3F1RA

Crystal structure of fgf20 dimer
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
157
structure length
157
Chain Sequence
PGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
pubmed doi rcsb
molecule keywords Fibroblast growth factor 20
molecule tags Hormone
source organism Homo sapiens
total genus 40
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3f1rA00
2D7IA 3FJAA 2D23A 2ZR1B 1S0LA 4HA2A 3N0KA 4YOLA 1XHBA 1A8DA 3TC2A 3OJVA 3UD8A 3IM5A 5FNWA 2DRYA 1IT0A 1XYFA 3FJHA 3FJJA 2LIEA 3RSJA 1R8OA 3VT0A 4IQPA 1XZZA 4L4HA 4A7KA 4I7IA 5D63A 3IM6A 1G82A 4GP3A 2VXTI 4QD2C 1IRPA 1JLYA 2LIQA 1AVUA 1FN0A 4JPZA 3O3QA 1E0OA 6I1BA 2NP0A 2F2FC 1IHKA 3FJKA 3OBTA 3OJ2A 3VWCA 1CE7B 3UJ0A 2Q3NB 3WINC 5FZUA 2XOAA 4ZOTA 1J0SA 1HIBA 4IONA 1FWVA 4QO3A 3PUBA 4JP0A 4QALA 3FJIA 3FJDA 3B9UA 1YTOA 5JLVA 2DREA 1JLXA 1TWMA 4II0A 4LO7B 2ET2A 4FGFA 4ISRA 3FGMA 4KEJA 1W3FA 1FWUA 4GP0A 2GZBA 4Q9GA 5I1BA 2E4MC 4LO1C 4P0JA 2Z48A 1GGPB 1PUMB 3S8JA 3VUOA 3BRGC 2K4AB 1QQLA 1AF9A 5D61A 3RTIB 3PHZA 2BEBA 3BADA 1HCDA 1I1BA 2L5XA 4Q91A 3P53A 1JT3A 3I2XA 2HZ9A 4LO0A 1DFQA 4USPA 3ZC9A 3HOMA 3I2AA 1FMZA 3O4BA 4AN6A 4X38A 1BLDA 2DS0A 3AKGA 3WA1A 3E8LC 4TLPA 3N7MA 1M16A 3HN1A 2KLLA 4I4SA 3K1XA 4QBCA 1HWPB 3MALA 1BLAA 4OEFA 1IRAX 1MD6A 1NZKA 2Q9XA 2DRZA 3D7WB 3HBWA 1ISYA 3IM7A 3CAHA 5EHAA 4EFQA 2F8XC 1T9FA 1K5VA 4I2SA 3FFZA 3AH2A 2KI4A 4FVVA 1NUNA 1N4KA 3PG0A 1S0GA 4ZKTB 4A7ZA 2AAIB 1Q03A 4D8HA 1I1EA 2ESUA 1SZ6B 2D44A 5E24E 2M49A 4F34A 4I4QA 1W3AA 4LO2A 3SNVA 4I4XA 4DEPA 3BX1C 2FFVA 3NJ5A 4KEIA 9ILBA 2BFHA 2MC2A 1RMLA 5BP5A 3UD7A 5BQUC 1SR4A 3VT1A 3QYDA 2QN4A 1WD3A 1YYNA 2D24A 1G9DA 4GOYA 4I6IA 31BIA 3NBNA 5FNXA 3FJBA 4I4UA 1HKNA 1EYLA 4G6MA 4QD2B 2P23A 3NBEA 3ZX7A 2ZQNA 2RG9B 4KEKA 4OEEA 4PC4A 1S0BA 3A21A 4OUJA 3LTQA 3WO3A 5BXPA 4IYBA 3VSZA 3CRHA 5DZUA 3F62B 2VUAA 1V6XA 3BB2A 3WMVA 5D62A 2D22A 3ZXDA 3N7JA 2D1ZA 2KI6B 1CVSA 3NBDA 2VSAA 41BIA 3ZC8A 1II4A 4LO3C 1Z0HA 2X2TA 3FJ9A 2Z49A 4I4RA 5EG6C 2NZ9A 4J23B 1JQZA 1TP0A 3AH4A 3CU1B 2E4MA 1IJTA 4LO1A 3CA0A 3BAQA 1ISZA 1BA7A 4XFSA 1ITBA 4EEEB 3A22A 2NVHA 1XG6A 3AZVA 5BXSA 4I3NA 2IWTB 3LLPA 3CRIA 2HWAA 3PMEA 2D7RA 1Q1UA 4ZA3B 2FGFA 3HMYA 4ZLBB 4IZXA 1ONKB 2K43A 4DCKC 5BOWA 1ISWA 2BEAA 2I1BA 3A23A 3FUOA 1BASA 4I96A 5G00A 1AVWB 1AVXB 2J3PA 3HALA 1EVTA 4ZFWB 3P6JA 2KH2A 2MLLB 1ABRB 4QC4A 1D0HA 1K5UA 3H6QA 4WBCA 3Q7WA 3BA5A 7I1BA 1P63A 1JY0A 4KBBA 1JT5A 4LO8B 4DENA 2R9KB 4QBVA 2P39A 5EC5A 3F1RA 3BAVA 3H6SE 3VEQA 2Y9GA 3IAGC 1FV3A 3BRFA 4R6UB 2HW9A 5BXTA 3BAUA 3RMYA 1KNMA 1Z4SA 2NTDA 3FJCA 3OBRA 3WMUA 2FO1A 2GO2A 4P6AA 4KC3A 4I37A 5BQUA 1EV2A 1Q04A 3Q7YA 4LO0C 4CJMA 3BAOA 4J2YA 2YUGA 4J2SA 3V0BA 3WO2A 1WBAA 4I4PA 3NBCA 1IILA 3I29B 1AVAC 3V0BB 1FQ9A 1QXMA 4G6JA 1VCLA 3BTAA 3KMVA 1T4QA 3BA7A 4ZGRB 4ZBVB 1TFMB 1DZCA 3JUTA 3VT2A 2AQZA 1BFCA 3R4UA 3V0AA 1DLLA 1PUUB 4ISQA 3QR5A 4USOA 2VSEA 3OGGA 2D20A 3C9ZA 5JMCA 3V0AB 1ISVA 4LO2C 1S0CA 3N7KA 3CA4A 1V6UA 2WBCA 1G9CA 2WRYA 1V6WA 2D43A 2F2FA 1HWMB 1TIEA 4JKQA 4IY8A 4I4OA 5HPZA 1G9AA 4JRAA 4J2KA 5BP5C 1W3GA 1OQLB 3AKFA 3T8SA 4Q9PA 5F8YA 1SR4C 5FZZA 3WINA 4XFTA 1YF8B 2Y9FA 1WBCA 2NYYA 3OGFA 2FDBM 1YXWA 3CA3A 2ZQOA 4I1BA 4OW4A 4I0YA 1RY7A 3O49A 3HSMA 4I4YA 4LO3A 1F31A 1ILR1 3AKIA 1V6VA 4Z8SB 4OWLA 1M2TB 1S0FA 3FUQA 3CRGA 4JAWA 4D0ZA 1G9BA 1DQOA 4I8MA 1BFGA 3UD9A 3S8KA 4JQ0A 1MC9A 4AN7B 5B2HA 2UUSA 3CA1A 5GAQA 4F83A 4JKXB 4EB2B 5BXRA 8I1BA 5DUYA 2RQ9A 2Y9XE 3JRRA 4X39A 1DZDA 3AZWA 3MPPG 1BFFA 4P0LA 4XFUA 3POKA 2IHOA 1AFCA 2X2SA 3O4DA 4H9WA 4GAIA 1WD4A 2ERMA 2AFGA 4EKXB 2AXMA 4A7YA 3ILAA 3CQAA 1YBIA 4G9NA 3FJFA 1JTCA 5F8SA 2VU9A 4LO7C 3AKHA 1JT4A 1RG8A 1JT7A 3R4SA 1BARA 3IIRA 1DFCA 5DSSB 1BFBA 3AJ6A 1RZOB 4Z9WB 1DQGA 1TWEA 4I1EA 3W9TA 3RTJB 2QYIB 4L4IA 4G1RA 1S0DA 2KKIA 3Q7XA 2VLCA 4OWKA 1DJSB 3UJ4A 3VSFA 5BVPI 3A07A 1TOOA 3FJEA 1TTUA 1DIWA 4G9MA 1HWNB 4I4VA 4QKRA 4HJJA 3O5WB 4EFRA 3N7LA 1HCEA 4ENDA 3O44A 1L2HA 3O4CA 4ZFYB 3EF2A 1PZZA 1FGAA 3H6RA 1FV2A 1PC8B 1PWAA 4X37A 5F90A 1Z2VA 1ISXA 5F8WA 2FFUA 1R8NA 3H6RB 4IZEA 3CA6A 1IOBA 3AJ5A 2RSTA 4ZFUB 3BA4A 3BRDA 3BAHA 1S0EA 4HR6C 4EFPA 4IY9A 4OEGA 2NM1A 3WO4A 3O4OA 3FJ8A 1QQKA 1FMMS 3UDAA 4D0TA 4J2XA 1HWOB 5FZYA 4XKIA 4H04A 2MIBA 4IHZA 1UPSA 3P6IA 4P0KA 4X3AA 2K8RA 4GOVA 4QKSA 3CA5A 4OWJA 2Y9WC 3BAGA 2HWMA 5DVHA 1AXMA 4GAFA 3ZXGA 3AH1A 21BIA 3O4AA 3V79C 3RMXA 1EPWA 3OJMA 2VXRA
chains in the Genus database with same CATH superfamily
2D7IA 3FJAA 2D23A 2ZR1B 1S0LA 4HA2A 3N0KA 4YOLA 1XHBA 1A8DA 3TC2A 3OJVA 3UD8A 3IM5A 5FNWA 2DRYA 1IT0A 1XYFA 3FJHA 3FJJA 2LIEA 3RSJA 1R8OA 3VT0A 4IQPA 1XZZA 4L4HA 4A7KA 4I7IA 5D63A 3IM6A 1G82A 4GP3A 2VXTI 4QD2C 1IRPA 1JLYA 2LIQA 1AVUA 1FN0A 4JPZA 3O3QA 1E0OA 6I1BA 2NP0A 2F2FC 1IHKA 3FJKA 3OBTA 3OJ2A 3VWCA 1CE7B 3UJ0A 2Q3NB 3WINC 5FZUA 2XOAA 4ZOTA 1J0SA 1HIBA 4IONA 1FWVA 4QO3A 3PUBA 4JP0A 4QALA 3FJIA 3FJDA 3B9UA 1YTOA 5JLVA 2DREA 1JLXA 4UY4A 1TWMA 4II0A 4LO7B 2ET2A 4FGFA 4ISRA 3FGMA 4KEJA 1W3FA 1FWUA 4GP0A 2GZBA 4Q9GA 5I1BA 2E4MC 4LO1C 4P0JA 2Z48A 1GGPB 1PUMB 3S8JA 3VUOA 3BRGC 2K4AB 1QQLA 1AF9A 5D61A 3RTIB 3PHZA 2BEBA 3BADA 1HCDA 1I1BA 2L5XA 4MZFB 3P53A 4Q91A 1JT3A 3I2XA 2HZ9A 4LO0A 1DFQA 4USPA 3ZC9A 3HOMA 3I2AA 1FMZA 3O4BA 4AN6A 4X38A 1BLDA 2DS0A 3AKGA 3WA1A 3E8LC 4TLPA 3N7MA 1M16A 3HN1A 2KLLA 4I4SA 3K1XA 4QBCA 1HWPB 3MALA 1BLAA 4OEFA 1IRAX 1MD6A 1NZKA 2Q9XA 2DRZA 3D7WB 3HBWA 1ISYA 3IM7A 3CAHA 5EHAA 4EFQA 2F8XC 1T9FA 1K5VA 4I2SA 3FFZA 3AH2A 2KI4A 4FVVA 1NUNA 1N4KA 3PG0A 1S0GA 4ZKTB 4A7ZA 2AAIB 1Q03A 4D8HA 1I1EA 2ESUA 1SZ6B 2D44A 5E24E 2M49A 4F34A 4I4QA 1W3AA 4LO2A 3SNVA 4I4XA 4DEPA 4MZHA 3BX1C 2FFVA 3NJ5A 4KEIA 9ILBA 2BFHA 2MC2A 1RMLA 5BP5A 3UD7A 5BQUC 1SR4A 3VT1A 3QYDA 2QN4A 1WD3A 1YYNA 2D24A 1G9DA 4GOYA 4I6IA 31BIA 3NBNA 5FNXA 3FJBA 4I4UA 1HKNA 1EYLA 4G6MA 4QD2B 2P23A 3NBEA 3ZX7A 2ZQNA 2RG9B 4KEKA 4OEEA 4PC4A 1S0BA 3A21A 4OUJA 3LTQA 3WO3A 5BXPA 4IYBA 3VSZA 3CRHA 5DZUA 3F62B 2VUAA 4H75A 1V6XA 3BB2A 3WMVA 5D62A 2D22A 3ZXDA 3N7JA 2D1ZA 2KI6B 1CVSA 3NBDA 2VSAA 41BIA 3ZC8A 1II4A 4LO3C 1Z0HA 2X2TA 3FJ9A 2Z49A 4I4RA 5EG6C 2NZ9A 4J23B 1JQZA 1TP0A 3AH4A 3CU1B 2E4MA 1IJTA 4LO1A 3CA0A 3BAQA 1ISZA 1BA7A 4XFSA 1ITBA 4EEEB 3A22A 2NVHA 1XG6A 3AZVA 5BXSA 4I3NA 2IWTB 3LLPA 3CRIA 2HWAA 3PMEA 2D7RA 1Q1UA 4ZA3B 2FGFA 3HMYA 4ZLBB 4IZXA 1ONKB 2K43A 4DCKC 5BOWA 1ISWA 2BEAA 2I1BA 3A23A 2NS2A 1BASA 3FUOA 4I96A 5G00A 1AVWB 1AVXB 2J3PA 3HALA 1EVTA 4ZFWB 3P6JA 2KH2A 2MLLB 1ABRB 4QC4A 1D0HA 1K5UA 3H6QA 4WBCA 3Q7WA 3BA5A 7I1BA 1P63A 1JY0A 4KBBA 1JT5A 4LO8B 4DENA 2R9KB 4QBVA 2P39A 5EC5A 3F1RA 3BAVA 3H6SE 3VEQA 2Y9GA 3IAGC 1FV3A 3BRFA 4R6UB 2HW9A 5BXTA 3BAUA 3RMYA 1KNMA 1Z4SA 2NTDA 3FJCA 3OBRA 3WMUA 2FO1A 2GO2A 4P6AA 4KC3A 4I37A 5BQUA 1EV2A 1Q04A 3Q7YA 4LO0C 4CJMA 3BAOA 4J2YA 2YUGA 4J2SA 3V0BA 3WO2A 1WBAA 4I4PA 3NBCA 1IILA 3I29B 1AVAC 3V0BB 1FQ9A 1QXMA 4G6JA 1VCLA 3BTAA 3KMVA 1T4QA 3BA7A 4ZGRB 4ZBVB 1TFMB 1DZCA 3JUTA 3VT2A 2AQZA 1BFCA 3R4UA 3V0AA 1DLLA 1PUUB 4ISQA 3QR5A 4USOA 2VSEA 3OGGA 2D20A 3C9ZA 5JMCA 3V0AB 1ISVA 4LO2C 1S0CA 3N7KA 3CA4A 1V6UA 2WBCA 1G9CA 2WRYA 1V6WA 2D43A 2F2FA 1HWMB 1TIEA 4JKQA 4IY8A 4I4OA 5HPZA 1G9AA 4JRAA 4J2KA 5BP5C 1W3GA 1OQLB 3AKFA 3T8SA 4Q9PA 5F8YA 1SR4C 5FZZA 3WINA 4XFTA 1YF8B 2Y9FA 1WBCA 2NYYA 3OGFA 2FDBM 1YXWA 4MZGB 3CA3A 2ZQOA 4I1BA 4OW4A 4I0YA 1RY7A 3O49A 3HSMA 4I4YA 4LO3A 1F31A 1ILR1 3AKIA 1V6VA 4Z8SB 4OWLA 1M2TB 1S0FA 3FUQA 3CRGA 4JAWA 4D0ZA 1G9BA 1DQOA 4I8MA 1BFGA 3UD9A 3S8KA 4JQ0A 1MC9A 4AN7B 5B2HA 2UUSA 3CA1A 5GAQA 4F83A 4JKXB 4EB2B 5BXRA 8I1BA 5DUYA 2RQ9A 2Y9XE 3JRRA 4X39A 1DZDA 3AZWA 3MPPG 1BFFA 4P0LA 4XFUA 3POKA 2IHOA 1AFCA 2X2SA 3O4DA 4H9WA 4GAIA 1WD4A 2ERMA 2AFGA 4EKXB 2AXMA 4A7YA 3ILAA 3CQAA 1YBIA 4G9NA 3FJFA 1JTCA 5F8SA 2VU9A 4LO7C 3AKHA 1JT4A 1RG8A 1JT7A 3R4SA 1BARA 3IIRA 1DFCA 5DSSB 1BFBA 3AJ6A 1RZOB 4Z9WB 1DQGA 1TWEA 4I1EA 3W9TA 3RTJB 2QYIB 4L4IA 4G1RA 1S0DA 2KKIA 3Q7XA 2VLCA 4OWKA 1DJSB 3UJ4A 3VSFA 5BVPI 3A07A 1TOOA 3FJEA 1TTUA 1DIWA 4G9MA 1HWNB 4I4VA 4QKRA 4HJJA 3O5WB 4EFRA 3N7LA 1HCEA 4ENDA 3O44A 1L2HA 3O4CA 4ZFYB 3EF2A 1PZZA 1FGAA 3H6RA 1FV2A 1PC8B 1PWAA 4X37A 5F90A 1Z2VA 1ISXA 5F8WA 2FFUA 1R8NA 3H6RB 4IZEA 3CA6A 1IOBA 3AJ5A 2RSTA 4ZFUB 3BA4A 3BRDA 3BAHA 1S0EA 4HR6C 4EFPA 4IY9A 4OEGA 2NM1A 3WO4A 3O4OA 3FJ8A 1QQKA 1FMMS 3UDAA 4D0TA 4J2XA 1HWOB 5FZYA 4XKIA 4H04A 2MIBA 4IHZA 1UPSA 3P6IA 4P0KA 4X3AA 2K8RA 4GOVA 4QKSA 3CA5A 4OWJA 2Y9WC 3BAGA 2HWMA 5DVHA 1AXMA 4GAFA 3ZXGA 3AH1A 21BIA 3O4AA 3V79C 3RMXA 1EPWA 3OJMA 2VXRA
chains in the Genus database with same CATH topology
2D7IA 3FJAA 2D23A 2ZR1B 1S0LA 4HA2A 3N0KA 4YOLA 1XHBA 1A8DA 3TC2A 3OJVA 3UD8A 3IM5A 5FNWA 2DRYA 1IT0A 1XYFA 3FJHA 3FJJA 2LIEA 3RSJA 1R8OA 3VT0A 4IQPA 1XZZA 4L4HA 4A7KA 4I7IA 5D63A 3IM6A 1G82A 4GP3A 2VXTI 4QD2C 1IRPA 1JLYA 2LIQA 1AVUA 1FN0A 4JPZA 3O3QA 1E0OA 6I1BA 2NP0A 2F2FC 1IHKA 3FJKA 3OBTA 3OJ2A 3VWCA 1CE7B 3UJ0A 2Q3NB 3WINC 5FZUA 2XOAA 4ZOTA 1J0SA 1HIBA 4IONA 1FWVA 4QO3A 3PUBA 4JP0A 4QALA 3FJIA 3FJDA 3B9UA 1YTOA 5JLVA 2DREA 1JLXA 4UY4A 1TWMA 4II0A 4LO7B 2ET2A 4FGFA 4ISRA 3FGMA 4KEJA 1W3FA 1FWUA 4GP0A 2GZBA 4Q9GA 5I1BA 2E4MC 4LO1C 4P0JA 2Z48A 1GGPB 1PUMB 3S8JA 3VUOA 3BRGC 2K4AB 1QQLA 1AF9A 5D61A 3RTIB 3PHZA 2BEBA 3BADA 1HCDA 1I1BA 2L5XA 4MZFB 3P53A 4Q91A 1JT3A 3I2XA 2HZ9A 4LO0A 1DFQA 4USPA 3ZC9A 3HOMA 3I2AA 1FMZA 3O4BA 4AN6A 4X38A 1BLDA 2DS0A 3AKGA 3WA1A 3E8LC 4TLPA 3N7MA 1M16A 3HN1A 2KLLA 4I4SA 3K1XA 4QBCA 1HWPB 3MALA 1BLAA 4OEFA 1IRAX 1MD6A 1NZKA 2Q9XA 2DRZA 3D7WB 3HBWA 1ISYA 3IM7A 3CAHA 5EHAA 4EFQA 2F8XC 1T9FA 1K5VA 4I2SA 3FFZA 3AH2A 2KI4A 4FVVA 1NUNA 1N4KA 3PG0A 1S0GA 4ZKTB 4A7ZA 2AAIB 1Q03A 4D8HA 1I1EA 2ESUA 1SZ6B 2D44A 5E24E 2M49A 4F34A 4I4QA 1W3AA 4LO2A 3SNVA 4I4XA 4DEPA 4MZHA 3BX1C 2FFVA 3NJ5A 4KEIA 9ILBA 2BFHA 2MC2A 1RMLA 5BP5A 3UD7A 5BQUC 1SR4A 3VT1A 3QYDA 2QN4A 1WD3A 1YYNA 2D24A 1G9DA 4GOYA 4I6IA 31BIA 3NBNA 5FNXA 3FJBA 4I4UA 1HKNA 1EYLA 4G6MA 4QD2B 2P23A 3NBEA 3ZX7A 2ZQNA 2RG9B 4KEKA 4OEEA 4PC4A 1S0BA 3A21A 4OUJA 3LTQA 3WO3A 5BXPA 4IYBA 3VSZA 3CRHA 5DZUA 3F62B 2VUAA 4H75A 1V6XA 3BB2A 3WMVA 5D62A 2D22A 3ZXDA 3N7JA 2D1ZA 2KI6B 1CVSA 3NBDA 2VSAA 41BIA 3ZC8A 1II4A 4LO3C 1Z0HA 2X2TA 3FJ9A 2Z49A 4I4RA 5EG6C 2NZ9A 4J23B 1JQZA 1TP0A 3AH4A 3CU1B 2E4MA 1IJTA 4LO1A 3CA0A 3BAQA 1ISZA 1BA7A 4XFSA 1ITBA 4EEEB 3A22A 2NVHA 1XG6A 3AZVA 5BXSA 4I3NA 2IWTB 3LLPA 3CRIA 2HWAA 3PMEA 2D7RA 1Q1UA 4ZA3B 2FGFA 3HMYA 4ZLBB 4IZXA 1ONKB 2K43A 4DCKC 5BOWA 1ISWA 2BEAA 2I1BA 3A23A 2NS2A 1BASA 3FUOA 4I96A 5G00A 1AVWB 1AVXB 2J3PA 3HALA 1EVTA 4ZFWB 3P6JA 2KH2A 2MLLB 1ABRB 4QC4A 1D0HA 1K5UA 3H6QA 4WBCA 3Q7WA 3BA5A 7I1BA 1P63A 1JY0A 4KBBA 1JT5A 4LO8B 4DENA 2R9KB 4QBVA 2P39A 5EC5A 3F1RA 3BAVA 3H6SE 3VEQA 2Y9GA 3IAGC 1FV3A 3BRFA 4R6UB 2HW9A 5BXTA 3BAUA 3RMYA 1KNMA 1Z4SA 2NTDA 3FJCA 3OBRA 3WMUA 2FO1A 2GO2A 4P6AA 4KC3A 4I37A 5BQUA 1EV2A 1Q04A 3Q7YA 4LO0C 4CJMA 3BAOA 4J2YA 2YUGA 4J2SA 3V0BA 3WO2A 1WBAA 4I4PA 3NBCA 1IILA 3I29B 1AVAC 3V0BB 1FQ9A 1QXMA 4G6JA 1VCLA 3BTAA 3KMVA 1T4QA 3BA7A 4ZGRB 4ZBVB 1TFMB 1DZCA 3JUTA 3VT2A 2AQZA 1BFCA 3R4UA 3V0AA 1DLLA 1PUUB 4ISQA 3QR5A 4USOA 2VSEA 3OGGA 2D20A 3C9ZA 5JMCA 3V0AB 1ISVA 4LO2C 1S0CA 3N7KA 3CA4A 1V6UA 2WBCA 1G9CA 2WRYA 1V6WA 2D43A 2F2FA 1HWMB 1TIEA 4JKQA 4IY8A 4I4OA 5HPZA 1G9AA 4JRAA 4J2KA 5BP5C 1W3GA 1OQLB 3AKFA 3T8SA 4Q9PA 5F8YA 1SR4C 5FZZA 3WINA 4XFTA 1YF8B 2Y9FA 1WBCA 2NYYA 3OGFA 2FDBM 1YXWA 4MZGB 3CA3A 2ZQOA 4I1BA 4OW4A 4I0YA 1RY7A 3O49A 3HSMA 4I4YA 4LO3A 1F31A 1ILR1 3AKIA 1V6VA 4Z8SB 4OWLA 1M2TB 1S0FA 3FUQA 3CRGA 4JAWA 4D0ZA 1G9BA 1DQOA 4I8MA 1BFGA 3UD9A 3S8KA 4JQ0A 1MC9A 4AN7B 5B2HA 2UUSA 3CA1A 5GAQA 4F83A 4JKXB 4EB2B 5BXRA 8I1BA 5DUYA 2RQ9A 2Y9XE 3JRRA 4X39A 1DZDA 3AZWA 3MPPG 1BFFA 4P0LA 4XFUA 3POKA 2IHOA 1AFCA 2X2SA 3O4DA 4H9WA 4GAIA 1WD4A 2ERMA 2AFGA 4EKXB 2AXMA 4A7YA 3ILAA 3CQAA 1YBIA 4G9NA 3FJFA 1JTCA 5F8SA 2VU9A 4LO7C 3AKHA 1JT4A 1RG8A 1JT7A 3R4SA 1BARA 3IIRA 1DFCA 5DSSB 1BFBA 3AJ6A 1RZOB 4Z9WB 1DQGA 1TWEA 4I1EA 3W9TA 3RTJB 2QYIB 4L4IA 4G1RA 1S0DA 2KKIA 3Q7XA 2VLCA 4OWKA 1DJSB 3UJ4A 3VSFA 5BVPI 3A07A 1TOOA 3FJEA 1TTUA 1DIWA 4G9MA 1HWNB 4I4VA 4QKRA 4HJJA 3O5WB 4EFRA 3N7LA 1HCEA 4ENDA 3O44A 1L2HA 3O4CA 4ZFYB 3EF2A 1PZZA 1FGAA 3H6RA 1FV2A 1PC8B 1PWAA 4X37A 5F90A 1Z2VA 1ISXA 5F8WA 2FFUA 1R8NA 3H6RB 4IZEA 3CA6A 1IOBA 3AJ5A 2RSTA 4ZFUB 3BA4A 3BRDA 3BAHA 1S0EA 4HR6C 4EFPA 4IY9A 4OEGA 2NM1A 3WO4A 3O4OA 3FJ8A 1QQKA 1FMMS 3UDAA 4D0TA 4J2XA 1HWOB 5FZYA 4XKIA 4H04A 2MIBA 4IHZA 1UPSA 3P6IA 4P0KA 4X3AA 2K8RA 4GOVA 4QKSA 3CA5A 4OWJA 2Y9WC 3BAGA 2HWMA 5DVHA 1AXMA 4GAFA 3ZXGA 3AH1A 21BIA 3O4AA 3V79C 3RMXA 1EPWA 3OJMA 2VXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7I A;  3FJA A;  2D23 A;  2ZR1 B;  1S0L A;  4HA2 A;  3N0K A;  4YOL A;  1XHB A;  1A8D A;  3TC2 A;  3OJV A;  3UD8 A;  3IM5 A;  5FNW A;  2DRY A;  1IT0 A;  1XYF A;  3FJH A;  3FJJ A;  2LIE A;  3RSJ A;  1R8O A;  3VT0 A;  4IQP A;  1XZZ A;  4L4H A;  4A7K A;  4I7I A;  5D63 A;  3IM6 A;  1G82 A;  4GP3 A;  2VXT I;  4QD2 C;  1IRP A;  1JLY A;  2LIQ A;  1AVU A;  1FN0 A;  4JPZ A;  3O3Q A;  1E0O A;  6I1B A;  2NP0 A;  2F2F C;  1IHK A;  3FJK A;  3OBT A;  3OJ2 A;  3VWC A;  1CE7 B;  3UJ0 A;  2Q3N B;  3WIN C;  5FZU A;  2XOA A;  4ZOT A;  1J0S A;  1HIB A;  4ION A;  1FWV A;  4QO3 A;  3PUB A;  4JP0 A;  4QAL A;  3FJI A;  3FJD A;  3B9U A;  1YTO A;  5JLV A;  2DRE A;  1JLX A;  1TWM A;  4II0 A;  4LO7 B;  2ET2 A;  4FGF A;  4ISR A;  3FGM A;  4KEJ A;  1W3F A;  1FWU A;  4GP0 A;  2GZB A;  4Q9G A;  5I1B A;  2E4M C;  4LO1 C;  4P0J A;  2Z48 A;  1GGP B;  1PUM B;  3S8J A;  3VUO A;  3BRG C;  2K4A B;  1QQL A;  1AF9 A;  5D61 A;  3RTI B;  3PHZ A;  2BEB A;  3BAD A;  1HCD A;  1I1B A;  2L5X A;  4Q91 A;  3P53 A;  1JT3 A;  3I2X A;  2HZ9 A;  4LO0 A;  1DFQ A;  4USP A;  3ZC9 A;  3HOM A;  3I2A A;  1FMZ A;  3O4B A;  4AN6 A;  4X38 A;  1BLD A;  2DS0 A;  3AKG A;  3WA1 A;  3E8L C;  4TLP A;  3N7M A;  1M16 A;  3HN1 A;  2KLL A;  4I4S A;  3K1X A;  4QBC A;  1HWP B;  3MAL A;  1BLA A;  4OEF A;  1IRA X;  1MD6 A;  1NZK A;  2Q9X A;  2DRZ A;  3D7W B;  3HBW A;  1ISY A;  3IM7 A;  3CAH A;  5EHA A;  4EFQ A;  2F8X C;  1T9F A;  1K5V A;  4I2S A;  3FFZ A;  3AH2 A;  2KI4 A;  4FVV A;  1NUN A;  1N4K A;  3PG0 A;  1S0G A;  4ZKT B;  4A7Z A;  2AAI B;  1Q03 A;  4D8H A;  1I1E A;  2ESU A;  1SZ6 B;  2D44 A;  5E24 E;  2M49 A;  4F34 A;  4I4Q A;  1W3A A;  4LO2 A;  3SNV A;  4I4X A;  4DEP A;  3BX1 C;  2FFV A;  3NJ5 A;  4KEI A;  9ILB A;  2BFH A;  2MC2 A;  1RML A;  5BP5 A;  3UD7 A;  5BQU C;  1SR4 A;  3VT1 A;  3QYD A;  2QN4 A;  1WD3 A;  1YYN A;  2D24 A;  1G9D A;  4GOY A;  4I6I A;  31BI A;  3NBN A;  5FNX A;  3FJB A;  4I4U A;  1HKN A;  1EYL A;  4G6M A;  4QD2 B;  2P23 A;  3NBE A;  3ZX7 A;  2ZQN A;  2RG9 B;  4KEK A;  4OEE A;  4PC4 A;  1S0B A;  3A21 A;  4OUJ A;  3LTQ A;  3WO3 A;  5BXP A;  4IYB A;  3VSZ A;  3CRH A;  5DZU A;  3F62 B;  2VUA A;  1V6X A;  3BB2 A;  3WMV A;  5D62 A;  2D22 A;  3ZXD A;  3N7J A;  2D1Z A;  2KI6 B;  1CVS A;  3NBD A;  2VSA A;  41BI A;  3ZC8 A;  1II4 A;  4LO3 C;  1Z0H A;  2X2T A;  3FJ9 A;  2Z49 A;  4I4R A;  5EG6 C;  2NZ9 A;  4J23 B;  1JQZ A;  1TP0 A;  3AH4 A;  3CU1 B;  2E4M A;  1IJT A;  4LO1 A;  3CA0 A;  3BAQ A;  1ISZ A;  1BA7 A;  4XFS A;  1ITB A;  4EEE B;  3A22 A;  2NVH A;  1XG6 A;  3AZV A;  5BXS A;  4I3N A;  2IWT B;  3LLP A;  3CRI A;  2HWA A;  3PME A;  2D7R A;  1Q1U A;  4ZA3 B;  2FGF A;  3HMY A;  4ZLB B;  4IZX A;  1ONK B;  2K43 A;  4DCK C;  5BOW A;  1ISW A;  2BEA A;  2I1B A;  3A23 A;  3FUO A;  1BAS A;  4I96 A;  5G00 A;  1AVW B;  1AVX B;  2J3P A;  3HAL A;  1EVT A;  4ZFW B;  3P6J A;  2KH2 A;  2MLL B;  1ABR B;  4QC4 A;  1D0H A;  1K5U A;  3H6Q A;  4WBC A;  3Q7W A;  3BA5 A;  7I1B A;  1P63 A;  1JY0 A;  4KBB A;  1JT5 A;  4LO8 B;  4DEN A;  2R9K B;  4QBV A;  2P39 A;  5EC5 A;  3F1R A;  3BAV A;  3H6S E;  3VEQ A;  2Y9G A;  3IAG C;  1FV3 A;  3BRF A;  4R6U B;  2HW9 A;  5BXT A;  3BAU A;  3RMY A;  1KNM A;  1Z4S A;  2NTD A;  3FJC A;  3OBR A;  3WMU A;  2FO1 A;  2GO2 A;  4P6A A;  4KC3 A;  4I37 A;  5BQU A;  1EV2 A;  1Q04 A;  3Q7Y A;  4LO0 C;  4CJM A;  3BAO A;  4J2Y A;  2YUG A;  4J2S A;  3V0B A;  3WO2 A;  1WBA A;  4I4P A;  3NBC A;  1IIL A;  3I29 B;  1AVA C;  3V0B B;  1FQ9 A;  1QXM A;  4G6J A;  1VCL A;  3BTA A;  3KMV A;  1T4Q A;  3BA7 A;  4ZGR B;  4ZBV B;  1TFM B;  1DZC A;  3JUT A;  3VT2 A;  2AQZ A;  1BFC A;  3R4U A;  3V0A A;  1DLL A;  1PUU B;  4ISQ A;  3QR5 A;  4USO A;  2VSE A;  3OGG A;  2D20 A;  3C9Z A;  5JMC A;  3V0A B;  1ISV A;  4LO2 C;  1S0C A;  3N7K A;  3CA4 A;  1V6U A;  2WBC A;  1G9C A;  2WRY A;  1V6W A;  2D43 A;  2F2F A;  1HWM B;  1TIE A;  4JKQ A;  4IY8 A;  4I4O A;  5HPZ A;  1G9A A;  4JRA A;  4J2K A;  5BP5 C;  1W3G A;  1OQL B;  3AKF A;  3T8S A;  4Q9P A;  5F8Y A;  1SR4 C;  5FZZ A;  3WIN A;  4XFT A;  1YF8 B;  2Y9F A;  1WBC A;  2NYY A;  3OGF A;  2FDB M;  1YXW A;  3CA3 A;  2ZQO A;  4I1B A;  4OW4 A;  4I0Y A;  1RY7 A;  3O49 A;  3HSM A;  4I4Y A;  4LO3 A;  1F31 A;  1ILR 1;  3AKI A;  1V6V A;  4Z8S B;  4OWL A;  1M2T B;  1S0F A;  3FUQ A;  3CRG A;  4JAW A;  4D0Z A;  1G9B A;  1DQO A;  4I8M A;  1BFG A;  3UD9 A;  3S8K A;  4JQ0 A;  1MC9 A;  4AN7 B;  5B2H A;  2UUS A;  3CA1 A;  5GAQ A;  4F83 A;  4JKX B;  4EB2 B;  5BXR A;  8I1B A;  5DUY A;  2RQ9 A;  2Y9X E;  3JRR A;  4X39 A;  1DZD A;  3AZW A;  3MPP G;  1BFF A;  4P0L A;  4XFU A;  3POK A;  2IHO A;  1AFC A;  2X2S A;  3O4D A;  4H9W A;  4GAI A;  1WD4 A;  2ERM A;  2AFG A;  4EKX B;  2AXM A;  4A7Y A;  3ILA A;  3CQA A;  1YBI A;  4G9N A;  3FJF A;  1JTC A;  5F8S A;  2VU9 A;  4LO7 C;  3AKH A;  1JT4 A;  1RG8 A;  1JT7 A;  3R4S A;  1BAR A;  3IIR A;  1DFC A;  5DSS B;  1BFB A;  3AJ6 A;  1RZO B;  4Z9W B;  1DQG A;  1TWE A;  4I1E A;  3W9T A;  3RTJ B;  2QYI B;  4L4I A;  4G1R A;  1S0D A;  2KKI A;  3Q7X A;  2VLC A;  4OWK A;  1DJS B;  3UJ4 A;  3VSF A;  5BVP I;  3A07 A;  1TOO A;  3FJE A;  1TTU A;  1DIW A;  4G9M A;  1HWN B;  4I4V A;  4QKR A;  4HJJ A;  3O5W B;  4EFR A;  3N7L A;  1HCE A;  4END A;  3O44 A;  1L2H A;  3O4C A;  4ZFY B;  3EF2 A;  1PZZ A;  1FGA A;  3H6R A;  1FV2 A;  1PC8 B;  1PWA A;  4X37 A;  5F90 A;  1Z2V A;  1ISX A;  5F8W A;  2FFU A;  1R8N A;  3H6R B;  4IZE A;  3CA6 A;  1IOB A;  3AJ5 A;  2RST A;  4ZFU B;  3BA4 A;  3BRD A;  3BAH A;  1S0E A;  4HR6 C;  4EFP A;  4IY9 A;  4OEG A;  2NM1 A;  3WO4 A;  3O4O A;  3FJ8 A;  1QQK A;  1FMM S;  3UDA A;  4D0T A;  4J2X A;  1HWO B;  5FZY A;  4XKI A;  4H04 A;  2MIB A;  4IHZ A;  1UPS A;  3P6I A;  4P0K A;  4X3A A;  2K8R A;  4GOV A;  4QKS A;  3CA5 A;  4OWJ A;  2Y9W C;  3BAG A;  2HWM A;  5DVH A;  1AXM A;  4GAF A;  3ZXG A;  3AH1 A;  21BI A;  3O4A A;  3V79 C;  3RMX A;  1EPW A;  3OJM A;  2VXR A; 
#chains in the Genus database with same CATH topology
 2D7I A;  3FJA A;  2D23 A;  2ZR1 B;  1S0L A;  4HA2 A;  3N0K A;  4YOL A;  1XHB A;  1A8D A;  3TC2 A;  3OJV A;  3UD8 A;  3IM5 A;  5FNW A;  2DRY A;  1IT0 A;  1XYF A;  3FJH A;  3FJJ A;  2LIE A;  3RSJ A;  1R8O A;  3VT0 A;  4IQP A;  1XZZ A;  4L4H A;  4A7K A;  4I7I A;  5D63 A;  3IM6 A;  1G82 A;  4GP3 A;  2VXT I;  4QD2 C;  1IRP A;  1JLY A;  2LIQ A;  1AVU A;  1FN0 A;  4JPZ A;  3O3Q A;  1E0O A;  6I1B A;  2NP0 A;  2F2F C;  1IHK A;  3FJK A;  3OBT A;  3OJ2 A;  3VWC A;  1CE7 B;  3UJ0 A;  2Q3N B;  3WIN C;  5FZU A;  2XOA A;  4ZOT A;  1J0S A;  1HIB A;  4ION A;  1FWV A;  4QO3 A;  3PUB A;  4JP0 A;  4QAL A;  3FJI A;  3FJD A;  3B9U A;  1YTO A;  5JLV A;  2DRE A;  1JLX A;  4UY4 A;  1TWM A;  4II0 A;  4LO7 B;  2ET2 A;  4FGF A;  4ISR A;  3FGM A;  4KEJ A;  1W3F A;  1FWU A;  4GP0 A;  2GZB A;  4Q9G A;  5I1B A;  2E4M C;  4LO1 C;  4P0J A;  2Z48 A;  1GGP B;  1PUM B;  3S8J A;  3VUO A;  3BRG C;  2K4A B;  1QQL A;  1AF9 A;  5D61 A;  3RTI B;  3PHZ A;  2BEB A;  3BAD A;  1HCD A;  1I1B A;  2L5X A;  4MZF B;  3P53 A;  4Q91 A;  1JT3 A;  3I2X A;  2HZ9 A;  4LO0 A;  1DFQ A;  4USP A;  3ZC9 A;  3HOM A;  3I2A A;  1FMZ A;  3O4B A;  4AN6 A;  4X38 A;  1BLD A;  2DS0 A;  3AKG A;  3WA1 A;  3E8L C;  4TLP A;  3N7M A;  1M16 A;  3HN1 A;  2KLL A;  4I4S A;  3K1X A;  4QBC A;  1HWP B;  3MAL A;  1BLA A;  4OEF A;  1IRA X;  1MD6 A;  1NZK A;  2Q9X A;  2DRZ A;  3D7W B;  3HBW A;  1ISY A;  3IM7 A;  3CAH A;  5EHA A;  4EFQ A;  2F8X C;  1T9F A;  1K5V A;  4I2S A;  3FFZ A;  3AH2 A;  2KI4 A;  4FVV A;  1NUN A;  1N4K A;  3PG0 A;  1S0G A;  4ZKT B;  4A7Z A;  2AAI B;  1Q03 A;  4D8H A;  1I1E A;  2ESU A;  1SZ6 B;  2D44 A;  5E24 E;  2M49 A;  4F34 A;  4I4Q A;  1W3A A;  4LO2 A;  3SNV A;  4I4X A;  4DEP A;  4MZH A;  3BX1 C;  2FFV A;  3NJ5 A;  4KEI A;  9ILB A;  2BFH A;  2MC2 A;  1RML A;  5BP5 A;  3UD7 A;  5BQU C;  1SR4 A;  3VT1 A;  3QYD A;  2QN4 A;  1WD3 A;  1YYN A;  2D24 A;  1G9D A;  4GOY A;  4I6I A;  31BI A;  3NBN A;  5FNX A;  3FJB A;  4I4U A;  1HKN A;  1EYL A;  4G6M A;  4QD2 B;  2P23 A;  3NBE A;  3ZX7 A;  2ZQN A;  2RG9 B;  4KEK A;  4OEE A;  4PC4 A;  1S0B A;  3A21 A;  4OUJ A;  3LTQ A;  3WO3 A;  5BXP A;  4IYB A;  3VSZ A;  3CRH A;  5DZU A;  3F62 B;  2VUA A;  4H75 A;  1V6X A;  3BB2 A;  3WMV A;  5D62 A;  2D22 A;  3ZXD A;  3N7J A;  2D1Z A;  2KI6 B;  1CVS A;  3NBD A;  2VSA A;  41BI A;  3ZC8 A;  1II4 A;  4LO3 C;  1Z0H A;  2X2T A;  3FJ9 A;  2Z49 A;  4I4R A;  5EG6 C;  2NZ9 A;  4J23 B;  1JQZ A;  1TP0 A;  3AH4 A;  3CU1 B;  2E4M A;  1IJT A;  4LO1 A;  3CA0 A;  3BAQ A;  1ISZ A;  1BA7 A;  4XFS A;  1ITB A;  4EEE B;  3A22 A;  2NVH A;  1XG6 A;  3AZV A;  5BXS A;  4I3N A;  2IWT B;  3LLP A;  3CRI A;  2HWA A;  3PME A;  2D7R A;  1Q1U A;  4ZA3 B;  2FGF A;  3HMY A;  4ZLB B;  4IZX A;  1ONK B;  2K43 A;  4DCK C;  5BOW A;  1ISW A;  2BEA A;  2I1B A;  3A23 A;  2NS2 A;  1BAS A;  3FUO A;  4I96 A;  5G00 A;  1AVW B;  1AVX B;  2J3P A;  3HAL A;  1EVT A;  4ZFW B;  3P6J A;  2KH2 A;  2MLL B;  1ABR B;  4QC4 A;  1D0H A;  1K5U A;  3H6Q A;  4WBC A;  3Q7W A;  3BA5 A;  7I1B A;  1P63 A;  1JY0 A;  4KBB A;  1JT5 A;  4LO8 B;  4DEN A;  2R9K B;  4QBV A;  2P39 A;  5EC5 A;  3F1R A;  3BAV A;  3H6S E;  3VEQ A;  2Y9G A;  3IAG C;  1FV3 A;  3BRF A;  4R6U B;  2HW9 A;  5BXT A;  3BAU A;  3RMY A;  1KNM A;  1Z4S A;  2NTD A;  3FJC A;  3OBR A;  3WMU A;  2FO1 A;  2GO2 A;  4P6A A;  4KC3 A;  4I37 A;  5BQU A;  1EV2 A;  1Q04 A;  3Q7Y A;  4LO0 C;  4CJM A;  3BAO A;  4J2Y A;  2YUG A;  4J2S A;  3V0B A;  3WO2 A;  1WBA A;  4I4P A;  3NBC A;  1IIL A;  3I29 B;  1AVA C;  3V0B B;  1FQ9 A;  1QXM A;  4G6J A;  1VCL A;  3BTA A;  3KMV A;  1T4Q A;  3BA7 A;  4ZGR B;  4ZBV B;  1TFM B;  1DZC A;  3JUT A;  3VT2 A;  2AQZ A;  1BFC A;  3R4U A;  3V0A A;  1DLL A;  1PUU B;  4ISQ A;  3QR5 A;  4USO A;  2VSE A;  3OGG A;  2D20 A;  3C9Z A;  5JMC A;  3V0A B;  1ISV A;  4LO2 C;  1S0C A;  3N7K A;  3CA4 A;  1V6U A;  2WBC A;  1G9C A;  2WRY A;  1V6W A;  2D43 A;  2F2F A;  1HWM B;  1TIE A;  4JKQ A;  4IY8 A;  4I4O A;  5HPZ A;  1G9A A;  4JRA A;  4J2K A;  5BP5 C;  1W3G A;  1OQL B;  3AKF A;  3T8S A;  4Q9P A;  5F8Y A;  1SR4 C;  5FZZ A;  3WIN A;  4XFT A;  1YF8 B;  2Y9F A;  1WBC A;  2NYY A;  3OGF A;  2FDB M;  1YXW A;  4MZG B;  3CA3 A;  2ZQO A;  4I1B A;  4OW4 A;  4I0Y A;  1RY7 A;  3O49 A;  3HSM A;  4I4Y A;  4LO3 A;  1F31 A;  1ILR 1;  3AKI A;  1V6V A;  4Z8S B;  4OWL A;  1M2T B;  1S0F A;  3FUQ A;  3CRG A;  4JAW A;  4D0Z A;  1G9B A;  1DQO A;  4I8M A;  1BFG A;  3UD9 A;  3S8K A;  4JQ0 A;  1MC9 A;  4AN7 B;  5B2H A;  2UUS A;  3CA1 A;  5GAQ A;  4F83 A;  4JKX B;  4EB2 B;  5BXR A;  8I1B A;  5DUY A;  2RQ9 A;  2Y9X E;  3JRR A;  4X39 A;  1DZD A;  3AZW A;  3MPP G;  1BFF A;  4P0L A;  4XFU A;  3POK A;  2IHO A;  1AFC A;  2X2S A;  3O4D A;  4H9W A;  4GAI A;  1WD4 A;  2ERM A;  2AFG A;  4EKX B;  2AXM A;  4A7Y A;  3ILA A;  3CQA A;  1YBI A;  4G9N A;  3FJF A;  1JTC A;  5F8S A;  2VU9 A;  4LO7 C;  3AKH A;  1JT4 A;  1RG8 A;  1JT7 A;  3R4S A;  1BAR A;  3IIR A;  1DFC A;  5DSS B;  1BFB A;  3AJ6 A;  1RZO B;  4Z9W B;  1DQG A;  1TWE A;  4I1E A;  3W9T A;  3RTJ B;  2QYI B;  4L4I A;  4G1R A;  1S0D A;  2KKI A;  3Q7X A;  2VLC A;  4OWK A;  1DJS B;  3UJ4 A;  3VSF A;  5BVP I;  3A07 A;  1TOO A;  3FJE A;  1TTU A;  1DIW A;  4G9M A;  1HWN B;  4I4V A;  4QKR A;  4HJJ A;  3O5W B;  4EFR A;  3N7L A;  1HCE A;  4END A;  3O44 A;  1L2H A;  3O4C A;  4ZFY B;  3EF2 A;  1PZZ A;  1FGA A;  3H6R A;  1FV2 A;  1PC8 B;  1PWA A;  4X37 A;  5F90 A;  1Z2V A;  1ISX A;  5F8W A;  2FFU A;  1R8N A;  3H6R B;  4IZE A;  3CA6 A;  1IOB A;  3AJ5 A;  2RST A;  4ZFU B;  3BA4 A;  3BRD A;  3BAH A;  1S0E A;  4HR6 C;  4EFP A;  4IY9 A;  4OEG A;  2NM1 A;  3WO4 A;  3O4O A;  3FJ8 A;  1QQK A;  1FMM S;  3UDA A;  4D0T A;  4J2X A;  1HWO B;  5FZY A;  4XKI A;  4H04 A;  2MIB A;  4IHZ A;  1UPS A;  3P6I A;  4P0K A;  4X3A A;  2K8R A;  4GOV A;  4QKS A;  3CA5 A;  4OWJ A;  2Y9W C;  3BAG A;  2HWM A;  5DVH A;  1AXM A;  4GAF A;  3ZXG A;  3AH1 A;  21BI A;  3O4A A;  3V79 C;  3RMX A;  1EPW A;  3OJM A;  2VXR A; 
#chains in the Genus database with same CATH homology
 2D7I A;  3FJA A;  2D23 A;  2ZR1 B;  1S0L A;  4HA2 A;  3N0K A;  4YOL A;  1XHB A;  1A8D A;  3TC2 A;  3OJV A;  3UD8 A;  3IM5 A;  5FNW A;  2DRY A;  1IT0 A;  1XYF A;  3FJH A;  3FJJ A;  2LIE A;  3RSJ A;  1R8O A;  3VT0 A;  4IQP A;  1XZZ A;  4L4H A;  4A7K A;  4I7I A;  5D63 A;  3IM6 A;  1G82 A;  4GP3 A;  2VXT I;  4QD2 C;  1IRP A;  1JLY A;  2LIQ A;  1AVU A;  1FN0 A;  4JPZ A;  3O3Q A;  1E0O A;  6I1B A;  2NP0 A;  2F2F C;  1IHK A;  3FJK A;  3OBT A;  3OJ2 A;  3VWC A;  1CE7 B;  3UJ0 A;  2Q3N B;  3WIN C;  5FZU A;  2XOA A;  4ZOT A;  1J0S A;  1HIB A;  4ION A;  1FWV A;  4QO3 A;  3PUB A;  4JP0 A;  4QAL A;  3FJI A;  3FJD A;  3B9U A;  1YTO A;  5JLV A;  2DRE A;  1JLX A;  4UY4 A;  1TWM A;  4II0 A;  4LO7 B;  2ET2 A;  4FGF A;  4ISR A;  3FGM A;  4KEJ A;  1W3F A;  1FWU A;  4GP0 A;  2GZB A;  4Q9G A;  5I1B A;  2E4M C;  4LO1 C;  4P0J A;  2Z48 A;  1GGP B;  1PUM B;  3S8J A;  3VUO A;  3BRG C;  2K4A B;  1QQL A;  1AF9 A;  5D61 A;  3RTI B;  3PHZ A;  2BEB A;  3BAD A;  1HCD A;  1I1B A;  2L5X A;  4MZF B;  3P53 A;  4Q91 A;  1JT3 A;  3I2X A;  2HZ9 A;  4LO0 A;  1DFQ A;  4USP A;  3ZC9 A;  3HOM A;  3I2A A;  1FMZ A;  3O4B A;  4AN6 A;  4X38 A;  1BLD A;  2DS0 A;  3AKG A;  3WA1 A;  3E8L C;  4TLP A;  3N7M A;  1M16 A;  3HN1 A;  2KLL A;  4I4S A;  3K1X A;  4QBC A;  1HWP B;  3MAL A;  1BLA A;  4OEF A;  1IRA X;  1MD6 A;  1NZK A;  2Q9X A;  2DRZ A;  3D7W B;  3HBW A;  1ISY A;  3IM7 A;  3CAH A;  5EHA A;  4EFQ A;  2F8X C;  1T9F A;  1K5V A;  4I2S A;  3FFZ A;  3AH2 A;  2KI4 A;  4FVV A;  1NUN A;  1N4K A;  3PG0 A;  1S0G A;  4ZKT B;  4A7Z A;  2AAI B;  1Q03 A;  4D8H A;  1I1E A;  2ESU A;  1SZ6 B;  2D44 A;  5E24 E;  2M49 A;  4F34 A;  4I4Q A;  1W3A A;  4LO2 A;  3SNV A;  4I4X A;  4DEP A;  4MZH A;  3BX1 C;  2FFV A;  3NJ5 A;  4KEI A;  9ILB A;  2BFH A;  2MC2 A;  1RML A;  5BP5 A;  3UD7 A;  5BQU C;  1SR4 A;  3VT1 A;  3QYD A;  2QN4 A;  1WD3 A;  1YYN A;  2D24 A;  1G9D A;  4GOY A;  4I6I A;  31BI A;  3NBN A;  5FNX A;  3FJB A;  4I4U A;  1HKN A;  1EYL A;  4G6M A;  4QD2 B;  2P23 A;  3NBE A;  3ZX7 A;  2ZQN A;  2RG9 B;  4KEK A;  4OEE A;  4PC4 A;  1S0B A;  3A21 A;  4OUJ A;  3LTQ A;  3WO3 A;  5BXP A;  4IYB A;  3VSZ A;  3CRH A;  5DZU A;  3F62 B;  2VUA A;  4H75 A;  1V6X A;  3BB2 A;  3WMV A;  5D62 A;  2D22 A;  3ZXD A;  3N7J A;  2D1Z A;  2KI6 B;  1CVS A;  3NBD A;  2VSA A;  41BI A;  3ZC8 A;  1II4 A;  4LO3 C;  1Z0H A;  2X2T A;  3FJ9 A;  2Z49 A;  4I4R A;  5EG6 C;  2NZ9 A;  4J23 B;  1JQZ A;  1TP0 A;  3AH4 A;  3CU1 B;  2E4M A;  1IJT A;  4LO1 A;  3CA0 A;  3BAQ A;  1ISZ A;  1BA7 A;  4XFS A;  1ITB A;  4EEE B;  3A22 A;  2NVH A;  1XG6 A;  3AZV A;  5BXS A;  4I3N A;  2IWT B;  3LLP A;  3CRI A;  2HWA A;  3PME A;  2D7R A;  1Q1U A;  4ZA3 B;  2FGF A;  3HMY A;  4ZLB B;  4IZX A;  1ONK B;  2K43 A;  4DCK C;  5BOW A;  1ISW A;  2BEA A;  2I1B A;  3A23 A;  2NS2 A;  1BAS A;  3FUO A;  4I96 A;  5G00 A;  1AVW B;  1AVX B;  2J3P A;  3HAL A;  1EVT A;  4ZFW B;  3P6J A;  2KH2 A;  2MLL B;  1ABR B;  4QC4 A;  1D0H A;  1K5U A;  3H6Q A;  4WBC A;  3Q7W A;  3BA5 A;  7I1B A;  1P63 A;  1JY0 A;  4KBB A;  1JT5 A;  4LO8 B;  4DEN A;  2R9K B;  4QBV A;  2P39 A;  5EC5 A;  3F1R A;  3BAV A;  3H6S E;  3VEQ A;  2Y9G A;  3IAG C;  1FV3 A;  3BRF A;  4R6U B;  2HW9 A;  5BXT A;  3BAU A;  3RMY A;  1KNM A;  1Z4S A;  2NTD A;  3FJC A;  3OBR A;  3WMU A;  2FO1 A;  2GO2 A;  4P6A A;  4KC3 A;  4I37 A;  5BQU A;  1EV2 A;  1Q04 A;  3Q7Y A;  4LO0 C;  4CJM A;  3BAO A;  4J2Y A;  2YUG A;  4J2S A;  3V0B A;  3WO2 A;  1WBA A;  4I4P A;  3NBC A;  1IIL A;  3I29 B;  1AVA C;  3V0B B;  1FQ9 A;  1QXM A;  4G6J A;  1VCL A;  3BTA A;  3KMV A;  1T4Q A;  3BA7 A;  4ZGR B;  4ZBV B;  1TFM B;  1DZC A;  3JUT A;  3VT2 A;  2AQZ A;  1BFC A;  3R4U A;  3V0A A;  1DLL A;  1PUU B;  4ISQ A;  3QR5 A;  4USO A;  2VSE A;  3OGG A;  2D20 A;  3C9Z A;  5JMC A;  3V0A B;  1ISV A;  4LO2 C;  1S0C A;  3N7K A;  3CA4 A;  1V6U A;  2WBC A;  1G9C A;  2WRY A;  1V6W A;  2D43 A;  2F2F A;  1HWM B;  1TIE A;  4JKQ A;  4IY8 A;  4I4O A;  5HPZ A;  1G9A A;  4JRA A;  4J2K A;  5BP5 C;  1W3G A;  1OQL B;  3AKF A;  3T8S A;  4Q9P A;  5F8Y A;  1SR4 C;  5FZZ A;  3WIN A;  4XFT A;  1YF8 B;  2Y9F A;  1WBC A;  2NYY A;  3OGF A;  2FDB M;  1YXW A;  4MZG B;  3CA3 A;  2ZQO A;  4I1B A;  4OW4 A;  4I0Y A;  1RY7 A;  3O49 A;  3HSM A;  4I4Y A;  4LO3 A;  1F31 A;  1ILR 1;  3AKI A;  1V6V A;  4Z8S B;  4OWL A;  1M2T B;  1S0F A;  3FUQ A;  3CRG A;  4JAW A;  4D0Z A;  1G9B A;  1DQO A;  4I8M A;  1BFG A;  3UD9 A;  3S8K A;  4JQ0 A;  1MC9 A;  4AN7 B;  5B2H A;  2UUS A;  3CA1 A;  5GAQ A;  4F83 A;  4JKX B;  4EB2 B;  5BXR A;  8I1B A;  5DUY A;  2RQ9 A;  2Y9X E;  3JRR A;  4X39 A;  1DZD A;  3AZW A;  3MPP G;  1BFF A;  4P0L A;  4XFU A;  3POK A;  2IHO A;  1AFC A;  2X2S A;  3O4D A;  4H9W A;  4GAI A;  1WD4 A;  2ERM A;  2AFG A;  4EKX B;  2AXM A;  4A7Y A;  3ILA A;  3CQA A;  1YBI A;  4G9N A;  3FJF A;  1JTC A;  5F8S A;  2VU9 A;  4LO7 C;  3AKH A;  1JT4 A;  1RG8 A;  1JT7 A;  3R4S A;  1BAR A;  3IIR A;  1DFC A;  5DSS B;  1BFB A;  3AJ6 A;  1RZO B;  4Z9W B;  1DQG A;  1TWE A;  4I1E A;  3W9T A;  3RTJ B;  2QYI B;  4L4I A;  4G1R A;  1S0D A;  2KKI A;  3Q7X A;  2VLC A;  4OWK A;  1DJS B;  3UJ4 A;  3VSF A;  5BVP I;  3A07 A;  1TOO A;  3FJE A;  1TTU A;  1DIW A;  4G9M A;  1HWN B;  4I4V A;  4QKR A;  4HJJ A;  3O5W B;  4EFR A;  3N7L A;  1HCE A;  4END A;  3O44 A;  1L2H A;  3O4C A;  4ZFY B;  3EF2 A;  1PZZ A;  1FGA A;  3H6R A;  1FV2 A;  1PC8 B;  1PWA A;  4X37 A;  5F90 A;  1Z2V A;  1ISX A;  5F8W A;  2FFU A;  1R8N A;  3H6R B;  4IZE A;  3CA6 A;  1IOB A;  3AJ5 A;  2RST A;  4ZFU B;  3BA4 A;  3BRD A;  3BAH A;  1S0E A;  4HR6 C;  4EFP A;  4IY9 A;  4OEG A;  2NM1 A;  3WO4 A;  3O4O A;  3FJ8 A;  1QQK A;  1FMM S;  3UDA A;  4D0T A;  4J2X A;  1HWO B;  5FZY A;  4XKI A;  4H04 A;  2MIB A;  4IHZ A;  1UPS A;  3P6I A;  4P0K A;  4X3A A;  2K8R A;  4GOV A;  4QKS A;  3CA5 A;  4OWJ A;  2Y9W C;  3BAG A;  2HWM A;  5DVH A;  1AXM A;  4GAF A;  3ZXG A;  3AH1 A;  21BI A;  3O4A A;  3V79 C;  3RMX A;  1EPW A;  3OJM A;  2VXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...