3F1RA

Crystal structure of fgf20 dimer
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
157
structure length
157
Chain Sequence
b'PGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor 20
publication title Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 40
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3f1rA00
5F8WA 5BVPI 4OWKA 4ISRA 4I4OA 3BRFA 3OBTA 3N7KA 1AVAC 4IHZA 2Q3NB 4EFQA 3FJ9A 3UDAA 1QQKA 3W9TA 3CA3A 4DENA 1BLAA 5D62A 3FFZA 1BFFA 1G9DA 1BLDA 3T8SA 3N0KA 2X2SA 2NP0A 2KLLA 4ZBVB 2Z48A 1JY0A 1TP0A 1S0GA 4H04A 1EV2A 3CA1A 3ZC8A 3V0BB 3HBWA 1YYNA 3NBNA 1OQLB 3BTAA 4FVVA 6I1BA 4P0LA 3QR5A 1HWMB 1Q03A 2ZQOA 3LTQA 4I1EA 7I1BA 4AN6A 3P6JA 4XKIA 1D0HA 3CA6A 4GAIA 3AZWA 3BA4A 1AVXB 2MLLB 1FV2A 3AZVA 1BFBA 1V6XA 1Q1UA 3A21A 3BAGA 3OGGA 3HMYA 3JUTA 1HKNA 1ITBA 2NM1A 3FGMA 4I2SA 1QXMA 3RMYA 4J2XA 4I1BA 3Q7WA 4ZA3B 3FJHA 1DQOA 2K8RA 1TTUA 3UD7A 2KH2A 1A8DA 1AFCA 1DFQA 1TWMA 2BFHA 2QN4A 3HALA 4I4VA 1BASA 2ET2A 2Z49A 1L2HA 3FUQA 4G9NA 2D20A 2MIBA 2VU9A 4J2SA 1BA7A 4R6UB 2E4MA 3AH2A 4GOVA 5FNWA 3HSMA 3MPPG 4IY8A 3FJCA 1XZZA 1I1BA 4I3NA 1XYFA 3OGFA 1BARA 5BOWA 2KI4A 4H9WA 4ZOTA 3FJDA 4EKXB 3CQAA 1MC9A 1XHBA 1G9AA 3PG0A 3RMXA 3PMEA 4LO7C 2NTDA 2R9KB 1W3AA 3P6IA 3QYDA 3H6RB 2M49A 3BX1C 4KC3A 2WBCA 3AJ5A 2Y9XE 4QKSA 2F2FA 4P6AA 4QKRA 4G1RA 4A7KA 5G00A 4USOA 4QD2C 1SR4A 3PUBA 1MD6A 3B9UA 4IZEA 4Z8SB 2I1BA 4XFUA 1EPWA 1RMLA 4Q9GA 3PHZA 1DZDA 3RSJA 4ISQA 4J23B 4YOLA 1WBAA 4G6MA 4QBVA 3LLPA 4F34A 1ISXA 5FZZA 1PUMB 3D7WB 1SZ6B 4I96A 3FJIA 1PZZA 5FZYA 3OJMA 3H6QA 2P23A 4ZGRB 1Z2VA 3IM7A 5HPZA 3SNVA 3Q7XA 4P0JA 4LO0A 1YF8B 3NBDA 1HCDA 2UUSA 1AF9A 3MALA 4DEPA 5F8SA 5BXPA 4LO3A 5BXTA 3R4UA 4I4QA 1JT4A 4Q91A 2VUAA 4JKXB 3FJKA 4X37A 1Z4SA 2D1ZA 1W3FA 5F90A 4FGFA 5BP5A 2K43A 3BADA 3I2AA 1WBCA 9ILBA 1NUNA 3VSZA 3O4OA 5D61A 1G9BA 2X2TA 2NVHA 2BEBA 5I1BA 4GAFA 4Z9WB 2F2FC 4L4HA 3VSFA 3CRHA 4A7ZA 4I4XA 4LO1A 5BQUA 1ISZA 1E0OA 4I0YA 3FJFA 4I8MA 5DZUA 4AN7B 4JAWA 1R8NA 1S0EA 1SR4C 3WO2A 4D8HA 3IM5A 3POKA 1S0LA 4HR6C 1AVWB 2K4AB 1IT0A 3F62B 3VT2A 2YUGA 2MC2A 3CRIA 4OW4A 8I1BA 2XOAA 1Z0HA 1WD4A 3V0AB 3V0BA 5DSSB 1TWEA 1P63A 3I29B 4QC4A 4DCKC 2QYIB 3WMUA 1JLYA 1RY7A 1AVUA 3ZXGA 3O44A 3V79C 3AKGA 2DRYA 2HW9A 2HWMA 1EVTA 2ERMA 4Q9PA 3O4DA 31BIA 2GZBA 2WRYA 1JQZA 1GGPB 4OUJA 1AXMA 5E24E 4ENDA 3ZX7A 4KBBA 4KEJA 1T4QA 1FMMS 2D43A 2FDBM 2ESUA 1FWUA 5B2HA 1FMZA 2NYYA 3VT0A 3WMVA 4HJJA 4JKQA 2AXMA 1HIBA 3E8LC 4ZFUB 5BP5C 1F31A 3AJ6A 3N7JA 4G9MA 5BXRA 4ZLBB 4JPZA 1JT5A 4ZFWB 4KEKA 2D44A 1RG8A 1I1EA 1Q04A 3AH1A 3BAQA 1TOOA 1CE7B 1FGAA 4I4PA 1BFGA 4IYBA 1JT7A 1IRPA 4LO1C 5BQUC 2FFUA 4X39A 2HWAA 4ZFYB 1PC8B 4XFTA 3KMVA 4CJMA 3WO4A 2VXRA 1DJSB 1T9FA 5JLVA 3BAVA 4IY9A 3BAUA 2D7IA 3VEQA 2NZ9A 3AKIA 1RZOB 4OEFA 3IAGC 3TC2A 1DFCA 1ISVA 1ISYA 4I7IA 1DQGA 3ILAA 1DLLA 4JQ0A 4WBCA 3A07A 3N7LA 3CU1B 2F8XC 4IONA 3R4SA 4LO7B 1FV3A 2E4MC 3H6RA 2HZ9A 4L4IA 2FGFA 1II4A 1ABRB 1YXWA 3UD8A 2D23A 3RTIB 1IHKA 1DIWA 4F83A 2KI6B 4OWLA 3HN1A 4QO3A 1ISWA 1IILA 2L5XA 3BA5A 3N7MA 2Y9GA 4I37A 1G9CA 4JRAA 3ZC9A 4HA2A 4IQPA 4GP3A 2D22A 3UJ4A 4QD2B 1HWNB 1M16A 1FQ9A 2D7RA 2AQZA 1V6WA 1G82A 1NZKA 5JMCA 3O49A 4P0KA 1S0BA 3BRDA 4KEIA 5EG6C 4I6IA 3VUOA 1BFCA 2RQ9A 3CRGA 1HCEA 3NBCA 4X3AA 1FN0A 4QALA 3O3QA 1M2TB 1TFMB 1S0CA 1S0FA 1JTCA 1V6UA 3Q7YA 4OEEA 2BEAA 3JRRA 5FNXA 3BRGC 2GO2A 4PC4A 1JT3A 3WINA 1K5VA 2FO1A 3AKFA 3O5WB 1DZCA 3NBEA 3AH4A 4JP0A 3VT1A 3AKHA 3FJ8A 3RTJB 5DVHA 4EFPA 4I4YA 4LO2A 3A22A 2ZR1B 4G6JA 5D63A 2VXTI 1S0DA 1EYLA 4A7YA 2LIEA 4QBCA 5F8YA 3CAHA 4ZKTB 1FWVA 2RG9B 21BIA 1ILR1 4IZXA 4II0A 4TLPA 1ONKB 2Y9WC 4EEEB 3IIRA 4I4SA 3S8JA 1K5UA 4LO0C 4OEGA 1CVSA 1VCLA 3UD9A 4OWJA 3F1RA 5GAQA 5DUYA 3WO3A 1PUUB 1YTOA 5FZUA 3VWCA 1PWAA 1IRAX 4LO3C 1XG6A 3WA1A 4XFSA 2LIQA 4LO8B 1HWOB 4EB2B 3O4CA 1WD3A 2DS0A 4I4UA 2VLCA 41BIA 3OBRA 2DRZA 1UPSA 3BB2A 3FJEA 1J0SA 4I4RA 1YBIA 1N4KA 3EF2A 1W3GA 2RSTA 2P39A 3NJ5A 3OJVA 4D0TA 2Y9FA 3V0AA 2DREA 2VSAA 2VSEA 2ZQNA 3P53A 3CA4A 3CA5A 2KKIA 5BXSA 1IJTA 1IOBA 3WINC 3FJJA 3OJ2A 3FUOA 3IM6A 3ZXDA 3A23A 3BA7A 4GOYA 4X38A 5EC5A 4LO2C 3O4BA 2J3PA 3FJAA 3BAOA 1JLXA 2IHOA 3BAHA 3C9ZA 1V6VA 3H6SE 4EFRA 4J2KA 2FFVA 3FJBA 5EHAA 3S8KA 2Q9XA 3HOMA 3K1XA 1R8OA 2AFGA 2D24A 2IWTB 3UJ0A 4D0ZA 4USPA 4J2YA 1QQLA 2AAIB 3CA0A 1HWPB 1KNMA 3O4AA 1TIEA 3I2XA 4GP0A
chains in the Genus database with same CATH superfamily
5F8WA 5BVPI 4OWKA 4ISRA 4I4OA 3BRFA 3OBTA 3N7KA 1AVAC 4IHZA 2Q3NB 4EFQA 3FJ9A 3UDAA 1QQKA 3W9TA 3CA3A 4DENA 1BLAA 5D62A 3FFZA 1BFFA 1G9DA 1BLDA 3T8SA 3N0KA 2X2SA 2NP0A 2KLLA 4ZBVB 2Z48A 1JY0A 1TP0A 1S0GA 4H04A 1EV2A 3CA1A 3ZC8A 3V0BB 3HBWA 1YYNA 3NBNA 1OQLB 3BTAA 4FVVA 6I1BA 4P0LA 3QR5A 1HWMB 1Q03A 2ZQOA 3LTQA 4I1EA 7I1BA 4AN6A 3P6JA 4XKIA 1D0HA 3CA6A 4GAIA 3AZWA 3BA4A 1AVXB 2MLLB 1FV2A 3AZVA 1BFBA 1V6XA 1Q1UA 4MZHA 3A21A 3BAGA 3OGGA 3HMYA 3JUTA 1HKNA 1ITBA 2NM1A 3FGMA 4I2SA 1QXMA 3RMYA 4J2XA 4I1BA 3Q7WA 4ZA3B 3FJHA 1DQOA 2K8RA 1TTUA 3UD7A 4UY4A 2KH2A 1A8DA 1AFCA 1DFQA 1TWMA 2BFHA 2QN4A 3HALA 4I4VA 1BASA 2ET2A 2Z49A 1L2HA 3FUQA 4G9NA 2D20A 2MIBA 2VU9A 4J2SA 1BA7A 4R6UB 2E4MA 3AH2A 4GOVA 5FNWA 3HSMA 3MPPG 4IY8A 3FJCA 1XZZA 1I1BA 4I3NA 1XYFA 3OGFA 1BARA 5BOWA 2KI4A 4H9WA 4ZOTA 3FJDA 4EKXB 3CQAA 1MC9A 1XHBA 1G9AA 3PG0A 3RMXA 3PMEA 4LO7C 2NTDA 2R9KB 1W3AA 3P6IA 3QYDA 3H6RB 2M49A 3BX1C 4KC3A 2WBCA 3AJ5A 2Y9XE 4QKSA 2F2FA 4P6AA 4QKRA 4G1RA 4A7KA 5G00A 4USOA 4QD2C 1SR4A 3PUBA 1MD6A 3B9UA 4IZEA 4Z8SB 2I1BA 4XFUA 1EPWA 1RMLA 4Q9GA 3PHZA 1DZDA 3RSJA 4ISQA 4J23B 4YOLA 1WBAA 4G6MA 4QBVA 3LLPA 4F34A 1ISXA 5FZZA 1PUMB 3D7WB 1SZ6B 4I96A 3FJIA 1PZZA 5FZYA 3OJMA 3H6QA 2P23A 4ZGRB 1Z2VA 3IM7A 5HPZA 3SNVA 3Q7XA 4P0JA 4LO0A 1YF8B 3NBDA 1HCDA 2UUSA 1AF9A 3MALA 4DEPA 5F8SA 5BXPA 4LO3A 5BXTA 3R4UA 4I4QA 1JT4A 4Q91A 2VUAA 4JKXB 3FJKA 4X37A 1Z4SA 2D1ZA 1W3FA 5F90A 4FGFA 5BP5A 2K43A 3BADA 3I2AA 1WBCA 9ILBA 1NUNA 3VSZA 3O4OA 5D61A 1G9BA 2X2TA 2NVHA 2BEBA 5I1BA 4GAFA 4Z9WB 2NS2A 2F2FC 4L4HA 3VSFA 3CRHA 4A7ZA 4I4XA 4LO1A 5BQUA 1ISZA 1E0OA 4I0YA 3FJFA 4I8MA 5DZUA 4AN7B 4JAWA 1R8NA 1S0EA 1SR4C 3WO2A 4D8HA 3IM5A 3POKA 1S0LA 4HR6C 1AVWB 2K4AB 1IT0A 3F62B 3VT2A 2YUGA 2MC2A 3CRIA 4OW4A 8I1BA 2XOAA 1Z0HA 4MZFB 1WD4A 3V0AB 3V0BA 5DSSB 1TWEA 1P63A 3I29B 4QC4A 4DCKC 2QYIB 3WMUA 1JLYA 1RY7A 1AVUA 3ZXGA 3O44A 3V79C 3AKGA 2DRYA 2HW9A 2HWMA 1EVTA 2ERMA 4Q9PA 3O4DA 31BIA 2GZBA 2WRYA 1JQZA 1GGPB 4OUJA 1AXMA 5E24E 4ENDA 3ZX7A 4KBBA 4KEJA 1T4QA 1FMMS 2D43A 2FDBM 2ESUA 1FWUA 5B2HA 1FMZA 2NYYA 3VT0A 3WMVA 4HJJA 4JKQA 2AXMA 1HIBA 3E8LC 4ZFUB 5BP5C 1F31A 3AJ6A 3N7JA 4G9MA 5BXRA 4ZLBB 4JPZA 1JT5A 4ZFWB 4KEKA 2D44A 1RG8A 1I1EA 1Q04A 3AH1A 3BAQA 1TOOA 1CE7B 1FGAA 4I4PA 4MZGB 1BFGA 4IYBA 1JT7A 1IRPA 4LO1C 5BQUC 2FFUA 4X39A 2HWAA 4ZFYB 1PC8B 4XFTA 3KMVA 4CJMA 3WO4A 2VXRA 1DJSB 1T9FA 5JLVA 3BAVA 4IY9A 3BAUA 2D7IA 3VEQA 2NZ9A 3AKIA 1RZOB 4OEFA 3IAGC 3TC2A 1DFCA 1ISVA 1ISYA 4I7IA 1DQGA 3ILAA 1DLLA 4JQ0A 4WBCA 3A07A 3N7LA 3CU1B 2F8XC 4IONA 3R4SA 4LO7B 1FV3A 2E4MC 3H6RA 2HZ9A 4L4IA 2FGFA 1II4A 1ABRB 1YXWA 3UD8A 2D23A 3RTIB 1IHKA 1DIWA 4F83A 2KI6B 4OWLA 3HN1A 4QO3A 1ISWA 1IILA 2L5XA 3BA5A 3N7MA 2Y9GA 4I37A 1G9CA 4JRAA 3ZC9A 4HA2A 4IQPA 4GP3A 2D22A 3UJ4A 4QD2B 1HWNB 1M16A 1FQ9A 2D7RA 2AQZA 1V6WA 1G82A 1NZKA 5JMCA 3O49A 4P0KA 1S0BA 3BRDA 4KEIA 5EG6C 4I6IA 3VUOA 1BFCA 2RQ9A 3CRGA 1HCEA 3NBCA 4X3AA 1FN0A 4QALA 3O3QA 1M2TB 1TFMB 1S0CA 1S0FA 1JTCA 1V6UA 3Q7YA 4OEEA 2BEAA 3JRRA 5FNXA 3BRGC 2GO2A 4PC4A 1JT3A 3WINA 1K5VA 2FO1A 3AKFA 3O5WB 1DZCA 3NBEA 3AH4A 4JP0A 3VT1A 3AKHA 3FJ8A 3RTJB 5DVHA 4EFPA 4I4YA 4LO2A 3A22A 2ZR1B 4G6JA 5D63A 2VXTI 1S0DA 1EYLA 4A7YA 2LIEA 4QBCA 5F8YA 3CAHA 4ZKTB 1FWVA 2RG9B 21BIA 1ILR1 4IZXA 4II0A 4TLPA 1ONKB 2Y9WC 4EEEB 3IIRA 4I4SA 3S8JA 1K5UA 4LO0C 4OEGA 1CVSA 1VCLA 3UD9A 4OWJA 3F1RA 5GAQA 5DUYA 3WO3A 1PUUB 1YTOA 5FZUA 3VWCA 1PWAA 1IRAX 4LO3C 1XG6A 3WA1A 4XFSA 2LIQA 4LO8B 1HWOB 4EB2B 3O4CA 4H75A 1WD3A 2DS0A 4I4UA 2VLCA 41BIA 3OBRA 2DRZA 1UPSA 3BB2A 3FJEA 1J0SA 4I4RA 1YBIA 1N4KA 3EF2A 1W3GA 2RSTA 2P39A 3NJ5A 3OJVA 4D0TA 2Y9FA 3V0AA 2DREA 2VSAA 2VSEA 2ZQNA 3P53A 3CA4A 3CA5A 2KKIA 5BXSA 1IJTA 1IOBA 3WINC 3FJJA 3OJ2A 3FUOA 3IM6A 3ZXDA 3A23A 3BA7A 4GOYA 4X38A 5EC5A 4LO2C 3O4BA 2J3PA 3FJAA 3BAOA 1JLXA 2IHOA 3BAHA 3C9ZA 1V6VA 3H6SE 4EFRA 4J2KA 2FFVA 3FJBA 5EHAA 3S8KA 2Q9XA 3HOMA 3K1XA 1R8OA 2AFGA 2D24A 2IWTB 3UJ0A 4D0ZA 4USPA 4J2YA 1QQLA 2AAIB 3CA0A 1HWPB 1KNMA 3O4AA 1TIEA 3I2XA 4GP0A
chains in the Genus database with same CATH topology
5F8WA 5BVPI 4OWKA 4ISRA 4I4OA 3BRFA 3OBTA 3N7KA 1AVAC 4IHZA 2Q3NB 4EFQA 3FJ9A 3UDAA 1QQKA 3W9TA 3CA3A 4DENA 1BLAA 5D62A 3FFZA 1BFFA 1G9DA 1BLDA 3T8SA 3N0KA 2X2SA 2NP0A 2KLLA 4ZBVB 2Z48A 1JY0A 1TP0A 1S0GA 4H04A 1EV2A 3CA1A 3ZC8A 3V0BB 3HBWA 1YYNA 3NBNA 1OQLB 3BTAA 4FVVA 6I1BA 4P0LA 3QR5A 1HWMB 1Q03A 2ZQOA 3LTQA 4I1EA 7I1BA 4AN6A 3P6JA 4XKIA 1D0HA 3CA6A 4GAIA 3AZWA 3BA4A 1AVXB 2MLLB 1FV2A 3AZVA 1BFBA 1V6XA 1Q1UA 4MZHA 3A21A 3BAGA 3OGGA 3HMYA 3JUTA 1HKNA 1ITBA 2NM1A 3FGMA 4I2SA 1QXMA 3RMYA 4J2XA 4I1BA 3Q7WA 4ZA3B 3FJHA 1DQOA 2K8RA 1TTUA 3UD7A 4UY4A 2KH2A 1A8DA 1AFCA 1DFQA 1TWMA 2BFHA 2QN4A 3HALA 4I4VA 1BASA 2ET2A 2Z49A 1L2HA 3FUQA 4G9NA 2D20A 2MIBA 2VU9A 4J2SA 1BA7A 4R6UB 2E4MA 3AH2A 4GOVA 5FNWA 3HSMA 3MPPG 4IY8A 3FJCA 1XZZA 1I1BA 4I3NA 1XYFA 3OGFA 1BARA 5BOWA 2KI4A 4H9WA 4ZOTA 3FJDA 4EKXB 3CQAA 1MC9A 1XHBA 1G9AA 3PG0A 3RMXA 3PMEA 4LO7C 2NTDA 2R9KB 1W3AA 3P6IA 3QYDA 3H6RB 2M49A 3BX1C 4KC3A 2WBCA 3AJ5A 2Y9XE 4QKSA 2F2FA 4P6AA 4QKRA 4G1RA 4A7KA 5G00A 4USOA 4QD2C 1SR4A 3PUBA 1MD6A 3B9UA 4IZEA 4Z8SB 2I1BA 4XFUA 1EPWA 1RMLA 4Q9GA 3PHZA 1DZDA 3RSJA 4ISQA 4J23B 4YOLA 1WBAA 4G6MA 4QBVA 3LLPA 4F34A 1ISXA 5FZZA 1PUMB 3D7WB 1SZ6B 4I96A 3FJIA 1PZZA 5FZYA 3OJMA 3H6QA 2P23A 4ZGRB 1Z2VA 3IM7A 5HPZA 3SNVA 3Q7XA 4P0JA 4LO0A 1YF8B 3NBDA 1HCDA 2UUSA 1AF9A 3MALA 4DEPA 5F8SA 5BXPA 4LO3A 5BXTA 3R4UA 4I4QA 1JT4A 4Q91A 2VUAA 4JKXB 3FJKA 4X37A 1Z4SA 2D1ZA 1W3FA 5F90A 4FGFA 5BP5A 2K43A 3BADA 3I2AA 1WBCA 9ILBA 1NUNA 3VSZA 3O4OA 5D61A 1G9BA 2X2TA 2NVHA 2BEBA 5I1BA 4GAFA 4Z9WB 2NS2A 2F2FC 4L4HA 3VSFA 3CRHA 4A7ZA 4I4XA 4LO1A 5BQUA 1ISZA 1E0OA 4I0YA 3FJFA 4I8MA 5DZUA 4AN7B 4JAWA 1R8NA 1S0EA 1SR4C 3WO2A 4D8HA 3IM5A 3POKA 1S0LA 4HR6C 1AVWB 2K4AB 1IT0A 3F62B 3VT2A 2YUGA 2MC2A 3CRIA 4OW4A 8I1BA 2XOAA 1Z0HA 4MZFB 1WD4A 3V0AB 3V0BA 5DSSB 1TWEA 1P63A 3I29B 4QC4A 4DCKC 2QYIB 3WMUA 1JLYA 1RY7A 1AVUA 3ZXGA 3O44A 3V79C 3AKGA 2DRYA 2HW9A 2HWMA 1EVTA 2ERMA 4Q9PA 3O4DA 31BIA 2GZBA 2WRYA 1JQZA 1GGPB 4OUJA 1AXMA 5E24E 4ENDA 3ZX7A 4KBBA 4KEJA 1T4QA 1FMMS 2D43A 2FDBM 2ESUA 1FWUA 5B2HA 1FMZA 2NYYA 3VT0A 3WMVA 4HJJA 4JKQA 2AXMA 1HIBA 3E8LC 4ZFUB 5BP5C 1F31A 3AJ6A 3N7JA 4G9MA 5BXRA 4ZLBB 4JPZA 1JT5A 4ZFWB 4KEKA 2D44A 1RG8A 1I1EA 1Q04A 3AH1A 3BAQA 1TOOA 1CE7B 1FGAA 4I4PA 4MZGB 1BFGA 4IYBA 1JT7A 1IRPA 4LO1C 5BQUC 2FFUA 4X39A 2HWAA 4ZFYB 1PC8B 4XFTA 3KMVA 4CJMA 3WO4A 2VXRA 1DJSB 1T9FA 5JLVA 3BAVA 4IY9A 3BAUA 2D7IA 3VEQA 2NZ9A 3AKIA 1RZOB 4OEFA 3IAGC 3TC2A 1DFCA 1ISVA 1ISYA 4I7IA 1DQGA 3ILAA 1DLLA 4JQ0A 4WBCA 3A07A 3N7LA 3CU1B 2F8XC 4IONA 3R4SA 4LO7B 1FV3A 2E4MC 3H6RA 2HZ9A 4L4IA 2FGFA 1II4A 1ABRB 1YXWA 3UD8A 2D23A 3RTIB 1IHKA 1DIWA 4F83A 2KI6B 4OWLA 3HN1A 4QO3A 1ISWA 1IILA 2L5XA 3BA5A 3N7MA 2Y9GA 4I37A 1G9CA 4JRAA 3ZC9A 4HA2A 4IQPA 4GP3A 2D22A 3UJ4A 4QD2B 1HWNB 1M16A 1FQ9A 2D7RA 2AQZA 1V6WA 1G82A 1NZKA 5JMCA 3O49A 4P0KA 1S0BA 3BRDA 4KEIA 5EG6C 4I6IA 3VUOA 1BFCA 2RQ9A 3CRGA 1HCEA 3NBCA 4X3AA 1FN0A 4QALA 3O3QA 1M2TB 1TFMB 1S0CA 1S0FA 1JTCA 1V6UA 3Q7YA 4OEEA 2BEAA 3JRRA 5FNXA 3BRGC 2GO2A 4PC4A 1JT3A 3WINA 1K5VA 2FO1A 3AKFA 3O5WB 1DZCA 3NBEA 3AH4A 4JP0A 3VT1A 3AKHA 3FJ8A 3RTJB 5DVHA 4EFPA 4I4YA 4LO2A 3A22A 2ZR1B 4G6JA 5D63A 2VXTI 1S0DA 1EYLA 4A7YA 2LIEA 4QBCA 5F8YA 3CAHA 4ZKTB 1FWVA 2RG9B 21BIA 1ILR1 4IZXA 4II0A 4TLPA 1ONKB 2Y9WC 4EEEB 3IIRA 4I4SA 3S8JA 1K5UA 4LO0C 4OEGA 1CVSA 1VCLA 3UD9A 4OWJA 3F1RA 5GAQA 5DUYA 3WO3A 1PUUB 1YTOA 5FZUA 3VWCA 1PWAA 1IRAX 4LO3C 1XG6A 3WA1A 4XFSA 2LIQA 4LO8B 1HWOB 4EB2B 3O4CA 4H75A 1WD3A 2DS0A 4I4UA 2VLCA 41BIA 3OBRA 2DRZA 1UPSA 3BB2A 3FJEA 1J0SA 4I4RA 1YBIA 1N4KA 3EF2A 1W3GA 2RSTA 2P39A 3NJ5A 3OJVA 4D0TA 2Y9FA 3V0AA 2DREA 2VSAA 2VSEA 2ZQNA 3P53A 3CA4A 3CA5A 2KKIA 5BXSA 1IJTA 1IOBA 3WINC 3FJJA 3OJ2A 3FUOA 3IM6A 3ZXDA 3A23A 3BA7A 4GOYA 4X38A 5EC5A 4LO2C 3O4BA 2J3PA 3FJAA 3BAOA 1JLXA 2IHOA 3BAHA 3C9ZA 1V6VA 3H6SE 4EFRA 4J2KA 2FFVA 3FJBA 5EHAA 3S8KA 2Q9XA 3HOMA 3K1XA 1R8OA 2AFGA 2D24A 2IWTB 3UJ0A 4D0ZA 4USPA 4J2YA 1QQLA 2AAIB 3CA0A 1HWPB 1KNMA 3O4AA 1TIEA 3I2XA 4GP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F8W A;  5BVP I;  4OWK A;  4ISR A;  4I4O A;  3BRF A;  3OBT A;  3N7K A;  1AVA C;  4IHZ A;  2Q3N B;  4EFQ A;  3FJ9 A;  3UDA A;  1QQK A;  3W9T A;  3CA3 A;  4DEN A;  1BLA A;  5D62 A;  3FFZ A;  1BFF A;  1G9D A;  1BLD A;  3T8S A;  3N0K A;  2X2S A;  2NP0 A;  2KLL A;  4ZBV B;  2Z48 A;  1JY0 A;  1TP0 A;  1S0G A;  4H04 A;  1EV2 A;  3CA1 A;  3ZC8 A;  3V0B B;  3HBW A;  1YYN A;  3NBN A;  1OQL B;  3BTA A;  4FVV A;  6I1B A;  4P0L A;  3QR5 A;  1HWM B;  1Q03 A;  2ZQO A;  3LTQ A;  4I1E A;  7I1B A;  4AN6 A;  3P6J A;  4XKI A;  1D0H A;  3CA6 A;  4GAI A;  3AZW A;  3BA4 A;  1AVX B;  2MLL B;  1FV2 A;  3AZV A;  1BFB A;  1V6X A;  1Q1U A;  3A21 A;  3BAG A;  3OGG A;  3HMY A;  3JUT A;  1HKN A;  1ITB A;  2NM1 A;  3FGM A;  4I2S A;  1QXM A;  3RMY A;  4J2X A;  4I1B A;  3Q7W A;  4ZA3 B;  3FJH A;  1DQO A;  2K8R A;  1TTU A;  3UD7 A;  2KH2 A;  1A8D A;  1AFC A;  1DFQ A;  1TWM A;  2BFH A;  2QN4 A;  3HAL A;  4I4V A;  1BAS A;  2ET2 A;  2Z49 A;  1L2H A;  3FUQ A;  4G9N A;  2D20 A;  2MIB A;  2VU9 A;  4J2S A;  1BA7 A;  4R6U B;  2E4M A;  3AH2 A;  4GOV A;  5FNW A;  3HSM A;  3MPP G;  4IY8 A;  3FJC A;  1XZZ A;  1I1B A;  4I3N A;  1XYF A;  3OGF A;  1BAR A;  5BOW A;  2KI4 A;  4H9W A;  4ZOT A;  3FJD A;  4EKX B;  3CQA A;  1MC9 A;  1XHB A;  1G9A A;  3PG0 A;  3RMX A;  3PME A;  4LO7 C;  2NTD A;  2R9K B;  1W3A A;  3P6I A;  3QYD A;  3H6R B;  2M49 A;  3BX1 C;  4KC3 A;  2WBC A;  3AJ5 A;  2Y9X E;  4QKS A;  2F2F A;  4P6A A;  4QKR A;  4G1R A;  4A7K A;  5G00 A;  4USO A;  4QD2 C;  1SR4 A;  3PUB A;  1MD6 A;  3B9U A;  4IZE A;  4Z8S B;  2I1B A;  4XFU A;  1EPW A;  1RML A;  4Q9G A;  3PHZ A;  1DZD A;  3RSJ A;  4ISQ A;  4J23 B;  4YOL A;  1WBA A;  4G6M A;  4QBV A;  3LLP A;  4F34 A;  1ISX A;  5FZZ A;  1PUM B;  3D7W B;  1SZ6 B;  4I96 A;  3FJI A;  1PZZ A;  5FZY A;  3OJM A;  3H6Q A;  2P23 A;  4ZGR B;  1Z2V A;  3IM7 A;  5HPZ A;  3SNV A;  3Q7X A;  4P0J A;  4LO0 A;  1YF8 B;  3NBD A;  1HCD A;  2UUS A;  1AF9 A;  3MAL A;  4DEP A;  5F8S A;  5BXP A;  4LO3 A;  5BXT A;  3R4U A;  4I4Q A;  1JT4 A;  4Q91 A;  2VUA A;  4JKX B;  3FJK A;  4X37 A;  1Z4S A;  2D1Z A;  1W3F A;  5F90 A;  4FGF A;  5BP5 A;  2K43 A;  3BAD A;  3I2A A;  1WBC A;  9ILB A;  1NUN A;  3VSZ A;  3O4O A;  5D61 A;  1G9B A;  2X2T A;  2NVH A;  2BEB A;  5I1B A;  4GAF A;  4Z9W B;  2F2F C;  4L4H A;  3VSF A;  3CRH A;  4A7Z A;  4I4X A;  4LO1 A;  5BQU A;  1ISZ A;  1E0O A;  4I0Y A;  3FJF A;  4I8M A;  5DZU A;  4AN7 B;  4JAW A;  1R8N A;  1S0E A;  1SR4 C;  3WO2 A;  4D8H A;  3IM5 A;  3POK A;  1S0L A;  4HR6 C;  1AVW B;  2K4A B;  1IT0 A;  3F62 B;  3VT2 A;  2YUG A;  2MC2 A;  3CRI A;  4OW4 A;  8I1B A;  2XOA A;  1Z0H A;  1WD4 A;  3V0A B;  3V0B A;  5DSS B;  1TWE A;  1P63 A;  3I29 B;  4QC4 A;  4DCK C;  2QYI B;  3WMU A;  1JLY A;  1RY7 A;  1AVU A;  3ZXG A;  3O44 A;  3V79 C;  3AKG A;  2DRY A;  2HW9 A;  2HWM A;  1EVT A;  2ERM A;  4Q9P A;  3O4D A;  31BI A;  2GZB A;  2WRY A;  1JQZ A;  1GGP B;  4OUJ A;  1AXM A;  5E24 E;  4END A;  3ZX7 A;  4KBB A;  4KEJ A;  1T4Q A;  1FMM S;  2D43 A;  2FDB M;  2ESU A;  1FWU A;  5B2H A;  1FMZ A;  2NYY A;  3VT0 A;  3WMV A;  4HJJ A;  4JKQ A;  2AXM A;  1HIB A;  3E8L C;  4ZFU B;  5BP5 C;  1F31 A;  3AJ6 A;  3N7J A;  4G9M A;  5BXR A;  4ZLB B;  4JPZ A;  1JT5 A;  4ZFW B;  4KEK A;  2D44 A;  1RG8 A;  1I1E A;  1Q04 A;  3AH1 A;  3BAQ A;  1TOO A;  1CE7 B;  1FGA A;  4I4P A;  1BFG A;  4IYB A;  1JT7 A;  1IRP A;  4LO1 C;  5BQU C;  2FFU A;  4X39 A;  2HWA A;  4ZFY B;  1PC8 B;  4XFT A;  3KMV A;  4CJM A;  3WO4 A;  2VXR A;  1DJS B;  1T9F A;  5JLV A;  3BAV A;  4IY9 A;  3BAU A;  2D7I A;  3VEQ A;  2NZ9 A;  3AKI A;  1RZO B;  4OEF A;  3IAG C;  3TC2 A;  1DFC A;  1ISV A;  1ISY A;  4I7I A;  1DQG A;  3ILA A;  1DLL A;  4JQ0 A;  4WBC A;  3A07 A;  3N7L A;  3CU1 B;  2F8X C;  4ION A;  3R4S A;  4LO7 B;  1FV3 A;  2E4M C;  3H6R A;  2HZ9 A;  4L4I A;  2FGF A;  1II4 A;  1ABR B;  1YXW A;  3UD8 A;  2D23 A;  3RTI B;  1IHK A;  1DIW A;  4F83 A;  2KI6 B;  4OWL A;  3HN1 A;  4QO3 A;  1ISW A;  1IIL A;  2L5X A;  3BA5 A;  3N7M A;  2Y9G A;  4I37 A;  1G9C A;  4JRA A;  3ZC9 A;  4HA2 A;  4IQP A;  4GP3 A;  2D22 A;  3UJ4 A;  4QD2 B;  1HWN B;  1M16 A;  1FQ9 A;  2D7R A;  2AQZ A;  1V6W A;  1G82 A;  1NZK A;  5JMC A;  3O49 A;  4P0K A;  1S0B A;  3BRD A;  4KEI A;  5EG6 C;  4I6I A;  3VUO A;  1BFC A;  2RQ9 A;  3CRG A;  1HCE A;  3NBC A;  4X3A A;  1FN0 A;  4QAL A;  3O3Q A;  1M2T B;  1TFM B;  1S0C A;  1S0F A;  1JTC A;  1V6U A;  3Q7Y A;  4OEE A;  2BEA A;  3JRR A;  5FNX A;  3BRG C;  2GO2 A;  4PC4 A;  1JT3 A;  3WIN A;  1K5V A;  2FO1 A;  3AKF A;  3O5W B;  1DZC A;  3NBE A;  3AH4 A;  4JP0 A;  3VT1 A;  3AKH A;  3FJ8 A;  3RTJ B;  5DVH A;  4EFP A;  4I4Y A;  4LO2 A;  3A22 A;  2ZR1 B;  4G6J A;  5D63 A;  2VXT I;  1S0D A;  1EYL A;  4A7Y A;  2LIE A;  4QBC A;  5F8Y A;  3CAH A;  4ZKT B;  1FWV A;  2RG9 B;  21BI A;  1ILR 1;  4IZX A;  4II0 A;  4TLP A;  1ONK B;  2Y9W C;  4EEE B;  3IIR A;  4I4S A;  3S8J A;  1K5U A;  4LO0 C;  4OEG A;  1CVS A;  1VCL A;  3UD9 A;  4OWJ A;  3F1R A;  5GAQ A;  5DUY A;  3WO3 A;  1PUU B;  1YTO A;  5FZU A;  3VWC A;  1PWA A;  1IRA X;  4LO3 C;  1XG6 A;  3WA1 A;  4XFS A;  2LIQ A;  4LO8 B;  1HWO B;  4EB2 B;  3O4C A;  1WD3 A;  2DS0 A;  4I4U A;  2VLC A;  41BI A;  3OBR A;  2DRZ A;  1UPS A;  3BB2 A;  3FJE A;  1J0S A;  4I4R A;  1YBI A;  1N4K A;  3EF2 A;  1W3G A;  2RST A;  2P39 A;  3NJ5 A;  3OJV A;  4D0T A;  2Y9F A;  3V0A A;  2DRE A;  2VSA A;  2VSE A;  2ZQN A;  3P53 A;  3CA4 A;  3CA5 A;  2KKI A;  5BXS A;  1IJT A;  1IOB A;  3WIN C;  3FJJ A;  3OJ2 A;  3FUO A;  3IM6 A;  3ZXD A;  3A23 A;  3BA7 A;  4GOY A;  4X38 A;  5EC5 A;  4LO2 C;  3O4B A;  2J3P A;  3FJA A;  3BAO A;  1JLX A;  2IHO A;  3BAH A;  3C9Z A;  1V6V A;  3H6S E;  4EFR A;  4J2K A;  2FFV A;  3FJB A;  5EHA A;  3S8K A;  2Q9X A;  3HOM A;  3K1X A;  1R8O A;  2AFG A;  2D24 A;  2IWT B;  3UJ0 A;  4D0Z A;  4USP A;  4J2Y A;  1QQL A;  2AAI B;  3CA0 A;  1HWP B;  1KNM A;  3O4A A;  1TIE A;  3I2X A;  4GP0 A; 
#chains in the Genus database with same CATH topology
 5F8W A;  5BVP I;  4OWK A;  4ISR A;  4I4O A;  3BRF A;  3OBT A;  3N7K A;  1AVA C;  4IHZ A;  2Q3N B;  4EFQ A;  3FJ9 A;  3UDA A;  1QQK A;  3W9T A;  3CA3 A;  4DEN A;  1BLA A;  5D62 A;  3FFZ A;  1BFF A;  1G9D A;  1BLD A;  3T8S A;  3N0K A;  2X2S A;  2NP0 A;  2KLL A;  4ZBV B;  2Z48 A;  1JY0 A;  1TP0 A;  1S0G A;  4H04 A;  1EV2 A;  3CA1 A;  3ZC8 A;  3V0B B;  3HBW A;  1YYN A;  3NBN A;  1OQL B;  3BTA A;  4FVV A;  6I1B A;  4P0L A;  3QR5 A;  1HWM B;  1Q03 A;  2ZQO A;  3LTQ A;  4I1E A;  7I1B A;  4AN6 A;  3P6J A;  4XKI A;  1D0H A;  3CA6 A;  4GAI A;  3AZW A;  3BA4 A;  1AVX B;  2MLL B;  1FV2 A;  3AZV A;  1BFB A;  1V6X A;  1Q1U A;  4MZH A;  3A21 A;  3BAG A;  3OGG A;  3HMY A;  3JUT A;  1HKN A;  1ITB A;  2NM1 A;  3FGM A;  4I2S A;  1QXM A;  3RMY A;  4J2X A;  4I1B A;  3Q7W A;  4ZA3 B;  3FJH A;  1DQO A;  2K8R A;  1TTU A;  3UD7 A;  4UY4 A;  2KH2 A;  1A8D A;  1AFC A;  1DFQ A;  1TWM A;  2BFH A;  2QN4 A;  3HAL A;  4I4V A;  1BAS A;  2ET2 A;  2Z49 A;  1L2H A;  3FUQ A;  4G9N A;  2D20 A;  2MIB A;  2VU9 A;  4J2S A;  1BA7 A;  4R6U B;  2E4M A;  3AH2 A;  4GOV A;  5FNW A;  3HSM A;  3MPP G;  4IY8 A;  3FJC A;  1XZZ A;  1I1B A;  4I3N A;  1XYF A;  3OGF A;  1BAR A;  5BOW A;  2KI4 A;  4H9W A;  4ZOT A;  3FJD A;  4EKX B;  3CQA A;  1MC9 A;  1XHB A;  1G9A A;  3PG0 A;  3RMX A;  3PME A;  4LO7 C;  2NTD A;  2R9K B;  1W3A A;  3P6I A;  3QYD A;  3H6R B;  2M49 A;  3BX1 C;  4KC3 A;  2WBC A;  3AJ5 A;  2Y9X E;  4QKS A;  2F2F A;  4P6A A;  4QKR A;  4G1R A;  4A7K A;  5G00 A;  4USO A;  4QD2 C;  1SR4 A;  3PUB A;  1MD6 A;  3B9U A;  4IZE A;  4Z8S B;  2I1B A;  4XFU A;  1EPW A;  1RML A;  4Q9G A;  3PHZ A;  1DZD A;  3RSJ A;  4ISQ A;  4J23 B;  4YOL A;  1WBA A;  4G6M A;  4QBV A;  3LLP A;  4F34 A;  1ISX A;  5FZZ A;  1PUM B;  3D7W B;  1SZ6 B;  4I96 A;  3FJI A;  1PZZ A;  5FZY A;  3OJM A;  3H6Q A;  2P23 A;  4ZGR B;  1Z2V A;  3IM7 A;  5HPZ A;  3SNV A;  3Q7X A;  4P0J A;  4LO0 A;  1YF8 B;  3NBD A;  1HCD A;  2UUS A;  1AF9 A;  3MAL A;  4DEP A;  5F8S A;  5BXP A;  4LO3 A;  5BXT A;  3R4U A;  4I4Q A;  1JT4 A;  4Q91 A;  2VUA A;  4JKX B;  3FJK A;  4X37 A;  1Z4S A;  2D1Z A;  1W3F A;  5F90 A;  4FGF A;  5BP5 A;  2K43 A;  3BAD A;  3I2A A;  1WBC A;  9ILB A;  1NUN A;  3VSZ A;  3O4O A;  5D61 A;  1G9B A;  2X2T A;  2NVH A;  2BEB A;  5I1B A;  4GAF A;  4Z9W B;  2NS2 A;  2F2F C;  4L4H A;  3VSF A;  3CRH A;  4A7Z A;  4I4X A;  4LO1 A;  5BQU A;  1ISZ A;  1E0O A;  4I0Y A;  3FJF A;  4I8M A;  5DZU A;  4AN7 B;  4JAW A;  1R8N A;  1S0E A;  1SR4 C;  3WO2 A;  4D8H A;  3IM5 A;  3POK A;  1S0L A;  4HR6 C;  1AVW B;  2K4A B;  1IT0 A;  3F62 B;  3VT2 A;  2YUG A;  2MC2 A;  3CRI A;  4OW4 A;  8I1B A;  2XOA A;  1Z0H A;  4MZF B;  1WD4 A;  3V0A B;  3V0B A;  5DSS B;  1TWE A;  1P63 A;  3I29 B;  4QC4 A;  4DCK C;  2QYI B;  3WMU A;  1JLY A;  1RY7 A;  1AVU A;  3ZXG A;  3O44 A;  3V79 C;  3AKG A;  2DRY A;  2HW9 A;  2HWM A;  1EVT A;  2ERM A;  4Q9P A;  3O4D A;  31BI A;  2GZB A;  2WRY A;  1JQZ A;  1GGP B;  4OUJ A;  1AXM A;  5E24 E;  4END A;  3ZX7 A;  4KBB A;  4KEJ A;  1T4Q A;  1FMM S;  2D43 A;  2FDB M;  2ESU A;  1FWU A;  5B2H A;  1FMZ A;  2NYY A;  3VT0 A;  3WMV A;  4HJJ A;  4JKQ A;  2AXM A;  1HIB A;  3E8L C;  4ZFU B;  5BP5 C;  1F31 A;  3AJ6 A;  3N7J A;  4G9M A;  5BXR A;  4ZLB B;  4JPZ A;  1JT5 A;  4ZFW B;  4KEK A;  2D44 A;  1RG8 A;  1I1E A;  1Q04 A;  3AH1 A;  3BAQ A;  1TOO A;  1CE7 B;  1FGA A;  4I4P A;  4MZG B;  1BFG A;  4IYB A;  1JT7 A;  1IRP A;  4LO1 C;  5BQU C;  2FFU A;  4X39 A;  2HWA A;  4ZFY B;  1PC8 B;  4XFT A;  3KMV A;  4CJM A;  3WO4 A;  2VXR A;  1DJS B;  1T9F A;  5JLV A;  3BAV A;  4IY9 A;  3BAU A;  2D7I A;  3VEQ A;  2NZ9 A;  3AKI A;  1RZO B;  4OEF A;  3IAG C;  3TC2 A;  1DFC A;  1ISV A;  1ISY A;  4I7I A;  1DQG A;  3ILA A;  1DLL A;  4JQ0 A;  4WBC A;  3A07 A;  3N7L A;  3CU1 B;  2F8X C;  4ION A;  3R4S A;  4LO7 B;  1FV3 A;  2E4M C;  3H6R A;  2HZ9 A;  4L4I A;  2FGF A;  1II4 A;  1ABR B;  1YXW A;  3UD8 A;  2D23 A;  3RTI B;  1IHK A;  1DIW A;  4F83 A;  2KI6 B;  4OWL A;  3HN1 A;  4QO3 A;  1ISW A;  1IIL A;  2L5X A;  3BA5 A;  3N7M A;  2Y9G A;  4I37 A;  1G9C A;  4JRA A;  3ZC9 A;  4HA2 A;  4IQP A;  4GP3 A;  2D22 A;  3UJ4 A;  4QD2 B;  1HWN B;  1M16 A;  1FQ9 A;  2D7R A;  2AQZ A;  1V6W A;  1G82 A;  1NZK A;  5JMC A;  3O49 A;  4P0K A;  1S0B A;  3BRD A;  4KEI A;  5EG6 C;  4I6I A;  3VUO A;  1BFC A;  2RQ9 A;  3CRG A;  1HCE A;  3NBC A;  4X3A A;  1FN0 A;  4QAL A;  3O3Q A;  1M2T B;  1TFM B;  1S0C A;  1S0F A;  1JTC A;  1V6U A;  3Q7Y A;  4OEE A;  2BEA A;  3JRR A;  5FNX A;  3BRG C;  2GO2 A;  4PC4 A;  1JT3 A;  3WIN A;  1K5V A;  2FO1 A;  3AKF A;  3O5W B;  1DZC A;  3NBE A;  3AH4 A;  4JP0 A;  3VT1 A;  3AKH A;  3FJ8 A;  3RTJ B;  5DVH A;  4EFP A;  4I4Y A;  4LO2 A;  3A22 A;  2ZR1 B;  4G6J A;  5D63 A;  2VXT I;  1S0D A;  1EYL A;  4A7Y A;  2LIE A;  4QBC A;  5F8Y A;  3CAH A;  4ZKT B;  1FWV A;  2RG9 B;  21BI A;  1ILR 1;  4IZX A;  4II0 A;  4TLP A;  1ONK B;  2Y9W C;  4EEE B;  3IIR A;  4I4S A;  3S8J A;  1K5U A;  4LO0 C;  4OEG A;  1CVS A;  1VCL A;  3UD9 A;  4OWJ A;  3F1R A;  5GAQ A;  5DUY A;  3WO3 A;  1PUU B;  1YTO A;  5FZU A;  3VWC A;  1PWA A;  1IRA X;  4LO3 C;  1XG6 A;  3WA1 A;  4XFS A;  2LIQ A;  4LO8 B;  1HWO B;  4EB2 B;  3O4C A;  4H75 A;  1WD3 A;  2DS0 A;  4I4U A;  2VLC A;  41BI A;  3OBR A;  2DRZ A;  1UPS A;  3BB2 A;  3FJE A;  1J0S A;  4I4R A;  1YBI A;  1N4K A;  3EF2 A;  1W3G A;  2RST A;  2P39 A;  3NJ5 A;  3OJV A;  4D0T A;  2Y9F A;  3V0A A;  2DRE A;  2VSA A;  2VSE A;  2ZQN A;  3P53 A;  3CA4 A;  3CA5 A;  2KKI A;  5BXS A;  1IJT A;  1IOB A;  3WIN C;  3FJJ A;  3OJ2 A;  3FUO A;  3IM6 A;  3ZXD A;  3A23 A;  3BA7 A;  4GOY A;  4X38 A;  5EC5 A;  4LO2 C;  3O4B A;  2J3P A;  3FJA A;  3BAO A;  1JLX A;  2IHO A;  3BAH A;  3C9Z A;  1V6V A;  3H6S E;  4EFR A;  4J2K A;  2FFV A;  3FJB A;  5EHA A;  3S8K A;  2Q9X A;  3HOM A;  3K1X A;  1R8O A;  2AFG A;  2D24 A;  2IWT B;  3UJ0 A;  4D0Z A;  4USP A;  4J2Y A;  1QQL A;  2AAI B;  3CA0 A;  1HWP B;  1KNM A;  3O4A A;  1TIE A;  3I2X A;  4GP0 A; 
#chains in the Genus database with same CATH homology
 5F8W A;  5BVP I;  4OWK A;  4ISR A;  4I4O A;  3BRF A;  3OBT A;  3N7K A;  1AVA C;  4IHZ A;  2Q3N B;  4EFQ A;  3FJ9 A;  3UDA A;  1QQK A;  3W9T A;  3CA3 A;  4DEN A;  1BLA A;  5D62 A;  3FFZ A;  1BFF A;  1G9D A;  1BLD A;  3T8S A;  3N0K A;  2X2S A;  2NP0 A;  2KLL A;  4ZBV B;  2Z48 A;  1JY0 A;  1TP0 A;  1S0G A;  4H04 A;  1EV2 A;  3CA1 A;  3ZC8 A;  3V0B B;  3HBW A;  1YYN A;  3NBN A;  1OQL B;  3BTA A;  4FVV A;  6I1B A;  4P0L A;  3QR5 A;  1HWM B;  1Q03 A;  2ZQO A;  3LTQ A;  4I1E A;  7I1B A;  4AN6 A;  3P6J A;  4XKI A;  1D0H A;  3CA6 A;  4GAI A;  3AZW A;  3BA4 A;  1AVX B;  2MLL B;  1FV2 A;  3AZV A;  1BFB A;  1V6X A;  1Q1U A;  4MZH A;  3A21 A;  3BAG A;  3OGG A;  3HMY A;  3JUT A;  1HKN A;  1ITB A;  2NM1 A;  3FGM A;  4I2S A;  1QXM A;  3RMY A;  4J2X A;  4I1B A;  3Q7W A;  4ZA3 B;  3FJH A;  1DQO A;  2K8R A;  1TTU A;  3UD7 A;  4UY4 A;  2KH2 A;  1A8D A;  1AFC A;  1DFQ A;  1TWM A;  2BFH A;  2QN4 A;  3HAL A;  4I4V A;  1BAS A;  2ET2 A;  2Z49 A;  1L2H A;  3FUQ A;  4G9N A;  2D20 A;  2MIB A;  2VU9 A;  4J2S A;  1BA7 A;  4R6U B;  2E4M A;  3AH2 A;  4GOV A;  5FNW A;  3HSM A;  3MPP G;  4IY8 A;  3FJC A;  1XZZ A;  1I1B A;  4I3N A;  1XYF A;  3OGF A;  1BAR A;  5BOW A;  2KI4 A;  4H9W A;  4ZOT A;  3FJD A;  4EKX B;  3CQA A;  1MC9 A;  1XHB A;  1G9A A;  3PG0 A;  3RMX A;  3PME A;  4LO7 C;  2NTD A;  2R9K B;  1W3A A;  3P6I A;  3QYD A;  3H6R B;  2M49 A;  3BX1 C;  4KC3 A;  2WBC A;  3AJ5 A;  2Y9X E;  4QKS A;  2F2F A;  4P6A A;  4QKR A;  4G1R A;  4A7K A;  5G00 A;  4USO A;  4QD2 C;  1SR4 A;  3PUB A;  1MD6 A;  3B9U A;  4IZE A;  4Z8S B;  2I1B A;  4XFU A;  1EPW A;  1RML A;  4Q9G A;  3PHZ A;  1DZD A;  3RSJ A;  4ISQ A;  4J23 B;  4YOL A;  1WBA A;  4G6M A;  4QBV A;  3LLP A;  4F34 A;  1ISX A;  5FZZ A;  1PUM B;  3D7W B;  1SZ6 B;  4I96 A;  3FJI A;  1PZZ A;  5FZY A;  3OJM A;  3H6Q A;  2P23 A;  4ZGR B;  1Z2V A;  3IM7 A;  5HPZ A;  3SNV A;  3Q7X A;  4P0J A;  4LO0 A;  1YF8 B;  3NBD A;  1HCD A;  2UUS A;  1AF9 A;  3MAL A;  4DEP A;  5F8S A;  5BXP A;  4LO3 A;  5BXT A;  3R4U A;  4I4Q A;  1JT4 A;  4Q91 A;  2VUA A;  4JKX B;  3FJK A;  4X37 A;  1Z4S A;  2D1Z A;  1W3F A;  5F90 A;  4FGF A;  5BP5 A;  2K43 A;  3BAD A;  3I2A A;  1WBC A;  9ILB A;  1NUN A;  3VSZ A;  3O4O A;  5D61 A;  1G9B A;  2X2T A;  2NVH A;  2BEB A;  5I1B A;  4GAF A;  4Z9W B;  2NS2 A;  2F2F C;  4L4H A;  3VSF A;  3CRH A;  4A7Z A;  4I4X A;  4LO1 A;  5BQU A;  1ISZ A;  1E0O A;  4I0Y A;  3FJF A;  4I8M A;  5DZU A;  4AN7 B;  4JAW A;  1R8N A;  1S0E A;  1SR4 C;  3WO2 A;  4D8H A;  3IM5 A;  3POK A;  1S0L A;  4HR6 C;  1AVW B;  2K4A B;  1IT0 A;  3F62 B;  3VT2 A;  2YUG A;  2MC2 A;  3CRI A;  4OW4 A;  8I1B A;  2XOA A;  1Z0H A;  4MZF B;  1WD4 A;  3V0A B;  3V0B A;  5DSS B;  1TWE A;  1P63 A;  3I29 B;  4QC4 A;  4DCK C;  2QYI B;  3WMU A;  1JLY A;  1RY7 A;  1AVU A;  3ZXG A;  3O44 A;  3V79 C;  3AKG A;  2DRY A;  2HW9 A;  2HWM A;  1EVT A;  2ERM A;  4Q9P A;  3O4D A;  31BI A;  2GZB A;  2WRY A;  1JQZ A;  1GGP B;  4OUJ A;  1AXM A;  5E24 E;  4END A;  3ZX7 A;  4KBB A;  4KEJ A;  1T4Q A;  1FMM S;  2D43 A;  2FDB M;  2ESU A;  1FWU A;  5B2H A;  1FMZ A;  2NYY A;  3VT0 A;  3WMV A;  4HJJ A;  4JKQ A;  2AXM A;  1HIB A;  3E8L C;  4ZFU B;  5BP5 C;  1F31 A;  3AJ6 A;  3N7J A;  4G9M A;  5BXR A;  4ZLB B;  4JPZ A;  1JT5 A;  4ZFW B;  4KEK A;  2D44 A;  1RG8 A;  1I1E A;  1Q04 A;  3AH1 A;  3BAQ A;  1TOO A;  1CE7 B;  1FGA A;  4I4P A;  4MZG B;  1BFG A;  4IYB A;  1JT7 A;  1IRP A;  4LO1 C;  5BQU C;  2FFU A;  4X39 A;  2HWA A;  4ZFY B;  1PC8 B;  4XFT A;  3KMV A;  4CJM A;  3WO4 A;  2VXR A;  1DJS B;  1T9F A;  5JLV A;  3BAV A;  4IY9 A;  3BAU A;  2D7I A;  3VEQ A;  2NZ9 A;  3AKI A;  1RZO B;  4OEF A;  3IAG C;  3TC2 A;  1DFC A;  1ISV A;  1ISY A;  4I7I A;  1DQG A;  3ILA A;  1DLL A;  4JQ0 A;  4WBC A;  3A07 A;  3N7L A;  3CU1 B;  2F8X C;  4ION A;  3R4S A;  4LO7 B;  1FV3 A;  2E4M C;  3H6R A;  2HZ9 A;  4L4I A;  2FGF A;  1II4 A;  1ABR B;  1YXW A;  3UD8 A;  2D23 A;  3RTI B;  1IHK A;  1DIW A;  4F83 A;  2KI6 B;  4OWL A;  3HN1 A;  4QO3 A;  1ISW A;  1IIL A;  2L5X A;  3BA5 A;  3N7M A;  2Y9G A;  4I37 A;  1G9C A;  4JRA A;  3ZC9 A;  4HA2 A;  4IQP A;  4GP3 A;  2D22 A;  3UJ4 A;  4QD2 B;  1HWN B;  1M16 A;  1FQ9 A;  2D7R A;  2AQZ A;  1V6W A;  1G82 A;  1NZK A;  5JMC A;  3O49 A;  4P0K A;  1S0B A;  3BRD A;  4KEI A;  5EG6 C;  4I6I A;  3VUO A;  1BFC A;  2RQ9 A;  3CRG A;  1HCE A;  3NBC A;  4X3A A;  1FN0 A;  4QAL A;  3O3Q A;  1M2T B;  1TFM B;  1S0C A;  1S0F A;  1JTC A;  1V6U A;  3Q7Y A;  4OEE A;  2BEA A;  3JRR A;  5FNX A;  3BRG C;  2GO2 A;  4PC4 A;  1JT3 A;  3WIN A;  1K5V A;  2FO1 A;  3AKF A;  3O5W B;  1DZC A;  3NBE A;  3AH4 A;  4JP0 A;  3VT1 A;  3AKH A;  3FJ8 A;  3RTJ B;  5DVH A;  4EFP A;  4I4Y A;  4LO2 A;  3A22 A;  2ZR1 B;  4G6J A;  5D63 A;  2VXT I;  1S0D A;  1EYL A;  4A7Y A;  2LIE A;  4QBC A;  5F8Y A;  3CAH A;  4ZKT B;  1FWV A;  2RG9 B;  21BI A;  1ILR 1;  4IZX A;  4II0 A;  4TLP A;  1ONK B;  2Y9W C;  4EEE B;  3IIR A;  4I4S A;  3S8J A;  1K5U A;  4LO0 C;  4OEG A;  1CVS A;  1VCL A;  3UD9 A;  4OWJ A;  3F1R A;  5GAQ A;  5DUY A;  3WO3 A;  1PUU B;  1YTO A;  5FZU A;  3VWC A;  1PWA A;  1IRA X;  4LO3 C;  1XG6 A;  3WA1 A;  4XFS A;  2LIQ A;  4LO8 B;  1HWO B;  4EB2 B;  3O4C A;  4H75 A;  1WD3 A;  2DS0 A;  4I4U A;  2VLC A;  41BI A;  3OBR A;  2DRZ A;  1UPS A;  3BB2 A;  3FJE A;  1J0S A;  4I4R A;  1YBI A;  1N4K A;  3EF2 A;  1W3G A;  2RST A;  2P39 A;  3NJ5 A;  3OJV A;  4D0T A;  2Y9F A;  3V0A A;  2DRE A;  2VSA A;  2VSE A;  2ZQN A;  3P53 A;  3CA4 A;  3CA5 A;  2KKI A;  5BXS A;  1IJT A;  1IOB A;  3WIN C;  3FJJ A;  3OJ2 A;  3FUO A;  3IM6 A;  3ZXD A;  3A23 A;  3BA7 A;  4GOY A;  4X38 A;  5EC5 A;  4LO2 C;  3O4B A;  2J3P A;  3FJA A;  3BAO A;  1JLX A;  2IHO A;  3BAH A;  3C9Z A;  1V6V A;  3H6S E;  4EFR A;  4J2K A;  2FFV A;  3FJB A;  5EHA A;  3S8K A;  2Q9X A;  3HOM A;  3K1X A;  1R8O A;  2AFG A;  2D24 A;  2IWT B;  3UJ0 A;  4D0Z A;  4USP A;  4J2Y A;  1QQL A;  2AAI B;  3CA0 A;  1HWP B;  1KNM A;  3O4A A;  1TIE A;  3I2X A;  4GP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...