L9FA 1TS7A 5HSQA 4WUJA 4WL9A 4EETB 3NOTC 4JGRA 3EWKA 2J80A 2QHKA 4GS9B 2VV7A 2ZOHA 5IU1A 3VE3A 2WKRA 5J7EA 1D7EA 2D01A
chains in the Genus database with same CATH superfamily
1S1ZA 1SDEA 2Q9NA 3OBFA 5F69A 3IHBA 3OOVA 3G32A 4P6ZS 2IWDA 4GLQA 1NYYA 5HARA 4BBUA 4BL2A 3IF6B 4IJGA 5FEFA 1HLUP 3O86A 1PFLA 5KMWA 4MEZA 2Y55A 1Q2PA 1MZUA 1HTZA 2PBYA 4X56A 2HZ5A 3VOYA 3S4XA 3FG8A 1RCJA 2Y4AA 1FSWA 1L0EA 4KZ6A 1PW1A 4I3AA 4I39A 2P9VB 4HH3A 5JYPA 3PR6A 2CMNA 4N1HA 1U60A 4F94A 4FD8A 4EQ1A 3E2KA 1TEMA 3HBRA 5FATA 3SS5A 4MLLA 1T1CA 2Y2JA 3GV9A 2GNXA 1KDSA 4JXVA 3JYIA 3T4TA 1BYWA 4KUOA 2L1MA 4XT2B 1DRMA 5HWTA 2H10A 4KG2A 4HQAA 1Y54A 4WEKA 4E3MA 3IQAA 2XK1A 3C8CA 1GSVA 3F1NA 2ZL1B 4NXBA 3IHAA 4G3KA 5G4ZA 2VEAA 5F5YA 3JVVA 4EEPA 2W3FA 4K0XA 3PBQA 5CTNA 2Z6CA 4L9FA 4WUJA 2HDRA 2Y2NA 4X1MA 4GS9B 1H8YA 4KQQA 2PU4A 2Y59A 3WRTA 5DTKA 5HAQA 1W8QA 3IXHA 2OOLA 3EGDC 4IEDA 1FQGA 3HUNA 4OPZA 2XSSA 3LY4A 2XR0A 5MC7A 2VA0A 4EERA 4Z1WA 4GJ4A 3T4QA 4BENA 2Z2LB 5A91A 1E4DA 3WS0A 1GHMA 4EV4A 3G6OA 2I72A 4E6XA 2PRFA 3KSFA 3VMAA 1OTAA 2I9VA 4Q8IA 1ALQA 4DE1A 2JKTM 3D9YA 2Y2QA 1TD5A 4RX3A 4OKPA 2W1TA 4CLCE 2KDKA 3B3XA 1T1BA 2HJEA 2R9WA 2ZC7A 1F2KA 3LIFA 4B9OA 4HJ6A 3IS2A 1K55C 4HOIA 3C4PA 3LUQA 2XLNA 1Y4OA 4BJPA 5A8BA 4KG6A 3SW1A 5EVID 1XJ6A 2M7UA 3UE6A 2XF3A 1HD8A 3LR4A 2Y2HA 1EI5A 4L9EA 1MBLA 3H9WA 1STZA 4S2KA 5HPIA 1RGZA 4LV0A 3OPHA 3N4IA 1WYBA 3HLGA 3CUEA 4K0WA 1YPRA 2OV5A 2VGJA 1S4RA 4R23A 4X6TA 1FCMA 3LIDA 3NDGA 5CRFA 2VV6A 3HUOA 3C5AA 2ZQDA 3KX0X 5FQQA 2OLUA 3VOLA 2PAVP 4ZAMA 5DJUA 3B47A 4CQHA 2VJWA 4WEJA 5IU1A 4PM8A 4PHTA 3GVBA 2Q9MA 3DTMA 5M19A 4QY5A 4S2IA 4JBFA 4OP8A 2VKSA 4PMAA 3HREA 1KGFA 3V5MA 2VGLS 5AQ9A 2RCXA 2P08A 2MJ6A 1MY8A 4UA7A 1YLZA 4C6YA 1OJ5A 1KE3A 4FUWA 1V9YA 2ZQAA 4Z9QA 3MFDA 5E2GA 5HAIA 4HP4A 4FTXA 4I3JA 4WZ5C 3BW6A 1CI8A 2PYPA 4RX2A 1YLWA 1TDGA 2O9BA 1WE4A 4E3IA 2WGVA 1JWVA 5CX7A 1G68A 3AGEA 4S2PA 1OTDA 1YAXA 4KZAA 2Y2LA 5M18A 2ZLYA 4AFIA 5AVFA 3RTYA 3ULFA 3W4OA 3M2KA 4PM6A 5TJJA 1GHIA 3TRCA 2JCHA 4JF4A 1XFNA 4ZJ1A 1F5MA 4HP9A 5HDSA 1QMFA 4E3OA 3ZG0A 3C30A 1J3WA 1K54C 5J3WA 1G28A 2HP5A 4QJGA 3FPWA 4S2LA 3VP1A 4DDSA 4CPKA 1JTGA 1YMSA 3GQZA 3SZTA 1N9LA 4FH4A 4HESA 3MQOA 1SHVA 3OCLA 2J3TC 2ZL1A 1BULA 3LR5A 2FFFB 3H7WB 5DF9A 5TGFA 2V20A 4BD1A 4JGRA 1H8MA 3V50A 1ESUA 2XD5A 3H7WA 4UQIS 1VETA 3MF0A 1S66L 5FQMA 5IHVA 5FQKA 3NC8A 3W4QA 4GHIB 4GD8A 1RP5A 2J9PA 1C3BA 2R9XA 3ZVWA 1BTLA 1PNEA 4GKUA 1T1AA 3CAXA 3SH7A 3IF5A 3LGOA 2Z2MB 1PRQA 5DKLA 1K4EA 1YSPA 1P97A 3CLOA 1XGIA 4N9LA 1N9NA 4O0PA 1KGGA 3UB7A 1N9OA 2Y91A 4OH0A 3C2WA 2W1TB 1MWRA 2WKIA 5HAPA 3WRZA 1P0ZA 3PBNA 4KQDA 3BLMA 2PDRA 4WELA 1IYOA 4YINA 4U0TA 3G30A 2HPBA 3T4JA 3GR2A 3MQQA 1VQQA 4L9GA 4RA7A 4KQOA 3IT9A 4DXBA 2W3DA 5CGWA 1AWIA 2J7VA 3BRMA 2A49A 2XA7M 1ES3A 4I3IA 1ONHA 3MBZA 1EROA 1FSYA 1K6SA 3CHWP 1L2SA 1I5QA 1NYMA 1NZUA 3QNCA 1SKOA 3O87A 2VV7A 2D01A 4GD6A 4UEYA 2DNSA 1FOFA 1H0MA 2WZZA 2EX6A 3QP6A 1CEGA 5FI7A 4LRXC 5AJGA 3HLWA 3LEZA 1PZOA 4KZ9A 1LSWA 4DE3A 2B95A 1OJGA 4Y0OA 2QMIA 4R3JA 4U0XA 1BT5A 1XA7A 1PZPA 2OWJA 3BQ8A 4MBKA 5GHXA 5CECA 2B02A 3B33A 1MC0A 4LRYC 4I38A 3K2NA 2HJ9C 2ZOIA 3M2JA 3UB9A 5C5KA 3UMDA 3IXBA 3LIBA 3M6BA 3PBSA 2NUTC 2O9CA 4ZTKA 4BMWA 4E6WA 3KSHA 2Y2PA 1LI9A 4GB7A 2WYXA 5EFWA 2A24B 1XGJA 2ZMAA 4R0QA 3A3EA 2VGKA 3FWLA 4ETXA 1W63Q 4Y3IA 1EWZA 1XX2A 3CUEC 2VV8A 3TE8A 4XUXA 3BEBA 2ZJ9A 3Q82A 3DTIA 5F1GA 5D3OA 2X01A 2C5WB 4JXWA 3IX8A 4G3VA 3SH8A 4KZ3A 5EOEA 4P6ZM 2XEPA 5A93A 2ACGA 1RGYA 3FZCA 2JN7A 2V1BA 3IWQA 4EXOA 3BFFA 3LIEA 2W3GA 5EPHA 1IYPA 2JHEA 1TS6A 5EM0A 1MWTA 4WN5A 1WA9A 2WGWB 2A3UA 4NG2A 3ZQ5A 3KSGA 1XP4A 2WGWA 3FKWA 3PBTA 1LI0A 1SDNA 3BM6A 5HL6A 1SKFA 4ME4A 5GLBA 1L3LA 2WKEA 5AQBA 5DTSA 4GDNA 4JF5A 4NXFA 2K31A 4S2MA 1O7EA 3LY3A 2KX6A 3UE1A 1ONGA 1S4SA 4C75A 2V8CA 4PAUA 3S7OA 3E0YA 2W27A 2K7SA 1K38A 4LCMA 1KOUA 4H6JA 3FKVA 1G6OA 3UB8A 2ZC6B 3EQVA 4GZBA 3A0VA 3NOPC 2ZC3B 3OLOA 2J9OA 3R7WA 5EVIC 3S1YA 4H6JB 3T4OA 3HJKA 3TG9A 4R6LA 2Q0OA 2VLGA 1BLPA 2HDUA 3BLSA 1E3UD 5HZHA 2WGIA 3VE4A 5K5BA 5F83A 5CEBA 2Y79A 3LEQA 3EEHA 3LR3A 4R70A 3RXWA 3DTKA 3IWIA 2KOIA 3TJZC 1SKOB 3HCYA 4A5RA 5FSRA 4EQIA 2G2WA 1VHMA 4WMCA 5CEDA 4B93A 4HH2A 3E4OA 3G31A 2G7UA 1CF0A 1ES2A 4N1XA 4R4RA 1E25A 2HF6A 4E3JA 1ERMA 4YFMA 3RH8B 5KZHA 3GMWA 3F1NB 1TS8A 2WZXA 4M4XA 3NY4A 3Q7ZA 4WZ5A 3ZG5A 5I5LA 5E43A 5J8XA 2J3WA 3G4PA 1UGUA 1K56A 5GHZA 1FCOA 3O5YA 5EOOA 1PW8A 2W3EA 4ID4A 1FR6A 1A0KA 4KZ4A 1BLCA 4GDBA 4FSFA 3VFFA 3CG5A 5EV0A 1IKGA 1YLJA 5HL1A 4F3LA 3CJMA 4OQHA 2PBDP 2XGNA 1VEUA 5F68A 2VGLM 3PHYA 5CGSA 3H82B 4QHCA 4JGPA 4F3LB 5KSCA 3HLBA 2WKHA 1K0KA 5E2FA 3CITA 3UB6A 4MBHA 1IKIA 4NXEA 3C38A 5TR7A 3BFDA 2V1ZA 2OSUA 1X0OA 5E2EA 3DW0A 1FCNA 2JKFA 2B5RA 3IS2B 3L9KA 4PM7A 1CI9A 1MXOA 1ZG6A 5DKKA 4QD4A 3IBJA 2C6WB 4EETB 2JKGA 3EWKA 3VV4A 2WKRA 3SH9A 4OPQA 3CWFA 4MNRA 5FAPA 3Q1FA 3Q7VA 3UDFA 3MKEA 5CHJA 1TS0A 3TOIA 5HWVA 3VFHA 2H0YA 2AVXA 1FR1A 4LRZE 1ES5A 3WWXA 3MSHA 5EUAA 4MDZA 1TDLA 1DJAA 4DN0A 1NLYA 2OLVA 1M6KA 3VP0A 3NBLA 4ESPA 1CK3A 2INWA 5L2FA 3G34A 4HY8A 3K3DA 2EFUA 2P7JA 4OQIA 5CHMA 4JKTA 3S7PA 4IUKA 1XFQA 1GHPA 1D1JA 2ZC4B 4DDYA 2V1AA 5AQ7A 1L0GA 5EM1A 1CEFA 4DF6A 5A90A 3MS6A 3FPVA 5A92A 3D4FA 4BBTA 4RQ9A 2HP9A 4Y0TA 1ZKJA 3MJQA 3FYZA 4JLFA 3L7HA 3E4PA 3A3JA 3UPNA 1BSGA 4JXSA 2GDNA 3MXQA 2WK0A 2RL3A 5FQ9A 2VZWA 5M1AA 4D60A 5HSQA 3P01A 2P04A 4S2JA 3GECA 4MN5A 1LL5A 4BL3A 1W8YA 4WZ4A 1K57A 1P9RA 5CERA 1UWPX 4BD0A 3WS1A 3LFVA 5HFOA 3E4QA 2PD8A 3MKFA 3ZVTA 5J4EA 1ERQA 4KENB 3IF6A 3ISGA 3D72A 2EXBA 1ZTUA 2YKHA 4GN2A 2A2LA 4HBTA 3UN7A 5FI6A 4FCFA 4PM5A 1CQAA 4N92A 3F1PA 4I5SA 2JBFA 2YKFA 2P9VA 3RJUA 3OCNA 1JWZA 3T1RA 4II7A 4BBVA 2ZBBA 3T50A 1DP9A 3N6IA 3S7NA 2W3HA 3PYPA 4EBPA 4P85A 2E8IA 1WYCA 1JWPA 1S67L 3NULA 2BLSA 3A0RA 3PXPA 4DKIA 1LHYA 3JPUA 3QP2A 3DAVA 1O07A 3PAGA 2WUQA 3KO6A 4OOYA 1ES4A 1ACFA 2PYRA 3VP3A 1Y28A 2PR5A 1T19A 4ARZB 2DCFA 2ZM8A 1G5UA 4LENA 2EFXA 2XFTA 5BOHA 1YLTA 1KDWA 1TVFA 4DE0A 2V9AA 2Z6DA 3RXXA 3EOIA 3IX3A 4XUZA 2IWBA 2XH9A 5DJTA 3BYDA 3ZG7B 1Q2QA 2EX8A 3E98A 4E3LA 3HVFA 3E2LA 4HHDA 2M1CA 3EEAA 3MQ0A 4GS9A 4O7DA 5GLCA 3QP5A 3NI9A 2IA2A 3UE0A 4O8GA 4IVKA 4JF6A 5L09A 4HJ4A 1NJ4A 3U2AA 3WS4A 5HX9A 4NEED 5EVLA 3WS5A 5AVEA 4LV2A 1PWDA 4D2OA 1OTIA 4X68A 1YQSA 1K4FA 4UAAA 2W1RA 3KSIA 3LO7A 5JYOA 4ZJ2A 1NXYA 3MFXA 5HWWA 4MN7A 1NWZA 3QP1A 5FASA 3ZDJA 1K25A 3DWZA 3UPOA 1DP6A 1FILA 3G2ZA 5TBMA 1L0DA 3IX4A 2R78A 1XJ2A 2DRWA 3RFBA 3LI9A 3ICYA 1ZHHB 2PU2A 2O99A 1LLBA 4IBXA 2EX9A 2O9AA 5AQAA 4DMZA 4CLCD 3ZFZA 4QWOA 1VM1A 1MKMA 4B4ZA 1W63M 3UDXA 1F9IA 4EEUA 1M40A 3QNBA 3S7QA 4MCWA 4FH2A 1E3UA 4IHQA 1ESIA 2PD7A 1S1YA 3BJNA 3AGFA 5E2HA 3UPPA 3BFEA 1OPXA 2EX2A 2VK3A 3AGDA 1T18A 1HVBA 2HP6A 5L10A 2EWVA 5DF7A 3N8RA 5HDCA 1D7EA 5GLDA 1KE0A 4G3WA 5FDSA 3ITBA 2V0UA 3ZYTA 5F6AA 1OTEA 3N7WA 3UMEA 1IEMA 4HJ3A 3QHYA 1IYSA 3ZG8B 2X71A 4UA6A 2WAEA 2UV0E 1JNUA 1L0FA 3VP2A 3ZNYA 4ZDXA 2Y2IA 5FA7A 4K91A 5FAOA 2P74A 4K08A 3Q07A 4IBRA 1DJCA 4CLCC 5CXWA 3BFGA 1ZC2A 2V8FA 3G2YA 5CHUA 3V67A 1F98A 3UB5P 1NLZA 4HI4A 3TSGA 1NY0A 1D06A 1PYYA 5FEGA 5HD5A 1PI4A 2HDSA 1Z09A 4OLGA 5KIZA 2GX5A 4XXRA 3V3RA 2JC7A 2J3TD 3ZG9B 4YNRA 4OOMA 3HJIA 4R1GA 2BASA 4LLOB 4DXCA 3T12B 4N9KA 3NECA 3MMHA 1XXMA 5IS1A 3P7NA 1VETB 1JVJA 3VSKA 4WL9A 2QYBA 2QHKA 1BLSA 2FH5A 3G35A 3HLFA 2H0TA 1YLYA 1MKIA 2BG1A 4R3BA 5L8MA 1DY6A 3MXSA 3IWOA 1GCEA 3MR0A 4O01A 1JTDA 2ZQ8A 3R7WB 4ARZA 4R38A 3T4KA 2HV1A 1BZAA 5HPFA 3QP8A 3V39A 4PKYA 2KLIA 4LPZA 2XA7S 2J8YA 2NUPC 2ZMFA 3KYZA 5FAQA 4NXGA 2VX8A 3UO9A 4HNBA 4OPRA 3KYQA 3N8LA 1H3QA 3DBAA 3NDEA 3NJAA 2B18A 1BUEA 5FI2A 2Y2MA 4Y5FA 5TBMB 1LSXA 4RVAA 3D3OA 3T1QB 3HLEA 3O3VA 4LV1A 4S2NA 1Z6FA 2QKPA 5EE8A 5HD3A 2M7VA 5CGXA 1XKZA 3VOZA 4E3NA 1W79A 4EWFA 4GCZA 1GA0A 4JGOA 3EQUA 2H28A 4EBNA 1TS7A 4OPYA 4CLCA 3NOTC 3PBOA 3VP4A 5J7EA 4ZRRA 4P0MA 3CPTA 2WKQA 3MZDA 4LFUA 1BLHA 2XD1A 2PR6A 2OAQ1 3C4OA 5G18A 3CPTB 3SS4A 1DP8A 4EBLA 4EUVA 3ZCZA 4WBGA 4MMNA 3A3FA 4PM9A 3CMZA 1H8ZA 1TF1A 1GSWA 2JKTI 1LSVA 1N4OA 3GDIA 3IXDA 3IF6C 4KZBA 1K54A 1CJFA 1SCWA 4RYEA 1ZG4A 3ZHHA 2V2FF 4LV3A 3P09A 1GA9A 3EGXC 3SS3A 2PHYA 4B4XA 5DFXA 2X02A 2GJ3A 3LICA 1IELA 1IOUA 3N8SA 2DMWA 4LCLA 1I2WA 1KVLA 3ITAA 3LR0A 4Y0UA 3BQAA 3C7VA 3H82A 3CI6A 4WM9A 3Q7VB 4KG5A 3NCKA 2W0NA 4Y7PA 4BLMA 4ZBEA 3T1XA 3LI8A 5DFYA 1LT0A 2ZC5B 4OVDA 3OPPA 5GHYA 3LIAA 1AXBA 5EVIB 2LB9A 1PWGA 3MZFA 4OQ0A 1W5DA 4X53A 2WADA 5EVIA 2BTFP 2QWSA 3GRJA 1K56D 1YSQA 3A3DA 3MXRA 3S22A 4B88A 2O0YA 5FL3A 2J80A 2ZM2A 4Q0IA 2QPNA 2ZQCA 4QPRA 4X25A 4LGWA 3C7UA 4MN6A 3ZGAB 4UHUA 2Y2KA 5L07A 2PT7A 4WMCD 1DJBA 5U47A 1ODVA 2ZD8A 3F1OB 4S2NC 4L0LA 1KGEA 5DF8A 2G2UA 1XPBA 3HUMA 3CZDA 3OPLA 2QJ7A 2JKRM 3F1OA 1NRFA 5DTTA 4DJ2A 4NKPA 3BECA 4WYYA 3R4KA 4X55A 2Y8HA 5G4YA 1K55A 4KZ5A 5FQIA 2ZMVA 4HIAA 4OQGA 1XJ3A 4EU0A 4NETA 2OAP1 5GL9A 4GHIA 2EA9A 1OTBA 5F82A 4IVIA 4UQIM 3I7JA 3M6HA 4YWZA 4E04A 3W4PA 3BWLA 3P98A 1G6AA 4ETZA 4P87A 3HLDA 1XJ4A 2ZQ9A 4Y15A 3F1PB 3V3SA 2L0WA 1W7FA 1KVMA 3BY9A 2HDQA 4JGQA 3ZNTA 2Y2GA 4KQRA 4OP5A 3PBRA 5CTMA 4UA9A 4JXGA 5LBRA 2CC1A 3A3IA 2HGVA 4Y2FA 4X1LA 2XQZA 2ZM0A 2ZOHA 5HDDA 4X69A 3UE3A 2EXAA 3O88A 3FC7A 2WKPA 4R3AA 3NIAA 5IT5A 2V0WA 4XT2A 3VSLA 4GOGA 2IWCA 3OZHA 1OT6A 3B42A 1NRJA 1IYQA 3OC2A 4QU3A 3NHQA 4QY6A 2FZ0A 3W8KA 1PIOA 4H8RA 2FFYA 1YLPA 1I2SA 4U3TA 1YKDA 1MWSA 1S6RA 4M3KA 4WF0A 4HBUA 5GLAA 3GSGA 4C3QA 3LCEA 2H5SA 2L4RA 4IUHA 4CLCB 2XROA 1YMXA 1J9MA 4YOFA 3T4SA 4OOLA 4KZ7A 5TFQA 1S0WA 4PKYG 2LB5A 4NK3A 4QB8A 1PWCA 1VEUB 4DE2A 1NZOA 3U4LP 4E3KA 2A24A 3PAEA 3A0SA 4JPMA 2JKRI 1PI5A 2K2NA 4EW7A 5EECA 3DWKA 1H5XA 4FOFA 5FQJA 4KUKA 4CJNA 3DTEA 1MWUA 4EUZA 1YT4A 4MBFA 3VE3A 3T4LA 2ZQ7A 3IH9A 3NOUC 3IH8A 2XDMA 4ZJ3A 1N9BA 2QJ5A 3FV7A 2E8JA 4EESA 1K57C 4S2OA 1LL8A 4GW9A 1UWNX 4OONA 1LL9A 1P9WA 4OLDA 2UWXA 4P6BA 4HEFA 5EVEA 5I94A 1OT9A 4WLAA 3GTCA 4DJ3A 3W2ZA 4Q0JA 2XRNA 4Y13A 1IFQA 3PTEA 3IBRA 3OPRA 4R4SA 1YM1A 3K3CA 3KYEA 1KE4A 1K6RA 2QZ6A 4DRTA 3UY6A 4Q0HA 1XA1A 5HW3A 3SOIA 1V9ZA 1QMEA 1SZVA 4BWIA 3UNWA 3WS2A 3QP4A 1EW0A 3BY8A 3JVUA 5FDHA 2WAFA 1MPLA 4GNUA 5F1FA 2D02A 5KSHA 3BFCA 4PPRA 3LYXA 3HLCA 2XFSA 3IXGA 1FIKA 5DVAA 2Y2OA 2OWHA 3MZEA 1GSXA 3HL9A 1OMEA 4KZ8A 3T1SA 2GZAA 4Y17A 1VB6A 1HZOA 2JE5A 2EWWA 3Q81A 3UDIA 3TW8A 4BQMA
chains in the Genus database with same CATH topology
3GECA 4MN5A 1S1ZA 2WKQA 4UEYA 3OBFA 5F69A 3OOVA 2PR6A 1P9RA 4P6ZS 4GLQA 2OAQ1 1UWPX 4BBUA 1DP8A 4EUVA 3LFVA 4MMNA 4LRXC 4IJGA 3E4QA 2PD8A 1TF1A 5AJGA 5J4EA 1GSWA 2JKTI 1LSVA 3GDIA 1LSWA 3D72A 1MZUA 1ZTUA 2YKHA 1OJGA 2A2LA 3FG8A 2OWJA 4I3AA 4I39A 3BQ8A 2B02A 3B33A 3EGXC 1MC0A 3F1PA 4I5SA 4HH3A 4LRYC 3PR6A 2PHYA 4I38A 3K2NA 2CMNA 5DFXA 2GJ3A 4EQ1A 2HJ9C 2ZOIA 3LICA 3UB9A 2YKFA 3OCNA 4II7A 1IOUA 4BBVA 2DMWA 2ZBBA 5C5KA 3T50A 3UMDA 1DP9A 3LR0A 3S7NA 2W3HA 1T1CA 3PYPA 3LIBA 3PBSA 2GNXA 3BQAA 2NUTC 2O9CA 3H82A 1S67L 3CI6A 3T4TA 3A0RA 4BMWA 1BYWA 4KUOA 2W0NA 2L1MA 3KSHA 3PXPA 4XT2B 1DRMA 5HWTA 5EFWA 3LI8A 5DFYA 1LT0A 2A24B 4HQAA 3KO6A 2PYRA 1Y28A 2PR5A 1T19A 3LIAA 4WEKA 4ARZB 1W63Q 4ETXA 4Y3IA 2LB9A 3C8CA 1GSVA 3F1NA 4NXBA 3CUEC 4G3KA 2VV8A 5G4ZA 3TE8A 2V9AA 2VEAA 2Z6DA 3EOIA 5F5YA 3JVVA 4ZRRA 4EEPA 2QWSA 2W3FA 3PBQA 5DJTA 2Z6CA 1YSQA 4L9FA 4WUJA 2O0YA 5FL3A 3E98A 2J80A 4GS9B 4G3VA 4HHDA 4Q0IA 2M1CA 4P6ZM 3EEAA 2OOLA 4QPRA 3EGDC 3MQ0A 4GS9A 4MN6A 2JN7A 2XSSA 2V1BA 2IA2A 4EXOA 5MC7A 2VA0A 3LIEA 4EERA 4Z1WA 4GJ4A 2W3GA 3T4QA 2JHEA 1TS6A 4O8GA 4WN5A 3G6OA 1WA9A 2PT7A 4HJ4A 3KSFA 1OTAA 2I9VA 3U2AA 3ZQ5A 2JKTM 1ODVA 3KSGA 1TD5A 4NEED 3F1OB 4L0LA 5AVEA 2W1TA 4CLCE 2KDKA 3PBTA 1T1BA 2HJEA 5HL6A 2QJ7A 4ME4A 2JKRM 3F1OA 1OTIA 4DJ2A 2W1RA 3LIFA 3KSIA 4NKPA 4B9OA 3R4KA 2Y8HA 4HJ6A 5G4YA 3IS2A 3MFXA 4HOIA 5HWWA 3LUQA 1NWZA 4MN7A 2ZMVA 4HIAA 4NXFA 1XJ3A 2K31A 1DP6A 4BJPA 5A8BA 4EU0A 2KX6A 5TBMA 2R78A 1XJ2A 3SW1A 1S4SA 3RFBA 1XJ6A 2OAP1 2M7UA 3LI9A 4PAUA 4GHIA 3UE6A 3ICYA 3LR4A 1ZHHB 3S7OA 2EA9A 1OTBA 4L9EA 2O99A 3E0YA 4UQIM 2W27A 2K7SA 4YWZA 3H9WA 4E04A 2O9AA 4DMZA 1STZA 5HPIA 1KOUA 4H6JA 4CLCD 1G6OA 1MKMA 3UB8A 3EQVA 1W63M 1F9IA 3A0VA 4EEUA 3NOPC 3OLOA 3BWLA 3CUEA 3R7WA 4H6JB 3S7QA 3T4OA 4MCWA 4ETZA 3HJKA 1XJ4A 1S4RA 4IHQA 2PD7A 3LIDA 1S1YA 2VV6A 3BJNA 3F1PB 4R6LA 2L0WA 3KX0X 2VLGA 3BY9A 3VOLA 1OPXA 4JGQA 5HZHA 3VE4A 5K5BA 3PBRA 5DJUA 3B47A 1T18A 5LBRA 4CQHA 2Y79A 2EWVA 2HGVA 2VJWA 4Y2FA 4WEJA 2ZOHA 5IU1A 5HDDA 5HDCA 1D7EA 4PHTA 3EEHA 3LR3A 4G3WA 4R70A 2KOIA 3TJZC 3UE3A 2V0UA 3ZYTA 5F6AA 3FC7A 3HCYA 2WKPA 2VKSA 4R3AA 5IT5A 2VGLS 1VHMA 1OTEA 2V0WA 4XT2A 4B93A 4HH2A 3E4OA 3UMEA 2G7UA 2P08A 2MJ6A 4HJ3A 2HF6A 1OT6A 3B42A 3OC2A 1NRJA 1OJ5A 3RH8B 1JNUA 1V9YA 3NHQA 2FZ0A 3F1NB 4HP4A 1TS8A 4I3JA 3BW6A 4M4XA 1YKDA 2PYPA 5I5LA 2O9BA 4K08A 4WF0A 2J3WA 4CLCC 1UGUA 3O5YA 5CX7A 2W3EA 1OTDA 1YAXA 3V67A 1F98A 2L4RA 1NLZA 4IUHA 4CLCB 4HI4A 2XROA 4FSFA 4AFIA 1D06A 4YOFA 5AVFA 3T4SA 3RTYA 3ULFA 4OOLA 5HD5A 4F3LA 5TJJA 5F68A 4PKYG 2VGLM 3PHYA 3TRCA 2LB5A 3H82B 1XFNA 4JGPA 1F5MA 4F3LB 4HP9A 5HDSA 5KIZA 3C30A 2GX5A 3CITA 5J3WA 1G28A 3UB6A 2A24A 3FPWA 3A0SA 2J3TD 3C38A 4NXEA 2JKRI 2K2NA 4YNRA 4EW7A 4OOMA 1X0OA 1N9LA 3HJIA 2BASA 4LLOB 3MQOA 4FOFA 3OCLA 4KUKA 3IS2B 2J3TC 3MMHA 5DKKA 5IS1A 3P7NA 3LR5A 3H7WB 5DF9A 3IBJA 4WL9A 4EETB 2QYBA 4JGRA 1H8MA 3EWKA 2QHKA 3VV4A 3VE3A 2WKRA 3T4LA 3H7WA 4UQIS 3MF0A 1S66L 3NOUC 3CWFA 2FH5A 4GHIB 2QJ5A 5L8MA 4EESA 1LL8A 3MR0A 4GW9A 1TS0A 1UWNX 5HWVA 1T1AA 3CAXA 1P9WA 4O01A 3R7WB 4LRZE 5DKLA 1YSPA 1P97A 3CLOA 4ARZA 4R38A 1OT9A 1N9NA 4WLAA 2HV1A 3T4KA 4O0PA 4DJ3A 5HPFA 3UB7A 3W2ZA 4Q0JA 1N9OA 2XRNA 4PKYA 4MDZA 1IFQA 2KLIA 3C2WA 4LPZA 2W1TB 2XA7S 4DN0A 3IBRA 2NUPC 1NLYA 2ZMFA 1P0ZA 3KYZA 3PBNA 3K3CA 4NXGA 2VX8A 4KQDA 2PDRA 4WELA 2INWA 4HNBA 4Q0HA 3KYQA 1H3QA 4HY8A 3K3DA 1V9ZA 3DBAA 4BWIA 3T4JA 3MQQA 3NJAA 2B18A 1EW0A 2P7JA 3BY8A 3S7PA 4Y5FA 4L9GA 3JVUA 4IUKA 5TBMB 4KQOA 1XFQA 2D02A 1LSXA 5KSHA 2W3DA 2V1AA 3D3OA 3LYXA 2QKPA 2XA7M 3FPVA 5HD3A 2M7VA 4BBTA 4RQ9A 3MJQA 2OWHA 1GSXA 4I3IA 2GZAA 3E4PA 1VB6A 3MXQA 4GCZA 2EWWA 4JGOA 2VZWA 2H28A 3EQUA 1TS7A 5HSQA 4CLCA 3P01A 3PBOA 3NOTC 3TW8A 2VV7A 2P04A 5J7EA 2D01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EEH A;  3H7W A;  4R70 A;  3GEC A;  4HHD A;  1S1Z A;  4MN5 A;  2WKQ A;  1S66 L;  2M1C A;  3NOU C;  3CWF A;  2OOL A;  2V0U A;  5F6A A;  4GS9 A;  3FC7 A;  5F69 A;  2WKP A;  4GHI B;  2PR6 A;  2QJ5 A;  4MN6 A;  4R3A A;  2JN7 A;  1UWP X;  4BBU A;  2V1B A;  1OTE A;  2V0W A;  1DP8 A;  4XT2 A;  4EES A;  4HH2 A;  4EXO A;  3E4O A;  3UME A;  3LIE A;  4EER A;  4LRX C;  3E4Q A;  1LL8 A;  2PD8 A;  3MR0 A;  4GW9 A;  2JHE A;  4HJ3 A;  1TS0 A;  1TS6 A;  1UWN X;  3G6O A;  4WN5 A;  5HWV A;  1WA9 A;  1T1A A;  1OT6 A;  3CAX A;  5J4E A;  1GSW A;  1LSV A;  1OJ5 A;  4HJ4 A;  3RH8 B;  1OTA A;  1JNU A;  1V9Y A;  2I9V A;  3GDI A;  1LSW A;  3D72 A;  3NHQ A;  3ZQ5 A;  5HDC A;  1MZU A;  4LRZ E;  5DKL A;  1ODV A;  5G4Z A;  2YKH A;  1P97 A;  1OJG A;  3F1O B;  3CLO A;  3F1N B;  4HP4 A;  4R38 A;  5AVE A;  1OT9 A;  1N9N A;  1TS8 A;  2HV1 A;  2KDK A;  3FG8 A;  4I3J A;  1T1B A;  4M4X A;  4WLA A;  4DJ3 A;  3UB7 A;  2PYP A;  1N9O A;  2OWJ A;  4I3A A;  4I39 A;  2QJ7 A;  4PKY A;  3F1O A;  2B02 A;  5I5L A;  1OTI A;  3C2W A;  3B33 A;  4K08 A;  4LPZ A;  4DJ2 A;  3F1P A;  4I5S A;  4HH3 A;  3IBR A;  3LIF A;  4I38 A;  2PHY A;  4LRY C;  4WF0 A;  4B9O A;  2CMN A;  1P0Z A;  4HJ6 A;  1UGU A;  3IS2 A;  5G4Y A;  2GJ3 A;  4EQ1 A;  3K3C A;  2ZOI A;  3LIC A;  3MFX A;  3UB9 A;  4NXG A;  4HOI A;  2YKF A;  5HWW A;  3LUQ A;  1NWZ A;  4KQD A;  1OTD A;  2PDR A;  4HIA A;  2INW A;  4HNB A;  4NXF A;  1XJ3 A;  1F98 A;  2ZBB A;  1DP6 A;  2L4R A;  4BBV A;  4HY8 A;  3K3D A;  4HI4 A;  3T50 A;  3UMD A;  5A8B A;  1DP9 A;  1V9Z A;  2KX6 A;  1D06 A;  5AVF A;  1T1C A;  3PYP A;  5TBM A;  2R78 A;  3RTY A;  3LIB A;  3MQQ A;  4EEU A;  1XJ2 A;  3NJA A;  3ULF A;  3SW1 A;  1EW0 A;  1S4S A;  1S67 L;  2P7J A;  3BY8 A;  3H82 A;  5HD5 A;  1XJ6 A;  3A0R A;  4F3L A;  3LI9 A;  3UE6 A;  4GHI A;  4L9G A;  3ICY A;  1BYW A;  4KUO A;  2W0N A;  2L1M A;  5F68 A;  5TBM B;  4PKY G;  1XFQ A;  2EA9 A;  1OTB A;  3PHY A;  4L9E A;  4XT2 B;  2W27 A;  2D02 A;  2K7S A;  1LSX A;  3H82 B;  1DRM A;  1XFN A;  4JGP A;  2V1A A;  3H9W A;  5EFW A;  4YWZ A;  4HP9 A;  3LI8 A;  5HWT A;  4E04 A;  5HDS A;  1LT0 A;  2A24 B;  4F3L B;  4HQA A;  1KOU A;  4H6J A;  5KIZ A;  3LYX A;  2PYR A;  2QKP A;  5J3W A;  3UB8 A;  1Y28 A;  1G28 A;  1T19 A;  1F9I A;  2PR5 A;  3A0V A;  3LIA A;  3NOP C;  2A24 A;  3BWL A;  3OLO A;  5HD3 A;  3UB6 A;  3A0S A;  4NXE A;  4BBT A;  4RQ9 A;  4H6J B;  3MJQ A;  3C8C A;  1GSV A;  3F1N A;  2OWH A;  4EW7 A;  3HJK A;  1GSX A;  1X0O A;  1N9L A;  1S4R A;  1XJ4 A;  3HJI A;  4NXB A;  2BAS A;  2PD7 A;  3LID A;  1S1Y A;  2VV6 A;  3F1P B;  3MQO A;  4I3I A;  2VV8 A;  2L0W A;  4LLO B;  4R6L A;  2V9A A;  2VEA A;  2VLG A;  2Z6D A;  3E4P A;  3BY9 A;  3KX0 X;  1VB6 A;  3IS2 B;  4KUK A;  5F5Y A;  5HDD A;  3VOL A;  2QWS A;  4EEP A;  4JGQ A;  3MXQ A;  4GCZ A;  5DJT A;  3VE4 A;  5HZH A;  5DKK A;  5IS1 A;  3P7N A;  2Z6C A;  5DJU A;  3H7W B;  4JGO A;  1T18 A;  2H28 A;  4L9F A;  1TS7 A;  5HSQ A;  4WUJ A;  4WL9 A;  4EET B;  3NOT C;  4JGR A;  3EWK A;  2J80 A;  2QHK A;  4GS9 B;  2VV7 A;  2ZOH A;  5IU1 A;  3VE3 A;  2WKR A;  5J7E A;  1D7E A;  2D01 A; 
#chains in the Genus database with same CATH topology
 1S1Z A;  1SDE A;  2Q9N A;  3OBF A;  5F69 A;  3IHB A;  3OOV A;  3G32 A;  4P6Z S;  2IWD A;  4GLQ A;  1NYY A;  5HAR A;  4BBU A;  4BL2 A;  3IF6 B;  4IJG A;  5FEF A;  1HLU P;  3O86 A;  1PFL A;  5KMW A;  4MEZ A;  2Y55 A;  1Q2P A;  1MZU A;  1HTZ A;  2PBY A;  4X56 A;  2HZ5 A;  3VOY A;  3S4X A;  3FG8 A;  1RCJ A;  2Y4A A;  1FSW A;  1L0E A;  4KZ6 A;  1PW1 A;  4I3A A;  4I39 A;  2P9V B;  4HH3 A;  5JYP A;  3PR6 A;  2CMN A;  4N1H A;  1U60 A;  4F94 A;  4FD8 A;  4EQ1 A;  3E2K A;  1TEM A;  3HBR A;  5FAT A;  3SS5 A;  4MLL A;  1T1C A;  2Y2J A;  3GV9 A;  2GNX A;  1KDS A;  4JXV A;  3JYI A;  3T4T A;  1BYW A;  4KUO A;  2L1M A;  4XT2 B;  1DRM A;  5HWT A;  2H10 A;  4KG2 A;  4HQA A;  1Y54 A;  4WEK A;  4E3M A;  3IQA A;  2XK1 A;  3C8C A;  1GSV A;  3F1N A;  2ZL1 B;  4NXB A;  3IHA A;  4G3K A;  5G4Z A;  2VEA A;  5F5Y A;  3JVV A;  4EEP A;  2W3F A;  4K0X A;  3PBQ A;  5CTN A;  2Z6C A;  4L9F A;  4WUJ A;  2HDR A;  2Y2N A;  4X1M A;  4GS9 B;  1H8Y A;  4KQQ A;  2PU4 A;  2Y59 A;  3WRT A;  5DTK A;  5HAQ A;  1W8Q A;  3IXH A;  2OOL A;  3EGD C;  4IED A;  1FQG A;  3HUN A;  4OPZ A;  2XSS A;  3LY4 A;  2XR0 A;  5MC7 A;  2VA0 A;  4EER A;  4Z1W A;  4GJ4 A;  3T4Q A;  4BEN A;  2Z2L B;  5A91 A;  1E4D A;  3WS0 A;  1GHM A;  4EV4 A;  3G6O A;  2I72 A;  4E6X A;  2PRF A;  3KSF A;  3VMA A;  1OTA A;  2I9V A;  4Q8I A;  1ALQ A;  4DE1 A;  2JKT M;  3D9Y A;  2Y2Q A;  1TD5 A;  4RX3 A;  4OKP A;  2W1T A;  4CLC E;  2KDK A;  3B3X A;  1T1B A;  2HJE A;  2R9W A;  2ZC7 A;  1F2K A;  3LIF A;  4B9O A;  4HJ6 A;  3IS2 A;  1K55 C;  4HOI A;  3C4P A;  3LUQ A;  2XLN A;  1Y4O A;  4BJP A;  5A8B A;  4KG6 A;  3SW1 A;  5EVI D;  1XJ6 A;  2M7U A;  3UE6 A;  2XF3 A;  1HD8 A;  3LR4 A;  2Y2H A;  1EI5 A;  4L9E A;  1MBL A;  3H9W A;  1STZ A;  4S2K A;  5HPI A;  1RGZ A;  4LV0 A;  3OPH A;  3N4I A;  1WYB A;  3HLG A;  3CUE A;  4K0W A;  1YPR A;  2OV5 A;  2VGJ A;  1S4R A;  4R23 A;  4X6T A;  1FCM A;  3LID A;  3NDG A;  5CRF A;  2VV6 A;  3HUO A;  3C5A A;  2ZQD A;  3KX0 X;  5FQQ A;  2OLU A;  3VOL A;  2PAV P;  4ZAM A;  5DJU A;  3B47 A;  4CQH A;  2VJW A;  4WEJ A;  5IU1 A;  4PM8 A;  4PHT A;  3GVB A;  2Q9M A;  3DTM A;  5M19 A;  4QY5 A;  4S2I A;  4JBF A;  4OP8 A;  2VKS A;  4PMA A;  3HRE A;  1KGF A;  3V5M A;  2VGL S;  5AQ9 A;  2RCX A;  2P08 A;  2MJ6 A;  1MY8 A;  4UA7 A;  1YLZ A;  4C6Y A;  1OJ5 A;  1KE3 A;  4FUW A;  1V9Y A;  2ZQA A;  4Z9Q A;  3MFD A;  5E2G A;  5HAI A;  4HP4 A;  4FTX A;  4I3J A;  4WZ5 C;  3BW6 A;  1CI8 A;  2PYP A;  4RX2 A;  1YLW A;  1TDG A;  2O9B A;  1WE4 A;  4E3I A;  2WGV A;  1JWV A;  5CX7 A;  1G68 A;  3AGE A;  4S2P A;  1OTD A;  1YAX A;  4KZA A;  2Y2L A;  5M18 A;  2ZLY A;  4AFI A;  5AVF A;  3RTY A;  3ULF A;  3W4O A;  3M2K A;  4PM6 A;  5TJJ A;  1GHI A;  3TRC A;  2JCH A;  4JF4 A;  1XFN A;  4ZJ1 A;  1F5M A;  4HP9 A;  5HDS A;  1QMF A;  4E3O A;  3ZG0 A;  3C30 A;  1J3W A;  1K54 C;  5J3W A;  1G28 A;  2HP5 A;  4QJG A;  3FPW A;  4S2L A;  3VP1 A;  4DDS A;  4CPK A;  1JTG A;  1YMS A;  3GQZ A;  3SZT A;  1N9L A;  4FH4 A;  4HES A;  3MQO A;  1SHV A;  3OCL A;  2J3T C;  2ZL1 A;  1BUL A;  3LR5 A;  2FFF B;  3H7W B;  5DF9 A;  5TGF A;  2V20 A;  4BD1 A;  4JGR A;  1H8M A;  3V50 A;  1ESU A;  2XD5 A;  3H7W A;  4UQI S;  1VET A;  3MF0 A;  1S66 L;  5FQM A;  5IHV A;  5FQK A;  3NC8 A;  3W4Q A;  4GHI B;  4GD8 A;  1RP5 A;  2J9P A;  1C3B A;  2R9X A;  3ZVW A;  1BTL A;  1PNE A;  4GKU A;  1T1A A;  3CAX A;  3SH7 A;  3IF5 A;  3LGO A;  2Z2M B;  1PRQ A;  5DKL A;  1K4E A;  1YSP A;  1P97 A;  3CLO A;  1XGI A;  4N9L A;  1N9N A;  4O0P A;  1KGG A;  3UB7 A;  1N9O A;  2Y91 A;  4OH0 A;  3C2W A;  2W1T B;  1MWR A;  2WKI A;  5HAP A;  3WRZ A;  1P0Z A;  3PBN A;  4KQD A;  3BLM A;  2PDR A;  4WEL A;  1IYO A;  4YIN A;  4U0T A;  3G30 A;  2HPB A;  3T4J A;  3GR2 A;  3MQQ A;  1VQQ A;  4L9G A;  4RA7 A;  4KQO A;  3IT9 A;  4DXB A;  2W3D A;  5CGW A;  1AWI A;  2J7V A;  3BRM A;  2A49 A;  2XA7 M;  1ES3 A;  4I3I A;  1ONH A;  3MBZ A;  1ERO A;  1FSY A;  1K6S A;  3CHW P;  1L2S A;  1I5Q A;  1NYM A;  1NZU A;  3QNC A;  1SKO A;  3O87 A;  2VV7 A;  2D01 A;  4GD6 A;  4UEY A;  2DNS A;  1FOF A;  1H0M A;  2WZZ A;  2EX6 A;  3QP6 A;  1CEG A;  5FI7 A;  4LRX C;  5AJG A;  3HLW A;  3LEZ A;  1PZO A;  4KZ9 A;  1LSW A;  4DE3 A;  2B95 A;  1OJG A;  4Y0O A;  2QMI A;  4R3J A;  4U0X A;  1BT5 A;  1XA7 A;  1PZP A;  2OWJ A;  3BQ8 A;  4MBK A;  5GHX A;  5CEC A;  2B02 A;  3B33 A;  1MC0 A;  4LRY C;  4I38 A;  3K2N A;  2HJ9 C;  2ZOI A;  3M2J A;  3UB9 A;  5C5K A;  3UMD A;  3IXB A;  3LIB A;  3M6B A;  3PBS A;  2NUT C;  2O9C A;  4ZTK A;  4BMW A;  4E6W A;  3KSH A;  2Y2P A;  1LI9 A;  4GB7 A;  2WYX A;  5EFW A;  2A24 B;  1XGJ A;  2ZMA A;  4R0Q A;  3A3E A;  2VGK A;  3FWL A;  4ETX A;  1W63 Q;  4Y3I A;  1EWZ A;  1XX2 A;  3CUE C;  2VV8 A;  3TE8 A;  4XUX A;  3BEB A;  2ZJ9 A;  3Q82 A;  3DTI A;  5F1G A;  5D3O A;  2X01 A;  2C5W B;  4JXW A;  3IX8 A;  4G3V A;  3SH8 A;  4KZ3 A;  5EOE A;  4P6Z M;  2XEP A;  5A93 A;  2ACG A;  1RGY A;  3FZC A;  2JN7 A;  2V1B A;  3IWQ A;  4EXO A;  3BFF A;  3LIE A;  2W3G A;  5EPH A;  1IYP A;  2JHE A;  1TS6 A;  5EM0 A;  1MWT A;  4WN5 A;  1WA9 A;  2WGW B;  2A3U A;  4NG2 A;  3ZQ5 A;  3KSG A;  1XP4 A;  2WGW A;  3FKW A;  3PBT A;  1LI0 A;  1SDN A;  3BM6 A;  5HL6 A;  1SKF A;  4ME4 A;  5GLB A;  1L3L A;  2WKE A;  5AQB A;  5DTS A;  4GDN A;  4JF5 A;  4NXF A;  2K31 A;  4S2M A;  1O7E A;  3LY3 A;  2KX6 A;  3UE1 A;  1ONG A;  1S4S A;  4C75 A;  2V8C A;  4PAU A;  3S7O A;  3E0Y A;  2W27 A;  2K7S A;  1K38 A;  4LCM A;  1KOU A;  4H6J A;  3FKV A;  1G6O A;  3UB8 A;  2ZC6 B;  3EQV A;  4GZB A;  3A0V A;  3NOP C;  2ZC3 B;  3OLO A;  2J9O A;  3R7W A;  5EVI C;  3S1Y A;  4H6J B;  3T4O A;  3HJK A;  3TG9 A;  4R6L A;  2Q0O A;  2VLG A;  1BLP A;  2HDU A;  3BLS A;  1E3U D;  5HZH A;  2WGI A;  3VE4 A;  5K5B A;  5F83 A;  5CEB A;  2Y79 A;  3LEQ A;  3EEH A;  3LR3 A;  4R70 A;  3RXW A;  3DTK A;  3IWI A;  2KOI A;  3TJZ C;  1SKO B;  3HCY A;  4A5R A;  5FSR A;  4EQI A;  2G2W A;  1VHM A;  4WMC A;  5CED A;  4B93 A;  4HH2 A;  3E4O A;  3G31 A;  2G7U A;  1CF0 A;  1ES2 A;  4N1X A;  4R4R A;  1E25 A;  2HF6 A;  4E3J A;  1ERM A;  4YFM A;  3RH8 B;  5KZH A;  3GMW A;  3F1N B;  1TS8 A;  2WZX A;  4M4X A;  3NY4 A;  3Q7Z A;  4WZ5 A;  3ZG5 A;  5I5L A;  5E43 A;  5J8X A;  2J3W A;  3G4P A;  1UGU A;  1K56 A;  5GHZ A;  1FCO A;  3O5Y A;  5EOO A;  1PW8 A;  2W3E A;  4ID4 A;  1FR6 A;  1A0K A;  4KZ4 A;  1BLC A;  4GDB A;  4FSF A;  3VFF A;  3CG5 A;  5EV0 A;  1IKG A;  1YLJ A;  5HL1 A;  4F3L A;  3CJM A;  4OQH A;  2PBD P;  2XGN A;  1VEU A;  5F68 A;  2VGL M;  3PHY A;  5CGS A;  3H82 B;  4QHC A;  4JGP A;  4F3L B;  5KSC A;  3HLB A;  2WKH A;  1K0K A;  5E2F A;  3CIT A;  3UB6 A;  4MBH A;  1IKI A;  4NXE A;  3C38 A;  5TR7 A;  3BFD A;  2V1Z A;  2OSU A;  1X0O A;  5E2E A;  3DW0 A;  1FCN A;  2JKF A;  2B5R A;  3IS2 B;  3L9K A;  4PM7 A;  1CI9 A;  1MXO A;  1ZG6 A;  5DKK A;  4QD4 A;  3IBJ A;  2C6W B;  4EET B;  2JKG A;  3EWK A;  3VV4 A;  2WKR A;  3SH9 A;  4OPQ A;  3CWF A;  4MNR A;  5FAP A;  3Q1F A;  3Q7V A;  3UDF A;  3MKE A;  5CHJ A;  1TS0 A;  3TOI A;  5HWV A;  3VFH A;  2H0Y A;  2AVX A;  1FR1 A;  4LRZ E;  1ES5 A;  3WWX A;  3MSH A;  5EUA A;  4MDZ A;  1TDL A;  1DJA A;  4DN0 A;  1NLY A;  2OLV A;  1M6K A;  3VP0 A;  3NBL A;  4ESP A;  1CK3 A;  2INW A;  5L2F A;  3G34 A;  4HY8 A;  3K3D A;  2EFU A;  2P7J A;  4OQI A;  5CHM A;  4JKT A;  3S7P A;  4IUK A;  1XFQ A;  1GHP A;  1D1J A;  2ZC4 B;  4DDY A;  2V1A A;  5AQ7 A;  1L0G A;  5EM1 A;  1CEF A;  4DF6 A;  5A90 A;  3MS6 A;  3FPV A;  5A92 A;  3D4F A;  4BBT A;  4RQ9 A;  2HP9 A;  4Y0T A;  1ZKJ A;  3MJQ A;  3FYZ A;  4JLF A;  3L7H A;  3E4P A;  3A3J A;  3UPN A;  1BSG A;  4JXS A;  2GDN A;  3MXQ A;  2WK0 A;  2RL3 A;  5FQ9 A;  2VZW A;  5M1A A;  4D60 A;  5HSQ A;  3P01 A;  2P04 A;  4S2J A;  3GEC A;  4MN5 A;  1LL5 A;  4BL3 A;  1W8Y A;  4WZ4 A;  1K57 A;  1P9R A;  5CER A;  1UWP X;  4BD0 A;  3WS1 A;  3LFV A;  5HFO A;  3E4Q A;  2PD8 A;  3MKF A;  3ZVT A;  5J4E A;  1ERQ A;  4KEN B;  3IF6 A;  3ISG A;  3D72 A;  2EXB A;  1ZTU A;  2YKH A;  4GN2 A;  2A2L A;  4HBT A;  3UN7 A;  5FI6 A;  4FCF A;  4PM5 A;  1CQA A;  4N92 A;  3F1P A;  4I5S A;  2JBF A;  2YKF A;  2P9V A;  3RJU A;  3OCN A;  1JWZ A;  3T1R A;  4II7 A;  4BBV A;  2ZBB A;  3T50 A;  1DP9 A;  3N6I A;  3S7N A;  2W3H A;  3PYP A;  4EBP A;  4P85 A;  2E8I A;  1WYC A;  1JWP A;  1S67 L;  3NUL A;  2BLS A;  3A0R A;  3PXP A;  4DKI A;  1LHY A;  3JPU A;  3QP2 A;  3DAV A;  1O07 A;  3PAG A;  2WUQ A;  3KO6 A;  4OOY A;  1ES4 A;  1ACF A;  2PYR A;  3VP3 A;  1Y28 A;  2PR5 A;  1T19 A;  4ARZ B;  2DCF A;  2ZM8 A;  1G5U A;  4LEN A;  2EFX A;  2XFT A;  5BOH A;  1YLT A;  1KDW A;  1TVF A;  4DE0 A;  2V9A A;  2Z6D A;  3RXX A;  3EOI A;  3IX3 A;  4XUZ A;  2IWB A;  2XH9 A;  5DJT A;  3BYD A;  3ZG7 B;  1Q2Q A;  2EX8 A;  3E98 A;  4E3L A;  3HVF A;  3E2L A;  4HHD A;  2M1C A;  3EEA A;  3MQ0 A;  4GS9 A;  4O7D A;  5GLC A;  3QP5 A;  3NI9 A;  2IA2 A;  3UE0 A;  4O8G A;  4IVK A;  4JF6 A;  5L09 A;  4HJ4 A;  1NJ4 A;  3U2A A;  3WS4 A;  5HX9 A;  4NEE D;  5EVL A;  3WS5 A;  5AVE A;  4LV2 A;  1PWD A;  4D2O A;  1OTI A;  4X68 A;  1YQS A;  1K4F A;  4UAA A;  2W1R A;  3KSI A;  3LO7 A;  5JYO A;  4ZJ2 A;  1NXY A;  3MFX A;  5HWW A;  4MN7 A;  1NWZ A;  3QP1 A;  5FAS A;  3ZDJ A;  1K25 A;  3DWZ A;  3UPO A;  1DP6 A;  1FIL A;  3G2Z A;  5TBM A;  1L0D A;  3IX4 A;  2R78 A;  1XJ2 A;  2DRW A;  3RFB A;  3LI9 A;  3ICY A;  1ZHH B;  2PU2 A;  2O99 A;  1LLB A;  4IBX A;  2EX9 A;  2O9A A;  5AQA A;  4DMZ A;  4CLC D;  3ZFZ A;  4QWO A;  1VM1 A;  1MKM A;  4B4Z A;  1W63 M;  3UDX A;  1F9I A;  4EEU A;  1M40 A;  3QNB A;  3S7Q A;  4MCW A;  4FH2 A;  1E3U A;  4IHQ A;  1ESI A;  2PD7 A;  1S1Y A;  3BJN A;  3AGF A;  5E2H A;  3UPP A;  3BFE A;  1OPX A;  2EX2 A;  2VK3 A;  3AGD A;  1T18 A;  1HVB A;  2HP6 A;  5L10 A;  2EWV A;  5DF7 A;  3N8R A;  5HDC A;  1D7E A;  5GLD A;  1KE0 A;  4G3W A;  5FDS A;  3ITB A;  2V0U A;  3ZYT A;  5F6A A;  1OTE A;  3N7W A;  3UME A;  1IEM A;  4HJ3 A;  3QHY A;  1IYS A;  3ZG8 B;  2X71 A;  4UA6 A;  2WAE A;  2UV0 E;  1JNU A;  1L0F A;  3VP2 A;  3ZNY A;  4ZDX A;  2Y2I A;  5FA7 A;  4K91 A;  5FAO A;  2P74 A;  4K08 A;  3Q07 A;  4IBR A;  1DJC A;  4CLC C;  5CXW A;  3BFG A;  1ZC2 A;  2V8F A;  3G2Y A;  5CHU A;  3V67 A;  1F98 A;  3UB5 P;  1NLZ A;  4HI4 A;  3TSG A;  1NY0 A;  1D06 A;  1PYY A;  5FEG A;  5HD5 A;  1PI4 A;  2HDS A;  1Z09 A;  4OLG A;  5KIZ A;  2GX5 A;  4XXR A;  3V3R A;  2JC7 A;  2J3T D;  3ZG9 B;  4YNR A;  4OOM A;  3HJI A;  4R1G A;  2BAS A;  4LLO B;  4DXC A;  3T12 B;  4N9K A;  3NEC A;  3MMH A;  1XXM A;  5IS1 A;  3P7N A;  1VET B;  1JVJ A;  3VSK A;  4WL9 A;  2QYB A;  2QHK A;  1BLS A;  2FH5 A;  3G35 A;  3HLF A;  2H0T A;  1YLY A;  1MKI A;  2BG1 A;  4R3B A;  5L8M A;  1DY6 A;  3MXS A;  3IWO A;  1GCE A;  3MR0 A;  4O01 A;  1JTD A;  2ZQ8 A;  3R7W B;  4ARZ A;  4R38 A;  3T4K A;  2HV1 A;  1BZA A;  5HPF A;  3QP8 A;  3V39 A;  4PKY A;  2KLI A;  4LPZ A;  2XA7 S;  2J8Y A;  2NUP C;  2ZMF A;  3KYZ A;  5FAQ A;  4NXG A;  2VX8 A;  3UO9 A;  4HNB A;  4OPR A;  3KYQ A;  3N8L A;  1H3Q A;  3DBA A;  3NDE A;  3NJA A;  2B18 A;  1BUE A;  5FI2 A;  2Y2M A;  4Y5F A;  5TBM B;  1LSX A;  4RVA A;  3D3O A;  3T1Q B;  3HLE A;  3O3V A;  4LV1 A;  4S2N A;  1Z6F A;  2QKP A;  5EE8 A;  5HD3 A;  2M7V A;  5CGX A;  1XKZ A;  3VOZ A;  4E3N A;  1W79 A;  4EWF A;  4GCZ A;  1GA0 A;  4JGO A;  3EQU A;  2H28 A;  4EBN A;  1TS7 A;  4OPY A;  4CLC A;  3NOT C;  3PBO A;  3VP4 A;  5J7E A;  4ZRR A;  4P0M A;  3CPT A;  2WKQ A;  3MZD A;  4LFU A;  1BLH A;  2XD1 A;  2PR6 A;  2OAQ 1;  3C4O A;  5G18 A;  3CPT B;  3SS4 A;  1DP8 A;  4EBL A;  4EUV A;  3ZCZ A;  4WBG A;  4MMN A;  3A3F A;  4PM9 A;  3CMZ A;  1H8Z A;  1TF1 A;  1GSW A;  2JKT I;  1LSV A;  1N4O A;  3GDI A;  3IXD A;  3IF6 C;  4KZB A;  1K54 A;  1CJF A;  1SCW A;  4RYE A;  1ZG4 A;  3ZHH A;  2V2F F;  4LV3 A;  3P09 A;  1GA9 A;  3EGX C;  3SS3 A;  2PHY A;  4B4X A;  5DFX A;  2X02 A;  2GJ3 A;  3LIC A;  1IEL A;  1IOU A;  3N8S A;  2DMW A;  4LCL A;  1I2W A;  1KVL A;  3ITA A;  3LR0 A;  4Y0U A;  3BQA A;  3C7V A;  3H82 A;  3CI6 A;  4WM9 A;  3Q7V B;  4KG5 A;  3NCK A;  2W0N A;  4Y7P A;  4BLM A;  4ZBE A;  3T1X A;  3LI8 A;  5DFY A;  1LT0 A;  2ZC5 B;  4OVD A;  3OPP A;  5GHY A;  3LIA A;  1AXB A;  5EVI B;  2LB9 A;  1PWG A;  3MZF A;  4OQ0 A;  1W5D A;  4X53 A;  2WAD A;  5EVI A;  2BTF P;  2QWS A;  3GRJ A;  1K56 D;  1YSQ A;  3A3D A;  3MXR A;  3S22 A;  4B88 A;  2O0Y A;  5FL3 A;  2J80 A;  2ZM2 A;  4Q0I A;  2QPN A;  2ZQC A;  4QPR A;  4X25 A;  4LGW A;  3C7U A;  4MN6 A;  3ZGA B;  4UHU A;  2Y2K A;  5L07 A;  2PT7 A;  4WMC D;  1DJB A;  5U47 A;  1ODV A;  2ZD8 A;  3F1O B;  4S2N C;  4L0L A;  1KGE A;  5DF8 A;  2G2U A;  1XPB A;  3HUM A;  3CZD A;  3OPL A;  2QJ7 A;  2JKR M;  3F1O A;  1NRF A;  5DTT A;  4DJ2 A;  4NKP A;  3BEC A;  4WYY A;  3R4K A;  4X55 A;  2Y8H A;  5G4Y A;  1K55 A;  4KZ5 A;  5FQI A;  2ZMV A;  4HIA A;  4OQG A;  1XJ3 A;  4EU0 A;  4NET A;  2OAP 1;  5GL9 A;  4GHI A;  2EA9 A;  1OTB A;  5F82 A;  4IVI A;  4UQI M;  3I7J A;  3M6H A;  4YWZ A;  4E04 A;  3W4P A;  3BWL A;  3P98 A;  1G6A A;  4ETZ A;  4P87 A;  3HLD A;  1XJ4 A;  2ZQ9 A;  4Y15 A;  3F1P B;  3V3S A;  2L0W A;  1W7F A;  1KVM A;  3BY9 A;  2HDQ A;  4JGQ A;  3ZNT A;  2Y2G A;  4KQR A;  4OP5 A;  3PBR A;  5CTM A;  4UA9 A;  4JXG A;  5LBR A;  2CC1 A;  3A3I A;  2HGV A;  4Y2F A;  4X1L A;  2XQZ A;  2ZM0 A;  2ZOH A;  5HDD A;  4X69 A;  3UE3 A;  2EXA A;  3O88 A;  3FC7 A;  2WKP A;  4R3A A;  3NIA A;  5IT5 A;  2V0W A;  4XT2 A;  3VSL A;  4GOG A;  2IWC A;  3OZH A;  1OT6 A;  3B42 A;  1NRJ A;  1IYQ A;  3OC2 A;  4QU3 A;  3NHQ A;  4QY6 A;  2FZ0 A;  3W8K A;  1PIO A;  4H8R A;  2FFY A;  1YLP A;  1I2S A;  4U3T A;  1YKD A;  1MWS A;  1S6R A;  4M3K A;  4WF0 A;  4HBU A;  5GLA A;  3GSG A;  4C3Q A;  3LCE A;  2H5S A;  2L4R A;  4IUH A;  4CLC B;  2XRO A;  1YMX A;  1J9M A;  4YOF A;  3T4S A;  4OOL A;  4KZ7 A;  5TFQ A;  1S0W A;  4PKY G;  2LB5 A;  4NK3 A;  4QB8 A;  1PWC A;  1VEU B;  4DE2 A;  1NZO A;  3U4L P;  4E3K A;  2A24 A;  3PAE A;  3A0S A;  4JPM A;  2JKR I;  1PI5 A;  2K2N A;  4EW7 A;  5EEC A;  3DWK A;  1H5X A;  4FOF A;  5FQJ A;  4KUK A;  4CJN A;  3DTE A;  1MWU A;  4EUZ A;  1YT4 A;  4MBF A;  3VE3 A;  3T4L A;  2ZQ7 A;  3IH9 A;  3NOU C;  3IH8 A;  2XDM A;  4ZJ3 A;  1N9B A;  2QJ5 A;  3FV7 A;  2E8J A;  4EES A;  1K57 C;  4S2O A;  1LL8 A;  4GW9 A;  1UWN X;  4OON A;  1LL9 A;  1P9W A;  4OLD A;  2UWX A;  4P6B A;  4HEF A;  5EVE A;  5I94 A;  1OT9 A;  4WLA A;  3GTC A;  4DJ3 A;  3W2Z A;  4Q0J A;  2XRN A;  4Y13 A;  1IFQ A;  3PTE A;  3IBR A;  3OPR A;  4R4S A;  1YM1 A;  3K3C A;  3KYE A;  1KE4 A;  1K6R A;  2QZ6 A;  4DRT A;  3UY6 A;  4Q0H A;  1XA1 A;  5HW3 A;  3SOI A;  1V9Z A;  1QME A;  1SZV A;  4BWI A;  3UNW A;  3WS2 A;  3QP4 A;  1EW0 A;  3BY8 A;  3JVU A;  5FDH A;  2WAF A;  1MPL A;  4GNU A;  5F1F A;  2D02 A;  5KSH A;  3BFC A;  4PPR A;  3LYX A;  3HLC A;  2XFS A;  3IXG A;  1FIK A;  5DVA A;  2Y2O A;  2OWH A;  3MZE A;  1GSX A;  3HL9 A;  1OME A;  4KZ8 A;  3T1S A;  2GZA A;  4Y17 A;  1VB6 A;  1HZO A;  2JE5 A;  2EWW A;  3Q81 A;  3UDI A;  3TW8 A;  4BQM A; 
#chains in the Genus database with same CATH homology
 3GEC A;  4MN5 A;  1S1Z A;  2WKQ A;  4UEY A;  3OBF A;  5F69 A;  3OOV A;  2PR6 A;  1P9R A;  4P6Z S;  4GLQ A;  2OAQ 1;  1UWP X;  4BBU A;  1DP8 A;  4EUV A;  3LFV A;  4MMN A;  4LRX C;  4IJG A;  3E4Q A;  2PD8 A;  1TF1 A;  5AJG A;  5J4E A;  1GSW A;  2JKT I;  1LSV A;  3GDI A;  1LSW A;  3D72 A;  1MZU A;  1ZTU A;  2YKH A;  1OJG A;  2A2L A;  3FG8 A;  2OWJ A;  4I3A A;  4I39 A;  3BQ8 A;  2B02 A;  3B33 A;  3EGX C;  1MC0 A;  3F1P A;  4I5S A;  4HH3 A;  4LRY C;  3PR6 A;  2PHY A;  4I38 A;  3K2N A;  2CMN A;  5DFX A;  2GJ3 A;  4EQ1 A;  2HJ9 C;  2ZOI A;  3LIC A;  3UB9 A;  2YKF A;  3OCN A;  4II7 A;  1IOU A;  4BBV A;  2DMW A;  2ZBB A;  5C5K A;  3T50 A;  3UMD A;  1DP9 A;  3LR0 A;  3S7N A;  2W3H A;  1T1C A;  3PYP A;  3LIB A;  3PBS A;  2GNX A;  3BQA A;  2NUT C;  2O9C A;  3H82 A;  1S67 L;  3CI6 A;  3T4T A;  3A0R A;  4BMW A;  1BYW A;  4KUO A;  2W0N A;  2L1M A;  3KSH A;  3PXP A;  4XT2 B;  1DRM A;  5HWT A;  5EFW A;  3LI8 A;  5DFY A;  1LT0 A;  2A24 B;  4HQA A;  3KO6 A;  2PYR A;  1Y28 A;  2PR5 A;  1T19 A;  3LIA A;  4WEK A;  4ARZ B;  1W63 Q;  4ETX A;  4Y3I A;  2LB9 A;  3C8C A;  1GSV A;  3F1N A;  4NXB A;  3CUE C;  4G3K A;  2VV8 A;  5G4Z A;  3TE8 A;  2V9A A;  2VEA A;  2Z6D A;  3EOI A;  5F5Y A;  3JVV A;  4ZRR A;  4EEP A;  2QWS A;  2W3F A;  3PBQ A;  5DJT A;  2Z6C A;  1YSQ A;  4L9F A;  4WUJ A;  2O0Y A;  5FL3 A;  3E98 A;  2J80 A;  4GS9 B;  4G3V A;  4HHD A;  4Q0I A;  2M1C A;  4P6Z M;  3EEA A;  2OOL A;  4QPR A;  3EGD C;  3MQ0 A;  4GS9 A;  4MN6 A;  2JN7 A;  2XSS A;  2V1B A;  2IA2 A;  4EXO A;  5MC7 A;  2VA0 A;  3LIE A;  4EER A;  4Z1W A;  4GJ4 A;  2W3G A;  3T4Q A;  2JHE A;  1TS6 A;  4O8G A;  4WN5 A;  3G6O A;  1WA9 A;  2PT7 A;  4HJ4 A;  3KSF A;  1OTA A;  2I9V A;  3U2A A;  3ZQ5 A;  2JKT M;  1ODV A;  3KSG A;  1TD5 A;  4NEE D;  3F1O B;  4L0L A;  5AVE A;  2W1T A;  4CLC E;  2KDK A;  3PBT A;  1T1B A;  2HJE A;  5HL6 A;  2QJ7 A;  4ME4 A;  2JKR M;  3F1O A;  1OTI A;  4DJ2 A;  2W1R A;  3LIF A;  3KSI A;  4NKP A;  4B9O A;  3R4K A;  2Y8H A;  4HJ6 A;  5G4Y A;  3IS2 A;  3MFX A;  4HOI A;  5HWW A;  3LUQ A;  1NWZ A;  4MN7 A;  2ZMV A;  4HIA A;  4NXF A;  1XJ3 A;  2K31 A;  1DP6 A;  4BJP A;  5A8B A;  4EU0 A;  2KX6 A;  5TBM A;  2R78 A;  1XJ2 A;  3SW1 A;  1S4S A;  3RFB A;  1XJ6 A;  2OAP 1;  2M7U A;  3LI9 A;  4PAU A;  4GHI A;  3UE6 A;  3ICY A;  3LR4 A;  1ZHH B;  3S7O A;  2EA9 A;  1OTB A;  4L9E A;  2O99 A;  3E0Y A;  4UQI M;  2W27 A;  2K7S A;  4YWZ A;  3H9W A;  4E04 A;  2O9A A;  4DMZ A;  1STZ A;  5HPI A;  1KOU A;  4H6J A;  4CLC D;  1G6O A;  1MKM A;  3UB8 A;  3EQV A;  1W63 M;  1F9I A;  3A0V A;  4EEU A;  3NOP C;  3OLO A;  3BWL A;  3CUE A;  3R7W A;  4H6J B;  3S7Q A;  3T4O A;  4MCW A;  4ETZ A;  3HJK A;  1XJ4 A;  1S4R A;  4IHQ A;  2PD7 A;  3LID A;  1S1Y A;  2VV6 A;  3BJN A;  3F1P B;  4R6L A;  2L0W A;  3KX0 X;  2VLG A;  3BY9 A;  3VOL A;  1OPX A;  4JGQ A;  5HZH A;  3VE4 A;  5K5B A;  3PBR A;  5DJU A;  3B47 A;  1T18 A;  5LBR A;  4CQH A;  2Y79 A;  2EWV A;  2HGV A;  2VJW A;  4Y2F A;  4WEJ A;  2ZOH A;  5IU1 A;  5HDD A;  5HDC A;  1D7E A;  4PHT A;  3EEH A;  3LR3 A;  4G3W A;  4R70 A;  2KOI A;  3TJZ C;  3UE3 A;  2V0U A;  3ZYT A;  5F6A A;  3FC7 A;  3HCY A;  2WKP A;  2VKS A;  4R3A A;  5IT5 A;  2VGL S;  1VHM A;  1OTE A;  2V0W A;  4XT2 A;  4B93 A;  4HH2 A;  3E4O A;  3UME A;  2G7U A;  2P08 A;  2MJ6 A;  4HJ3 A;  2HF6 A;  1OT6 A;  3B42 A;  3OC2 A;  1NRJ A;  1OJ5 A;  3RH8 B;  1JNU A;  1V9Y A;  3NHQ A;  2FZ0 A;  3F1N B;  4HP4 A;  1TS8 A;  4I3J A;  3BW6 A;  4M4X A;  1YKD A;  2PYP A;  5I5L A;  2O9B A;  4K08 A;  4WF0 A;  2J3W A;  4CLC C;  1UGU A;  3O5Y A;  5CX7 A;  2W3E A;  1OTD A;  1YAX A;  3V67 A;  1F98 A;  2L4R A;  1NLZ A;  4IUH A;  4CLC B;  4HI4 A;  2XRO A;  4FSF A;  4AFI A;  1D06 A;  4YOF A;  5AVF A;  3T4S A;  3RTY A;  3ULF A;  4OOL A;  5HD5 A;  4F3L A;  5TJJ A;  5F68 A;  4PKY G;  2VGL M;  3PHY A;  3TRC A;  2LB5 A;  3H82 B;  1XFN A;  4JGP A;  1F5M A;  4F3L B;  4HP9 A;  5HDS A;  5KIZ A;  3C30 A;  2GX5 A;  3CIT A;  5J3W A;  1G28 A;  3UB6 A;  2A24 A;  3FPW A;  3A0S A;  2J3T D;  3C38 A;  4NXE A;  2JKR I;  2K2N A;  4YNR A;  4EW7 A;  4OOM A;  1X0O A;  1N9L A;  3HJI A;  2BAS A;  4LLO B;  3MQO A;  4FOF A;  3OCL A;  4KUK A;  3IS2 B;  2J3T C;  3MMH A;  5DKK A;  5IS1 A;  3P7N A;  3LR5 A;  3H7W B;  5DF9 A;  3IBJ A;  4WL9 A;  4EET B;  2QYB A;  4JGR A;  1H8M A;  3EWK A;  2QHK A;  3VV4 A;  3VE3 A;  2WKR A;  3T4L A;  3H7W A;  4UQI S;  3MF0 A;  1S66 L;  3NOU C;  3CWF A;  2FH5 A;  4GHI B;  2QJ5 A;  5L8M A;  4EES A;  1LL8 A;  3MR0 A;  4GW9 A;  1TS0 A;  1UWN X;  5HWV A;  1T1A A;  3CAX A;  1P9W A;  4O01 A;  3R7W B;  4LRZ E;  5DKL A;  1YSP A;  1P97 A;  3CLO A;  4ARZ A;  4R38 A;  1OT9 A;  1N9N A;  4WLA A;  2HV1 A;  3T4K A;  4O0P A;  4DJ3 A;  5HPF A;  3UB7 A;  3W2Z A;  4Q0J A;  1N9O A;  2XRN A;  4PKY A;  4MDZ A;  1IFQ A;  2KLI A;  3C2W A;  4LPZ A;  2W1T B;  2XA7 S;  4DN0 A;  3IBR A;  2NUP C;  1NLY A;  2ZMF A;  1P0Z A;  3KYZ A;  3PBN A;  3K3C A;  4NXG A;  2VX8 A;  4KQD A;  2PDR A;  4WEL A;  2INW A;  4HNB A;  4Q0H A;  3KYQ A;  1H3Q A;  4HY8 A;  3K3D A;  1V9Z A;  3DBA A;  4BWI A;  3T4J A;  3MQQ A;  3NJA A;  2B18 A;  1EW0 A;  2P7J A;  3BY8 A;  3S7P A;  4Y5F A;  4L9G A;  3JVU A;  4IUK A;  5TBM B;  4KQO A;  1XFQ A;  2D02 A;  1LSX A;  5KSH A;  2W3D A;  2V1A A;  3D3O A;  3LYX A;  2QKP A;  2XA7 M;  3FPV A;  5HD3 A;  2M7V A;  4BBT A;  4RQ9 A;  3MJQ A;  2OWH A;  1GSX A;  4I3I A;  2GZA A;  3E4P A;  1VB6 A;  3MXQ A;  4GCZ A;  2EWW A;  4JGO A;  2VZW A;  2H28 A;  3EQU A;  1TS7 A;  5HSQ A;  4CLC A;  3P01 A;  3PBO A;  3NOT C;  3TW8 A;  2VV7 A;  2P04 A;  5J7E A;  2D01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...