3F1PB

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
b'VCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 30
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1pB01
2KX6A 1S4SA 1OTEA 3BY9A 3F1OB 2WKPA 5I5LA 2WKRA 4JGQA 3PYPA 3LIAA 3RH8B 2PHYA 4RQ9A 4JGOA 3CWFA 3MXQA 2YKFA 2M1CA 2VLGA 2V1AA 1LSVA 4F3LA 4DJ2A 2PYRA 2A24B 3GECA 4LRXC 2ZBBA 3A0VA 2JHEA 2W0NA 2V0WA 4PKYA 3F1NB 2QJ5A 4WN5A 5F69A 5G4ZA 2OOLA 4JGPA 3H82B 4R3AA 3B33A 5IS1A 1S67L 1OJ5A 4I5SA 3UMEA 1OT6A 2VV6A 1V9YA 2INWA 3SW1A 2D02A 3ICYA 1TS7A 1LT0A 2V1BA 4NXEA 4HOIA 3A0RA 1P97A 3H7WB 4WL9A 5J7EA 2ZOIA 4XT2A 1OTBA 3IBRA 1X0OA 1N9OA 2GJ3A 4H6JA 3VOLA 4I3AA 5HWTA 5J3WA 4GHIA 5TBMB 2QJ7A 5DJUA 4EERA 4WF0A 3FG8A 3IS2B 5IU1A 4LRZE 4NXBA 1XJ4A 4PKYG 3A0SA 4KUOA 2J80A 1P0ZA 3NOPC 2KDKA 5AVFA 2I9VA 1KOUA 3UB8A 1XJ6A 4L9EA 1T1AA 4HJ3A 1OT9A 2V9AA 2PR5A 3KX0X 4GS9A 4HNBA 1TS0A 4DJ3A 1D7EA 4EESA 3MQQA 3LIFA 3GDIA 3CAXA 3MFXA 4KQDA 4HQAA 4YWZA 5F68A 1MZUA 1JNUA 2YKHA 3E4OA 4L9FA 1BYWA 5F5YA 2CMNA 4KUKA 1OJGA 2PYPA 3H82A 4WUJA 1UGUA 5J4EA 1UWNX 2V0UA 1Y28A 3VE3A 1S1YA 1DP8A 3RTYA 4MN6A 3F1PA 3LI9A 1N9LA 2L1MA 1GSVA 2QHKA 4I38A 1DRMA 4LLOB 3BWLA 1GSWA 4I3IA 2QKPA 1OTDA 1T19A 5DKKA 2OWHA 1S1ZA 2W27A 3K3CA 2P7JA 4BBUA 2Z6DA 5HD3A 2R78A 4BBVA 2OWJA 5HDCA 3EWKA 3UMDA 5DJTA 4F3LB 1NWZA 2HV1A 3D72A 1T1CA 3UB7A 3NHQA 3P7NA 4EW7A 3UB9A 5KIZA 4K08A 4HHDA 1LL8A 3HJIA 5F6AA 2VV7A 1G28A 4EQ1A 1T18A 3LIEA 1F9IA 3VE4A 3PHYA 4R70A 2VEAA 2BASA 3F1OA 3UB6A 4XT2B 4JGRA 2PD7A 4H6JB 3MQOA 1XJ2A 4HY8A 3T50A 3LICA 2L0WA 1D06A 1WA9A 3ZQ5A 4I3JA 2A24A 4HP4A 2QWSA 4R38A 1GSXA 1T1BA 1TS6A 1XJ3A 2PDRA 4EXOA 3F1NA 3HJKA 2EA9A 2Z6CA 5EFWA 3C8CA 3FC7A 3C2WA 1ODVA 4HI4A 1LSXA 4HP9A 4HH2A 3ULFA 4L9GA 4GS9B 1V9ZA 4M4XA 4HJ6A 4HJ4A 1N9NA 4MN5A 1DP9A 3MJQA 2B02A 3H7WA 5G4YA 1TS8A 4BBTA 3LIBA 1OTAA 4EEUA 1DP6A 3K3DA 3LUQA 5TBMA 1S4RA 3LYXA 4I39A 4E04A 2ZOHA 2VV8A 1S66L 3LIDA 3E4QA 4R6LA 4EETB 3NOUC 2H28A 3IS2A 1OTIA 1XFNA 3UE6A 5HDSA 5HSQA 3F1PB 4B9OA 3MR0A 4EEPA 3E4PA 5HZHA 2D01A 5AVEA 3CLOA 3BY8A 3OLOA 5HWVA 2K7SA 2JN7A 4GW9A 3EEHA 1VB6A 3NOTC 5HDDA 5HWWA 4GCZA 1UWPX 1EW0A 3NJAA 4NXGA 1XFQA 3H9WA 5A8BA 2WKQA 3LI8A 4LRYC 2PD8A 3G6OA 4GHIB 4WLAA 2L4RA 5HD5A 4LPZA 5DKLA 4HH3A 4HIAA 1F98A 4NXFA 1LSWA 2PR6A
chains in the Genus database with same CATH superfamily
5KSHA 2KX6A 3F1OB 4GZBA 4R0QA 3LIAA 3ISGA 4Y3IA 2XGNA 2R9WA 5GLCA 1Z09A 4IEDA 4RQ9A 1YAXA 3BJNA 3MXQA 3L7HA 4X1LA 2YKFA 1NJ4A 5AJGA 1H0MA 1LSVA 4S2KA 4CPKA 1ZKJA 2A24B 2E8JA 4LRXC 3IH9A 3A3DA 3A0VA 3IX4A 3R7WB 1VEUB 4PKYA 3SS3A 3OPRA 4BENA 4OLDA 4E3KA 2OOLA 4Q0IA 3H82B 4QHCA 4I5SA 1CF0A 1XGJA 4X56A 1V9YA 5EVID 2INWA 1VQQA 3IBJA 3SW1A 1YSQA 3ICYA 3D4FA 3KSGA 2W1TB 2ZL1B 4NXEA 2EX9A 3ZDJA 3A3JA 5KMWA 4OPYA 4Y5FA 3N8RA 4XT2A 3HVFA 4H6JA 5FA7A 2XA7S 5HWTA 5L07A 3MZFA 4P0MA 5DJUA 5GLDA 4EERA 2DCFA 4WF0A 4G3VA 2JC7A 3G2ZA 3T4TA 5DF7A 5F1FA 3A0SA 3A3IA 3OC2A 5GL9A 2V8FA 1FCNA 2HDRA 3UDFA 2Y55A 3FYZA 2M7UA 3C5AA 5FASA 2XH9A 5DTKA 4L9EA 3C38A 1T1AA 4KG6A 4HJ3A 2Y2GA 1W8QA 1XXMA 2PR5A 1KE0A 4MBHA 4GS9A 3VMAA 1H8ZA 1TS0A 3OCLA 1L3LA 4BD0A 2C5WB 3LIFA 3IXGA 3GDIA 3UE1A 5FQKA 3S7OA 2ZJ9A 4IUKA 1GA0A 1TEMA 4S2IA 2ZM0A 3T4OA 5CERA 3V39A 3B3XA 1BUEA 1RCJA 4R3JA 3IF6C 4BMWA 4KZ3A 4GLQA 2CMNA 4KUKA 2Q9MA 1PWCA 3OZHA 4DE0A 5HAIA 5FDSA 3MFDA 3RTYA 4MN6A 4ZJ3A 3F1PA 1M40A 2EX6A 2O9BA 2L1MA 3M2JA 2JKRM 1G6OA 3CMZA 5A91A 1W8YA 2BTFP 3S4XA 3VV4A 3QP8A 2J9PA 4OOLA 2WGWA 2GX5A 1K57C 3CPTA 1MWUA 3W4OA 4Q8IA 1T19A 5DKKA 5DTTA 2W27A 2W3HA 2P08A 2P7JA 2XF3A 4IBRA 2XFTA 4FUWA 4MMNA 1VM1A 1NWZA 2H10A 2Y2LA 2RL3A 1T1CA 1BLCA 3S22A 4HEFA 5F1GA 1H3QA 5KIZA 4R23A 4K08A 5EVIA 2XROA 1LL8A 1MKIA 1YKDA 2J3TC 3HLBA 4ZJ2A 4K0XA 3S7NA 1G28A 4ZTKA 2VGJA 2O99A 4IBXA 5E2FA 3UB6A 1H5XA 4XT2B 4JGRA 1EROA 5FDHA 4H6JB 2ZQ9A 3O86A 4KZ9A 1XJ2A 2WAEA 3LICA 5HW3A 5I94A 4FH4A 3HLGA 2EWWA 3IXHA 5FSRA 4EQIA 2V8CA 1T1BA 5GHXA 4YFMA 1EWZA 2G7UA 3F1NA 3IF5A 3VP2A 5EFWA 4L0LA 3RJUA 3C8CA 4EBPA 4OQGA 1M6KA 3IWQA 1ODVA 4CLCE 4Y17A 5FQIA 1DY6A 1S6RA 4L9GA 4GS9B 1V9ZA 2ZQDA 3KYZA 1HZOA 4HJ4A 1N9NA 3ZVWA 2H0YA 3CUEC 3OPPA 3VFFA 4S2JA 3LEQA 3QP6A 1F2KA 4XUXA 3NECA 4BD1A 4QY5A 3ZGAB 1L0DA 4UA7A 3NCKA 1S4RA 3VSKA 2ZOHA 2J9OA 2AVXA 5JYPA 4R6LA 4WZ5A 4OQHA 3WWXA 1HD8A 4E3MA 4C3QA 2H28A 1BLSA 4IHQA 2OLUA 1XA1A 1NZOA 4MN7A 1MBLA 4ZBEA 4KZBA 3F1PB 4YOFA 1K55A 5EECA 4JPMA 4ETXA 5FEGA 4U0TA 2JKGA 1IYSA 2D01A 2GZAA 2WGWB 3CLOA 2FFFB 1MY8A 2JN7A 3FWLA 4GW9A 4E3IA 3EEHA 2IWBA 4JXGA 4GCZA 2FZ0A 1UWPX 1YMXA 1TDGA 3PBRA 4C75A 2Y2MA 2PD8A 1A0KA 4KG2A 3HLWA 4S2LA 4GHIB 1VHMA 3QHYA 1ZC2A 4OONA 2WKHA 3JYIA 2Y2KA 2A2LA 1PIOA 3T1QB 3M6BA 5DKLA 4HH3A 3DW0A 3EGDC 5EVIB 5KSCA 2WGVA 1ZHHB 3KYQA 3ZG0A 4DE1A 1F98A 4ZRRA 1MWRA 3CI6A 1ONGA 5U47A 4K0WA 4KG5A 1PFLA 5TFQA 1OMEA 2OV5A 4ME4A 4WMCD 1H8MA 2WKRA 5I5LA 2J7VA 4QB8A 1YLWA 2EWVA 2HP9A 1AWIA 1NRFA 3EQVA 4KQOA 2RCXA 3S7PA 4OQ0A 2XR0A 3SH8A 2OSUA 2OLVA 5EOEA 3MBZA 1PWGA 1JVJA 2VLGA 1EI5A 3PBTA 4PM8A 3GVBA 4O7DA 5CEDA 4B4XA 4KZ7A 2UWXA 2V0WA 3F1NB 5F69A 1TVFA 4GKUA 1PI5A 3LR3A 1KVLA 3PBOA 3FKVA 1NZUA 5IS1A 1OT6A 2VV6A 5EV0A 5IHVA 3LO7A 3UO9A 4EBLA 1LT0A 2K31A 1XA7A 4HOIA 4NEED 4GN2A 4HBTA 1OTBA 3IBRA 1X0OA 3N4IA 1K4FA 3VOLA 1TDLA 4XUZA 5FQJA 3LY4A 1G68A 5AQ7A 5J3WA 4FCFA 2PU2A 3HREA 4KQRA 1WYCA 4N92A 1RGYA 2R9XA 1K4EA 4EU0A 1JWZA 4Y7PA 2B5RA 2QPNA 5EM0A 5IU1A 2ZMFA 4LRZE 2P04A 3O5YA 1XJ4A 4MCWA 3MKEA 3MS6A 4JXSA 4KUOA 2J80A 3N8LA 2J3TD 2VZWA 1U60A 2VX8A 3DWZA 3PBNA 3E0YA 3G35A 1KOUA 4S2NC 3UB8A 3IWOA 1KGGA 5CXWA 4WZ4A 4FTXA 1E4DA 1KGFA 3I7JA 1CI9A 3KX0X 2Z2MB 3MZDA 4HNBA 4M3KA 2HGVA 4OKPA 1BLHA 4DJ3A 5G18A 4KQQA 1I2SA 4DE2A 4DXCA 1K54C 3IX8A 3CAXA 2Q0OA 4X68A 1OPXA 4OP5A 3E2KA 4DMZA 3VOZA 3N6IA 1L0EA 3V3SA 1JNUA 4K91A 3E4OA 3C4PA 4L9FA 1BYWA 4ZAMA 2WK0A 3P09A 2VK3A 5FI2A 1UGUA 3BFEA 2P9VA 1UWNX 3E98A 5M19A 1S1YA 1DP8A 2IA2A 4LGWA 1LI9A 2FFYA 2WKIA 2V1ZA 4WMCA 2Y59A 1PYYA 1XGIA 5AQ9A 3K2NA 2HJ9C 1DRMA 1NLYA 1C3BA 1GSWA 2B95A 5HARA 2XA7M 4PMAA 2QKPA 2BLSA 4UA6A 1DJBA 5EPHA 1FR1A 3AGEA 2IWDA 3ZHHA 1FSWA 3W4PA 3WS4A 4BBVA 1I2WA 3CJMA 4S2PA 3UMDA 5DJTA 3IF6A 4BL2A 5L8MA 2W1RA 5FATA 3UB7A 1FOFA 2B18A 2G2WA 1K6RA 1SCWA 3SH9A 4BL3A 5EOOA 1YLJA 1AXBA 1W5DA 1ACFA 4OPZA 2NUTC 3DTKA 1CK3A 1DJAA 4WBGA 3HJIA 1VETA 3KSIA 4O0PA 2VV7A 2EX2A 3ITBA 1T18A 3GTCA 1K57A 3TOIA 3PHYA 4E3LA 2VEAA 2BASA 2EFXA 4R4RA 4LENA 4ZJ1A 2PD7A 4IVIA 1DJCA 4FOFA 5FI6A 2ACGA 3TG9A 3PBQA 3O3VA 1KE3A 2VKSA 1TF1A 3C30A 1P9RA 4I3JA 3FZCA 5FQMA 5LBRA 5FI7A 3VP0A 2QZ6A 3WS5A 1TS6A 1XJ3A 1NRJA 4RX3A 4F94A 1YPRA 3VP3A 2KOIA 1O7EA 1PW8A 2X02A 5HPIA 2Y2OA 3M6HA 3HUNA 3WS0A 1LSXA 3UE3A 3HLDA 4HP9A 3ZG9B 4HH2A 4O01A 4M4XA 4HJ6A 3E2LA 3EQUA 1DP9A 3NDEA 3H7WA 1TS8A 5IT5A 1OTAA 1STZA 4EEUA 1FIKA 4ID4A 1K38A 3K3DA 1MXOA 1L2SA 3G31A 3FPWA 3LYXA 4E04A 4NKPA 3IH8A 3MQ0A 3LIDA 3E4QA 3T1XA 3IWIA 4G3KA 2WKEA 3DTEA 4WEKA 5CHMA 1XFNA 3ZNTA 4P87A 5EVLA 3C7VA 3UE6A 1ES5A 2JKTM 5HDSA 2VGKA 3L9KA 5HSQA 3G2YA 5E2GA 4B9OA 4X25A 5GHYA 3BRMA 1XKZA 3CUEA 1GHPA 1LL5A 5HL1A 1SDEA 1ERMA 3OLOA 5HWVA 2K7SA 3QP2A 4R3BA 1ESIA 1VB6A 3V5MA 2ZC7A 1EW0A 3NJAA 3M2KA 4QPRA 3GRJA 3IF6B 5CEBA 2WADA 1NYMA 3ZYTA 2ZQCA 5L09A 3G6OA 2O0YA 4DDYA 4WLAA 1SZVA 2L4RA 1FCMA 3LCEA 3G34A 1NLZA 3WS2A 4LPZA 1VETB 3NIAA 3ZG8B 4OQIA 1LSWA 3VFHA 5A8BA 3U4LP 5TJJA 4EBNA 3UPPA 5CGSA 1S4SA 3BY9A 3W4QA 2WKPA 3HCYA 3UY6A 3PYPA 1BTLA 4NETA 2Y2HA 2PHYA 4OLGA 4P6BA 3UN7A 3A3EA 3CWFA 1ZG4A 2XK1A 3RXXA 2M1CA 3SS4A 4PM7A 2JCHA 1W63Q 2V1AA 4GDNA 1YSPA 4DJ2A 1S0WA 4U3TA 4G3WA 2PBDP 4ETZA 3FV7A 2W0NA 3T4LA 4Q0JA 3CZDA 2QJ5A 2GDNA 1CQAA 4HESA 2Y91A 2ZM8A 4YNRA 4R3AA 3UDXA 3R4KA 1OJ5A 4BJPA 3KSHA 3UMEA 3WS1A 3BFCA 4RX2A 1G5UA 5GLBA 1IEMA 4E3JA 1YM1A 2NUPC 1YLZA 4C6YA 1CEGA 5HX9A 3UPOA 3UB5P 3ZG7B 3A0RA 1P97A 3H7WB 4WL9A 4ZDXA 5J7EA 2ZOIA 2PRFA 4IVKA 2GJ3A 4FD8A 4I3AA 2OAP1 3CPTB 3NY4A 4LV0A 3KO6A 3SZTA 1H8YA 4GD8A 5D3OA 4WM9A 1GCEA 3TW8A 3BECA 4CLCC 4UQIS 1MKMA 2ZC5B 3PBSA 1PWDA 4EUZA 4MLLA 5GHZA 4B93A 4GD6A 4CJNA 2XLNA 3Q7VA 4Y0UA 3MXRA 1BZAA 3QNBA 4E6WA 1P0ZA 2ZM2A 2KDKA 3KYEA 2I9VA 4Z1WA 1XJ6A 3ZNYA 4DXBA 5DFYA 4PM9A 1OT9A 5M1AA 3IQAA 5GLAA 1YT4A 1BULA 1E3UD 3GMWA 2Y2QA 1D1JA 1D7EA 1ERQA 3PAGA 3MQQA 3BLSA 1GHMA 2IWCA 5E2EA 1L0FA 3GR2A 4E6XA 3OCNA 3MFXA 2X71A 5A92A 2ZC6B 4GNUA 4KQDA 1ZG6A 1MZUA 5CGWA 4PAUA 5CTNA 2ZC4B 3H82A 3DAVA 4WUJA 5FQ9A 3WRTA 1QMEA 4Z9QA 2VA0A 5J4EA 5F83A 4DRTA 2V0UA 2HF6A 5AQBA 2ZQ7A 4S2NA 1K0KA 4YINA 4JLFA 1N9LA 4N1HA 1GSVA 1JTGA 1KDSA 1LL9A 2XD5A 3LR5A 5DFXA 4OH0A 2J8YA 4LLOB 2ZLYA 5F82A 1W7FA 2Y2PA 5E43A 3MXSA 4U0XA 5EVEA 5FQQA 4QY6A 2I72A 4EUVA 3K3CA 4N1XA 3BFGA 2Z6DA 4WELA 5HD3A 4S2OA 4QD4A 4MEZA 3T4SA 3C7UA 4Q0HA 5FAPA 2HP5A 4JBFA 2HV1A 1ALQA 3D72A 3BFFA 2Z2LB 1SDNA 3P7NA 4EW7A 3A3FA 1YQSA 2JKRI 1KDWA 3G32A 3D3OA 4PM6A 2PU4A 3NDGA 4LV2A 3P01A 4O8GA 1HVBA 2ZMAA 2PBYA 3LIEA 1F9IA 3VE4A 4DDSA 2O9CA 3IXDA 4R70A 1TD5A 5CTMA 4MBFA 2VGLS 3W8KA 4GOGA 1MPLA 3JVUA 5BOHA 4WEJA 4MBKA 4HY8A 3FKWA 5CECA 2EXAA 1WA9A 1IYPA 3T4KA 5J8XA 1KVMA 4R4SA 1YLPA 4E3NA 3ZQ5A 3LFVA 2XD1A 5A90A 3ZCZA 1CEFA 2QWSA 2EFUA 2DRWA 1XP4A 2PDRA 3Q7VB 3BW6A 2P74A 3B47A 2WZXA 2EA9A 2Z6CA 3T1SA 3FC7A 1ES2A 3C2WA 1ESUA 4HI4A 4QU3A 2ZMVA 3B42A 3HLCA 1PW1A 1E3UA 3Q07A 4LCLA 4X1MA 1NYYA 2Q9NA 2HDQA 4JF6A 4LV3A 3NULA 5G4YA 4BBTA 4DN0A 3LIBA 3MKFA 5HAQA 1DP6A 1IELA 5DVAA 4JKTA 1ZTUA 3G4PA 3MF0A 3SH7A 3LUQA 5HL6A 5TBMA 4UEYA 2V2FF 3S7QA 4PM5A 2VV8A 1S66L 2E8IA 2WZZA 1Q2PA 1L0GA 4EETB 3NOUC 3IS2A 3ITAA 2G2UA 3NC8A 3OOVA 3T1RA 2PAVP 1G6AA 1OTIA 2WAFA 1PZOA 1Q2QA 4KZ8A 3Q82A 5HAPA 2ZD8A 3T4JA 4EEPA 2XEPA 1WYBA 3E4PA 2J3WA 5HZHA 5AVEA 1J3WA 1SKOA 3V3RA 5DF9A 1MWTA 5FEFA 3BM6A 4P6ZM 3NOTC 5HDDA 5HWWA 4R1GA 2LB9A 3H9WA 4XXRA 4UHUA 4GJ4A 4QWOA 3DTMA 2WKQA 3LI8A 4LRYC 4PHTA 4KZ4A 4CLCD 5K5BA 4P6ZS 1IYOA 3JPUA 5JYOA 3CHWP 3GQZA 2CC1A 5HD5A 5KZHA 2H0TA 4S2MA 1ONHA 3AGFA 1PZPA 3EGXC 4HIAA 4UAAA 3N7WA 4QJGA 3TE8A 4LCMA 4UA9A 5E2HA 5DF8A 3LR4A 3SS5A 3BQ8A 3VP1A 1OTEA 5FAOA 5TGFA 3NBLA 4JGQA 5EM1A 4MNRA 1RGZA 1Z6FA 3HUMA 3RH8B 3OPHA 5A93A 1Y54A 3AGDA 4X6TA 1CJFA 4BLMA 4JGOA 4GDBA 2Y2JA 3DBAA 1J9MA 3Q81A 1QMFA 4DF6A 1ES4A 3QP5A 4F3LA 2WGIA 3ZVTA 2PYRA 3CG5A 3G30A 3GECA 2ZBBA 3TJZC 1YMSA 4OPQA 1LHYA 2JHEA 3VOYA 5FAQA 4WN5A 5G4ZA 4JGPA 3B33A 3OBFA 1JTDA 1S67L 3BYDA 2P9VB 1K56D 2OAQ1 4Y15A 4Y2FA 4OPRA 2D02A 2HDUA 1TS7A 3Q7ZA 3T12B 3Q1FA 3HLEA 3N8SA 3ZG5A 1P9WA 2V1BA 4D2OA 5AQAA 4FH2A 4B4ZA 1N9OA 1HLUP 2XSSA 3IHBA 3VSLA 1ES3A 5CHUA 3O87A 4GHIA 1GA9A 5TBMB 2QJ7A 4GB7A 1LLBA 3RXWA 3C4OA 2UV0E 3FG8A 2W3GA 3IS2B 3VP4A 5EUAA 2ZC3B 4NXBA 3RFBA 4PKYG 2HZ5A 3NOPC 3KSFA 5AVFA 5CHJA 1PNEA 1SKOB 2FH5A 3GSGA 4HBUA 2V9AA 2C6WB 4P85A 1BSGA 3S1YA 3HUOA 4EESA 1XX2A 2MJ6A 2XQZA 2HJEA 2WYXA 3QP4A 1FSYA 4JF4A 4N9LA 4CLCA 2Y2NA 2LB5A 3MSHA 2M7VA 4JF5A 2Y4AA 4HQAA 4YWZA 5F68A 1E25A 4DKIA 5M18A 4KZ6A 2YKHA 2DMWA 2HDSA 5MC7A 1YLYA 4IJGA 3V50A 4A5RA 5F5YA 1OJGA 2PYPA 1CI8A 3PR6A 1Y28A 3VE3A 2DNSA 4JXWA 3HLFA 5FL3A 5CGXA 2XRNA 3LI9A 1KE4A 2QHKA 4I38A 5EVIC 3SOIA 1KGEA 2X01A 3BWLA 3PAEA 4PPRA 4ESPA 1O07A 4I3IA 1HTZA 4Y0OA 2JBFA 3D9YA 1OTDA 3T4QA 2OWHA 1S1ZA 4KZAA 4Y0TA 3BEBA 4OP8A 4D60A 4ARZA 4OOYA 4BBUA 3DWKA 2R78A 3UE0A 2OWJA 4UQIM 5HDCA 3EWKA 4NK3A 4F3LB 2HPBA 2JKFA 4LV1A 3MMHA 3NHQA 3OPLA 3DTIA 1Y4OA 4OVDA 1PRQA 1W63M 3NI9A 3UB9A 3QP1A 2ZQAA 1K56A 1IKIA 4HHDA 1IOUA 4IUHA 5F6AA 1WE4A 1IKGA 4RYEA 4MDZA 4BWIA 4EQ1A 4WYYA 2XDMA 2VJWA 2WUQA 2Y8HA 3F1OA 5CX7A 3MQOA 3T50A 1N4OA 4EV4A 3U2AA 2L0WA 2V20A 1D06A 1NXYA 3PTEA 2K2NA 3TRCA 3CITA 5HFOA 1IYQA 2A3UA 1BT5A 3BQAA 3MZEA 3EEAA 1XPBA 4EWFA 1K6SA 2A24A 4HP4A 2A49A 4R38A 1GSXA 3IXBA 1RP5A 3ZFZA 2Y79A 3IT9A 4H8RA 4WZ5C 3HL9A 3R7WA 2PT7A 1VEUA 4EXOA 3V67A 2KLIA 3LR0A 3HJKA 5DTSA 1LI0A 4KENB 1K25A 4II7A 2ZQ8A 2EXBA 1K55C 3LY3A 3ULFA 2HP6A 2W3FA 1NY0A 4BQMA 2W1TA 1JWVA 4MN5A 2ZL1A 3MJQA 2B02A 1JWPA 4OOMA 3UNWA 3PXPA 4CLCB 2GNXA 1FR6A 2W3EA 3BFDA 3IHAA 1PI4A 4DE3A 1K54A 1I5QA 3HBRA 3JVVA 2QMIA 4I39A 4KZ5A 3WRZA 2QYBA 1FQGA 4LFUA 1N9BA 4CQHA 4RA7A 3UPNA 2W3DA 2EX8A 2JE5A 3FPVA 5TR7A 1FILA 1SHVA 5EE8A 4X55A 3MR0A 2Y2IA 3IX3A 5CRFA 3P98A 2O9AA 2VGLM 1F5MA 4X69A 3W2ZA 3GV9A 3TSGA 3LEZA 3BY8A 5C5KA 1GHIA 1IFQA 4ARZB 3BLMA 3O88A 3LGOA 1SKFA 1YLTA 4NXGA 4B88A 1XFQA 1FCOA 5HPFA 4JXVA 3EOIA 4AFIA 2JKTI 1BLPA 4RVAA 1MWSA 2H5SA 3UDIA 3QNCA 1MC0A 4FSFA 4Y13A 2XFSA 5L2FA 4X53A 1W79A 5L10A 4E3OA 4NG2A 2BG1A 4N9KA 4NXFA 2PR6A
chains in the Genus database with same CATH topology
5TJJA 5KSHA 2KX6A 3LR4A 1S4SA 3BQ8A 1OTEA 3BY9A 3F1OB 2WKPA 3HCYA 4ME4A 5I5LA 1H8MA 2WKRA 4JGQA 3PYPA 3LIAA 2EWVA 4Y3IA 2PHYA 3RH8B 3EQVA 4RQ9A 1YAXA 4JGOA 4KQOA 3S7PA 3CWFA 3BJNA 3DBAA 3MXQA 2YKFA 2M1CA 5AJGA 2VLGA 3PBTA 1W63Q 2V1AA 1LSVA 4F3LA 1YSPA 4DJ2A 2PYRA 2A24B 3GECA 4LRXC 2ZBBA 3A0VA 4G3WA 3TJZC 2JHEA 3R7WB 4ETZA 2W0NA 3T4LA 4Q0JA 2V0WA 4PKYA 3F1NB 2QJ5A 4WN5A 5F69A 5G4ZA 3LR3A 3PBOA 2OOLA 4Q0IA 4JGPA 3H82B 4YNRA 4R3AA 3B33A 3OBFA 3R4KA 5IS1A 1S67L 1OJ5A 4BJPA 4I5SA 3KSHA 3UMEA 1OT6A 2VV6A 2OAQ1 1V9YA 2INWA 4Y2FA 3IBJA 3SW1A 1YSQA 2D02A 3ICYA 1TS7A 1LT0A 2NUPC 2K31A 3KSGA 2W1TB 1P9WA 2V1BA 4NXEA 4HOIA 4NEED 3A0RA 1P97A 3H7WB 4WL9A 4Y5FA 5J7EA 2ZOIA 4XT2A 1OTBA 3IBRA 1X0OA 1N9OA 2GJ3A 4H6JA 3VOLA 2XSSA 4I3AA 2XA7S 2OAP1 3KO6A 5HWTA 5J3WA 4GHIA 5TBMB 3TW8A 2QJ7A 5DJUA 4EU0A 4CLCC 4EERA 4UQIS 1MKMA 3PBSA 4WF0A 3FG8A 2W3GA 3IS2B 5IU1A 4G3VA 2ZMFA 4LRZE 2P04A 3O5YA 4NXBA 1XJ4A 3T4TA 4MCWA 4B93A 3RFBA 4PKYG 3A0SA 3OC2A 4KUOA 2J80A 2J3TD 2VZWA 1P0ZA 3NOPC 3KSFA 2VX8A 2KDKA 2M7UA 5AVFA 3PBNA 3E0YA 2I9VA 4Z1WA 1KOUA 3UB8A 1XJ6A 4L9EA 3C38A 1T1AA 5DFYA 2FH5A 4HJ3A 1OT9A 2V9AA 2PR5A 3KX0X 4GS9A 4HNBA 2HGVA 1TS0A 4DJ3A 1D7EA 3OCLA 2MJ6A 4EESA 2HJEA 3MQQA 3LIFA 3GDIA 4CLCA 2LB5A 3CAXA 3S7OA 4IUKA 2M7VA 3OCNA 3MFXA 1OPXA 3T4OA 4KQDA 4HQAA 4YWZA 4DMZA 5F68A 1MZUA 1JNUA 2YKHA 2DMWA 5MC7A 3E4OA 4L9FA 1BYWA 4IJGA 4PAUA 4BMWA 4GLQA 5F5YA 2CMNA 4KUKA 1OJGA 2PYPA 3H82A 4WUJA 1UGUA 2VA0A 5J4EA 3PR6A 1UWNX 2V0UA 2HF6A 3E98A 1Y28A 3VE3A 1S1YA 1DP8A 3RTYA 5FL3A 4MN6A 3F1PA 2XRNA 3LI9A 2IA2A 2O9BA 1N9LA 2L1MA 1GSVA 2QHKA 4I38A 2JKRM 1G6OA 3LR5A 5DFXA 3VV4A 3K2NA 2HJ9C 1DRMA 1NLYA 4LLOB 3BWLA 1GSWA 4OOLA 4I3IA 2GX5A 2XA7M 2QKPA 1OTDA 1T19A 5DKKA 2OWHA 1S1ZA 3T4QA 4EUVA 2W27A 3K3CA 2W3HA 2P08A 4ARZA 2P7JA 4BBUA 2Z6DA 4WELA 5HD3A 2R78A 3T4SA 2OWJA 4UQIM 5HDCA 4BBVA 3EWKA 4Q0HA 3UMDA 5DJTA 5L8MA 4F3LB 4MMNA 1NWZA 2HV1A 2W1RA 3D72A 1T1CA 3UB7A 2B18A 3MMHA 3NHQA 3P7NA 4EW7A 2JKRI 1H3QA 1W63M 2NUTC 3UB9A 5KIZA 3D3OA 4K08A 4HHDA 2XROA 1IOUA 1LL8A 2J3TC 1YKDA 3HJIA 4IUHA 5F6AA 3KSIA 4O0PA 2VV7A 4MDZA 3S7NA 4BWIA 1G28A 3P01A 4EQ1A 4O8GA 1T18A 3LIEA 1F9IA 2O99A 3VE4A 2VJWA 3PHYA 2O9CA 2Y8HA 4R70A 1TD5A 2BASA 2VEAA 2VGLS 3F1OA 3UB6A 4XT2B 3JVUA 4JGRA 2PD7A 5CX7A 4H6JB 4WEJA 3MQOA 4FOFA 3PBQA 1XJ2A 4HY8A 3T50A 3LICA 3U2AA 2L0WA 1D06A 1WA9A 2K2NA 2VKSA 1TF1A 3TRCA 3T4KA 3CITA 2EWWA 3C30A 3BQAA 3ZQ5A 1P9RA 3LFVA 4I3JA 3EEAA 5LBRA 2A24A 4HP4A 2QWSA 4R38A 1GSXA 1T1BA 1TS6A 1XJ3A 2Y79A 1NRJA 2PDRA 3R7WA 3BW6A 2PT7A 4EXOA 3V67A 2G7UA 2KLIA 3LR0A 3F1NA 3B47A 3HJKA 2EA9A 2Z6CA 2KOIA 4L0LA 3C8CA 5EFWA 3FC7A 5HPIA 3C2WA 4II7A 1ODVA 4HI4A 1LSXA 2ZMVA 3B42A 4CLCE 3UE3A 4HP9A 4HH2A 3ULFA 4L9GA 4GS9B 2W3FA 4O01A 1V9ZA 3KYZA 4M4XA 4HJ6A 4HJ4A 1N9NA 2W1TA 3EQUA 4MN5A 3CUEC 1DP9A 3MJQA 2B02A 3H7WA 4OOMA 5G4YA 1TS8A 4BBTA 5IT5A 4DN0A 3LIBA 1OTAA 1STZA 4EEUA 3PXPA 1DP6A 4CLCB 1ZTUA 2GNXA 2W3EA 3MF0A 3K3DA 3LUQA 5HL6A 5TBMA 1S4RA 3FPWA 3JVVA 4UEYA 3LYXA 3S7QA 4I39A 4E04A 2ZOHA 4NKPA 2VV8A 1S66L 3MQ0A 3LIDA 3E4QA 4R6LA 2QYBA 4EETB 4G3KA 3NOUC 2H28A 3IS2A 4IHQA 3OOVA 4WEKA 4CQHA 2W3DA 1OTIA 1XFNA 4MN7A 3UE6A 2JKTM 5HDSA 3FPVA 5HSQA 3F1PB 4YOFA 4B9OA 3MR0A 3T4JA 4EEPA 4ETXA 2O9AA 2VGLM 1F5MA 3E4PA 2J3WA 5HZHA 2D01A 5AVEA 3W2ZA 3CUEA 2GZAA 3CLOA 3BY8A 5DF9A 3OLOA 5HWVA 2K7SA 2JN7A 5C5KA 4GW9A 4P6ZM 3EEHA 1VB6A 1IFQA 3NOTC 5HDDA 4ARZB 5HWWA 4GCZA 2FZ0A 1UWPX 1EW0A 2LB9A 3NJAA 4NXGA 1XFQA 3H9WA 4QPRA 5A8BA 3PBRA 4GJ4A 2WKQA 3LI8A 3ZYTA 4LRYC 5HPFA 4PHTA 4CLCD 3EOIA 4AFIA 2PD8A 3G6OA 2O0YA 2JKTI 4GHIB 5K5BA 1VHMA 4WLAA 4P6ZS 2L4RA 1NLZA 2A2LA 5HD5A 1MC0A 4FSFA 4LPZA 5DKLA 4HH3A 3EGDC 3EGXC 4HIAA 1ZHHB 3KYQA 1F98A 4ZRRA 4NXFA 3TE8A 1LSWA 2PR6A 3CI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KX6 A;  1S4S A;  1OTE A;  3BY9 A;  3F1O B;  2WKP A;  5I5L A;  2WKR A;  4JGQ A;  3PYP A;  3LIA A;  3RH8 B;  2PHY A;  4RQ9 A;  4JGO A;  3CWF A;  3MXQ A;  2YKF A;  2M1C A;  2VLG A;  2V1A A;  1LSV A;  4F3L A;  4DJ2 A;  2PYR A;  2A24 B;  3GEC A;  4LRX C;  2ZBB A;  3A0V A;  2JHE A;  2W0N A;  2V0W A;  4PKY A;  3F1N B;  2QJ5 A;  4WN5 A;  5F69 A;  5G4Z A;  2OOL A;  4JGP A;  3H82 B;  4R3A A;  3B33 A;  5IS1 A;  1S67 L;  1OJ5 A;  4I5S A;  3UME A;  1OT6 A;  2VV6 A;  1V9Y A;  2INW A;  3SW1 A;  2D02 A;  3ICY A;  1TS7 A;  1LT0 A;  2V1B A;  4NXE A;  4HOI A;  3A0R A;  1P97 A;  3H7W B;  4WL9 A;  5J7E A;  2ZOI A;  4XT2 A;  1OTB A;  3IBR A;  1X0O A;  1N9O A;  2GJ3 A;  4H6J A;  3VOL A;  4I3A A;  5HWT A;  5J3W A;  4GHI A;  5TBM B;  2QJ7 A;  5DJU A;  4EER A;  4WF0 A;  3FG8 A;  3IS2 B;  5IU1 A;  4LRZ E;  4NXB A;  1XJ4 A;  4PKY G;  3A0S A;  4KUO A;  2J80 A;  1P0Z A;  3NOP C;  2KDK A;  5AVF A;  2I9V A;  1KOU A;  3UB8 A;  1XJ6 A;  4L9E A;  1T1A A;  4HJ3 A;  1OT9 A;  2V9A A;  2PR5 A;  3KX0 X;  4GS9 A;  4HNB A;  1TS0 A;  4DJ3 A;  1D7E A;  4EES A;  3MQQ A;  3LIF A;  3GDI A;  3CAX A;  3MFX A;  4KQD A;  4HQA A;  4YWZ A;  5F68 A;  1MZU A;  1JNU A;  2YKH A;  3E4O A;  4L9F A;  1BYW A;  5F5Y A;  2CMN A;  4KUK A;  1OJG A;  2PYP A;  3H82 A;  4WUJ A;  1UGU A;  5J4E A;  1UWN X;  2V0U A;  1Y28 A;  3VE3 A;  1S1Y A;  1DP8 A;  3RTY A;  4MN6 A;  3F1P A;  3LI9 A;  1N9L A;  2L1M A;  1GSV A;  2QHK A;  4I38 A;  1DRM A;  4LLO B;  3BWL A;  1GSW A;  4I3I A;  2QKP A;  1OTD A;  1T19 A;  5DKK A;  2OWH A;  1S1Z A;  2W27 A;  3K3C A;  2P7J A;  4BBU A;  2Z6D A;  5HD3 A;  2R78 A;  4BBV A;  2OWJ A;  5HDC A;  3EWK A;  3UMD A;  5DJT A;  4F3L B;  1NWZ A;  2HV1 A;  3D72 A;  1T1C A;  3UB7 A;  3NHQ A;  3P7N A;  4EW7 A;  3UB9 A;  5KIZ A;  4K08 A;  4HHD A;  1LL8 A;  3HJI A;  5F6A A;  2VV7 A;  1G28 A;  4EQ1 A;  1T18 A;  3LIE A;  1F9I A;  3VE4 A;  3PHY A;  4R70 A;  2VEA A;  2BAS A;  3F1O A;  3UB6 A;  4XT2 B;  4JGR A;  2PD7 A;  4H6J B;  3MQO A;  1XJ2 A;  4HY8 A;  3T50 A;  3LIC A;  2L0W A;  1D06 A;  1WA9 A;  3ZQ5 A;  4I3J A;  2A24 A;  4HP4 A;  2QWS A;  4R38 A;  1GSX A;  1T1B A;  1TS6 A;  1XJ3 A;  2PDR A;  4EXO A;  3F1N A;  3HJK A;  2EA9 A;  2Z6C A;  5EFW A;  3C8C A;  3FC7 A;  3C2W A;  1ODV A;  4HI4 A;  1LSX A;  4HP9 A;  4HH2 A;  3ULF A;  4L9G A;  4GS9 B;  1V9Z A;  4M4X A;  4HJ6 A;  4HJ4 A;  1N9N A;  4MN5 A;  1DP9 A;  3MJQ A;  2B02 A;  3H7W A;  5G4Y A;  1TS8 A;  4BBT A;  3LIB A;  1OTA A;  4EEU A;  1DP6 A;  3K3D A;  3LUQ A;  5TBM A;  1S4R A;  3LYX A;  4I39 A;  4E04 A;  2ZOH A;  2VV8 A;  1S66 L;  3LID A;  3E4Q A;  4R6L A;  4EET B;  3NOU C;  2H28 A;  3IS2 A;  1OTI A;  1XFN A;  3UE6 A;  5HDS A;  5HSQ A;  3F1P B;  4B9O A;  3MR0 A;  4EEP A;  3E4P A;  5HZH A;  2D01 A;  5AVE A;  3CLO A;  3BY8 A;  3OLO A;  5HWV A;  2K7S A;  2JN7 A;  4GW9 A;  3EEH A;  1VB6 A;  3NOT C;  5HDD A;  5HWW A;  4GCZ A;  1UWP X;  1EW0 A;  3NJA A;  4NXG A;  1XFQ A;  3H9W A;  5A8B A;  2WKQ A;  3LI8 A;  4LRY C;  2PD8 A;  3G6O A;  4GHI B;  4WLA A;  2L4R A;  5HD5 A;  4LPZ A;  5DKL A;  4HH3 A;  4HIA A;  1F98 A;  4NXF A;  1LSW A;  2PR6 A; 
#chains in the Genus database with same CATH topology
 5KSH A;  2KX6 A;  3F1O B;  4GZB A;  4R0Q A;  3LIA A;  3ISG A;  4Y3I A;  2XGN A;  2R9W A;  5GLC A;  1Z09 A;  4IED A;  4RQ9 A;  1YAX A;  3BJN A;  3MXQ A;  3L7H A;  4X1L A;  2YKF A;  1NJ4 A;  5AJG A;  1H0M A;  1LSV A;  4S2K A;  4CPK A;  1ZKJ A;  2A24 B;  2E8J A;  4LRX C;  3IH9 A;  3A3D A;  3A0V A;  3IX4 A;  3R7W B;  1VEU B;  4PKY A;  3SS3 A;  3OPR A;  4BEN A;  4OLD A;  4E3K A;  2OOL A;  4Q0I A;  3H82 B;  4QHC A;  4I5S A;  1CF0 A;  1XGJ A;  4X56 A;  1V9Y A;  5EVI D;  2INW A;  1VQQ A;  3IBJ A;  3SW1 A;  1YSQ A;  3ICY A;  3D4F A;  3KSG A;  2W1T B;  2ZL1 B;  4NXE A;  2EX9 A;  3ZDJ A;  3A3J A;  5KMW A;  4OPY A;  4Y5F A;  3N8R A;  4XT2 A;  3HVF A;  4H6J A;  5FA7 A;  2XA7 S;  5HWT A;  5L07 A;  3MZF A;  4P0M A;  5DJU A;  5GLD A;  4EER A;  2DCF A;  4WF0 A;  4G3V A;  2JC7 A;  3G2Z A;  3T4T A;  5DF7 A;  5F1F A;  3A0S A;  3A3I A;  3OC2 A;  5GL9 A;  2V8F A;  1FCN A;  2HDR A;  3UDF A;  2Y55 A;  3FYZ A;  2M7U A;  3C5A A;  5FAS A;  2XH9 A;  5DTK A;  4L9E A;  3C38 A;  1T1A A;  4KG6 A;  4HJ3 A;  2Y2G A;  1W8Q A;  1XXM A;  2PR5 A;  1KE0 A;  4MBH A;  4GS9 A;  3VMA A;  1H8Z A;  1TS0 A;  3OCL A;  1L3L A;  4BD0 A;  2C5W B;  3LIF A;  3IXG A;  3GDI A;  3UE1 A;  5FQK A;  3S7O A;  2ZJ9 A;  4IUK A;  1GA0 A;  1TEM A;  4S2I A;  2ZM0 A;  3T4O A;  5CER A;  3V39 A;  3B3X A;  1BUE A;  1RCJ A;  4R3J A;  3IF6 C;  4BMW A;  4KZ3 A;  4GLQ A;  2CMN A;  4KUK A;  2Q9M A;  1PWC A;  3OZH A;  4DE0 A;  5HAI A;  5FDS A;  3MFD A;  3RTY A;  4MN6 A;  4ZJ3 A;  3F1P A;  1M40 A;  2EX6 A;  2O9B A;  2L1M A;  3M2J A;  2JKR M;  1G6O A;  3CMZ A;  5A91 A;  1W8Y A;  2BTF P;  3S4X A;  3VV4 A;  3QP8 A;  2J9P A;  4OOL A;  2WGW A;  2GX5 A;  1K57 C;  3CPT A;  1MWU A;  3W4O A;  4Q8I A;  1T19 A;  5DKK A;  5DTT A;  2W27 A;  2W3H A;  2P08 A;  2P7J A;  2XF3 A;  4IBR A;  2XFT A;  4FUW A;  4MMN A;  1VM1 A;  1NWZ A;  2H10 A;  2Y2L A;  2RL3 A;  1T1C A;  1BLC A;  3S22 A;  4HEF A;  5F1G A;  1H3Q A;  5KIZ A;  4R23 A;  4K08 A;  5EVI A;  2XRO A;  1LL8 A;  1MKI A;  1YKD A;  2J3T C;  3HLB A;  4ZJ2 A;  4K0X A;  3S7N A;  1G28 A;  4ZTK A;  2VGJ A;  2O99 A;  4IBX A;  5E2F A;  3UB6 A;  1H5X A;  4XT2 B;  4JGR A;  1ERO A;  5FDH A;  4H6J B;  2ZQ9 A;  3O86 A;  4KZ9 A;  1XJ2 A;  2WAE A;  3LIC A;  5HW3 A;  5I94 A;  4FH4 A;  3HLG A;  2EWW A;  3IXH A;  5FSR A;  4EQI A;  2V8C A;  1T1B A;  5GHX A;  4YFM A;  1EWZ A;  2G7U A;  3F1N A;  3IF5 A;  3VP2 A;  5EFW A;  4L0L A;  3RJU A;  3C8C A;  4EBP A;  4OQG A;  1M6K A;  3IWQ A;  1ODV A;  4CLC E;  4Y17 A;  5FQI A;  1DY6 A;  1S6R A;  4L9G A;  4GS9 B;  1V9Z A;  2ZQD A;  3KYZ A;  1HZO A;  4HJ4 A;  1N9N A;  3ZVW A;  2H0Y A;  3CUE C;  3OPP A;  3VFF A;  4S2J A;  3LEQ A;  3QP6 A;  1F2K A;  4XUX A;  3NEC A;  4BD1 A;  4QY5 A;  3ZGA B;  1L0D A;  4UA7 A;  3NCK A;  1S4R A;  3VSK A;  2ZOH A;  2J9O A;  2AVX A;  5JYP A;  4R6L A;  4WZ5 A;  4OQH A;  3WWX A;  1HD8 A;  4E3M A;  4C3Q A;  2H28 A;  1BLS A;  4IHQ A;  2OLU A;  1XA1 A;  1NZO A;  4MN7 A;  1MBL A;  4ZBE A;  4KZB A;  3F1P B;  4YOF A;  1K55 A;  5EEC A;  4JPM A;  4ETX A;  5FEG A;  4U0T A;  2JKG A;  1IYS A;  2D01 A;  2GZA A;  2WGW B;  3CLO A;  2FFF B;  1MY8 A;  2JN7 A;  3FWL A;  4GW9 A;  4E3I A;  3EEH A;  2IWB A;  4JXG A;  4GCZ A;  2FZ0 A;  1UWP X;  1YMX A;  1TDG A;  3PBR A;  4C75 A;  2Y2M A;  2PD8 A;  1A0K A;  4KG2 A;  3HLW A;  4S2L A;  4GHI B;  1VHM A;  3QHY A;  1ZC2 A;  4OON A;  2WKH A;  3JYI A;  2Y2K A;  2A2L A;  1PIO A;  3T1Q B;  3M6B A;  5DKL A;  4HH3 A;  3DW0 A;  3EGD C;  5EVI B;  5KSC A;  2WGV A;  1ZHH B;  3KYQ A;  3ZG0 A;  4DE1 A;  1F98 A;  4ZRR A;  1MWR A;  3CI6 A;  1ONG A;  5U47 A;  4K0W A;  4KG5 A;  1PFL A;  5TFQ A;  1OME A;  2OV5 A;  4ME4 A;  4WMC D;  1H8M A;  2WKR A;  5I5L A;  2J7V A;  4QB8 A;  1YLW A;  2EWV A;  2HP9 A;  1AWI A;  1NRF A;  3EQV A;  4KQO A;  2RCX A;  3S7P A;  4OQ0 A;  2XR0 A;  3SH8 A;  2OSU A;  2OLV A;  5EOE A;  3MBZ A;  1PWG A;  1JVJ A;  2VLG A;  1EI5 A;  3PBT A;  4PM8 A;  3GVB A;  4O7D A;  5CED A;  4B4X A;  4KZ7 A;  2UWX A;  2V0W A;  3F1N B;  5F69 A;  1TVF A;  4GKU A;  1PI5 A;  3LR3 A;  1KVL A;  3PBO A;  3FKV A;  1NZU A;  5IS1 A;  1OT6 A;  2VV6 A;  5EV0 A;  5IHV A;  3LO7 A;  3UO9 A;  4EBL A;  1LT0 A;  2K31 A;  1XA7 A;  4HOI A;  4NEE D;  4GN2 A;  4HBT A;  1OTB A;  3IBR A;  1X0O A;  3N4I A;  1K4F A;  3VOL A;  1TDL A;  4XUZ A;  5FQJ A;  3LY4 A;  1G68 A;  5AQ7 A;  5J3W A;  4FCF A;  2PU2 A;  3HRE A;  4KQR A;  1WYC A;  4N92 A;  1RGY A;  2R9X A;  1K4E A;  4EU0 A;  1JWZ A;  4Y7P A;  2B5R A;  2QPN A;  5EM0 A;  5IU1 A;  2ZMF A;  4LRZ E;  2P04 A;  3O5Y A;  1XJ4 A;  4MCW A;  3MKE A;  3MS6 A;  4JXS A;  4KUO A;  2J80 A;  3N8L A;  2J3T D;  2VZW A;  1U60 A;  2VX8 A;  3DWZ A;  3PBN A;  3E0Y A;  3G35 A;  1KOU A;  4S2N C;  3UB8 A;  3IWO A;  1KGG A;  5CXW A;  4WZ4 A;  4FTX A;  1E4D A;  1KGF A;  3I7J A;  1CI9 A;  3KX0 X;  2Z2M B;  3MZD A;  4HNB A;  4M3K A;  2HGV A;  4OKP A;  1BLH A;  4DJ3 A;  5G18 A;  4KQQ A;  1I2S A;  4DE2 A;  4DXC A;  1K54 C;  3IX8 A;  3CAX A;  2Q0O A;  4X68 A;  1OPX A;  4OP5 A;  3E2K A;  4DMZ A;  3VOZ A;  3N6I A;  1L0E A;  3V3S A;  1JNU A;  4K91 A;  3E4O A;  3C4P A;  4L9F A;  1BYW A;  4ZAM A;  2WK0 A;  3P09 A;  2VK3 A;  5FI2 A;  1UGU A;  3BFE A;  2P9V A;  1UWN X;  3E98 A;  5M19 A;  1S1Y A;  1DP8 A;  2IA2 A;  4LGW A;  1LI9 A;  2FFY A;  2WKI A;  2V1Z A;  4WMC A;  2Y59 A;  1PYY A;  1XGI A;  5AQ9 A;  3K2N A;  2HJ9 C;  1DRM A;  1NLY A;  1C3B A;  1GSW A;  2B95 A;  5HAR A;  2XA7 M;  4PMA A;  2QKP A;  2BLS A;  4UA6 A;  1DJB A;  5EPH A;  1FR1 A;  3AGE A;  2IWD A;  3ZHH A;  1FSW A;  3W4P A;  3WS4 A;  4BBV A;  1I2W A;  3CJM A;  4S2P A;  3UMD A;  5DJT A;  3IF6 A;  4BL2 A;  5L8M A;  2W1R A;  5FAT A;  3UB7 A;  1FOF A;  2B18 A;  2G2W A;  1K6R A;  1SCW A;  3SH9 A;  4BL3 A;  5EOO A;  1YLJ A;  1AXB A;  1W5D A;  1ACF A;  4OPZ A;  2NUT C;  3DTK A;  1CK3 A;  1DJA A;  4WBG A;  3HJI A;  1VET A;  3KSI A;  4O0P A;  2VV7 A;  2EX2 A;  3ITB A;  1T18 A;  3GTC A;  1K57 A;  3TOI A;  3PHY A;  4E3L A;  2VEA A;  2BAS A;  2EFX A;  4R4R A;  4LEN A;  4ZJ1 A;  2PD7 A;  4IVI A;  1DJC A;  4FOF A;  5FI6 A;  2ACG A;  3TG9 A;  3PBQ A;  3O3V A;  1KE3 A;  2VKS A;  1TF1 A;  3C30 A;  1P9R A;  4I3J A;  3FZC A;  5FQM A;  5LBR A;  5FI7 A;  3VP0 A;  2QZ6 A;  3WS5 A;  1TS6 A;  1XJ3 A;  1NRJ A;  4RX3 A;  4F94 A;  1YPR A;  3VP3 A;  2KOI A;  1O7E A;  1PW8 A;  2X02 A;  5HPI A;  2Y2O A;  3M6H A;  3HUN A;  3WS0 A;  1LSX A;  3UE3 A;  3HLD A;  4HP9 A;  3ZG9 B;  4HH2 A;  4O01 A;  4M4X A;  4HJ6 A;  3E2L A;  3EQU A;  1DP9 A;  3NDE A;  3H7W A;  1TS8 A;  5IT5 A;  1OTA A;  1STZ A;  4EEU A;  1FIK A;  4ID4 A;  1K38 A;  3K3D A;  1MXO A;  1L2S A;  3G31 A;  3FPW A;  3LYX A;  4E04 A;  4NKP A;  3IH8 A;  3MQ0 A;  3LID A;  3E4Q A;  3T1X A;  3IWI A;  4G3K A;  2WKE A;  3DTE A;  4WEK A;  5CHM A;  1XFN A;  3ZNT A;  4P87 A;  5EVL A;  3C7V A;  3UE6 A;  1ES5 A;  2JKT M;  5HDS A;  2VGK A;  3L9K A;  5HSQ A;  3G2Y A;  5E2G A;  4B9O A;  4X25 A;  5GHY A;  3BRM A;  1XKZ A;  3CUE A;  1GHP A;  1LL5 A;  5HL1 A;  1SDE A;  1ERM A;  3OLO A;  5HWV A;  2K7S A;  3QP2 A;  4R3B A;  1ESI A;  1VB6 A;  3V5M A;  2ZC7 A;  1EW0 A;  3NJA A;  3M2K A;  4QPR A;  3GRJ A;  3IF6 B;  5CEB A;  2WAD A;  1NYM A;  3ZYT A;  2ZQC A;  5L09 A;  3G6O A;  2O0Y A;  4DDY A;  4WLA A;  1SZV A;  2L4R A;  1FCM A;  3LCE A;  3G34 A;  1NLZ A;  3WS2 A;  4LPZ A;  1VET B;  3NIA A;  3ZG8 B;  4OQI A;  1LSW A;  3VFH A;  5A8B A;  3U4L P;  5TJJ A;  4EBN A;  3UPP A;  5CGS A;  1S4S A;  3BY9 A;  3W4Q A;  2WKP A;  3HCY A;  3UY6 A;  3PYP A;  1BTL A;  4NET A;  2Y2H A;  2PHY A;  4OLG A;  4P6B A;  3UN7 A;  3A3E A;  3CWF A;  1ZG4 A;  2XK1 A;  3RXX A;  2M1C A;  3SS4 A;  4PM7 A;  2JCH A;  1W63 Q;  2V1A A;  4GDN A;  1YSP A;  4DJ2 A;  1S0W A;  4U3T A;  4G3W A;  2PBD P;  4ETZ A;  3FV7 A;  2W0N A;  3T4L A;  4Q0J A;  3CZD A;  2QJ5 A;  2GDN A;  1CQA A;  4HES A;  2Y91 A;  2ZM8 A;  4YNR A;  4R3A A;  3UDX A;  3R4K A;  1OJ5 A;  4BJP A;  3KSH A;  3UME A;  3WS1 A;  3BFC A;  4RX2 A;  1G5U A;  5GLB A;  1IEM A;  4E3J A;  1YM1 A;  2NUP C;  1YLZ A;  4C6Y A;  1CEG A;  5HX9 A;  3UPO A;  3UB5 P;  3ZG7 B;  3A0R A;  1P97 A;  3H7W B;  4WL9 A;  4ZDX A;  5J7E A;  2ZOI A;  2PRF A;  4IVK A;  2GJ3 A;  4FD8 A;  4I3A A;  2OAP 1;  3CPT B;  3NY4 A;  4LV0 A;  3KO6 A;  3SZT A;  1H8Y A;  4GD8 A;  5D3O A;  4WM9 A;  1GCE A;  3TW8 A;  3BEC A;  4CLC C;  4UQI S;  1MKM A;  2ZC5 B;  3PBS A;  1PWD A;  4EUZ A;  4MLL A;  5GHZ A;  4B93 A;  4GD6 A;  4CJN A;  2XLN A;  3Q7V A;  4Y0U A;  3MXR A;  1BZA A;  3QNB A;  4E6W A;  1P0Z A;  2ZM2 A;  2KDK A;  3KYE A;  2I9V A;  4Z1W A;  1XJ6 A;  3ZNY A;  4DXB A;  5DFY A;  4PM9 A;  1OT9 A;  5M1A A;  3IQA A;  5GLA A;  1YT4 A;  1BUL A;  1E3U D;  3GMW A;  2Y2Q A;  1D1J A;  1D7E A;  1ERQ A;  3PAG A;  3MQQ A;  3BLS A;  1GHM A;  2IWC A;  5E2E A;  1L0F A;  3GR2 A;  4E6X A;  3OCN A;  3MFX A;  2X71 A;  5A92 A;  2ZC6 B;  4GNU A;  4KQD A;  1ZG6 A;  1MZU A;  5CGW A;  4PAU A;  5CTN A;  2ZC4 B;  3H82 A;  3DAV A;  4WUJ A;  5FQ9 A;  3WRT A;  1QME A;  4Z9Q A;  2VA0 A;  5J4E A;  5F83 A;  4DRT A;  2V0U A;  2HF6 A;  5AQB A;  2ZQ7 A;  4S2N A;  1K0K A;  4YIN A;  4JLF A;  1N9L A;  4N1H A;  1GSV A;  1JTG A;  1KDS A;  1LL9 A;  2XD5 A;  3LR5 A;  5DFX A;  4OH0 A;  2J8Y A;  4LLO B;  2ZLY A;  5F82 A;  1W7F A;  2Y2P A;  5E43 A;  3MXS A;  4U0X A;  5EVE A;  5FQQ A;  4QY6 A;  2I72 A;  4EUV A;  3K3C A;  4N1X A;  3BFG A;  2Z6D A;  4WEL A;  5HD3 A;  4S2O A;  4QD4 A;  4MEZ A;  3T4S A;  3C7U A;  4Q0H A;  5FAP A;  2HP5 A;  4JBF A;  2HV1 A;  1ALQ A;  3D72 A;  3BFF A;  2Z2L B;  1SDN A;  3P7N A;  4EW7 A;  3A3F A;  1YQS A;  2JKR I;  1KDW A;  3G32 A;  3D3O A;  4PM6 A;  2PU4 A;  3NDG A;  4LV2 A;  3P01 A;  4O8G A;  1HVB A;  2ZMA A;  2PBY A;  3LIE A;  1F9I A;  3VE4 A;  4DDS A;  2O9C A;  3IXD A;  4R70 A;  1TD5 A;  5CTM A;  4MBF A;  2VGL S;  3W8K A;  4GOG A;  1MPL A;  3JVU A;  5BOH A;  4WEJ A;  4MBK A;  4HY8 A;  3FKW A;  5CEC A;  2EXA A;  1WA9 A;  1IYP A;  3T4K A;  5J8X A;  1KVM A;  4R4S A;  1YLP A;  4E3N A;  3ZQ5 A;  3LFV A;  2XD1 A;  5A90 A;  3ZCZ A;  1CEF A;  2QWS A;  2EFU A;  2DRW A;  1XP4 A;  2PDR A;  3Q7V B;  3BW6 A;  2P74 A;  3B47 A;  2WZX A;  2EA9 A;  2Z6C A;  3T1S A;  3FC7 A;  1ES2 A;  3C2W A;  1ESU A;  4HI4 A;  4QU3 A;  2ZMV A;  3B42 A;  3HLC A;  1PW1 A;  1E3U A;  3Q07 A;  4LCL A;  4X1M A;  1NYY A;  2Q9N A;  2HDQ A;  4JF6 A;  4LV3 A;  3NUL A;  5G4Y A;  4BBT A;  4DN0 A;  3LIB A;  3MKF A;  5HAQ A;  1DP6 A;  1IEL A;  5DVA A;  4JKT A;  1ZTU A;  3G4P A;  3MF0 A;  3SH7 A;  3LUQ A;  5HL6 A;  5TBM A;  4UEY A;  2V2F F;  3S7Q A;  4PM5 A;  2VV8 A;  1S66 L;  2E8I A;  2WZZ A;  1Q2P A;  1L0G A;  4EET B;  3NOU C;  3IS2 A;  3ITA A;  2G2U A;  3NC8 A;  3OOV A;  3T1R A;  2PAV P;  1G6A A;  1OTI A;  2WAF A;  1PZO A;  1Q2Q A;  4KZ8 A;  3Q82 A;  5HAP A;  2ZD8 A;  3T4J A;  4EEP A;  2XEP A;  1WYB A;  3E4P A;  2J3W A;  5HZH A;  5AVE A;  1J3W A;  1SKO A;  3V3R A;  5DF9 A;  1MWT A;  5FEF A;  3BM6 A;  4P6Z M;  3NOT C;  5HDD A;  5HWW A;  4R1G A;  2LB9 A;  3H9W A;  4XXR A;  4UHU A;  4GJ4 A;  4QWO A;  3DTM A;  2WKQ A;  3LI8 A;  4LRY C;  4PHT A;  4KZ4 A;  4CLC D;  5K5B A;  4P6Z S;  1IYO A;  3JPU A;  5JYO A;  3CHW P;  3GQZ A;  2CC1 A;  5HD5 A;  5KZH A;  2H0T A;  4S2M A;  1ONH A;  3AGF A;  1PZP A;  3EGX C;  4HIA A;  4UAA A;  3N7W A;  4QJG A;  3TE8 A;  4LCM A;  4UA9 A;  5E2H A;  5DF8 A;  3LR4 A;  3SS5 A;  3BQ8 A;  3VP1 A;  1OTE A;  5FAO A;  5TGF A;  3NBL A;  4JGQ A;  5EM1 A;  4MNR A;  1RGZ A;  1Z6F A;  3HUM A;  3RH8 B;  3OPH A;  5A93 A;  1Y54 A;  3AGD A;  4X6T A;  1CJF A;  4BLM A;  4JGO A;  4GDB A;  2Y2J A;  3DBA A;  1J9M A;  3Q81 A;  1QMF A;  4DF6 A;  1ES4 A;  3QP5 A;  4F3L A;  2WGI A;  3ZVT A;  2PYR A;  3CG5 A;  3G30 A;  3GEC A;  2ZBB A;  3TJZ C;  1YMS A;  4OPQ A;  1LHY A;  2JHE A;  3VOY A;  5FAQ A;  4WN5 A;  5G4Z A;  4JGP A;  3B33 A;  3OBF A;  1JTD A;  1S67 L;  3BYD A;  2P9V B;  1K56 D;  2OAQ 1;  4Y15 A;  4Y2F A;  4OPR A;  2D02 A;  2HDU A;  1TS7 A;  3Q7Z A;  3T12 B;  3Q1F A;  3HLE A;  3N8S A;  3ZG5 A;  1P9W A;  2V1B A;  4D2O A;  5AQA A;  4FH2 A;  4B4Z A;  1N9O A;  1HLU P;  2XSS A;  3IHB A;  3VSL A;  1ES3 A;  5CHU A;  3O87 A;  4GHI A;  1GA9 A;  5TBM B;  2QJ7 A;  4GB7 A;  1LLB A;  3RXW A;  3C4O A;  2UV0 E;  3FG8 A;  2W3G A;  3IS2 B;  3VP4 A;  5EUA A;  2ZC3 B;  4NXB A;  3RFB A;  4PKY G;  2HZ5 A;  3NOP C;  3KSF A;  5AVF A;  5CHJ A;  1PNE A;  1SKO B;  2FH5 A;  3GSG A;  4HBU A;  2V9A A;  2C6W B;  4P85 A;  1BSG A;  3S1Y A;  3HUO A;  4EES A;  1XX2 A;  2MJ6 A;  2XQZ A;  2HJE A;  2WYX A;  3QP4 A;  1FSY A;  4JF4 A;  4N9L A;  4CLC A;  2Y2N A;  2LB5 A;  3MSH A;  2M7V A;  4JF5 A;  2Y4A A;  4HQA A;  4YWZ A;  5F68 A;  1E25 A;  4DKI A;  5M18 A;  4KZ6 A;  2YKH A;  2DMW A;  2HDS A;  5MC7 A;  1YLY A;  4IJG A;  3V50 A;  4A5R A;  5F5Y A;  1OJG A;  2PYP A;  1CI8 A;  3PR6 A;  1Y28 A;  3VE3 A;  2DNS A;  4JXW A;  3HLF A;  5FL3 A;  5CGX A;  2XRN A;  3LI9 A;  1KE4 A;  2QHK A;  4I38 A;  5EVI C;  3SOI A;  1KGE A;  2X01 A;  3BWL A;  3PAE A;  4PPR A;  4ESP A;  1O07 A;  4I3I A;  1HTZ A;  4Y0O A;  2JBF A;  3D9Y A;  1OTD A;  3T4Q A;  2OWH A;  1S1Z A;  4KZA A;  4Y0T A;  3BEB A;  4OP8 A;  4D60 A;  4ARZ A;  4OOY A;  4BBU A;  3DWK A;  2R78 A;  3UE0 A;  2OWJ A;  4UQI M;  5HDC A;  3EWK A;  4NK3 A;  4F3L B;  2HPB A;  2JKF A;  4LV1 A;  3MMH A;  3NHQ A;  3OPL A;  3DTI A;  1Y4O A;  4OVD A;  1PRQ A;  1W63 M;  3NI9 A;  3UB9 A;  3QP1 A;  2ZQA A;  1K56 A;  1IKI A;  4HHD A;  1IOU A;  4IUH A;  5F6A A;  1WE4 A;  1IKG A;  4RYE A;  4MDZ A;  4BWI A;  4EQ1 A;  4WYY A;  2XDM A;  2VJW A;  2WUQ A;  2Y8H A;  3F1O A;  5CX7 A;  3MQO A;  3T50 A;  1N4O A;  4EV4 A;  3U2A A;  2L0W A;  2V20 A;  1D06 A;  1NXY A;  3PTE A;  2K2N A;  3TRC A;  3CIT A;  5HFO A;  1IYQ A;  2A3U A;  1BT5 A;  3BQA A;  3MZE A;  3EEA A;  1XPB A;  4EWF A;  1K6S A;  2A24 A;  4HP4 A;  2A49 A;  4R38 A;  1GSX A;  3IXB A;  1RP5 A;  3ZFZ A;  2Y79 A;  3IT9 A;  4H8R A;  4WZ5 C;  3HL9 A;  3R7W A;  2PT7 A;  1VEU A;  4EXO A;  3V67 A;  2KLI A;  3LR0 A;  3HJK A;  5DTS A;  1LI0 A;  4KEN B;  1K25 A;  4II7 A;  2ZQ8 A;  2EXB A;  1K55 C;  3LY3 A;  3ULF A;  2HP6 A;  2W3F A;  1NY0 A;  4BQM A;  2W1T A;  1JWV A;  4MN5 A;  2ZL1 A;  3MJQ A;  2B02 A;  1JWP A;  4OOM A;  3UNW A;  3PXP A;  4CLC B;  2GNX A;  1FR6 A;  2W3E A;  3BFD A;  3IHA A;  1PI4 A;  4DE3 A;  1K54 A;  1I5Q A;  3HBR A;  3JVV A;  2QMI A;  4I39 A;  4KZ5 A;  3WRZ A;  2QYB A;  1FQG A;  4LFU A;  1N9B A;  4CQH A;  4RA7 A;  3UPN A;  2W3D A;  2EX8 A;  2JE5 A;  3FPV A;  5TR7 A;  1FIL A;  1SHV A;  5EE8 A;  4X55 A;  3MR0 A;  2Y2I A;  3IX3 A;  5CRF A;  3P98 A;  2O9A A;  2VGL M;  1F5M A;  4X69 A;  3W2Z A;  3GV9 A;  3TSG A;  3LEZ A;  3BY8 A;  5C5K A;  1GHI A;  1IFQ A;  4ARZ B;  3BLM A;  3O88 A;  3LGO A;  1SKF A;  1YLT A;  4NXG A;  4B88 A;  1XFQ A;  1FCO A;  5HPF A;  4JXV A;  3EOI A;  4AFI A;  2JKT I;  1BLP A;  4RVA A;  1MWS A;  2H5S A;  3UDI A;  3QNC A;  1MC0 A;  4FSF A;  4Y13 A;  2XFS A;  5L2F A;  4X53 A;  1W79 A;  5L10 A;  4E3O A;  4NG2 A;  2BG1 A;  4N9K A;  4NXF A;  2PR6 A; 
#chains in the Genus database with same CATH homology
 5TJJ A;  5KSH A;  2KX6 A;  3LR4 A;  1S4S A;  3BQ8 A;  1OTE A;  3BY9 A;  3F1O B;  2WKP A;  3HCY A;  4ME4 A;  5I5L A;  1H8M A;  2WKR A;  4JGQ A;  3PYP A;  3LIA A;  2EWV A;  4Y3I A;  2PHY A;  3RH8 B;  3EQV A;  4RQ9 A;  1YAX A;  4JGO A;  4KQO A;  3S7P A;  3CWF A;  3BJN A;  3DBA A;  3MXQ A;  2YKF A;  2M1C A;  5AJG A;  2VLG A;  3PBT A;  1W63 Q;  2V1A A;  1LSV A;  4F3L A;  1YSP A;  4DJ2 A;  2PYR A;  2A24 B;  3GEC A;  4LRX C;  2ZBB A;  3A0V A;  4G3W A;  3TJZ C;  2JHE A;  3R7W B;  4ETZ A;  2W0N A;  3T4L A;  4Q0J A;  2V0W A;  4PKY A;  3F1N B;  2QJ5 A;  4WN5 A;  5F69 A;  5G4Z A;  3LR3 A;  3PBO A;  2OOL A;  4Q0I A;  4JGP A;  3H82 B;  4YNR A;  4R3A A;  3B33 A;  3OBF A;  3R4K A;  5IS1 A;  1S67 L;  1OJ5 A;  4BJP A;  4I5S A;  3KSH A;  3UME A;  1OT6 A;  2VV6 A;  2OAQ 1;  1V9Y A;  2INW A;  4Y2F A;  3IBJ A;  3SW1 A;  1YSQ A;  2D02 A;  3ICY A;  1TS7 A;  1LT0 A;  2NUP C;  2K31 A;  3KSG A;  2W1T B;  1P9W A;  2V1B A;  4NXE A;  4HOI A;  4NEE D;  3A0R A;  1P97 A;  3H7W B;  4WL9 A;  4Y5F A;  5J7E A;  2ZOI A;  4XT2 A;  1OTB A;  3IBR A;  1X0O A;  1N9O A;  2GJ3 A;  4H6J A;  3VOL A;  2XSS A;  4I3A A;  2XA7 S;  2OAP 1;  3KO6 A;  5HWT A;  5J3W A;  4GHI A;  5TBM B;  3TW8 A;  2QJ7 A;  5DJU A;  4EU0 A;  4CLC C;  4EER A;  4UQI S;  1MKM A;  3PBS A;  4WF0 A;  3FG8 A;  2W3G A;  3IS2 B;  5IU1 A;  4G3V A;  2ZMF A;  4LRZ E;  2P04 A;  3O5Y A;  4NXB A;  1XJ4 A;  3T4T A;  4MCW A;  4B93 A;  3RFB A;  4PKY G;  3A0S A;  3OC2 A;  4KUO A;  2J80 A;  2J3T D;  2VZW A;  1P0Z A;  3NOP C;  3KSF A;  2VX8 A;  2KDK A;  2M7U A;  5AVF A;  3PBN A;  3E0Y A;  2I9V A;  4Z1W A;  1KOU A;  3UB8 A;  1XJ6 A;  4L9E A;  3C38 A;  1T1A A;  5DFY A;  2FH5 A;  4HJ3 A;  1OT9 A;  2V9A A;  2PR5 A;  3KX0 X;  4GS9 A;  4HNB A;  2HGV A;  1TS0 A;  4DJ3 A;  1D7E A;  3OCL A;  2MJ6 A;  4EES A;  2HJE A;  3MQQ A;  3LIF A;  3GDI A;  4CLC A;  2LB5 A;  3CAX A;  3S7O A;  4IUK A;  2M7V A;  3OCN A;  3MFX A;  1OPX A;  3T4O A;  4KQD A;  4HQA A;  4YWZ A;  4DMZ A;  5F68 A;  1MZU A;  1JNU A;  2YKH A;  2DMW A;  5MC7 A;  3E4O A;  4L9F A;  1BYW A;  4IJG A;  4PAU A;  4BMW A;  4GLQ A;  5F5Y A;  2CMN A;  4KUK A;  1OJG A;  2PYP A;  3H82 A;  4WUJ A;  1UGU A;  2VA0 A;  5J4E A;  3PR6 A;  1UWN X;  2V0U A;  2HF6 A;  3E98 A;  1Y28 A;  3VE3 A;  1S1Y A;  1DP8 A;  3RTY A;  5FL3 A;  4MN6 A;  3F1P A;  2XRN A;  3LI9 A;  2IA2 A;  2O9B A;  1N9L A;  2L1M A;  1GSV A;  2QHK A;  4I38 A;  2JKR M;  1G6O A;  3LR5 A;  5DFX A;  3VV4 A;  3K2N A;  2HJ9 C;  1DRM A;  1NLY A;  4LLO B;  3BWL A;  1GSW A;  4OOL A;  4I3I A;  2GX5 A;  2XA7 M;  2QKP A;  1OTD A;  1T19 A;  5DKK A;  2OWH A;  1S1Z A;  3T4Q A;  4EUV A;  2W27 A;  3K3C A;  2W3H A;  2P08 A;  4ARZ A;  2P7J A;  4BBU A;  2Z6D A;  4WEL A;  5HD3 A;  2R78 A;  3T4S A;  2OWJ A;  4UQI M;  5HDC A;  4BBV A;  3EWK A;  4Q0H A;  3UMD A;  5DJT A;  5L8M A;  4F3L B;  4MMN A;  1NWZ A;  2HV1 A;  2W1R A;  3D72 A;  1T1C A;  3UB7 A;  2B18 A;  3MMH A;  3NHQ A;  3P7N A;  4EW7 A;  2JKR I;  1H3Q A;  1W63 M;  2NUT C;  3UB9 A;  5KIZ A;  3D3O A;  4K08 A;  4HHD A;  2XRO A;  1IOU A;  1LL8 A;  2J3T C;  1YKD A;  3HJI A;  4IUH A;  5F6A A;  3KSI A;  4O0P A;  2VV7 A;  4MDZ A;  3S7N A;  4BWI A;  1G28 A;  3P01 A;  4EQ1 A;  4O8G A;  1T18 A;  3LIE A;  1F9I A;  2O99 A;  3VE4 A;  2VJW A;  3PHY A;  2O9C A;  2Y8H A;  4R70 A;  1TD5 A;  2BAS A;  2VEA A;  2VGL S;  3F1O A;  3UB6 A;  4XT2 B;  3JVU A;  4JGR A;  2PD7 A;  5CX7 A;  4H6J B;  4WEJ A;  3MQO A;  4FOF A;  3PBQ A;  1XJ2 A;  4HY8 A;  3T50 A;  3LIC A;  3U2A A;  2L0W A;  1D06 A;  1WA9 A;  2K2N A;  2VKS A;  1TF1 A;  3TRC A;  3T4K A;  3CIT A;  2EWW A;  3C30 A;  3BQA A;  3ZQ5 A;  1P9R A;  3LFV A;  4I3J A;  3EEA A;  5LBR A;  2A24 A;  4HP4 A;  2QWS A;  4R38 A;  1GSX A;  1T1B A;  1TS6 A;  1XJ3 A;  2Y79 A;  1NRJ A;  2PDR A;  3R7W A;  3BW6 A;  2PT7 A;  4EXO A;  3V67 A;  2G7U A;  2KLI A;  3LR0 A;  3F1N A;  3B47 A;  3HJK A;  2EA9 A;  2Z6C A;  2KOI A;  4L0L A;  3C8C A;  5EFW A;  3FC7 A;  5HPI A;  3C2W A;  4II7 A;  1ODV A;  4HI4 A;  1LSX A;  2ZMV A;  3B42 A;  4CLC E;  3UE3 A;  4HP9 A;  4HH2 A;  3ULF A;  4L9G A;  4GS9 B;  2W3F A;  4O01 A;  1V9Z A;  3KYZ A;  4M4X A;  4HJ6 A;  4HJ4 A;  1N9N A;  2W1T A;  3EQU A;  4MN5 A;  3CUE C;  1DP9 A;  3MJQ A;  2B02 A;  3H7W A;  4OOM A;  5G4Y A;  1TS8 A;  4BBT A;  5IT5 A;  4DN0 A;  3LIB A;  1OTA A;  1STZ A;  4EEU A;  3PXP A;  1DP6 A;  4CLC B;  1ZTU A;  2GNX A;  2W3E A;  3MF0 A;  3K3D A;  3LUQ A;  5HL6 A;  5TBM A;  1S4R A;  3FPW A;  3JVV A;  4UEY A;  3LYX A;  3S7Q A;  4I39 A;  4E04 A;  2ZOH A;  4NKP A;  2VV8 A;  1S66 L;  3MQ0 A;  3LID A;  3E4Q A;  4R6L A;  2QYB A;  4EET B;  4G3K A;  3NOU C;  2H28 A;  3IS2 A;  4IHQ A;  3OOV A;  4WEK A;  4CQH A;  2W3D A;  1OTI A;  1XFN A;  4MN7 A;  3UE6 A;  2JKT M;  5HDS A;  3FPV A;  5HSQ A;  3F1P B;  4YOF A;  4B9O A;  3MR0 A;  3T4J A;  4EEP A;  4ETX A;  2O9A A;  2VGL M;  1F5M A;  3E4P A;  2J3W A;  5HZH A;  2D01 A;  5AVE A;  3W2Z A;  3CUE A;  2GZA A;  3CLO A;  3BY8 A;  5DF9 A;  3OLO A;  5HWV A;  2K7S A;  2JN7 A;  5C5K A;  4GW9 A;  4P6Z M;  3EEH A;  1VB6 A;  1IFQ A;  3NOT C;  5HDD A;  4ARZ B;  5HWW A;  4GCZ A;  2FZ0 A;  1UWP X;  1EW0 A;  2LB9 A;  3NJA A;  4NXG A;  1XFQ A;  3H9W A;  4QPR A;  5A8B A;  3PBR A;  4GJ4 A;  2WKQ A;  3LI8 A;  3ZYT A;  4LRY C;  5HPF A;  4PHT A;  4CLC D;  3EOI A;  4AFI A;  2PD8 A;  3G6O A;  2O0Y A;  2JKT I;  4GHI B;  5K5B A;  1VHM A;  4WLA A;  4P6Z S;  2L4R A;  1NLZ A;  2A2L A;  5HD5 A;  1MC0 A;  4FSF A;  4LPZ A;  5DKL A;  4HH3 A;  3EGD C;  3EGX C;  4HIA A;  1ZHH B;  3KYQ A;  1F98 A;  4ZRR A;  4NXF A;  3TE8 A;  1LSW A;  2PR6 A;  3CI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...