3F1PB

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
VCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 30
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1pB01
2V9AA 3HJKA 1V9YA 5HDCA 5J4EA 1DP9A 2W0NA 1S1ZA 3PYPA 4EERA 2J80A 1LT0A 4KQDA 3F1PB 2K7SA 3LUQA 1OTEA 1OTIA 4YWZA 1ODVA 2OWJA 5HWVA 2OWHA 1LL8A 3P7NA 4HH2A 3CWFA 1UWNX 2V0WA 2PD8A 3G6OA 2YKFA 2KX6A 1EW0A 3VE4A 3H7WB 2INWA 3RTYA 3IS2B 3NOUC 2V1AA 4I3AA 2YKHA 3MFXA 3LIAA 3MJQA 4HP4A 5DKLA 3F1PA 3F1OB 4PKYA 1OTBA 4NXFA 2L0WA 3VE3A 3BY9A 4XT2A 5DJTA 3K3CA 3LIFA 5G4ZA 1S4SA 4I5SA 4HI4A 4HOIA 1N9LA 1XFQA 5HWWA 3IS2A 4EETB 4HJ6A 3CLOA 3PHYA 4HY8A 3HJIA 3LIEA 4WN5A 3H82B 2ZOIA 1UWPX 1Y28A 1TS7A 1S4RA 1OJGA 1X0OA 3F1OA 2V1BA 2B02A 4I3IA 2ZOHA 1F9IA 4JGRA 3UE6A 4F3LB 2PD7A 1V9ZA 5HSQA 2GJ3A 5HD5A 1P0ZA 3F1NB 1T18A 5DJUA 1T1BA 3UB7A 2JN7A 4JGOA 4M4XA 1GSWA 3VOLA 3RH8B 4JGQA 3UB8A 4BBUA 3EWKA 1GSXA 3NOTC 5KIZA 3UMEA 3IBRA 1N9NA 3D72A 1BYWA 4R3AA 4L9FA 2VLGA 4K08A 4GCZA 5AVFA 2QJ5A 2VV8A 2ZBBA 4I38A 3FC7A 1UGUA 5A8BA 3F1NA 4EW7A 1DP8A 1WA9A 5F6AA 2PR5A 1TS0A 4LRXC 3B33A 4HJ3A 4NXGA 1KOUA 4GS9B 4H6JB 4HQAA 4WL9A 4R70A 2QHKA 4BBTA 1XFNA 4I39A 2W27A 5F5YA 2PYPA 2EA9A 1GSVA 3C8CA 1TS6A 3LIDA 1T19A 3E4QA 1LSXA 4RQ9A 3BY8A 3NHQA 4HH3A 2M1CA 3BWLA 4KUKA 5J7EA 3UB9A 3H7WA 2R78A 4GS9A 4H6JA 2A24B 4HIAA 1XJ6A 3A0RA 4EEUA 4L9GA 5DKKA 3LI9A 2VV6A 4HHDA 4NXEA 4R6LA 3E4OA 1P97A 4WLAA 5F68A 4KUOA 1T1CA 5HDSA 1F98A 4LRZE 4JGPA 4HP9A 2WKRA 2CMNA 2Z6CA 4EQ1A 1G28A 1DRMA 2WKQA 2QKPA 2OOLA 4WF0A 1S1YA 1XJ2A 3ULFA 4HJ4A 2QWSA 3UB6A 3H82A 5IS1A 5HWTA 3KX0X 2V0UA 3H9WA 3MXQA 1S67L 2PDRA 1LSVA 3MQQA 5HZHA 2PR6A 5TBMB 4BBVA 4GW9A 1XJ4A 3OLOA 3GDIA 4F3LA 1DP6A 1XJ3A 3GECA 4GHIB 4EXOA 4L9EA 2WKPA 1D06A 3MR0A 4LRYC 3LI8A 4HNBA 4E04A 3LIBA 1OJ5A 4EESA 1N9OA 1S66L 4XT2B 1LSWA 2HV1A 3K3DA 4MN5A 3UMDA 5G4YA 3A0VA 3A0SA 5TBMA 5I5LA 1NWZA 2L4RA 1D7EA 1T1AA 4LLOB 3ZQ5A 4GHIA 2D01A 3CAXA 4I3JA 4MN6A 4LPZA 5J3WA 2KDKA 4R38A 1JNUA 2H28A 2P7JA 2L1MA 3NOPC 2Z6DA 2BASA 4B9OA 1OT6A 3LICA 3ICYA 5F69A 4DJ2A 4PKYG 4DJ3A 3E4PA 3C2WA 5EFWA 3EEHA 4EEPA 2QJ7A 3NJAA 3LYXA 3MQOA 5IU1A 2A24A 4WUJA 1OTDA 1VB6A 5HD3A 1OTAA 3T50A 3FG8A 4NXBA 1TS8A 2JHEA 5AVEA 2PHYA 2PYRA 2VV7A 1OT9A 1MZUA 2D02A 3SW1A 2I9VA 2VEAA 5HDDA
chains in the Genus database with same CATH superfamily
2V9AA 4QY6A 1V9YA 3OCNA 5E2GA 1L0EA 5HDCA 1DP9A 5AQAA 3PYPA 1MY8A 3F1PB 4IEDA 1YAXA 5EOOA 2XRNA 1EROA 2Y2MA 2H10A 1VETB 4JF4A 5BOHA 3T4KA 4MBKA 4DE1A 1SDEA 1ODVA 1IFQA 2OWJA 1MWTA 4S2KA 2EXAA 4R3JA 4HH2A 2DRWA 4ETZA 2PD8A 4QY5A 3C5AA 2ZMVA 3ZYTA 4DF6A 4P87A 5AJGA 1L3LA 3IXGA 4BQMA 5DTSA 3D9YA 4RX2A 4OVDA 4R23A 2JC7A 3BLSA 3DTKA 3BEBA 4X55A 3R7WB 5GHYA 4Y2FA 4PKYA 4E3MA 1OTBA 4X56A 2QPNA 4Y0OA 2L0WA 3VE3A 4BWIA 5FQKA 5EV0A 4XT2A 2J8YA 5FA7A 4O8GA 3W4QA 4S2PA 3O3VA 4S2NA 1N9BA 1S4SA 3Q7VB 5G18A 4P0MA 5KSHA 4S2JA 1JWPA 5KMWA 2OAP1 4NETA 4K91A 5MC7A 1XFQA 4EETB 1AWIA 4HJ6A 1E3UA 2XDMA 4MN7A 3H82B 5DFYA 5CTMA 2ZOIA 3QNBA 1FQGA 3VMAA 1S4RA 3C7UA 3IWIA 1OJGA 3P01A 4JXSA 1X0OA 4P6ZS 4NEED 2WGWB 2WK0A 1F9IA 2VJWA 3N7WA 3UE6A 2ZC6B 3OOVA 2PD7A 5CERA 5HSQA 1W79A 3E2KA 2GJ3A 1F2KA 3QP1A 1TDLA 1T18A 4ZBEA 2X01A 3GTCA 2WGIA 3UB7A 4JGOA 1RGYA 2JN7A 3CPTB 1GSWA 2WGVA 3ITBA 5FI2A 3RXXA 1W7FA 4XUXA 1K54C 2QYBA 4HEFA 4BBUA 4DE3A 3IF6C 4DXBA 2XH9A 1HZOA 3VP3A 4DKIA 4KZ8A 4EWFA 3DAVA 2ZL1B 1HTZA 1MXOA 4HBTA 2QJ5A 3U4LP 2VV8A 4KZ5A 3A3DA 1PWGA 3DTIA 4EW7A 1KE0A 4UA9A 5DFXA 1OPXA 5L2FA 1N4OA 5F1FA 1FCOA 1LL5A 1IEMA 3OPLA 3HLGA 2VX8A 5FAQA 4NXGA 5FI7A 3M2JA 4WEKA 2MJ6A 4H6JB 4HQAA 5L8MA 3KSIA 3V3SA 3DTEA 2HDSA 2WUQA 3T1XA 2QHKA 1XFNA 4OQHA 4I39A 3N8SA 3CZDA 1DJAA 1YPRA 1HD8A 3LIDA 1M40A 4KENB 4RQ9A 1XX2A 2ZQ8A 1XA7A 4WMCD 2XA7S 3OBFA 2KLIA 2R78A 3PBRA 3U2AA 4BLMA 4GS9A 4LV3A 4WM9A 2ZM8A 2M7VA 4HIAA 4CLCB 3PBNA 4N1HA 1K56D 5DKKA 3LI9A 1K4FA 3BRMA 5HL6A 4UAAA 4HHDA 4NXEA 3HUOA 4R6LA 1PW8A 1SKOB 4WLAA 5F68A 1I2SA 3LR3A 1PNEA 4P6ZM 3T1QB 4JGPA 2WKRA 2CMNA 2Z6CA 1NYYA 2OOLA 1FILA 3V5MA 3ULFA 3WS1A 1XP4A 3C4OA 5GHXA 2O9BA 4OQ0A 3ZHHA 3VV4A 2XFTA 5IS1A 3KYQA 3H9WA 2PDRA 1I2WA 2PR6A 1YSPA 4PM6A 1YM1A 4KZ6A 5E2HA 4F3LA 3LGOA 2BLSA 2PAVP 5FDSA 3HLEA 3GECA 4GHIB 4LV0A 3SS3A 1BLHA 3N4IA 1Q2QA 5F82A 1D06A 3D4FA 3WS2A 3JYIA 1MWUA 3LI8A 2HJEA 3LIBA 4EESA 1N9OA 3DWKA 4XT2B 4UQIM 5CGSA 3K3DA 1K54A 3LCEA 3A0VA 2OLUA 2Y55A 4RVAA 1NWZA 1JTGA 4N9KA 1HLUP 3NDGA 4BMWA 1D7EA 1KGFA 1CK3A 1ZG4A 3E2LA 2P9VA 4IUHA 3ZQ5A 4KZ4A 2D01A 4QD4A 4I3JA 4MN6A 2E8JA 4LPZA 4PM7A 1LI9A 4CLCE 2Q9MA 1JTDA 5M18A 4R38A 4QU3A 3SZTA 2H28A 2O9AA 2P7JA 3ZVTA 1WE4A 1I5QA 4GDNA 4WMCA 2XA7M 5FASA 1KGEA 1YKDA 4BENA 1H3QA 4D60A 1OT6A 1BSGA 5EPHA 3MS6A 1KE3A 2BG1A 1K56A 1VHMA 4PKYG 4ZJ3A 2HDRA 3E4PA 3C2WA 5GLAA 5EFWA 2WAEA 2E8IA 2Y91A 4EEPA 3PBQA 3PR6A 2PBYA 3TOIA 1IYOA 3QP2A 3MQOA 5IHVA 2A24A 3HREA 4GOGA 5HD3A 3CMZA 1CJFA 2A2LA 4XUZA 4A5RA 3MSHA 1TS8A 5LBRA 2ZMAA 2K31A 2Y2OA 3K2NA 2PYRA 1MZUA 2ZQDA 3BLMA 4KG5A 3KSGA 2HF6A 5EECA 2DCFA 2FH5A 3V39A 2VEAA 3S7QA 1CQAA 4EBLA 1ALQA 5EVIC 3NBLA 5J4EA 1O07A 3HLCA 1ESIA 2JKRI 1RCJA 1S1ZA 1LT0A 3WRZA 1XGJA 5K5BA 4MBHA 4KZBA 3FPWA 3M6BA 2W1RA 2HP9A 1YSQA 5HWVA 1ONGA 1NXYA 3G6OA 2YKFA 2KX6A 1EW0A 4R4SA 3VE4A 3OZHA 1IKIA 1DJCA 1IYQA 3NOUC 4EUVA 4BL3A 4DMZA 2JE5A 2V1AA 3MFXA 4E3JA 4JXWA 5A91A 3C30A 2GDNA 3F1OB 3NULA 1G5UA 4Y0UA 3LR5A 5DJTA 5G4ZA 3WS0A 4ZTKA 1W8YA 4Q0IA 4IVKA 4MNRA 1JWZA 4U3TA 2P08A 5HWWA 1YLZA 1U60A 2Q0OA 3IS2A 2V20A 3CLOA 4Q0JA 3AGFA 3LO7A 3L9KA 5DVAA 4DRTA 3IXDA 3W4PA 1TS7A 3GMWA 4C3QA 4GN2A 1WYCA 4DE2A 1FCNA 4GDBA 3VFHA 3CITA 4Z1WA 1W8QA 2ZOHA 5CTNA 4F3LB 1RP5A 3JPUA 1PYYA 5GLBA 1XGIA 3ZG8B 3B3XA 4GD8A 2V1ZA 5HD5A 1P0ZA 4N1XA 4N9LA 5DJUA 5EE8A 1O7EA 2ZC7A 3R4KA 4KQQA 3VOLA 1VEUA 1KE4A 4LENA 1ES5A 3B42A 5E43A 3NI9A 1NLYA 1K0KA 3IH8A 2VKSA 1W5DA 5FQ9A 4R3AA 4NG2A 3Q1FA 5A92A 4GCZA 1IOUA 2P9VB 4P6BA 2V2FF 4PM5A 1VQQA 2XEPA 3F1NA 1F5MA 4HBUA 4B4ZA 3DTMA 5F6AA 2PR5A 4LRXC 4FCFA 4GLQA 4HJ3A 5CECA 4ZRRA 3RJUA 4EBNA 4WL9A 4R70A 5A90A 4FH4A 4BBTA 2OV5A 2W27A 5F5YA 3A3EA 1GCEA 4ID4A 1TS6A 1T19A 3G32A 2QZ6A 3MQ0A 3DWZA 2ZD8A 3E4QA 1GHPA 3DW0A 3MZFA 5DTTA 1AXBA 2VK3A 3IWQA 4R3BA 5DTKA 3BWLA 5GL9A 2W3FA 3ZDJA 3H7WA 5FEFA 4BJPA 3RXWA 3G4PA 2A24B 3S1YA 4G3KA 2ZC4B 1TDGA 1XJ6A 4Y17A 4IHQA 1FCMA 5CRFA 3MXSA 4MMNA 2P74A 2VV6A 3SH7A 3S7OA 1GA9A 3HLFA 4JLFA 1OMEA 2AVXA 5HDSA 3HBRA 2P04A 3EQUA 4M3KA 5FQMA 3V67A 5M19A 4OH0A 1L0GA 3SS5A 4KQRA 4EQ1A 4ESPA 4QJGA 1DRMA 2WKQA 3MKEA 2J3TC 4WF0A 1ZTUA 1S1YA 4E6XA 1XJ2A 5AQ7A 4Y3IA 4GKUA 2V8CA 2UV0E 2W3GA 3GRJA 2H5SA 2QWSA 3QP4A 2ZJ9A 5FQJA 5FSRA 3ZG5A 3WS5A 3KX0X 4OOMA 4ETXA 4OKPA 3GSGA 1S67L 1LSVA 1FOFA 5TBMB 2HPBA 4II7A 4GW9A 4BBVA 5CEDA 1XJ4A 1YT4A 1ZG6A 2C6WB 4Y0TA 4K0WA 2Y2HA 2WKPA 3T12B 1RGZA 4LRYC 4UQIS 5DF8A 1XPBA 4OOLA 2J7VA 1OJ5A 3BFDA 2JKTM 1S66L 5TGFA 2HV1A 2ZM0A 4BL2A 3V50A 5CGXA 3T4OA 2W1TB 4PMAA 1K57C 2O9CA 1SKFA 2WKHA 2VGLS 4Y7PA 1E4DA 3PBSA 4KZAA 4AFIA 2ZQCA 3UE1A 3GVBA 4FUWA 4X25A 3A3JA 4IVIA 1A0KA 3NECA 1YMSA 2WKEA 3CAXA 1G6OA 1SZVA 1CI8A 3UN7A 1TD5A 1GHIA 3MKFA 3IXHA 4UA6A 4GNUA 4LCLA 3W2ZA 2O99A 2WZZA 2HDQA 1PI4A 2PBDP 3T4JA 3HCYA 4E3LA 1QMFA 3IHAA 3LICA 1YMXA 3ICYA 4DDYA 4JBFA 3A3IA 1NRFA 1H8YA 1K6SA 5F69A 3BFCA 3VP1A 1VEUB 4DJ3A 2JKFA 3PBTA 4NKPA 3FPVA 3I7JA 2QJ7A 2ZC3B 4E3OA 1K55C 1XXMA 3LYXA 2VGKA 4Y15A 3EQVA 1VB6A 4Q8IA 2JKGA 3UNWA 1PRQA 2LB9A 1OTAA 4D2OA 4O7DA 3UO9A 3FG8A 4U0XA 5CX7A 4NXBA 2Y2GA 3C38A 1H8MA 5AVEA 1EWZA 2ZQAA 2VV7A 1OT9A 2XF3A 3SW1A 2I9VA 5TJJA 2PU4A 3PAEA 2IA2A 3HJKA 1H5XA 4ARZA 2QMIA 2IWCA 2W0NA 3AGDA 4WYYA 4KQDA 1YQSA 3EGXC 1MBLA 2GX5A 4E3KA 1OTIA 4YWZA 5FEGA 4YOFA 5E2FA 4JKTA 4LGWA 5FI6A 2ZLYA 2GZAA 3IF6A 1BUEA 3IHBA 3HLBA 3PXPA 3H7WB 2G2WA 2INWA 2VGLM 4EBPA 4XXRA 4IJGA 3QP6A 1PI5A 5IT5A 2Z2MB 3G31A 3LIAA 4BD0A 3MJQA 4HP4A 3T1SA 4CJNA 3F1PA 4GZBA 1VETA 5EVEA 3G2ZA 3BY9A 3CJMA 3K3CA 1IYSA 4L0LA 3W4OA 2EX2A 3LIFA 4LFUA 5FAOA 4N92A 4C6YA 5EVLA 4CLCC 3VFFA 5HL1A 4O0PA 4OPYA 4HY8A 5HFOA 3HJIA 2HP5A 3O5YA 4YFMA 3BFGA 4U0TA 1UWPX 1Y28A 2O0YA 1KVLA 3G30A 3R7WA 4YINA 3N6IA 1WYBA 3GR2A 2B02A 5CGWA 4WBGA 3QP8A 4DXCA 4I3IA 1XKZA 3TJZC 3MF0A 1FSYA 1ES4A 3MMHA 3Q7VA 4MEZA 1J3WA 3A3FA 1KDSA 3G35A 1T1BA 4M4XA 4YNRA 2DNSA 1YLPA 3RH8B 5CXWA 2W3DA 3PBOA 3EWKA 1ACFA 1NYMA 4MLLA 3IBRA 3HLWA 3IX4A 1P9WA 3TE8A 3D72A 3BQ8A 5FL3A 1BYWA 3DBAA 3WRTA 3EGDC 4OQGA 4E3IA 4L9FA 4PAUA 4UHUA 2R9XA 4K08A 3VP2A 4F94A 1PWDA 5CHMA 1TF1A 1SHVA 2ZBBA 4I38A 2XD1A 3FC7A 1UGUA 3VSLA 1CF0A 5FQIA 3CPTA 3OCLA 5EUAA 1KOUA 1PZPA 4GS9B 2Y2NA 5EVID 5L09A 4GJ4A 3NIAA 3ISGA 1NZOA 2FFFB 2JCHA 3O88A 3ZG9B 1IYPA 2PYPA 3LR0A 1GSVA 3C8CA 1E25A 2DMWA 5TR7A 2ZL1A 4FH2A 2M7UA 2X02A 2EWVA 3OPHA 3GQZA 3T4LA 2W3EA 2C5WB 1ERMA 4QWOA 3BECA 1FIKA 1Z6FA 1CI9A 3Q7ZA 1FSWA 4HH3A 3ZGAB 3TW8A 2M1CA 5J7EA 2CC1A 3UB9A 4OQIA 4GB7A 4H6JA 3CUEC 1K6RA 3A0RA 4EEUA 4IBRA 4S2IA 2UWXA 1ZHHB 4UA7A 3N8RA 2XFSA 2B18A 1MWRA 5FAPA 2FZ0A 3E4OA 5CHUA 1P97A 1NZUA 4KUOA 1DY6A 1T1CA 2HZ5A 4IBXA 1CEFA 1IELA 4OPRA 4LRZE 2W3HA 3UDIA 3S4XA 3LEZA 3SOIA 2EXBA 1G28A 4JXGA 3M6HA 2QKPA 3GV9A 3WS4A 1LI0A 3UPPA 1P9RA 2Z2LB 4HJ4A 2FFYA 3OPRA 3BM6A 3NC8A 3PTEA 3MZDA 3FV7A 1ZC2A 1K4EA 3CG5A 1G6AA 3S22A 5HWTA 3W8KA 5HX9A 2HDUA 1TVFA 2V0UA 4HESA 2NUPC 3LEQA 3MXQA 5D3OA 4RYEA 1SKOA 2PT7A 1W63Q 2JKTI 1C3BA 3HLDA 5HARA 2Y79A 5HPIA 1PWCA 3GDIA 1DP6A 1IKGA 4RX3A 1W63M 4B4XA 3LFVA 3HVFA 3QNCA 5AQBA 3TSGA 4PPRA 3MR0A 4HNBA 4E04A 3MXRA 1YLYA 2G2UA 3AGEA 3C4PA 2WKIA 1LSWA 3UMDA 5G4YA 5EVIA 3A0SA 2KOIA 2XSSA 2XROA 4CPKA 5KSCA 5AQ9A 2ZQ7A 4EUZA 3B47A 1Y4OA 2JKRM 1T1AA 2OLVA 4GHIA 4QB8A 5J3WA 4LV2A 4X69A 3KO6A 1STZA 1BLPA 1D1JA 5GLDA 3P98A 4FTXA 1JNUA 3BFEA 4KZ3A 2L1MA 1GHMA 4PHTA 3NOPC 3VOZA 2V8FA 2BASA 4B9OA 3VOYA 1KDWA 2K2NA 4RA7A 2Y2IA 2Y2QA 1QMEA 5KZHA 5U47A 4DJ2A 4MBFA 1Q2PA 2XLNA 3E0YA 2B95A 4OLDA 4GD6A 5GLCA 2EX6A 2RL3A 2HJ9C 3QHYA 1BULA 2ZM2A 5I94A 2ZQ9A 3HL9A 5IU1A 4WUJA 1CEGA 3FZCA 3LR4A 2VA0A 4C75A 1JWVA 1S0WA 4DE0A 3T50A 4CQHA 4H8RA 1ESUA 2EX8A 3CUEA 4OONA 2JHEA 2PHYA 4OPZA 3T4SA 2IWDA 1LLBA 3ZFZA 2Q9NA 2Y8HA 1NJ4A 3VP4A 4QPRA 3VSKA 4LCMA 2J3TD 4KG6A 4EERA 2J80A 4DN0A 3D3OA 2K7SA 3UPOA 3LUQA 1OTEA 3EEAA 1J9MA 4WEJA 3Q07A 4EQIA 4S2LA 4E3NA 3IX3A 3IH9A 2Y2PA 1PIOA 2OWHA 1LL8A 3P7NA 1SCWA 4P85A 3CWFA 1NRJA 1UWNX 2V0WA 1YLTA 4UEYA 2XQZA 3RTYA 3IS2B 5HPFA 2A49A 2WZXA 4OP8A 3ZCZA 4I3AA 2YKHA 4KG2A 4PM9A 3JVUA 3FWLA 5DKLA 3BYDA 1M6KA 3KYEA 1PZOA 3CHWP 4NXFA 1PFLA 2A3UA 3HUMA 3V3RA 4WZ4A 4S2MA 3Q82A 4Y5FA 3UB5P 5L07A 3T1RA 4R4RA 2HGVA 4ZJ1A 3FKVA 4LV1A 3OPPA 4I5SA 4HI4A 4HOIA 2NUTC 3MBZA 1N9LA 4OP5A 2JBFA 2Y2JA 3TRCA 1GA0A 5C5KA 4O01A 3PHYA 5DF9A 3LIEA 4WN5A 2H0TA 1G68A 2XGNA 3NCKA 3ZVWA 3F1OA 2V1BA 5CHJA 5HAIA 2I72A 4JGRA 3N8LA 3VP0A 1K38A 4EU0A 3ITAA 1V9ZA 3UE3A 2J3WA 2HP6A 1NY0A 3IBJA 3F1NB 4R1GA 3JVVA 3E98A 4FD8A 4MCWA 3LY3A 3IXBA 4WZ5C 4JGQA 3UB8A 1L0DA 4Q0HA 1GSXA 4NK3A 4PM8A 3IQAA 3NOTC 3O87A 5JYPA 5KIZA 3UMEA 4ZJ2A 2VGJA 1N9NA 3FYZA 5EVIB 5F1GA 5DF7A 3FKWA 3ZG0A 2ZC5B 3Q81A 3SH9A 4JXVA 2VLGA 4X53A 5AVFA 2IWBA 3UPNA 1K25A 2OSUA 5A8BA 1DP8A 3KSFA 1WA9A 2R9WA 1TS0A 4BD1A 3HUNA 3B33A 1DJBA 2B5RA 2J9PA 1S6RA 2Y2KA 1H0MA 5E2EA 4X1MA 5J8XA 1PW1A 2EA9A 2LB5A 3IX8A 1LL9A 1ES2A 1LSXA 3OC2A 4IUKA 3SH8A 3RFBA 3BW6A 3BY8A 3NHQA 4X68A 4X1LA 1VM1A 4E6WA 5F83A 4KUKA 1Z09A 4Y13A 3ZNTA 4X6TA 2XR0A 1K57A 5HAPA 3NDEA 3S7NA 3BJNA 1MC0A 2GNXA 4L9GA 4JPMA 2WADA 2BTFP 4MDZA 1ZKJA 5FDHA 4KQOA 1JVJA 1YLWA 2XK1A 3NY4A 3O86A 1F98A 3ZG7B 2G7UA 5A93A 4JF5A 3UDFA 3T4TA 4HP9A 5M1AA 1KVMA 3QP5A 3IT9A 3ZNYA 4CLCD 5HAQA 4KZ9A 5CEBA 4Z9QA 2J9OA 4FSFA 2VZWA 1BZAA 5L10A 3UB6A 3H82A 4R0QA 3T4QA 2EWWA 2EFUA 1EI5A 3PAGA 4WELA 5JYOA 3MQQA 1MKMA 5HZHA 1L0FA 2PU2A 2WGWA 3IF5A 4EV4A 3OLOA 3WWXA 2WYXA 2PRFA 4ZAMA 1K55A 1NLZA 2ZMFA 1MPLA 1XJ3A 2EX9A 4K0XA 4DDSA 4S2OA 3UY6A 4EXOA 4L9EA 4QHCA 1TEMA 3M2KA 2ACGA 2H0YA 1YLJA 5FQQA 4S2NC 2WAFA 2EFXA 4WZ5A 4MN5A 1BLCA 3KYZA 3BFFA 4OLGA 5TBMA 5I5LA 1L2SA 2Y4AA 1MWSA 3P09A 2L4RA 3TG9A 2XD5A 3KSHA 3MFDA 4LLOB 5FATA 2RCXA 2KDKA 5TFQA 4G3WA 4B93A 3CI6A 5GHZA 1ONHA 2Z6DA 3LY4A 2W1TA 1SDNA 1MKIA 1LHYA 1ERQA 3UDXA 4OPQA 1BTLA 3L7HA 3MZEA 3G2YA 1E3UD 1XA1A 3BQAA 1Y54A 3C7VA 4ARZB 1H8ZA 2Y59A 4G3VA 3G34A 3EEHA 2OAQ1 3S7PA 3NJAA 2X71A 4FOFA 4ZDXA 1FR6A 1FR1A 1OTDA 5EM1A 2Y2LA 4ME4A 4JF6A 4CLCA 1BT5A 5EM0A 5EOEA 3EOIA 4KZ7A 1KGGA 3UE0A 3IWOA 4B88A 1BLSA 3IF6B 4OOYA 3SS4A 2D02A 1ES3A 1HVBA 5HDDA 5HW3A
chains in the Genus database with same CATH topology
2Y8HA 2V9AA 2IA2A 3HJKA 1V9YA 3OCNA 5HDCA 4ARZA 5J4EA 1DP9A 4QPRA 2JKRI 2J3TD 2W0NA 1S1ZA 3PYPA 4EERA 2J80A 4DN0A 1LT0A 4KQDA 3F1PB 3D3OA 2K7SA 3LUQA 3EGXC 1YAXA 5K5BA 1OTEA 2XRNA 3EEAA 2GX5A 4WEJA 3T4KA 3FPWA 1OTIA 4YWZA 1ODVA 2W1RA 1IFQA 2OWJA 1YSQA 5HWVA 4YOFA 2OWHA 1LL8A 3P7NA 4HH2A 3CWFA 2GZAA 4ETZA 1NRJA 1UWNX 2V0WA 2PD8A 3G6OA 2YKFA 2KX6A 1EW0A 2ZMVA 3VE4A 3ZYTA 3PXPA 3H7WB 4UEYA 2INWA 2VGLM 3RTYA 3IS2B 5AJGA 5HPFA 3NOUC 4IJGA 4EUVA 4DMZA 2V1AA 5IT5A 4I3AA 2YKHA 3MFXA 3LIAA 3MJQA 4HP4A 3JVUA 5DKLA 3C30A 3F1PA 3R7WB 3F1OB 4Y2FA 4PKYA 1OTBA 4NXFA 2L0WA 3VE3A 4BWIA 3BY9A 3LR5A 4XT2A 4Y5FA 5DJTA 4O8GA 3K3CA 4L0LA 2HGVA 3LIFA 5G4ZA 1S4SA 4Q0IA 4I5SA 5KSHA 4HI4A 4HOIA 2NUTC 2OAP1 1N9LA 4CLCC 2P08A 5MC7A 1XFQA 3TRCA 5C5KA 5HWWA 3IS2A 4EETB 4O01A 4HJ6A 4O0PA 3CLOA 3PHYA 4Q0JA 4HY8A 5DF9A 3HJIA 3LIEA 4MN7A 4WN5A 3H82B 5DFYA 3O5YA 2ZOIA 1UWPX 1Y28A 2O0YA 1TS7A 1S4RA 3R7WA 1OJGA 3P01A 1X0OA 3F1OA 2V1BA 2B02A 4P6ZS 4NEED 3CITA 4I3IA 4Z1WA 2ZOHA 1F9IA 4JGRA 2VJWA 3UE6A 4F3LB 3TJZC 3MF0A 3OOVA 2PD7A 4EU0A 1V9ZA 3MMHA 3UE3A 5HSQA 2J3WA 2GJ3A 3IBJA 5HD5A 1P0ZA 3F1NB 1T18A 5DJUA 1T1BA 3JVVA 3UB7A 3E98A 2JN7A 3R4KA 4JGOA 4MCWA 4M4XA 1GSWA 3VOLA 4YNRA 3RH8B 2QYBA 2W3DA 4JGQA 3UB8A 4BBUA 4Q0HA 3PBOA 3EWKA 1GSXA 3B42A 3NOTC 5KIZA 3UMEA 3IBRA 1NLYA 1N9NA 1P9WA 3TE8A 3D72A 2VKSA 3BQ8A 5FL3A 1BYWA 3DBAA 3EGDC 4R3AA 4L9FA 2VLGA 4PAUA 4K08A 4GCZA 1IOUA 5AVFA 2QJ5A 1TF1A 2VV8A 2ZBBA 4I38A 3FC7A 1UGUA 5A8BA 3F1NA 4EW7A 1F5MA 1DP8A 5DFXA 1OPXA 3KSFA 1WA9A 5F6AA 2PR5A 1TS0A 4LRXC 4GLQA 2VX8A 3OCLA 3B33A 4HJ3A 4NXGA 1KOUA 4ZRRA 4WEKA 2MJ6A 4GS9B 4H6JB 4HQAA 5L8MA 3KSIA 4WL9A 4GJ4A 4R70A 2QHKA 4BBTA 1XFNA 4I39A 2W27A 5F5YA 2PYPA 2EA9A 3LR0A 1GSVA 3C8CA 2LB5A 1TS6A 2DMWA 1T19A 3LIDA 2M7UA 2EWVA 3MQ0A 3T4LA 2W3EA 3E4QA 1LSXA 3OC2A 4IUKA 4RQ9A 3RFBA 3BW6A 3BY8A 3NHQA 4HH3A 2XA7S 3TW8A 2M1CA 3BWLA 3OBFA 4KUKA 5J7EA 2W3FA 3UB9A 2KLIA 3H7WA 2R78A 3PBRA 3S7NA 3U2AA 4BJPA 4GS9A 4H6JA 2A24B 3BJNA 3CUEC 1MC0A 4G3KA 4HIAA 2M7VA 1XJ6A 4IHQA 3A0RA 4CLCB 3PBNA 4EEUA 2GNXA 4L9GA 4MMNA 5DKKA 1ZHHB 3LI9A 2VV6A 5HL6A 2B18A 4HHDA 3S7OA 4NXEA 2FZ0A 4R6LA 3E4OA 1P97A 4MDZA 4WLAA 5F68A 4KUOA 1T1CA 4KQOA 5HDSA 3LR3A 2P04A 1F98A 2G7UA 3EQUA 3V67A 4P6ZM 4LRZE 3T4TA 2W3HA 4JGPA 4HP9A 2WKRA 2CMNA 2Z6CA 4EQ1A 1G28A 1DRMA 2WKQA 2J3TC 2OOLA 1ZTUA 2QKPA 4WF0A 1S1YA 4CLCD 1XJ2A 3ULFA 4Y3IA 1P9RA 2O9BA 4HJ4A 2W3GA 4FSFA 2VZWA 2QWSA 3VV4A 3UB6A 3H82A 3T4QA 2EWWA 5IS1A 5HWTA 3KX0X 3KYQA 4OOMA 4ETXA 2V0UA 3H9WA 4WELA 2NUPC 3MXQA 1S67L 2PDRA 1LSVA 3MQQA 1MKMA 5HZHA 2PT7A 1W63Q 2JKTI 2PR6A 5TBMB 4II7A 4GW9A 1YSPA 4BBVA 2Y79A 5HPIA 1XJ4A 3OLOA 3GDIA 4F3LA 1DP6A 1NLZA 2ZMFA 1W63M 1XJ3A 3GECA 3LFVA 4GHIB 4EXOA 4L9EA 2WKPA 1D06A 3MR0A 4LRYC 4UQIS 3LI8A 4HNBA 4E04A 4OOLA 2HJEA 3LIBA 1OJ5A 4EESA 1N9OA 2JKTM 1S66L 4XT2B 1LSWA 4UQIM 2HV1A 3T4OA 3K3DA 2W1TB 4MN5A 2O9CA 3KYZA 3UMDA 2VGLS 5G4YA 3A0VA 3A0SA 3PBSA 2KOIA 4AFIA 2XSSA 5TBMA 5I5LA 1NWZA 2XROA 4BMWA 2L4RA 3B47A 1D7EA 2JKRM 1T1AA 3KSHA 4IUHA 4LLOB 3ZQ5A 4GHIA 2D01A 3CAXA 1G6OA 4I3JA 4LPZA 4MN6A 5J3WA 4CLCE 3KO6A 1STZA 1TD5A 2KDKA 4R38A 1JNUA 4G3WA 2H28A 2O9AA 4B93A 2P7JA 3CI6A 2L1MA 4PHTA 3W2ZA 2O99A 2XA7M 3NOPC 2Z6DA 3T4JA 2W1TA 3HCYA 1YKDA 1H3QA 2BASA 4B9OA 1OT6A 3LICA 3ICYA 2K2NA 5F69A 1VHMA 4DJ2A 4PKYG 3E0YA 3BQAA 4DJ3A 3E4PA 3C2WA 5EFWA 3PBTA 4NKPA 4ARZB 3FPVA 4G3VA 2HJ9C 3EEHA 2OAQ1 3S7PA 4EEPA 3PBQA 3PR6A 2QJ7A 3NJAA 3LYXA 3MQOA 4FOFA 5IU1A 2A24A 3EQVA 4WUJA 1OTDA 3LR4A 1VB6A 5HD3A 2LB9A 4ME4A 2A2LA 2VA0A 4CLCA 1OTAA 3T50A 4CQHA 3FG8A 5CX7A 3EOIA 4NXBA 1TS8A 3C38A 3CUEA 5LBRA 1H8MA 2JHEA 2K31A 5AVEA 2PHYA 3K2NA 2PYRA 2VV7A 1OT9A 3T4SA 1MZUA 3KSGA 2HF6A 2D02A 3SW1A 2FH5A 2I9VA 2VEAA 5TJJA 3S7QA 5HDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V9A A;  3HJK A;  1V9Y A;  5HDC A;  5J4E A;  1DP9 A;  2W0N A;  1S1Z A;  3PYP A;  4EER A;  2J80 A;  1LT0 A;  4KQD A;  3F1P B;  2K7S A;  3LUQ A;  1OTE A;  1OTI A;  4YWZ A;  1ODV A;  2OWJ A;  5HWV A;  2OWH A;  1LL8 A;  3P7N A;  4HH2 A;  3CWF A;  1UWN X;  2V0W A;  2PD8 A;  3G6O A;  2YKF A;  2KX6 A;  1EW0 A;  3VE4 A;  3H7W B;  2INW A;  3RTY A;  3IS2 B;  3NOU C;  2V1A A;  4I3A A;  2YKH A;  3MFX A;  3LIA A;  3MJQ A;  4HP4 A;  5DKL A;  3F1P A;  3F1O B;  4PKY A;  1OTB A;  4NXF A;  2L0W A;  3VE3 A;  3BY9 A;  4XT2 A;  5DJT A;  3K3C A;  3LIF A;  5G4Z A;  1S4S A;  4I5S A;  4HI4 A;  4HOI A;  1N9L A;  1XFQ A;  5HWW A;  3IS2 A;  4EET B;  4HJ6 A;  3CLO A;  3PHY A;  4HY8 A;  3HJI A;  3LIE A;  4WN5 A;  3H82 B;  2ZOI A;  1UWP X;  1Y28 A;  1TS7 A;  1S4R A;  1OJG A;  1X0O A;  3F1O A;  2V1B A;  2B02 A;  4I3I A;  2ZOH A;  1F9I A;  4JGR A;  3UE6 A;  4F3L B;  2PD7 A;  1V9Z A;  5HSQ A;  2GJ3 A;  5HD5 A;  1P0Z A;  3F1N B;  1T18 A;  5DJU A;  1T1B A;  3UB7 A;  2JN7 A;  4JGO A;  4M4X A;  1GSW A;  3VOL A;  3RH8 B;  4JGQ A;  3UB8 A;  4BBU A;  3EWK A;  1GSX A;  3NOT C;  5KIZ A;  3UME A;  3IBR A;  1N9N A;  3D72 A;  1BYW A;  4R3A A;  4L9F A;  2VLG A;  4K08 A;  4GCZ A;  5AVF A;  2QJ5 A;  2VV8 A;  2ZBB A;  4I38 A;  3FC7 A;  1UGU A;  5A8B A;  3F1N A;  4EW7 A;  1DP8 A;  1WA9 A;  5F6A A;  2PR5 A;  1TS0 A;  4LRX C;  3B33 A;  4HJ3 A;  4NXG A;  1KOU A;  4GS9 B;  4H6J B;  4HQA A;  4WL9 A;  4R70 A;  2QHK A;  4BBT A;  1XFN A;  4I39 A;  2W27 A;  5F5Y A;  2PYP A;  2EA9 A;  1GSV A;  3C8C A;  1TS6 A;  3LID A;  1T19 A;  3E4Q A;  1LSX A;  4RQ9 A;  3BY8 A;  3NHQ A;  4HH3 A;  2M1C A;  3BWL A;  4KUK A;  5J7E A;  3UB9 A;  3H7W A;  2R78 A;  4GS9 A;  4H6J A;  2A24 B;  4HIA A;  1XJ6 A;  3A0R A;  4EEU A;  4L9G A;  5DKK A;  3LI9 A;  2VV6 A;  4HHD A;  4NXE A;  4R6L A;  3E4O A;  1P97 A;  4WLA A;  5F68 A;  4KUO A;  1T1C A;  5HDS A;  1F98 A;  4LRZ E;  4JGP A;  4HP9 A;  2WKR A;  2CMN A;  2Z6C A;  4EQ1 A;  1G28 A;  1DRM A;  2WKQ A;  2QKP A;  2OOL A;  4WF0 A;  1S1Y A;  1XJ2 A;  3ULF A;  4HJ4 A;  2QWS A;  3UB6 A;  3H82 A;  5IS1 A;  5HWT A;  3KX0 X;  2V0U A;  3H9W A;  3MXQ A;  1S67 L;  2PDR A;  1LSV A;  3MQQ A;  5HZH A;  2PR6 A;  5TBM B;  4BBV A;  4GW9 A;  1XJ4 A;  3OLO A;  3GDI A;  4F3L A;  1DP6 A;  1XJ3 A;  3GEC A;  4GHI B;  4EXO A;  4L9E A;  2WKP A;  1D06 A;  3MR0 A;  4LRY C;  3LI8 A;  4HNB A;  4E04 A;  3LIB A;  1OJ5 A;  4EES A;  1N9O A;  1S66 L;  4XT2 B;  1LSW A;  2HV1 A;  3K3D A;  4MN5 A;  3UMD A;  5G4Y A;  3A0V A;  3A0S A;  5TBM A;  5I5L A;  1NWZ A;  2L4R A;  1D7E A;  1T1A A;  4LLO B;  3ZQ5 A;  4GHI A;  2D01 A;  3CAX A;  4I3J A;  4MN6 A;  4LPZ A;  5J3W A;  2KDK A;  4R38 A;  1JNU A;  2H28 A;  2P7J A;  2L1M A;  3NOP C;  2Z6D A;  2BAS A;  4B9O A;  1OT6 A;  3LIC A;  3ICY A;  5F69 A;  4DJ2 A;  4PKY G;  4DJ3 A;  3E4P A;  3C2W A;  5EFW A;  3EEH A;  4EEP A;  2QJ7 A;  3NJA A;  3LYX A;  3MQO A;  5IU1 A;  2A24 A;  4WUJ A;  1OTD A;  1VB6 A;  5HD3 A;  1OTA A;  3T50 A;  3FG8 A;  4NXB A;  1TS8 A;  2JHE A;  5AVE A;  2PHY A;  2PYR A;  2VV7 A;  1OT9 A;  1MZU A;  2D02 A;  3SW1 A;  2I9V A;  2VEA A;  5HDD A; 
#chains in the Genus database with same CATH topology
 2V9A A;  4QY6 A;  1V9Y A;  3OCN A;  5E2G A;  1L0E A;  5HDC A;  1DP9 A;  5AQA A;  3PYP A;  1MY8 A;  3F1P B;  4IED A;  1YAX A;  5EOO A;  2XRN A;  1ERO A;  2Y2M A;  2H10 A;  1VET B;  4JF4 A;  5BOH A;  3T4K A;  4MBK A;  4DE1 A;  1SDE A;  1ODV A;  1IFQ A;  2OWJ A;  1MWT A;  4S2K A;  2EXA A;  4R3J A;  4HH2 A;  2DRW A;  4ETZ A;  2PD8 A;  4QY5 A;  3C5A A;  2ZMV A;  3ZYT A;  4DF6 A;  4P87 A;  5AJG A;  1L3L A;  3IXG A;  4BQM A;  5DTS A;  3D9Y A;  4RX2 A;  4OVD A;  4R23 A;  2JC7 A;  3BLS A;  3DTK A;  3BEB A;  4X55 A;  3R7W B;  5GHY A;  4Y2F A;  4PKY A;  4E3M A;  1OTB A;  4X56 A;  2QPN A;  4Y0O A;  2L0W A;  3VE3 A;  4BWI A;  5FQK A;  5EV0 A;  4XT2 A;  2J8Y A;  5FA7 A;  4O8G A;  3W4Q A;  4S2P A;  3O3V A;  4S2N A;  1N9B A;  1S4S A;  3Q7V B;  5G18 A;  4P0M A;  5KSH A;  4S2J A;  1JWP A;  5KMW A;  2OAP 1;  4NET A;  4K91 A;  5MC7 A;  1XFQ A;  4EET B;  1AWI A;  4HJ6 A;  1E3U A;  2XDM A;  4MN7 A;  3H82 B;  5DFY A;  5CTM A;  2ZOI A;  3QNB A;  1FQG A;  3VMA A;  1S4R A;  3C7U A;  3IWI A;  1OJG A;  3P01 A;  4JXS A;  1X0O A;  4P6Z S;  4NEE D;  2WGW B;  2WK0 A;  1F9I A;  2VJW A;  3N7W A;  3UE6 A;  2ZC6 B;  3OOV A;  2PD7 A;  5CER A;  5HSQ A;  1W79 A;  3E2K A;  2GJ3 A;  1F2K A;  3QP1 A;  1TDL A;  1T18 A;  4ZBE A;  2X01 A;  3GTC A;  2WGI A;  3UB7 A;  4JGO A;  1RGY A;  2JN7 A;  3CPT B;  1GSW A;  2WGV A;  3ITB A;  5FI2 A;  3RXX A;  1W7F A;  4XUX A;  1K54 C;  2QYB A;  4HEF A;  4BBU A;  4DE3 A;  3IF6 C;  4DXB A;  2XH9 A;  1HZO A;  3VP3 A;  4DKI A;  4KZ8 A;  4EWF A;  3DAV A;  2ZL1 B;  1HTZ A;  1MXO A;  4HBT A;  2QJ5 A;  3U4L P;  2VV8 A;  4KZ5 A;  3A3D A;  1PWG A;  3DTI A;  4EW7 A;  1KE0 A;  4UA9 A;  5DFX A;  1OPX A;  5L2F A;  1N4O A;  5F1F A;  1FCO A;  1LL5 A;  1IEM A;  3OPL A;  3HLG A;  2VX8 A;  5FAQ A;  4NXG A;  5FI7 A;  3M2J A;  4WEK A;  2MJ6 A;  4H6J B;  4HQA A;  5L8M A;  3KSI A;  3V3S A;  3DTE A;  2HDS A;  2WUQ A;  3T1X A;  2QHK A;  1XFN A;  4OQH A;  4I39 A;  3N8S A;  3CZD A;  1DJA A;  1YPR A;  1HD8 A;  3LID A;  1M40 A;  4KEN B;  4RQ9 A;  1XX2 A;  2ZQ8 A;  1XA7 A;  4WMC D;  2XA7 S;  3OBF A;  2KLI A;  2R78 A;  3PBR A;  3U2A A;  4BLM A;  4GS9 A;  4LV3 A;  4WM9 A;  2ZM8 A;  2M7V A;  4HIA A;  4CLC B;  3PBN A;  4N1H A;  1K56 D;  5DKK A;  3LI9 A;  1K4F A;  3BRM A;  5HL6 A;  4UAA A;  4HHD A;  4NXE A;  3HUO A;  4R6L A;  1PW8 A;  1SKO B;  4WLA A;  5F68 A;  1I2S A;  3LR3 A;  1PNE A;  4P6Z M;  3T1Q B;  4JGP A;  2WKR A;  2CMN A;  2Z6C A;  1NYY A;  2OOL A;  1FIL A;  3V5M A;  3ULF A;  3WS1 A;  1XP4 A;  3C4O A;  5GHX A;  2O9B A;  4OQ0 A;  3ZHH A;  3VV4 A;  2XFT A;  5IS1 A;  3KYQ A;  3H9W A;  2PDR A;  1I2W A;  2PR6 A;  1YSP A;  4PM6 A;  1YM1 A;  4KZ6 A;  5E2H A;  4F3L A;  3LGO A;  2BLS A;  2PAV P;  5FDS A;  3HLE A;  3GEC A;  4GHI B;  4LV0 A;  3SS3 A;  1BLH A;  3N4I A;  1Q2Q A;  5F82 A;  1D06 A;  3D4F A;  3WS2 A;  3JYI A;  1MWU A;  3LI8 A;  2HJE A;  3LIB A;  4EES A;  1N9O A;  3DWK A;  4XT2 B;  4UQI M;  5CGS A;  3K3D A;  1K54 A;  3LCE A;  3A0V A;  2OLU A;  2Y55 A;  4RVA A;  1NWZ A;  1JTG A;  4N9K A;  1HLU P;  3NDG A;  4BMW A;  1D7E A;  1KGF A;  1CK3 A;  1ZG4 A;  3E2L A;  2P9V A;  4IUH A;  3ZQ5 A;  4KZ4 A;  2D01 A;  4QD4 A;  4I3J A;  4MN6 A;  2E8J A;  4LPZ A;  4PM7 A;  1LI9 A;  4CLC E;  2Q9M A;  1JTD A;  5M18 A;  4R38 A;  4QU3 A;  3SZT A;  2H28 A;  2O9A A;  2P7J A;  3ZVT A;  1WE4 A;  1I5Q A;  4GDN A;  4WMC A;  2XA7 M;  5FAS A;  1KGE A;  1YKD A;  4BEN A;  1H3Q A;  4D60 A;  1OT6 A;  1BSG A;  5EPH A;  3MS6 A;  1KE3 A;  2BG1 A;  1K56 A;  1VHM A;  4PKY G;  4ZJ3 A;  2HDR A;  3E4P A;  3C2W A;  5GLA A;  5EFW A;  2WAE A;  2E8I A;  2Y91 A;  4EEP A;  3PBQ A;  3PR6 A;  2PBY A;  3TOI A;  1IYO A;  3QP2 A;  3MQO A;  5IHV A;  2A24 A;  3HRE A;  4GOG A;  5HD3 A;  3CMZ A;  1CJF A;  2A2L A;  4XUZ A;  4A5R A;  3MSH A;  1TS8 A;  5LBR A;  2ZMA A;  2K31 A;  2Y2O A;  3K2N A;  2PYR A;  1MZU A;  2ZQD A;  3BLM A;  4KG5 A;  3KSG A;  2HF6 A;  5EEC A;  2DCF A;  2FH5 A;  3V39 A;  2VEA A;  3S7Q A;  1CQA A;  4EBL A;  1ALQ A;  5EVI C;  3NBL A;  5J4E A;  1O07 A;  3HLC A;  1ESI A;  2JKR I;  1RCJ A;  1S1Z A;  1LT0 A;  3WRZ A;  1XGJ A;  5K5B A;  4MBH A;  4KZB A;  3FPW A;  3M6B A;  2W1R A;  2HP9 A;  1YSQ A;  5HWV A;  1ONG A;  1NXY A;  3G6O A;  2YKF A;  2KX6 A;  1EW0 A;  4R4S A;  3VE4 A;  3OZH A;  1IKI A;  1DJC A;  1IYQ A;  3NOU C;  4EUV A;  4BL3 A;  4DMZ A;  2JE5 A;  2V1A A;  3MFX A;  4E3J A;  4JXW A;  5A91 A;  3C30 A;  2GDN A;  3F1O B;  3NUL A;  1G5U A;  4Y0U A;  3LR5 A;  5DJT A;  5G4Z A;  3WS0 A;  4ZTK A;  1W8Y A;  4Q0I A;  4IVK A;  4MNR A;  1JWZ A;  4U3T A;  2P08 A;  5HWW A;  1YLZ A;  1U60 A;  2Q0O A;  3IS2 A;  2V20 A;  3CLO A;  4Q0J A;  3AGF A;  3LO7 A;  3L9K A;  5DVA A;  4DRT A;  3IXD A;  3W4P A;  1TS7 A;  3GMW A;  4C3Q A;  4GN2 A;  1WYC A;  4DE2 A;  1FCN A;  4GDB A;  3VFH A;  3CIT A;  4Z1W A;  1W8Q A;  2ZOH A;  5CTN A;  4F3L B;  1RP5 A;  3JPU A;  1PYY A;  5GLB A;  1XGI A;  3ZG8 B;  3B3X A;  4GD8 A;  2V1Z A;  5HD5 A;  1P0Z A;  4N1X A;  4N9L A;  5DJU A;  5EE8 A;  1O7E A;  2ZC7 A;  3R4K A;  4KQQ A;  3VOL A;  1VEU A;  1KE4 A;  4LEN A;  1ES5 A;  3B42 A;  5E43 A;  3NI9 A;  1NLY A;  1K0K A;  3IH8 A;  2VKS A;  1W5D A;  5FQ9 A;  4R3A A;  4NG2 A;  3Q1F A;  5A92 A;  4GCZ A;  1IOU A;  2P9V B;  4P6B A;  2V2F F;  4PM5 A;  1VQQ A;  2XEP A;  3F1N A;  1F5M A;  4HBU A;  4B4Z A;  3DTM A;  5F6A A;  2PR5 A;  4LRX C;  4FCF A;  4GLQ A;  4HJ3 A;  5CEC A;  4ZRR A;  3RJU A;  4EBN A;  4WL9 A;  4R70 A;  5A90 A;  4FH4 A;  4BBT A;  2OV5 A;  2W27 A;  5F5Y A;  3A3E A;  1GCE A;  4ID4 A;  1TS6 A;  1T19 A;  3G32 A;  2QZ6 A;  3MQ0 A;  3DWZ A;  2ZD8 A;  3E4Q A;  1GHP A;  3DW0 A;  3MZF A;  5DTT A;  1AXB A;  2VK3 A;  3IWQ A;  4R3B A;  5DTK A;  3BWL A;  5GL9 A;  2W3F A;  3ZDJ A;  3H7W A;  5FEF A;  4BJP A;  3RXW A;  3G4P A;  2A24 B;  3S1Y A;  4G3K A;  2ZC4 B;  1TDG A;  1XJ6 A;  4Y17 A;  4IHQ A;  1FCM A;  5CRF A;  3MXS A;  4MMN A;  2P74 A;  2VV6 A;  3SH7 A;  3S7O A;  1GA9 A;  3HLF A;  4JLF A;  1OME A;  2AVX A;  5HDS A;  3HBR A;  2P04 A;  3EQU A;  4M3K A;  5FQM A;  3V67 A;  5M19 A;  4OH0 A;  1L0G A;  3SS5 A;  4KQR A;  4EQ1 A;  4ESP A;  4QJG A;  1DRM A;  2WKQ A;  3MKE A;  2J3T C;  4WF0 A;  1ZTU A;  1S1Y A;  4E6X A;  1XJ2 A;  5AQ7 A;  4Y3I A;  4GKU A;  2V8C A;  2UV0 E;  2W3G A;  3GRJ A;  2H5S A;  2QWS A;  3QP4 A;  2ZJ9 A;  5FQJ A;  5FSR A;  3ZG5 A;  3WS5 A;  3KX0 X;  4OOM A;  4ETX A;  4OKP A;  3GSG A;  1S67 L;  1LSV A;  1FOF A;  5TBM B;  2HPB A;  4II7 A;  4GW9 A;  4BBV A;  5CED A;  1XJ4 A;  1YT4 A;  1ZG6 A;  2C6W B;  4Y0T A;  4K0W A;  2Y2H A;  2WKP A;  3T12 B;  1RGZ A;  4LRY C;  4UQI S;  5DF8 A;  1XPB A;  4OOL A;  2J7V A;  1OJ5 A;  3BFD A;  2JKT M;  1S66 L;  5TGF A;  2HV1 A;  2ZM0 A;  4BL2 A;  3V50 A;  5CGX A;  3T4O A;  2W1T B;  4PMA A;  1K57 C;  2O9C A;  1SKF A;  2WKH A;  2VGL S;  4Y7P A;  1E4D A;  3PBS A;  4KZA A;  4AFI A;  2ZQC A;  3UE1 A;  3GVB A;  4FUW A;  4X25 A;  3A3J A;  4IVI A;  1A0K A;  3NEC A;  1YMS A;  2WKE A;  3CAX A;  1G6O A;  1SZV A;  1CI8 A;  3UN7 A;  1TD5 A;  1GHI A;  3MKF A;  3IXH A;  4UA6 A;  4GNU A;  4LCL A;  3W2Z A;  2O99 A;  2WZZ A;  2HDQ A;  1PI4 A;  2PBD P;  3T4J A;  3HCY A;  4E3L A;  1QMF A;  3IHA A;  3LIC A;  1YMX A;  3ICY A;  4DDY A;  4JBF A;  3A3I A;  1NRF A;  1H8Y A;  1K6S A;  5F69 A;  3BFC A;  3VP1 A;  1VEU B;  4DJ3 A;  2JKF A;  3PBT A;  4NKP A;  3FPV A;  3I7J A;  2QJ7 A;  2ZC3 B;  4E3O A;  1K55 C;  1XXM A;  3LYX A;  2VGK A;  4Y15 A;  3EQV A;  1VB6 A;  4Q8I A;  2JKG A;  3UNW A;  1PRQ A;  2LB9 A;  1OTA A;  4D2O A;  4O7D A;  3UO9 A;  3FG8 A;  4U0X A;  5CX7 A;  4NXB A;  2Y2G A;  3C38 A;  1H8M A;  5AVE A;  1EWZ A;  2ZQA A;  2VV7 A;  1OT9 A;  2XF3 A;  3SW1 A;  2I9V A;  5TJJ A;  2PU4 A;  3PAE A;  2IA2 A;  3HJK A;  1H5X A;  4ARZ A;  2QMI A;  2IWC A;  2W0N A;  3AGD A;  4WYY A;  4KQD A;  1YQS A;  3EGX C;  1MBL A;  2GX5 A;  4E3K A;  1OTI A;  4YWZ A;  5FEG A;  4YOF A;  5E2F A;  4JKT A;  4LGW A;  5FI6 A;  2ZLY A;  2GZA A;  3IF6 A;  1BUE A;  3IHB A;  3HLB A;  3PXP A;  3H7W B;  2G2W A;  2INW A;  2VGL M;  4EBP A;  4XXR A;  4IJG A;  3QP6 A;  1PI5 A;  5IT5 A;  2Z2M B;  3G31 A;  3LIA A;  4BD0 A;  3MJQ A;  4HP4 A;  3T1S A;  4CJN A;  3F1P A;  4GZB A;  1VET A;  5EVE A;  3G2Z A;  3BY9 A;  3CJM A;  3K3C A;  1IYS A;  4L0L A;  3W4O A;  2EX2 A;  3LIF A;  4LFU A;  5FAO A;  4N92 A;  4C6Y A;  5EVL A;  4CLC C;  3VFF A;  5HL1 A;  4O0P A;  4OPY A;  4HY8 A;  5HFO A;  3HJI A;  2HP5 A;  3O5Y A;  4YFM A;  3BFG A;  4U0T A;  1UWP X;  1Y28 A;  2O0Y A;  1KVL A;  3G30 A;  3R7W A;  4YIN A;  3N6I A;  1WYB A;  3GR2 A;  2B02 A;  5CGW A;  4WBG A;  3QP8 A;  4DXC A;  4I3I A;  1XKZ A;  3TJZ C;  3MF0 A;  1FSY A;  1ES4 A;  3MMH A;  3Q7V A;  4MEZ A;  1J3W A;  3A3F A;  1KDS A;  3G35 A;  1T1B A;  4M4X A;  4YNR A;  2DNS A;  1YLP A;  3RH8 B;  5CXW A;  2W3D A;  3PBO A;  3EWK A;  1ACF A;  1NYM A;  4MLL A;  3IBR A;  3HLW A;  3IX4 A;  1P9W A;  3TE8 A;  3D72 A;  3BQ8 A;  5FL3 A;  1BYW A;  3DBA A;  3WRT A;  3EGD C;  4OQG A;  4E3I A;  4L9F A;  4PAU A;  4UHU A;  2R9X A;  4K08 A;  3VP2 A;  4F94 A;  1PWD A;  5CHM A;  1TF1 A;  1SHV A;  2ZBB A;  4I38 A;  2XD1 A;  3FC7 A;  1UGU A;  3VSL A;  1CF0 A;  5FQI A;  3CPT A;  3OCL A;  5EUA A;  1KOU A;  1PZP A;  4GS9 B;  2Y2N A;  5EVI D;  5L09 A;  4GJ4 A;  3NIA A;  3ISG A;  1NZO A;  2FFF B;  2JCH A;  3O88 A;  3ZG9 B;  1IYP A;  2PYP A;  3LR0 A;  1GSV A;  3C8C A;  1E25 A;  2DMW A;  5TR7 A;  2ZL1 A;  4FH2 A;  2M7U A;  2X02 A;  2EWV A;  3OPH A;  3GQZ A;  3T4L A;  2W3E A;  2C5W B;  1ERM A;  4QWO A;  3BEC A;  1FIK A;  1Z6F A;  1CI9 A;  3Q7Z A;  1FSW A;  4HH3 A;  3ZGA B;  3TW8 A;  2M1C A;  5J7E A;  2CC1 A;  3UB9 A;  4OQI A;  4GB7 A;  4H6J A;  3CUE C;  1K6R A;  3A0R A;  4EEU A;  4IBR A;  4S2I A;  2UWX A;  1ZHH B;  4UA7 A;  3N8R A;  2XFS A;  2B18 A;  1MWR A;  5FAP A;  2FZ0 A;  3E4O A;  5CHU A;  1P97 A;  1NZU A;  4KUO A;  1DY6 A;  1T1C A;  2HZ5 A;  4IBX A;  1CEF A;  1IEL A;  4OPR A;  4LRZ E;  2W3H A;  3UDI A;  3S4X A;  3LEZ A;  3SOI A;  2EXB A;  1G28 A;  4JXG A;  3M6H A;  2QKP A;  3GV9 A;  3WS4 A;  1LI0 A;  3UPP A;  1P9R A;  2Z2L B;  4HJ4 A;  2FFY A;  3OPR A;  3BM6 A;  3NC8 A;  3PTE A;  3MZD A;  3FV7 A;  1ZC2 A;  1K4E A;  3CG5 A;  1G6A A;  3S22 A;  5HWT A;  3W8K A;  5HX9 A;  2HDU A;  1TVF A;  2V0U A;  4HES A;  2NUP C;  3LEQ A;  3MXQ A;  5D3O A;  4RYE A;  1SKO A;  2PT7 A;  1W63 Q;  2JKT I;  1C3B A;  3HLD A;  5HAR A;  2Y79 A;  5HPI A;  1PWC A;  3GDI A;  1DP6 A;  1IKG A;  4RX3 A;  1W63 M;  4B4X A;  3LFV A;  3HVF A;  3QNC A;  5AQB A;  3TSG A;  4PPR A;  3MR0 A;  4HNB A;  4E04 A;  3MXR A;  1YLY A;  2G2U A;  3AGE A;  3C4P A;  2WKI A;  1LSW A;  3UMD A;  5G4Y A;  5EVI A;  3A0S A;  2KOI A;  2XSS A;  2XRO A;  4CPK A;  5KSC A;  5AQ9 A;  2ZQ7 A;  4EUZ A;  3B47 A;  1Y4O A;  2JKR M;  1T1A A;  2OLV A;  4GHI A;  4QB8 A;  5J3W A;  4LV2 A;  4X69 A;  3KO6 A;  1STZ A;  1BLP A;  1D1J A;  5GLD A;  3P98 A;  4FTX A;  1JNU A;  3BFE A;  4KZ3 A;  2L1M A;  1GHM A;  4PHT A;  3NOP C;  3VOZ A;  2V8F A;  2BAS A;  4B9O A;  3VOY A;  1KDW A;  2K2N A;  4RA7 A;  2Y2I A;  2Y2Q A;  1QME A;  5KZH A;  5U47 A;  4DJ2 A;  4MBF A;  1Q2P A;  2XLN A;  3E0Y A;  2B95 A;  4OLD A;  4GD6 A;  5GLC A;  2EX6 A;  2RL3 A;  2HJ9 C;  3QHY A;  1BUL A;  2ZM2 A;  5I94 A;  2ZQ9 A;  3HL9 A;  5IU1 A;  4WUJ A;  1CEG A;  3FZC A;  3LR4 A;  2VA0 A;  4C75 A;  1JWV A;  1S0W A;  4DE0 A;  3T50 A;  4CQH A;  4H8R A;  1ESU A;  2EX8 A;  3CUE A;  4OON A;  2JHE A;  2PHY A;  4OPZ A;  3T4S A;  2IWD A;  1LLB A;  3ZFZ A;  2Q9N A;  2Y8H A;  1NJ4 A;  3VP4 A;  4QPR A;  3VSK A;  4LCM A;  2J3T D;  4KG6 A;  4EER A;  2J80 A;  4DN0 A;  3D3O A;  2K7S A;  3UPO A;  3LUQ A;  1OTE A;  3EEA A;  1J9M A;  4WEJ A;  3Q07 A;  4EQI A;  4S2L A;  4E3N A;  3IX3 A;  3IH9 A;  2Y2P A;  1PIO A;  2OWH A;  1LL8 A;  3P7N A;  1SCW A;  4P85 A;  3CWF A;  1NRJ A;  1UWN X;  2V0W A;  1YLT A;  4UEY A;  2XQZ A;  3RTY A;  3IS2 B;  5HPF A;  2A49 A;  2WZX A;  4OP8 A;  3ZCZ A;  4I3A A;  2YKH A;  4KG2 A;  4PM9 A;  3JVU A;  3FWL A;  5DKL A;  3BYD A;  1M6K A;  3KYE A;  1PZO A;  3CHW P;  4NXF A;  1PFL A;  2A3U A;  3HUM A;  3V3R A;  4WZ4 A;  4S2M A;  3Q82 A;  4Y5F A;  3UB5 P;  5L07 A;  3T1R A;  4R4R A;  2HGV A;  4ZJ1 A;  3FKV A;  4LV1 A;  3OPP A;  4I5S A;  4HI4 A;  4HOI A;  2NUT C;  3MBZ A;  1N9L A;  4OP5 A;  2JBF A;  2Y2J A;  3TRC A;  1GA0 A;  5C5K A;  4O01 A;  3PHY A;  5DF9 A;  3LIE A;  4WN5 A;  2H0T A;  1G68 A;  2XGN A;  3NCK A;  3ZVW A;  3F1O A;  2V1B A;  5CHJ A;  5HAI A;  2I72 A;  4JGR A;  3N8L A;  3VP0 A;  1K38 A;  4EU0 A;  3ITA A;  1V9Z A;  3UE3 A;  2J3W A;  2HP6 A;  1NY0 A;  3IBJ A;  3F1N B;  4R1G A;  3JVV A;  3E98 A;  4FD8 A;  4MCW A;  3LY3 A;  3IXB A;  4WZ5 C;  4JGQ A;  3UB8 A;  1L0D A;  4Q0H A;  1GSX A;  4NK3 A;  4PM8 A;  3IQA A;  3NOT C;  3O87 A;  5JYP A;  5KIZ A;  3UME A;  4ZJ2 A;  2VGJ A;  1N9N A;  3FYZ A;  5EVI B;  5F1G A;  5DF7 A;  3FKW A;  3ZG0 A;  2ZC5 B;  3Q81 A;  3SH9 A;  4JXV A;  2VLG A;  4X53 A;  5AVF A;  2IWB A;  3UPN A;  1K25 A;  2OSU A;  5A8B A;  1DP8 A;  3KSF A;  1WA9 A;  2R9W A;  1TS0 A;  4BD1 A;  3HUN A;  3B33 A;  1DJB A;  2B5R A;  2J9P A;  1S6R A;  2Y2K A;  1H0M A;  5E2E A;  4X1M A;  5J8X A;  1PW1 A;  2EA9 A;  2LB5 A;  3IX8 A;  1LL9 A;  1ES2 A;  1LSX A;  3OC2 A;  4IUK A;  3SH8 A;  3RFB A;  3BW6 A;  3BY8 A;  3NHQ A;  4X68 A;  4X1L A;  1VM1 A;  4E6W A;  5F83 A;  4KUK A;  1Z09 A;  4Y13 A;  3ZNT A;  4X6T A;  2XR0 A;  1K57 A;  5HAP A;  3NDE A;  3S7N A;  3BJN A;  1MC0 A;  2GNX A;  4L9G A;  4JPM A;  2WAD A;  2BTF P;  4MDZ A;  1ZKJ A;  5FDH A;  4KQO A;  1JVJ A;  1YLW A;  2XK1 A;  3NY4 A;  3O86 A;  1F98 A;  3ZG7 B;  2G7U A;  5A93 A;  4JF5 A;  3UDF A;  3T4T A;  4HP9 A;  5M1A A;  1KVM A;  3QP5 A;  3IT9 A;  3ZNY A;  4CLC D;  5HAQ A;  4KZ9 A;  5CEB A;  4Z9Q A;  2J9O A;  4FSF A;  2VZW A;  1BZA A;  5L10 A;  3UB6 A;  3H82 A;  4R0Q A;  3T4Q A;  2EWW A;  2EFU A;  1EI5 A;  3PAG A;  4WEL A;  5JYO A;  3MQQ A;  1MKM A;  5HZH A;  1L0F A;  2PU2 A;  2WGW A;  3IF5 A;  4EV4 A;  3OLO A;  3WWX A;  2WYX A;  2PRF A;  4ZAM A;  1K55 A;  1NLZ A;  2ZMF A;  1MPL A;  1XJ3 A;  2EX9 A;  4K0X A;  4DDS A;  4S2O A;  3UY6 A;  4EXO A;  4L9E A;  4QHC A;  1TEM A;  3M2K A;  2ACG A;  2H0Y A;  1YLJ A;  5FQQ A;  4S2N C;  2WAF A;  2EFX A;  4WZ5 A;  4MN5 A;  1BLC A;  3KYZ A;  3BFF A;  4OLG A;  5TBM A;  5I5L A;  1L2S A;  2Y4A A;  1MWS A;  3P09 A;  2L4R A;  3TG9 A;  2XD5 A;  3KSH A;  3MFD A;  4LLO B;  5FAT A;  2RCX A;  2KDK A;  5TFQ A;  4G3W A;  4B93 A;  3CI6 A;  5GHZ A;  1ONH A;  2Z6D A;  3LY4 A;  2W1T A;  1SDN A;  1MKI A;  1LHY A;  1ERQ A;  3UDX A;  4OPQ A;  1BTL A;  3L7H A;  3MZE A;  3G2Y A;  1E3U D;  1XA1 A;  3BQA A;  1Y54 A;  3C7V A;  4ARZ B;  1H8Z A;  2Y59 A;  4G3V A;  3G34 A;  3EEH A;  2OAQ 1;  3S7P A;  3NJA A;  2X71 A;  4FOF A;  4ZDX A;  1FR6 A;  1FR1 A;  1OTD A;  5EM1 A;  2Y2L A;  4ME4 A;  4JF6 A;  4CLC A;  1BT5 A;  5EM0 A;  5EOE A;  3EOI A;  4KZ7 A;  1KGG A;  3UE0 A;  3IWO A;  4B88 A;  1BLS A;  3IF6 B;  4OOY A;  3SS4 A;  2D02 A;  1ES3 A;  1HVB A;  5HDD A;  5HW3 A; 
#chains in the Genus database with same CATH homology
 2Y8H A;  2V9A A;  2IA2 A;  3HJK A;  1V9Y A;  3OCN A;  5HDC A;  4ARZ A;  5J4E A;  1DP9 A;  4QPR A;  2JKR I;  2J3T D;  2W0N A;  1S1Z A;  3PYP A;  4EER A;  2J80 A;  4DN0 A;  1LT0 A;  4KQD A;  3F1P B;  3D3O A;  2K7S A;  3LUQ A;  3EGX C;  1YAX A;  5K5B A;  1OTE A;  2XRN A;  3EEA A;  2GX5 A;  4WEJ A;  3T4K A;  3FPW A;  1OTI A;  4YWZ A;  1ODV A;  2W1R A;  1IFQ A;  2OWJ A;  1YSQ A;  5HWV A;  4YOF A;  2OWH A;  1LL8 A;  3P7N A;  4HH2 A;  3CWF A;  2GZA A;  4ETZ A;  1NRJ A;  1UWN X;  2V0W A;  2PD8 A;  3G6O A;  2YKF A;  2KX6 A;  1EW0 A;  2ZMV A;  3VE4 A;  3ZYT A;  3PXP A;  3H7W B;  4UEY A;  2INW A;  2VGL M;  3RTY A;  3IS2 B;  5AJG A;  5HPF A;  3NOU C;  4IJG A;  4EUV A;  4DMZ A;  2V1A A;  5IT5 A;  4I3A A;  2YKH A;  3MFX A;  3LIA A;  3MJQ A;  4HP4 A;  3JVU A;  5DKL A;  3C30 A;  3F1P A;  3R7W B;  3F1O B;  4Y2F A;  4PKY A;  1OTB A;  4NXF A;  2L0W A;  3VE3 A;  4BWI A;  3BY9 A;  3LR5 A;  4XT2 A;  4Y5F A;  5DJT A;  4O8G A;  3K3C A;  4L0L A;  2HGV A;  3LIF A;  5G4Z A;  1S4S A;  4Q0I A;  4I5S A;  5KSH A;  4HI4 A;  4HOI A;  2NUT C;  2OAP 1;  1N9L A;  4CLC C;  2P08 A;  5MC7 A;  1XFQ A;  3TRC A;  5C5K A;  5HWW A;  3IS2 A;  4EET B;  4O01 A;  4HJ6 A;  4O0P A;  3CLO A;  3PHY A;  4Q0J A;  4HY8 A;  5DF9 A;  3HJI A;  3LIE A;  4MN7 A;  4WN5 A;  3H82 B;  5DFY A;  3O5Y A;  2ZOI A;  1UWP X;  1Y28 A;  2O0Y A;  1TS7 A;  1S4R A;  3R7W A;  1OJG A;  3P01 A;  1X0O A;  3F1O A;  2V1B A;  2B02 A;  4P6Z S;  4NEE D;  3CIT A;  4I3I A;  4Z1W A;  2ZOH A;  1F9I A;  4JGR A;  2VJW A;  3UE6 A;  4F3L B;  3TJZ C;  3MF0 A;  3OOV A;  2PD7 A;  4EU0 A;  1V9Z A;  3MMH A;  3UE3 A;  5HSQ A;  2J3W A;  2GJ3 A;  3IBJ A;  5HD5 A;  1P0Z A;  3F1N B;  1T18 A;  5DJU A;  1T1B A;  3JVV A;  3UB7 A;  3E98 A;  2JN7 A;  3R4K A;  4JGO A;  4MCW A;  4M4X A;  1GSW A;  3VOL A;  4YNR A;  3RH8 B;  2QYB A;  2W3D A;  4JGQ A;  3UB8 A;  4BBU A;  4Q0H A;  3PBO A;  3EWK A;  1GSX A;  3B42 A;  3NOT C;  5KIZ A;  3UME A;  3IBR A;  1NLY A;  1N9N A;  1P9W A;  3TE8 A;  3D72 A;  2VKS A;  3BQ8 A;  5FL3 A;  1BYW A;  3DBA A;  3EGD C;  4R3A A;  4L9F A;  2VLG A;  4PAU A;  4K08 A;  4GCZ A;  1IOU A;  5AVF A;  2QJ5 A;  1TF1 A;  2VV8 A;  2ZBB A;  4I38 A;  3FC7 A;  1UGU A;  5A8B A;  3F1N A;  4EW7 A;  1F5M A;  1DP8 A;  5DFX A;  1OPX A;  3KSF A;  1WA9 A;  5F6A A;  2PR5 A;  1TS0 A;  4LRX C;  4GLQ A;  2VX8 A;  3OCL A;  3B33 A;  4HJ3 A;  4NXG A;  1KOU A;  4ZRR A;  4WEK A;  2MJ6 A;  4GS9 B;  4H6J B;  4HQA A;  5L8M A;  3KSI A;  4WL9 A;  4GJ4 A;  4R70 A;  2QHK A;  4BBT A;  1XFN A;  4I39 A;  2W27 A;  5F5Y A;  2PYP A;  2EA9 A;  3LR0 A;  1GSV A;  3C8C A;  2LB5 A;  1TS6 A;  2DMW A;  1T19 A;  3LID A;  2M7U A;  2EWV A;  3MQ0 A;  3T4L A;  2W3E A;  3E4Q A;  1LSX A;  3OC2 A;  4IUK A;  4RQ9 A;  3RFB A;  3BW6 A;  3BY8 A;  3NHQ A;  4HH3 A;  2XA7 S;  3TW8 A;  2M1C A;  3BWL A;  3OBF A;  4KUK A;  5J7E A;  2W3F A;  3UB9 A;  2KLI A;  3H7W A;  2R78 A;  3PBR A;  3S7N A;  3U2A A;  4BJP A;  4GS9 A;  4H6J A;  2A24 B;  3BJN A;  3CUE C;  1MC0 A;  4G3K A;  4HIA A;  2M7V A;  1XJ6 A;  4IHQ A;  3A0R A;  4CLC B;  3PBN A;  4EEU A;  2GNX A;  4L9G A;  4MMN A;  5DKK A;  1ZHH B;  3LI9 A;  2VV6 A;  5HL6 A;  2B18 A;  4HHD A;  3S7O A;  4NXE A;  2FZ0 A;  4R6L A;  3E4O A;  1P97 A;  4MDZ A;  4WLA A;  5F68 A;  4KUO A;  1T1C A;  4KQO A;  5HDS A;  3LR3 A;  2P04 A;  1F98 A;  2G7U A;  3EQU A;  3V67 A;  4P6Z M;  4LRZ E;  3T4T A;  2W3H A;  4JGP A;  4HP9 A;  2WKR A;  2CMN A;  2Z6C A;  4EQ1 A;  1G28 A;  1DRM A;  2WKQ A;  2J3T C;  2OOL A;  1ZTU A;  2QKP A;  4WF0 A;  1S1Y A;  4CLC D;  1XJ2 A;  3ULF A;  4Y3I A;  1P9R A;  2O9B A;  4HJ4 A;  2W3G A;  4FSF A;  2VZW A;  2QWS A;  3VV4 A;  3UB6 A;  3H82 A;  3T4Q A;  2EWW A;  5IS1 A;  5HWT A;  3KX0 X;  3KYQ A;  4OOM A;  4ETX A;  2V0U A;  3H9W A;  4WEL A;  2NUP C;  3MXQ A;  1S67 L;  2PDR A;  1LSV A;  3MQQ A;  1MKM A;  5HZH A;  2PT7 A;  1W63 Q;  2JKT I;  2PR6 A;  5TBM B;  4II7 A;  4GW9 A;  1YSP A;  4BBV A;  2Y79 A;  5HPI A;  1XJ4 A;  3OLO A;  3GDI A;  4F3L A;  1DP6 A;  1NLZ A;  2ZMF A;  1W63 M;  1XJ3 A;  3GEC A;  3LFV A;  4GHI B;  4EXO A;  4L9E A;  2WKP A;  1D06 A;  3MR0 A;  4LRY C;  4UQI S;  3LI8 A;  4HNB A;  4E04 A;  4OOL A;  2HJE A;  3LIB A;  1OJ5 A;  4EES A;  1N9O A;  2JKT M;  1S66 L;  4XT2 B;  1LSW A;  4UQI M;  2HV1 A;  3T4O A;  3K3D A;  2W1T B;  4MN5 A;  2O9C A;  3KYZ A;  3UMD A;  2VGL S;  5G4Y A;  3A0V A;  3A0S A;  3PBS A;  2KOI A;  4AFI A;  2XSS A;  5TBM A;  5I5L A;  1NWZ A;  2XRO A;  4BMW A;  2L4R A;  3B47 A;  1D7E A;  2JKR M;  1T1A A;  3KSH A;  4IUH A;  4LLO B;  3ZQ5 A;  4GHI A;  2D01 A;  3CAX A;  1G6O A;  4I3J A;  4LPZ A;  4MN6 A;  5J3W A;  4CLC E;  3KO6 A;  1STZ A;  1TD5 A;  2KDK A;  4R38 A;  1JNU A;  4G3W A;  2H28 A;  2O9A A;  4B93 A;  2P7J A;  3CI6 A;  2L1M A;  4PHT A;  3W2Z A;  2O99 A;  2XA7 M;  3NOP C;  2Z6D A;  3T4J A;  2W1T A;  3HCY A;  1YKD A;  1H3Q A;  2BAS A;  4B9O A;  1OT6 A;  3LIC A;  3ICY A;  2K2N A;  5F69 A;  1VHM A;  4DJ2 A;  4PKY G;  3E0Y A;  3BQA A;  4DJ3 A;  3E4P A;  3C2W A;  5EFW A;  3PBT A;  4NKP A;  4ARZ B;  3FPV A;  4G3V A;  2HJ9 C;  3EEH A;  2OAQ 1;  3S7P A;  4EEP A;  3PBQ A;  3PR6 A;  2QJ7 A;  3NJA A;  3LYX A;  3MQO A;  4FOF A;  5IU1 A;  2A24 A;  3EQV A;  4WUJ A;  1OTD A;  3LR4 A;  1VB6 A;  5HD3 A;  2LB9 A;  4ME4 A;  2A2L A;  2VA0 A;  4CLC A;  1OTA A;  3T50 A;  4CQH A;  3FG8 A;  5CX7 A;  3EOI A;  4NXB A;  1TS8 A;  3C38 A;  3CUE A;  5LBR A;  1H8M A;  2JHE A;  2K31 A;  5AVE A;  2PHY A;  3K2N A;  2PYR A;  2VV7 A;  1OT9 A;  3T4S A;  1MZU A;  3KSG A;  2HF6 A;  2D02 A;  3SW1 A;  2FH5 A;  2I9V A;  2VEA A;  5TJJ A;  3S7Q A;  5HDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...