3F1RA

Crystal structure of fgf20 dimer
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
157
structure length
157
Chain Sequence
PGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor 20
publication title Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 40
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3f1rA00
2HWMA 1V6WA 2Y9FA 3O4OA 1BA7A 1PZZA 4HJJA 1ISYA 1TOOA 3R4SA 3CRHA 3H6RA 2KLLA 2BEAA 3NBNA 1S0FA 3UJ0A 3HSMA 3VT1A 3BX1C 4IYBA 5F90A 5E24E 1T4QA 3O3QA 3A23A 1JT3A 1L2HA 1WBCA 3FJEA 3FJJA 2ET2A 3B9UA 3ZXGA 1TFMB 2WRYA 3FUQA 3UD7A 1EV2A 2VXRA 3KMVA 5DZUA 3RTIB 3OJ2A 3NBDA 5FZUA 1TWMA 2WBCA 3WO2A 3BTAA 1OQLB 3CA4A 4J2XA 4ZLBB 5FZYA 4QBCA 4JPZA 3OBTA 3OJMA 4ZGRB 4LO0C 2VUAA 4XFSA 5BQUA 1ITBA 3UD8A 2QYIB 1YXWA 3V0AA 4AN6A 1BASA 3FJAA 5FNWA 3FGMA 1IRAX 3PMEA 1V6XA 4P6AA 3W9TA 1PWAA 4IY9A 3AJ5A 3IM5A 4EEEB 3FJBA 1QXMA 2FFUA 4F34A 2P39A 4G9MA 4JKXB 4LO7B 3TC2A 3HOMA 4FGFA 3NJ5A 2IWTB 4XFUA 4OUJA 1A8DA 3N7KA 1DFQA 3QYDA 5BP5A 4G9NA 2D7RA 4J23B 4I37A 3F62B 1Q03A 4KBBA 5F8WA 3FUOA 1AVAC 3CAHA 1R8NA 1QQKA 2RG9B 3O44A 4F83A 3CA0A 4LO7C 4GAIA 3WA1A 3O5WB 3FJ9A 4A7KA 3AKGA 3CRIA 3CA1A 5EC5A 3V0BA 2P23A 5BXTA 3P6IA 4CJMA 4I6IA 1EYLA 3BADA 3K1XA 1FGAA 2X2TA 4H9WA 1S0GA 4I8MA 3HBWA 4D0TA 3QR5A 1TP0A 4OEFA 4JRAA 4JAWA 5EG6C 5D62A 2AQZA 4LO2A 3H6SE 4EKXB 3H6QA 3I2XA 3C9ZA 4QC4A 5JMCA 2GO2A 1BARA 1TTUA 1AF9A 2Z49A 1ABRB 1Z4SA 1BFFA 5BVPI 3CQAA 3H6RB 8I1BA 2F2FA 4TLPA 1EVTA 3AH1A 3WINC 3FJFA 1W3AA 3CA6A 2ESUA 3WO4A 3ZXDA 5FNXA 2LIEA 1DIWA 2D22A 1HKNA 2DREA 2NYYA 4Z8SB 2MLLB 1RZOB 4IZEA 2AFGA 2MIBA 2Y9XE 5DSSB 3V79C 3BB2A 4IQPA 3JRRA 3UJ4A 2Y9GA 4KEKA 3P6JA 4X39A 2FFVA 1II4A 3A07A 4DENA 3JUTA 1HCDA 1W3FA 1G9CA 4ENDA 3V0AB 1BFBA 2MC2A 2AAIB 3MPPG 1EPWA 3BAOA 1IJTA 1JLYA 1WD4A 4Q9PA 3UDAA 2ZQOA 4G6JA 1FV2A 4LO3A 4WBCA 1V6UA 1XHBA 3PHZA 1RMLA 2I1BA 5GAQA 3AKHA 3CA5A 4XKIA 5F8SA 4EB2B 5BXPA 4G1RA 4Q91A 3LTQA 4GP0A 5BQUC 3IM6A 3FJDA 3VWCA 1BFCA 1FMMS 3BAUA 4I2SA 4I4QA 5EHAA 4QD2C 3R4UA 2NM1A 4I4OA 1JT5A 1M2TB 3IM7A 3SNVA 4I4YA 4AN7B 4QKSA 1ISZA 2LIQA 3S8KA 4Q9GA 4LO1A 4I4PA 1FV3A 1IHKA 4QKRA 5BXSA 3HALA 4Z9WB 1Z0HA 4P0KA 4L4HA 5BP5C 2X2SA 3V0BB 3ZX7A 2XOAA 1HWOB 2AXMA 1S0DA 2F8XC 1DJSB 3RMYA 3A22A 4OWKA 4IHZA 1TWEA 1ISWA 4QALA 1Z2VA 2E4MA 3A21A 2DRYA 3AZVA 3ZC8A 1TIEA 5BOWA 1CVSA 1MC9A 5HPZA 4EFQA 1SR4A 9ILBA 1DFCA 1S0EA 3Q7XA 2ERMA 2R9KB 1Q04A 1V6VA 4GAFA 4J2KA 1AVUA 1DQOA 4EFRA 3T8SA 1FWVA 4HR6C 4JP0A 2KKIA 3NBEA 1DQGA 2VU9A 3BRDA 4LO2C 4ISRA 1HIBA 3WO3A 1W3GA 3CU1B 4KEIA 2Z48A 3OGGA 4GOYA 5FZZA 1XZZA 2ZR1B 4P0JA 4I0YA 3D7WB 1NZKA 4IONA 2D44A 2L5XA 3AKFA 3S8JA 2VLCA 4X3AA 4ZFYB 7I1BA 1Q1UA 1IOBA 2BFHA 3ILAA 4I4UA 4II0A 4I3NA 4ZFWB 1JT4A 3OBRA 4JKQA 1AVWB 1G82A 1VCLA 4I4VA 2F2FC 5B2HA 1K5UA 1PUMB 3RMXA 4EFPA 2UUSA 2GZBA 1PUUB 1YYNA 3WMUA 1IT0A 1M16A 2M49A 4QBVA 3RTJB 2D7IA 3N7LA 3Q7YA 3UD9A 3FJKA 3VT0A 31BIA 1BLDA 1G9BA 4USOA 3O4DA 41BIA 4A7YA 4H04A 2NP0A 4I1EA 3O49A 1IRPA 2K43A 1S0BA 2D43A 4I1BA 4OWLA 3MALA 4KEJA 3BAVA 3E8LC 3AH2A 4D0ZA 1BFGA 1YTOA 4QD2B 1D0HA 3N0KA 4P0LA 4LO3C 4J2YA 2FO1A 1E0OA 1R8OA 5DUYA 3BAGA 3F1RA 2D23A 3IIRA 2K4AB 1HWMB 2FDBM 1ISXA 1ISVA 3BA4A 5I1BA 1S0CA 4R6UB 5JLVA 1WBAA 3OJVA 4ZA3B 2DS0A 1HWNB 2K8RA 4YOLA 1AVXB 1PC8B 1BLAA 4FVVA 3FJHA 1RY7A 2VXTI 2NTDA 4LO1C 3AJ6A 3IAGC 1T9FA 3PG0A 4IY8A 1ILR1 3BA7A 3ZC9A 4LO0A 4LO8B 4I4XA 3VUOA 21BIA 5G00A 3BAHA 2ZQNA 4OW4A 4ZOTA 3AKIA 4X37A 3FJIA 2HW9A 3BA5A 3BRGC 1I1BA 1YF8B 2E4MC 4L4IA 1AXMA 2Q3NB 1FQ9A 2Q9XA 3FJ8A 1JTCA 2HZ9A 2KH2A 4IZXA 1I1EA 1G9DA 1SR4C 1JT7A 1DZCA 3CA3A 2DRZA 1FMZA 1FN0A 1NUNA 1RG8A 2IHOA 2RSTA 2NZ9A 2HWAA 1ONKB 4I96A 2VSAA 3I2AA 1XG6A 3AZWA 1CE7B 3N7JA 1MD6A 3POKA 4I7IA 3I29B 3WMVA 1N4KA 3O4BA 1S0LA 2J3PA 4G6MA 4PC4A 2VSEA 5F8YA 1J0SA 1DZDA 4ZKTB 1IILA 1F31A 5D63A 1FWUA 4I4SA 4OEGA 1KNMA 2BEBA 1SZ6B 3VSFA 3CRGA 4GP3A 4DEPA 1UPSA 5DVHA 3Q7WA 2KI4A 2YUGA 4OWJA 1JLXA 2D1ZA 3LLPA 1QQLA 2KI6B 3VEQA 3VT2A 1XYFA 2RQ9A 4USPA 2FGFA 2QN4A 1WD3A 4KC3A 2D24A 3RSJA 3BRFA 4XFTA 2NVHA 3O4AA 5BXRA 3OGFA 4HA2A 4X38A 1DLLA 4ISQA 6I1BA 3PUBA 4OEEA 4A7ZA 1P63A 3FFZA 4GOVA 1JQZA 1JY0A 3EF2A 1G9AA 3HN1A 3HMYA 4I4RA 4QO3A 3NBCA 3FJCA 3N7MA 1HCEA 3P53A 1YBIA 4J2SA 4ZFUB 4D8HA 1AFCA 3WINA 1GGPB 2D20A 4ZBVB 3O4CA 3BAQA 1K5VA 5D61A 4DCKC 3AH4A 3VSZA 1HWPB 2Y9WC 4JQ0A
chains in the Genus database with same CATH superfamily
2HWMA 1V6WA 2Y9FA 3O4OA 1BA7A 1PZZA 4HJJA 1ISYA 1TOOA 3R4SA 3CRHA 3H6RA 2KLLA 2BEAA 3NBNA 1S0FA 3UJ0A 3HSMA 3VT1A 3BX1C 4IYBA 5F90A 5E24E 1T4QA 3O3QA 3A23A 1JT3A 1L2HA 1WBCA 3FJEA 3FJJA 4H75A 2ET2A 3B9UA 3ZXGA 1TFMB 2WRYA 3FUQA 3UD7A 1EV2A 2VXRA 3KMVA 5DZUA 3RTIB 3OJ2A 3NBDA 5FZUA 1TWMA 2WBCA 3WO2A 3BTAA 1OQLB 3CA4A 4J2XA 4ZLBB 5FZYA 4QBCA 4JPZA 3OBTA 3OJMA 4ZGRB 4LO0C 2VUAA 4XFSA 5BQUA 1ITBA 3UD8A 2QYIB 1YXWA 3V0AA 4AN6A 1BASA 3FJAA 5FNWA 3FGMA 1IRAX 3PMEA 1V6XA 4P6AA 3W9TA 1PWAA 4IY9A 3AJ5A 3IM5A 4EEEB 3FJBA 1QXMA 2FFUA 4F34A 2P39A 4G9MA 4JKXB 4LO7B 3TC2A 3HOMA 4FGFA 3NJ5A 2IWTB 4XFUA 4OUJA 1A8DA 3N7KA 1DFQA 3QYDA 5BP5A 4G9NA 2D7RA 4J23B 4I37A 3F62B 1Q03A 4KBBA 5F8WA 3FUOA 1AVAC 3CAHA 1R8NA 1QQKA 2RG9B 3O44A 4F83A 3CA0A 4LO7C 4GAIA 3WA1A 3O5WB 3FJ9A 4A7KA 3AKGA 3CRIA 3CA1A 5EC5A 3V0BA 2P23A 5BXTA 3P6IA 4CJMA 4I6IA 1EYLA 3BADA 2NS2A 3K1XA 1FGAA 2X2TA 4H9WA 1S0GA 4I8MA 3HBWA 4D0TA 3QR5A 1TP0A 4OEFA 4JRAA 4JAWA 5EG6C 5D62A 2AQZA 4LO2A 3H6SE 4EKXB 3H6QA 3I2XA 3C9ZA 4QC4A 5JMCA 2GO2A 1BARA 1TTUA 1AF9A 2Z49A 1ABRB 1Z4SA 1BFFA 5BVPI 3CQAA 3H6RB 8I1BA 2F2FA 4TLPA 1EVTA 3AH1A 3WINC 3FJFA 1W3AA 3CA6A 2ESUA 3WO4A 3ZXDA 5FNXA 2LIEA 1DIWA 2D22A 1HKNA 2DREA 2NYYA 4Z8SB 2MLLB 1RZOB 4IZEA 2AFGA 2MIBA 2Y9XE 5DSSB 3V79C 3BB2A 4IQPA 3JRRA 3UJ4A 2Y9GA 4KEKA 3P6JA 4X39A 2FFVA 1II4A 3A07A 4DENA 3JUTA 1HCDA 1W3FA 1G9CA 4ENDA 3V0AB 1BFBA 2MC2A 2AAIB 3MPPG 1EPWA 3BAOA 1IJTA 1JLYA 1WD4A 4Q9PA 3UDAA 2ZQOA 4G6JA 1FV2A 4LO3A 4WBCA 1V6UA 1XHBA 3PHZA 1RMLA 2I1BA 4MZFB 3AKHA 3CA5A 4XKIA 5F8SA 5GAQA 4EB2B 5BXPA 4G1RA 4Q91A 3LTQA 4GP0A 5BQUC 3IM6A 3FJDA 3VWCA 1BFCA 1FMMS 3BAUA 4I2SA 4I4QA 5EHAA 4QD2C 3R4UA 2NM1A 4I4OA 1JT5A 1M2TB 3IM7A 3SNVA 4I4YA 4AN7B 4QKSA 1ISZA 2LIQA 3S8KA 4Q9GA 4LO1A 4I4PA 1FV3A 1IHKA 4QKRA 5BXSA 3HALA 4Z9WB 1Z0HA 4P0KA 4L4HA 5BP5C 2X2SA 3V0BB 3ZX7A 2XOAA 1HWOB 2AXMA 1S0DA 2F8XC 1DJSB 3RMYA 3A22A 4OWKA 4IHZA 1TWEA 1ISWA 4QALA 1Z2VA 2E4MA 3A21A 2DRYA 3AZVA 3ZC8A 1TIEA 5BOWA 1CVSA 1MC9A 5HPZA 4EFQA 1SR4A 9ILBA 1DFCA 1S0EA 3Q7XA 2ERMA 2R9KB 1Q04A 1V6VA 4GAFA 4J2KA 1AVUA 1DQOA 4EFRA 3T8SA 1FWVA 4HR6C 4JP0A 2KKIA 3NBEA 1DQGA 2VU9A 3BRDA 4LO2C 4ISRA 1HIBA 3WO3A 1W3GA 3CU1B 4KEIA 2Z48A 3OGGA 4GOYA 5FZZA 1XZZA 2ZR1B 4P0JA 4I0YA 3D7WB 1NZKA 4IONA 2D44A 2L5XA 3AKFA 3S8JA 2VLCA 4X3AA 4ZFYB 7I1BA 1Q1UA 1IOBA 2BFHA 3ILAA 4I4UA 4II0A 4I3NA 4ZFWB 1JT4A 3OBRA 4JKQA 1AVWB 1G82A 1VCLA 4I4VA 2F2FC 5B2HA 1K5UA 1PUMB 3RMXA 4EFPA 2UUSA 2GZBA 1PUUB 1YYNA 3WMUA 1IT0A 1M16A 2M49A 4QBVA 3RTJB 2D7IA 3N7LA 3Q7YA 3UD9A 3FJKA 3VT0A 31BIA 1BLDA 1G9BA 4USOA 3O4DA 41BIA 4A7YA 4H04A 2NP0A 4I1EA 3O49A 1IRPA 2K43A 1S0BA 2D43A 4I1BA 4OWLA 3MALA 4KEJA 3BAVA 4UY4A 3E8LC 3AH2A 4D0ZA 1BFGA 1YTOA 4QD2B 1D0HA 3N0KA 4P0LA 4LO3C 4J2YA 2FO1A 1E0OA 1R8OA 5DUYA 3BAGA 3F1RA 2D23A 3IIRA 2K4AB 1HWMB 2FDBM 1ISXA 1ISVA 3BA4A 5I1BA 1S0CA 4R6UB 5JLVA 1WBAA 3OJVA 4ZA3B 2DS0A 1HWNB 2K8RA 4YOLA 1AVXB 1PC8B 1BLAA 4FVVA 3FJHA 1RY7A 2VXTI 2NTDA 4LO1C 3AJ6A 4MZGB 3IAGC 1T9FA 3PG0A 4IY8A 1ILR1 3BA7A 3ZC9A 4LO0A 4LO8B 4I4XA 3VUOA 4MZHA 21BIA 5G00A 3BAHA 2ZQNA 4OW4A 4ZOTA 3AKIA 4X37A 3FJIA 2HW9A 3BA5A 3BRGC 1I1BA 1YF8B 2E4MC 4L4IA 1AXMA 2Q3NB 1FQ9A 2Q9XA 3FJ8A 1JTCA 2HZ9A 2KH2A 4IZXA 1I1EA 1G9DA 1SR4C 1JT7A 1DZCA 3CA3A 2DRZA 1FMZA 1FN0A 1NUNA 1RG8A 2IHOA 2RSTA 2NZ9A 2HWAA 1ONKB 4I96A 2VSAA 3I2AA 1XG6A 3AZWA 1CE7B 3N7JA 1MD6A 3POKA 4I7IA 3I29B 3WMVA 1N4KA 3O4BA 1S0LA 2J3PA 4G6MA 4PC4A 2VSEA 5F8YA 1J0SA 1DZDA 4ZKTB 1IILA 1F31A 5D63A 1FWUA 4I4SA 4OEGA 1KNMA 2BEBA 1SZ6B 3VSFA 3CRGA 4GP3A 4DEPA 1UPSA 5DVHA 3Q7WA 2KI4A 2YUGA 4OWJA 1JLXA 2D1ZA 3LLPA 1QQLA 2KI6B 3VEQA 3VT2A 1XYFA 2RQ9A 4USPA 2FGFA 2QN4A 1WD3A 4KC3A 2D24A 3RSJA 3BRFA 4XFTA 2NVHA 3O4AA 5BXRA 3OGFA 4HA2A 4X38A 1DLLA 4ISQA 6I1BA 3PUBA 4OEEA 4A7ZA 1P63A 3FFZA 4GOVA 1JQZA 1JY0A 3EF2A 1G9AA 3HN1A 3HMYA 4I4RA 4QO3A 3NBCA 3FJCA 3N7MA 1HCEA 3P53A 1YBIA 4J2SA 4ZFUB 4D8HA 1AFCA 3WINA 1GGPB 2D20A 4ZBVB 3O4CA 3BAQA 1K5VA 5D61A 4DCKC 3AH4A 3VSZA 1HWPB 2Y9WC 4JQ0A
chains in the Genus database with same CATH topology
2HWMA 1V6WA 2Y9FA 3O4OA 1BA7A 1PZZA 4HJJA 1ISYA 1TOOA 3R4SA 3CRHA 3H6RA 2KLLA 2BEAA 3NBNA 1S0FA 3UJ0A 3HSMA 3VT1A 3BX1C 4IYBA 5F90A 5E24E 1T4QA 3O3QA 3A23A 1JT3A 1L2HA 1WBCA 3FJEA 3FJJA 4H75A 2ET2A 3B9UA 3ZXGA 1TFMB 2WRYA 3FUQA 3UD7A 1EV2A 2VXRA 3KMVA 5DZUA 3RTIB 3OJ2A 3NBDA 5FZUA 1TWMA 2WBCA 3WO2A 3BTAA 1OQLB 3CA4A 4J2XA 4ZLBB 5FZYA 4QBCA 4JPZA 3OBTA 3OJMA 4ZGRB 4LO0C 2VUAA 4XFSA 5BQUA 1ITBA 3UD8A 2QYIB 1YXWA 3V0AA 4AN6A 1BASA 3FJAA 5FNWA 3FGMA 1IRAX 3PMEA 1V6XA 4P6AA 3W9TA 1PWAA 4IY9A 3AJ5A 3IM5A 4EEEB 3FJBA 1QXMA 2FFUA 4F34A 2P39A 4G9MA 4JKXB 4LO7B 3TC2A 3HOMA 4FGFA 3NJ5A 2IWTB 4XFUA 4OUJA 1A8DA 3N7KA 1DFQA 3QYDA 5BP5A 4G9NA 2D7RA 4J23B 4I37A 3F62B 1Q03A 4KBBA 5F8WA 3FUOA 1AVAC 3CAHA 1R8NA 1QQKA 2RG9B 3O44A 4F83A 3CA0A 4LO7C 4GAIA 3WA1A 3O5WB 3FJ9A 4A7KA 3AKGA 3CRIA 3CA1A 5EC5A 3V0BA 2P23A 5BXTA 3P6IA 4CJMA 4I6IA 1EYLA 3BADA 2NS2A 3K1XA 1FGAA 2X2TA 4H9WA 1S0GA 4I8MA 3HBWA 4D0TA 3QR5A 1TP0A 4OEFA 4JRAA 4JAWA 5EG6C 5D62A 2AQZA 4LO2A 3H6SE 4EKXB 3H6QA 3I2XA 3C9ZA 4QC4A 5JMCA 2GO2A 1BARA 1TTUA 1AF9A 2Z49A 1ABRB 1Z4SA 1BFFA 5BVPI 3CQAA 3H6RB 8I1BA 2F2FA 4TLPA 1EVTA 3AH1A 3WINC 3FJFA 1W3AA 3CA6A 2ESUA 3WO4A 3ZXDA 5FNXA 2LIEA 1DIWA 2D22A 1HKNA 2DREA 2NYYA 4Z8SB 2MLLB 1RZOB 4IZEA 2AFGA 2MIBA 2Y9XE 5DSSB 3V79C 3BB2A 4IQPA 3JRRA 3UJ4A 2Y9GA 4KEKA 3P6JA 4X39A 2FFVA 1II4A 3A07A 4DENA 3JUTA 1HCDA 1W3FA 1G9CA 4ENDA 3V0AB 1BFBA 2MC2A 2AAIB 3MPPG 1EPWA 3BAOA 1IJTA 1JLYA 1WD4A 4Q9PA 3UDAA 2ZQOA 4G6JA 1FV2A 4LO3A 4WBCA 1V6UA 1XHBA 3PHZA 1RMLA 2I1BA 4MZFB 3AKHA 3CA5A 4XKIA 5F8SA 5GAQA 4EB2B 5BXPA 4G1RA 4Q91A 3LTQA 4GP0A 5BQUC 3IM6A 3FJDA 3VWCA 1BFCA 1FMMS 3BAUA 4I2SA 4I4QA 5EHAA 4QD2C 3R4UA 2NM1A 4I4OA 1JT5A 1M2TB 3IM7A 3SNVA 4I4YA 4AN7B 4QKSA 1ISZA 2LIQA 3S8KA 4Q9GA 4LO1A 4I4PA 1FV3A 1IHKA 4QKRA 5BXSA 3HALA 4Z9WB 1Z0HA 4P0KA 4L4HA 5BP5C 2X2SA 3V0BB 3ZX7A 2XOAA 1HWOB 2AXMA 1S0DA 2F8XC 1DJSB 3RMYA 3A22A 4OWKA 4IHZA 1TWEA 1ISWA 4QALA 1Z2VA 2E4MA 3A21A 2DRYA 3AZVA 3ZC8A 1TIEA 5BOWA 1CVSA 1MC9A 5HPZA 4EFQA 1SR4A 9ILBA 1DFCA 1S0EA 3Q7XA 2ERMA 2R9KB 1Q04A 1V6VA 4GAFA 4J2KA 1AVUA 1DQOA 4EFRA 3T8SA 1FWVA 4HR6C 4JP0A 2KKIA 3NBEA 1DQGA 2VU9A 3BRDA 4LO2C 4ISRA 1HIBA 3WO3A 1W3GA 3CU1B 4KEIA 2Z48A 3OGGA 4GOYA 5FZZA 1XZZA 2ZR1B 4P0JA 4I0YA 3D7WB 1NZKA 4IONA 2D44A 2L5XA 3AKFA 3S8JA 2VLCA 4X3AA 4ZFYB 7I1BA 1Q1UA 1IOBA 2BFHA 3ILAA 4I4UA 4II0A 4I3NA 4ZFWB 1JT4A 3OBRA 4JKQA 1AVWB 1G82A 1VCLA 4I4VA 2F2FC 5B2HA 1K5UA 1PUMB 3RMXA 4EFPA 2UUSA 2GZBA 1PUUB 1YYNA 3WMUA 1IT0A 1M16A 2M49A 4QBVA 3RTJB 2D7IA 3N7LA 3Q7YA 3UD9A 3FJKA 3VT0A 31BIA 1BLDA 1G9BA 4USOA 3O4DA 41BIA 4A7YA 4H04A 2NP0A 4I1EA 3O49A 1IRPA 2K43A 1S0BA 2D43A 4I1BA 4OWLA 3MALA 4KEJA 3BAVA 4UY4A 3E8LC 3AH2A 4D0ZA 1BFGA 1YTOA 4QD2B 1D0HA 3N0KA 4P0LA 4LO3C 4J2YA 2FO1A 1E0OA 1R8OA 5DUYA 3BAGA 3F1RA 2D23A 3IIRA 2K4AB 1HWMB 2FDBM 1ISXA 1ISVA 3BA4A 5I1BA 1S0CA 4R6UB 5JLVA 1WBAA 3OJVA 4ZA3B 2DS0A 1HWNB 2K8RA 4YOLA 1AVXB 1PC8B 1BLAA 4FVVA 3FJHA 1RY7A 2VXTI 2NTDA 4LO1C 3AJ6A 4MZGB 3IAGC 1T9FA 3PG0A 4IY8A 1ILR1 3BA7A 3ZC9A 4LO0A 4LO8B 4I4XA 3VUOA 4MZHA 21BIA 5G00A 3BAHA 2ZQNA 4OW4A 4ZOTA 3AKIA 4X37A 3FJIA 2HW9A 3BA5A 3BRGC 1I1BA 1YF8B 2E4MC 4L4IA 1AXMA 2Q3NB 1FQ9A 2Q9XA 3FJ8A 1JTCA 2HZ9A 2KH2A 4IZXA 1I1EA 1G9DA 1SR4C 1JT7A 1DZCA 3CA3A 2DRZA 1FMZA 1FN0A 1NUNA 1RG8A 2IHOA 2RSTA 2NZ9A 2HWAA 1ONKB 4I96A 2VSAA 3I2AA 1XG6A 3AZWA 1CE7B 3N7JA 1MD6A 3POKA 4I7IA 3I29B 3WMVA 1N4KA 3O4BA 1S0LA 2J3PA 4G6MA 4PC4A 2VSEA 5F8YA 1J0SA 1DZDA 4ZKTB 1IILA 1F31A 5D63A 1FWUA 4I4SA 4OEGA 1KNMA 2BEBA 1SZ6B 3VSFA 3CRGA 4GP3A 4DEPA 1UPSA 5DVHA 3Q7WA 2KI4A 2YUGA 4OWJA 1JLXA 2D1ZA 3LLPA 1QQLA 2KI6B 3VEQA 3VT2A 1XYFA 2RQ9A 4USPA 2FGFA 2QN4A 1WD3A 4KC3A 2D24A 3RSJA 3BRFA 4XFTA 2NVHA 3O4AA 5BXRA 3OGFA 4HA2A 4X38A 1DLLA 4ISQA 6I1BA 3PUBA 4OEEA 4A7ZA 1P63A 3FFZA 4GOVA 1JQZA 1JY0A 3EF2A 1G9AA 3HN1A 3HMYA 4I4RA 4QO3A 3NBCA 3FJCA 3N7MA 1HCEA 3P53A 1YBIA 4J2SA 4ZFUB 4D8HA 1AFCA 3WINA 1GGPB 2D20A 4ZBVB 3O4CA 3BAQA 1K5VA 5D61A 4DCKC 3AH4A 3VSZA 1HWPB 2Y9WC 4JQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HWM A;  1V6W A;  2Y9F A;  3O4O A;  1BA7 A;  1PZZ A;  4HJJ A;  1ISY A;  1TOO A;  3R4S A;  3CRH A;  3H6R A;  2KLL A;  2BEA A;  3NBN A;  1S0F A;  3UJ0 A;  3HSM A;  3VT1 A;  3BX1 C;  4IYB A;  5F90 A;  5E24 E;  1T4Q A;  3O3Q A;  3A23 A;  1JT3 A;  1L2H A;  1WBC A;  3FJE A;  3FJJ A;  2ET2 A;  3B9U A;  3ZXG A;  1TFM B;  2WRY A;  3FUQ A;  3UD7 A;  1EV2 A;  2VXR A;  3KMV A;  5DZU A;  3RTI B;  3OJ2 A;  3NBD A;  5FZU A;  1TWM A;  2WBC A;  3WO2 A;  3BTA A;  1OQL B;  3CA4 A;  4J2X A;  4ZLB B;  5FZY A;  4QBC A;  4JPZ A;  3OBT A;  3OJM A;  4ZGR B;  4LO0 C;  2VUA A;  4XFS A;  5BQU A;  1ITB A;  3UD8 A;  2QYI B;  1YXW A;  3V0A A;  4AN6 A;  1BAS A;  3FJA A;  5FNW A;  3FGM A;  1IRA X;  3PME A;  1V6X A;  4P6A A;  3W9T A;  1PWA A;  4IY9 A;  3AJ5 A;  3IM5 A;  4EEE B;  3FJB A;  1QXM A;  2FFU A;  4F34 A;  2P39 A;  4G9M A;  4JKX B;  4LO7 B;  3TC2 A;  3HOM A;  4FGF A;  3NJ5 A;  2IWT B;  4XFU A;  4OUJ A;  1A8D A;  3N7K A;  1DFQ A;  3QYD A;  5BP5 A;  4G9N A;  2D7R A;  4J23 B;  4I37 A;  3F62 B;  1Q03 A;  4KBB A;  5F8W A;  3FUO A;  1AVA C;  3CAH A;  1R8N A;  1QQK A;  2RG9 B;  3O44 A;  4F83 A;  3CA0 A;  4LO7 C;  4GAI A;  3WA1 A;  3O5W B;  3FJ9 A;  4A7K A;  3AKG A;  3CRI A;  3CA1 A;  5EC5 A;  3V0B A;  2P23 A;  5BXT A;  3P6I A;  4CJM A;  4I6I A;  1EYL A;  3BAD A;  3K1X A;  1FGA A;  2X2T A;  4H9W A;  1S0G A;  4I8M A;  3HBW A;  4D0T A;  3QR5 A;  1TP0 A;  4OEF A;  4JRA A;  4JAW A;  5EG6 C;  5D62 A;  2AQZ A;  4LO2 A;  3H6S E;  4EKX B;  3H6Q A;  3I2X A;  3C9Z A;  4QC4 A;  5JMC A;  2GO2 A;  1BAR A;  1TTU A;  1AF9 A;  2Z49 A;  1ABR B;  1Z4S A;  1BFF A;  5BVP I;  3CQA A;  3H6R B;  8I1B A;  2F2F A;  4TLP A;  1EVT A;  3AH1 A;  3WIN C;  3FJF A;  1W3A A;  3CA6 A;  2ESU A;  3WO4 A;  3ZXD A;  5FNX A;  2LIE A;  1DIW A;  2D22 A;  1HKN A;  2DRE A;  2NYY A;  4Z8S B;  2MLL B;  1RZO B;  4IZE A;  2AFG A;  2MIB A;  2Y9X E;  5DSS B;  3V79 C;  3BB2 A;  4IQP A;  3JRR A;  3UJ4 A;  2Y9G A;  4KEK A;  3P6J A;  4X39 A;  2FFV A;  1II4 A;  3A07 A;  4DEN A;  3JUT A;  1HCD A;  1W3F A;  1G9C A;  4END A;  3V0A B;  1BFB A;  2MC2 A;  2AAI B;  3MPP G;  1EPW A;  3BAO A;  1IJT A;  1JLY A;  1WD4 A;  4Q9P A;  3UDA A;  2ZQO A;  4G6J A;  1FV2 A;  4LO3 A;  4WBC A;  1V6U A;  1XHB A;  3PHZ A;  1RML A;  2I1B A;  5GAQ A;  3AKH A;  3CA5 A;  4XKI A;  5F8S A;  4EB2 B;  5BXP A;  4G1R A;  4Q91 A;  3LTQ A;  4GP0 A;  5BQU C;  3IM6 A;  3FJD A;  3VWC A;  1BFC A;  1FMM S;  3BAU A;  4I2S A;  4I4Q A;  5EHA A;  4QD2 C;  3R4U A;  2NM1 A;  4I4O A;  1JT5 A;  1M2T B;  3IM7 A;  3SNV A;  4I4Y A;  4AN7 B;  4QKS A;  1ISZ A;  2LIQ A;  3S8K A;  4Q9G A;  4LO1 A;  4I4P A;  1FV3 A;  1IHK A;  4QKR A;  5BXS A;  3HAL A;  4Z9W B;  1Z0H A;  4P0K A;  4L4H A;  5BP5 C;  2X2S A;  3V0B B;  3ZX7 A;  2XOA A;  1HWO B;  2AXM A;  1S0D A;  2F8X C;  1DJS B;  3RMY A;  3A22 A;  4OWK A;  4IHZ A;  1TWE A;  1ISW A;  4QAL A;  1Z2V A;  2E4M A;  3A21 A;  2DRY A;  3AZV A;  3ZC8 A;  1TIE A;  5BOW A;  1CVS A;  1MC9 A;  5HPZ A;  4EFQ A;  1SR4 A;  9ILB A;  1DFC A;  1S0E A;  3Q7X A;  2ERM A;  2R9K B;  1Q04 A;  1V6V A;  4GAF A;  4J2K A;  1AVU A;  1DQO A;  4EFR A;  3T8S A;  1FWV A;  4HR6 C;  4JP0 A;  2KKI A;  3NBE A;  1DQG A;  2VU9 A;  3BRD A;  4LO2 C;  4ISR A;  1HIB A;  3WO3 A;  1W3G A;  3CU1 B;  4KEI A;  2Z48 A;  3OGG A;  4GOY A;  5FZZ A;  1XZZ A;  2ZR1 B;  4P0J A;  4I0Y A;  3D7W B;  1NZK A;  4ION A;  2D44 A;  2L5X A;  3AKF A;  3S8J A;  2VLC A;  4X3A A;  4ZFY B;  7I1B A;  1Q1U A;  1IOB A;  2BFH A;  3ILA A;  4I4U A;  4II0 A;  4I3N A;  4ZFW B;  1JT4 A;  3OBR A;  4JKQ A;  1AVW B;  1G82 A;  1VCL A;  4I4V A;  2F2F C;  5B2H A;  1K5U A;  1PUM B;  3RMX A;  4EFP A;  2UUS A;  2GZB A;  1PUU B;  1YYN A;  3WMU A;  1IT0 A;  1M16 A;  2M49 A;  4QBV A;  3RTJ B;  2D7I A;  3N7L A;  3Q7Y A;  3UD9 A;  3FJK A;  3VT0 A;  31BI A;  1BLD A;  1G9B A;  4USO A;  3O4D A;  41BI A;  4A7Y A;  4H04 A;  2NP0 A;  4I1E A;  3O49 A;  1IRP A;  2K43 A;  1S0B A;  2D43 A;  4I1B A;  4OWL A;  3MAL A;  4KEJ A;  3BAV A;  3E8L C;  3AH2 A;  4D0Z A;  1BFG A;  1YTO A;  4QD2 B;  1D0H A;  3N0K A;  4P0L A;  4LO3 C;  4J2Y A;  2FO1 A;  1E0O A;  1R8O A;  5DUY A;  3BAG A;  3F1R A;  2D23 A;  3IIR A;  2K4A B;  1HWM B;  2FDB M;  1ISX A;  1ISV A;  3BA4 A;  5I1B A;  1S0C A;  4R6U B;  5JLV A;  1WBA A;  3OJV A;  4ZA3 B;  2DS0 A;  1HWN B;  2K8R A;  4YOL A;  1AVX B;  1PC8 B;  1BLA A;  4FVV A;  3FJH A;  1RY7 A;  2VXT I;  2NTD A;  4LO1 C;  3AJ6 A;  3IAG C;  1T9F A;  3PG0 A;  4IY8 A;  1ILR 1;  3BA7 A;  3ZC9 A;  4LO0 A;  4LO8 B;  4I4X A;  3VUO A;  21BI A;  5G00 A;  3BAH A;  2ZQN A;  4OW4 A;  4ZOT A;  3AKI A;  4X37 A;  3FJI A;  2HW9 A;  3BA5 A;  3BRG C;  1I1B A;  1YF8 B;  2E4M C;  4L4I A;  1AXM A;  2Q3N B;  1FQ9 A;  2Q9X A;  3FJ8 A;  1JTC A;  2HZ9 A;  2KH2 A;  4IZX A;  1I1E A;  1G9D A;  1SR4 C;  1JT7 A;  1DZC A;  3CA3 A;  2DRZ A;  1FMZ A;  1FN0 A;  1NUN A;  1RG8 A;  2IHO A;  2RST A;  2NZ9 A;  2HWA A;  1ONK B;  4I96 A;  2VSA A;  3I2A A;  1XG6 A;  3AZW A;  1CE7 B;  3N7J A;  1MD6 A;  3POK A;  4I7I A;  3I29 B;  3WMV A;  1N4K A;  3O4B A;  1S0L A;  2J3P A;  4G6M A;  4PC4 A;  2VSE A;  5F8Y A;  1J0S A;  1DZD A;  4ZKT B;  1IIL A;  1F31 A;  5D63 A;  1FWU A;  4I4S A;  4OEG A;  1KNM A;  2BEB A;  1SZ6 B;  3VSF A;  3CRG A;  4GP3 A;  4DEP A;  1UPS A;  5DVH A;  3Q7W A;  2KI4 A;  2YUG A;  4OWJ A;  1JLX A;  2D1Z A;  3LLP A;  1QQL A;  2KI6 B;  3VEQ A;  3VT2 A;  1XYF A;  2RQ9 A;  4USP A;  2FGF A;  2QN4 A;  1WD3 A;  4KC3 A;  2D24 A;  3RSJ A;  3BRF A;  4XFT A;  2NVH A;  3O4A A;  5BXR A;  3OGF A;  4HA2 A;  4X38 A;  1DLL A;  4ISQ A;  6I1B A;  3PUB A;  4OEE A;  4A7Z A;  1P63 A;  3FFZ A;  4GOV A;  1JQZ A;  1JY0 A;  3EF2 A;  1G9A A;  3HN1 A;  3HMY A;  4I4R A;  4QO3 A;  3NBC A;  3FJC A;  3N7M A;  1HCE A;  3P53 A;  1YBI A;  4J2S A;  4ZFU B;  4D8H A;  1AFC A;  3WIN A;  1GGP B;  2D20 A;  4ZBV B;  3O4C A;  3BAQ A;  1K5V A;  5D61 A;  4DCK C;  3AH4 A;  3VSZ A;  1HWP B;  2Y9W C;  4JQ0 A; 
#chains in the Genus database with same CATH topology
 2HWM A;  1V6W A;  2Y9F A;  3O4O A;  1BA7 A;  1PZZ A;  4HJJ A;  1ISY A;  1TOO A;  3R4S A;  3CRH A;  3H6R A;  2KLL A;  2BEA A;  3NBN A;  1S0F A;  3UJ0 A;  3HSM A;  3VT1 A;  3BX1 C;  4IYB A;  5F90 A;  5E24 E;  1T4Q A;  3O3Q A;  3A23 A;  1JT3 A;  1L2H A;  1WBC A;  3FJE A;  3FJJ A;  4H75 A;  2ET2 A;  3B9U A;  3ZXG A;  1TFM B;  2WRY A;  3FUQ A;  3UD7 A;  1EV2 A;  2VXR A;  3KMV A;  5DZU A;  3RTI B;  3OJ2 A;  3NBD A;  5FZU A;  1TWM A;  2WBC A;  3WO2 A;  3BTA A;  1OQL B;  3CA4 A;  4J2X A;  4ZLB B;  5FZY A;  4QBC A;  4JPZ A;  3OBT A;  3OJM A;  4ZGR B;  4LO0 C;  2VUA A;  4XFS A;  5BQU A;  1ITB A;  3UD8 A;  2QYI B;  1YXW A;  3V0A A;  4AN6 A;  1BAS A;  3FJA A;  5FNW A;  3FGM A;  1IRA X;  3PME A;  1V6X A;  4P6A A;  3W9T A;  1PWA A;  4IY9 A;  3AJ5 A;  3IM5 A;  4EEE B;  3FJB A;  1QXM A;  2FFU A;  4F34 A;  2P39 A;  4G9M A;  4JKX B;  4LO7 B;  3TC2 A;  3HOM A;  4FGF A;  3NJ5 A;  2IWT B;  4XFU A;  4OUJ A;  1A8D A;  3N7K A;  1DFQ A;  3QYD A;  5BP5 A;  4G9N A;  2D7R A;  4J23 B;  4I37 A;  3F62 B;  1Q03 A;  4KBB A;  5F8W A;  3FUO A;  1AVA C;  3CAH A;  1R8N A;  1QQK A;  2RG9 B;  3O44 A;  4F83 A;  3CA0 A;  4LO7 C;  4GAI A;  3WA1 A;  3O5W B;  3FJ9 A;  4A7K A;  3AKG A;  3CRI A;  3CA1 A;  5EC5 A;  3V0B A;  2P23 A;  5BXT A;  3P6I A;  4CJM A;  4I6I A;  1EYL A;  3BAD A;  2NS2 A;  3K1X A;  1FGA A;  2X2T A;  4H9W A;  1S0G A;  4I8M A;  3HBW A;  4D0T A;  3QR5 A;  1TP0 A;  4OEF A;  4JRA A;  4JAW A;  5EG6 C;  5D62 A;  2AQZ A;  4LO2 A;  3H6S E;  4EKX B;  3H6Q A;  3I2X A;  3C9Z A;  4QC4 A;  5JMC A;  2GO2 A;  1BAR A;  1TTU A;  1AF9 A;  2Z49 A;  1ABR B;  1Z4S A;  1BFF A;  5BVP I;  3CQA A;  3H6R B;  8I1B A;  2F2F A;  4TLP A;  1EVT A;  3AH1 A;  3WIN C;  3FJF A;  1W3A A;  3CA6 A;  2ESU A;  3WO4 A;  3ZXD A;  5FNX A;  2LIE A;  1DIW A;  2D22 A;  1HKN A;  2DRE A;  2NYY A;  4Z8S B;  2MLL B;  1RZO B;  4IZE A;  2AFG A;  2MIB A;  2Y9X E;  5DSS B;  3V79 C;  3BB2 A;  4IQP A;  3JRR A;  3UJ4 A;  2Y9G A;  4KEK A;  3P6J A;  4X39 A;  2FFV A;  1II4 A;  3A07 A;  4DEN A;  3JUT A;  1HCD A;  1W3F A;  1G9C A;  4END A;  3V0A B;  1BFB A;  2MC2 A;  2AAI B;  3MPP G;  1EPW A;  3BAO A;  1IJT A;  1JLY A;  1WD4 A;  4Q9P A;  3UDA A;  2ZQO A;  4G6J A;  1FV2 A;  4LO3 A;  4WBC A;  1V6U A;  1XHB A;  3PHZ A;  1RML A;  2I1B A;  4MZF B;  3AKH A;  3CA5 A;  4XKI A;  5F8S A;  5GAQ A;  4EB2 B;  5BXP A;  4G1R A;  4Q91 A;  3LTQ A;  4GP0 A;  5BQU C;  3IM6 A;  3FJD A;  3VWC A;  1BFC A;  1FMM S;  3BAU A;  4I2S A;  4I4Q A;  5EHA A;  4QD2 C;  3R4U A;  2NM1 A;  4I4O A;  1JT5 A;  1M2T B;  3IM7 A;  3SNV A;  4I4Y A;  4AN7 B;  4QKS A;  1ISZ A;  2LIQ A;  3S8K A;  4Q9G A;  4LO1 A;  4I4P A;  1FV3 A;  1IHK A;  4QKR A;  5BXS A;  3HAL A;  4Z9W B;  1Z0H A;  4P0K A;  4L4H A;  5BP5 C;  2X2S A;  3V0B B;  3ZX7 A;  2XOA A;  1HWO B;  2AXM A;  1S0D A;  2F8X C;  1DJS B;  3RMY A;  3A22 A;  4OWK A;  4IHZ A;  1TWE A;  1ISW A;  4QAL A;  1Z2V A;  2E4M A;  3A21 A;  2DRY A;  3AZV A;  3ZC8 A;  1TIE A;  5BOW A;  1CVS A;  1MC9 A;  5HPZ A;  4EFQ A;  1SR4 A;  9ILB A;  1DFC A;  1S0E A;  3Q7X A;  2ERM A;  2R9K B;  1Q04 A;  1V6V A;  4GAF A;  4J2K A;  1AVU A;  1DQO A;  4EFR A;  3T8S A;  1FWV A;  4HR6 C;  4JP0 A;  2KKI A;  3NBE A;  1DQG A;  2VU9 A;  3BRD A;  4LO2 C;  4ISR A;  1HIB A;  3WO3 A;  1W3G A;  3CU1 B;  4KEI A;  2Z48 A;  3OGG A;  4GOY A;  5FZZ A;  1XZZ A;  2ZR1 B;  4P0J A;  4I0Y A;  3D7W B;  1NZK A;  4ION A;  2D44 A;  2L5X A;  3AKF A;  3S8J A;  2VLC A;  4X3A A;  4ZFY B;  7I1B A;  1Q1U A;  1IOB A;  2BFH A;  3ILA A;  4I4U A;  4II0 A;  4I3N A;  4ZFW B;  1JT4 A;  3OBR A;  4JKQ A;  1AVW B;  1G82 A;  1VCL A;  4I4V A;  2F2F C;  5B2H A;  1K5U A;  1PUM B;  3RMX A;  4EFP A;  2UUS A;  2GZB A;  1PUU B;  1YYN A;  3WMU A;  1IT0 A;  1M16 A;  2M49 A;  4QBV A;  3RTJ B;  2D7I A;  3N7L A;  3Q7Y A;  3UD9 A;  3FJK A;  3VT0 A;  31BI A;  1BLD A;  1G9B A;  4USO A;  3O4D A;  41BI A;  4A7Y A;  4H04 A;  2NP0 A;  4I1E A;  3O49 A;  1IRP A;  2K43 A;  1S0B A;  2D43 A;  4I1B A;  4OWL A;  3MAL A;  4KEJ A;  3BAV A;  4UY4 A;  3E8L C;  3AH2 A;  4D0Z A;  1BFG A;  1YTO A;  4QD2 B;  1D0H A;  3N0K A;  4P0L A;  4LO3 C;  4J2Y A;  2FO1 A;  1E0O A;  1R8O A;  5DUY A;  3BAG A;  3F1R A;  2D23 A;  3IIR A;  2K4A B;  1HWM B;  2FDB M;  1ISX A;  1ISV A;  3BA4 A;  5I1B A;  1S0C A;  4R6U B;  5JLV A;  1WBA A;  3OJV A;  4ZA3 B;  2DS0 A;  1HWN B;  2K8R A;  4YOL A;  1AVX B;  1PC8 B;  1BLA A;  4FVV A;  3FJH A;  1RY7 A;  2VXT I;  2NTD A;  4LO1 C;  3AJ6 A;  4MZG B;  3IAG C;  1T9F A;  3PG0 A;  4IY8 A;  1ILR 1;  3BA7 A;  3ZC9 A;  4LO0 A;  4LO8 B;  4I4X A;  3VUO A;  4MZH A;  21BI A;  5G00 A;  3BAH A;  2ZQN A;  4OW4 A;  4ZOT A;  3AKI A;  4X37 A;  3FJI A;  2HW9 A;  3BA5 A;  3BRG C;  1I1B A;  1YF8 B;  2E4M C;  4L4I A;  1AXM A;  2Q3N B;  1FQ9 A;  2Q9X A;  3FJ8 A;  1JTC A;  2HZ9 A;  2KH2 A;  4IZX A;  1I1E A;  1G9D A;  1SR4 C;  1JT7 A;  1DZC A;  3CA3 A;  2DRZ A;  1FMZ A;  1FN0 A;  1NUN A;  1RG8 A;  2IHO A;  2RST A;  2NZ9 A;  2HWA A;  1ONK B;  4I96 A;  2VSA A;  3I2A A;  1XG6 A;  3AZW A;  1CE7 B;  3N7J A;  1MD6 A;  3POK A;  4I7I A;  3I29 B;  3WMV A;  1N4K A;  3O4B A;  1S0L A;  2J3P A;  4G6M A;  4PC4 A;  2VSE A;  5F8Y A;  1J0S A;  1DZD A;  4ZKT B;  1IIL A;  1F31 A;  5D63 A;  1FWU A;  4I4S A;  4OEG A;  1KNM A;  2BEB A;  1SZ6 B;  3VSF A;  3CRG A;  4GP3 A;  4DEP A;  1UPS A;  5DVH A;  3Q7W A;  2KI4 A;  2YUG A;  4OWJ A;  1JLX A;  2D1Z A;  3LLP A;  1QQL A;  2KI6 B;  3VEQ A;  3VT2 A;  1XYF A;  2RQ9 A;  4USP A;  2FGF A;  2QN4 A;  1WD3 A;  4KC3 A;  2D24 A;  3RSJ A;  3BRF A;  4XFT A;  2NVH A;  3O4A A;  5BXR A;  3OGF A;  4HA2 A;  4X38 A;  1DLL A;  4ISQ A;  6I1B A;  3PUB A;  4OEE A;  4A7Z A;  1P63 A;  3FFZ A;  4GOV A;  1JQZ A;  1JY0 A;  3EF2 A;  1G9A A;  3HN1 A;  3HMY A;  4I4R A;  4QO3 A;  3NBC A;  3FJC A;  3N7M A;  1HCE A;  3P53 A;  1YBI A;  4J2S A;  4ZFU B;  4D8H A;  1AFC A;  3WIN A;  1GGP B;  2D20 A;  4ZBV B;  3O4C A;  3BAQ A;  1K5V A;  5D61 A;  4DCK C;  3AH4 A;  3VSZ A;  1HWP B;  2Y9W C;  4JQ0 A; 
#chains in the Genus database with same CATH homology
 2HWM A;  1V6W A;  2Y9F A;  3O4O A;  1BA7 A;  1PZZ A;  4HJJ A;  1ISY A;  1TOO A;  3R4S A;  3CRH A;  3H6R A;  2KLL A;  2BEA A;  3NBN A;  1S0F A;  3UJ0 A;  3HSM A;  3VT1 A;  3BX1 C;  4IYB A;  5F90 A;  5E24 E;  1T4Q A;  3O3Q A;  3A23 A;  1JT3 A;  1L2H A;  1WBC A;  3FJE A;  3FJJ A;  4H75 A;  2ET2 A;  3B9U A;  3ZXG A;  1TFM B;  2WRY A;  3FUQ A;  3UD7 A;  1EV2 A;  2VXR A;  3KMV A;  5DZU A;  3RTI B;  3OJ2 A;  3NBD A;  5FZU A;  1TWM A;  2WBC A;  3WO2 A;  3BTA A;  1OQL B;  3CA4 A;  4J2X A;  4ZLB B;  5FZY A;  4QBC A;  4JPZ A;  3OBT A;  3OJM A;  4ZGR B;  4LO0 C;  2VUA A;  4XFS A;  5BQU A;  1ITB A;  3UD8 A;  2QYI B;  1YXW A;  3V0A A;  4AN6 A;  1BAS A;  3FJA A;  5FNW A;  3FGM A;  1IRA X;  3PME A;  1V6X A;  4P6A A;  3W9T A;  1PWA A;  4IY9 A;  3AJ5 A;  3IM5 A;  4EEE B;  3FJB A;  1QXM A;  2FFU A;  4F34 A;  2P39 A;  4G9M A;  4JKX B;  4LO7 B;  3TC2 A;  3HOM A;  4FGF A;  3NJ5 A;  2IWT B;  4XFU A;  4OUJ A;  1A8D A;  3N7K A;  1DFQ A;  3QYD A;  5BP5 A;  4G9N A;  2D7R A;  4J23 B;  4I37 A;  3F62 B;  1Q03 A;  4KBB A;  5F8W A;  3FUO A;  1AVA C;  3CAH A;  1R8N A;  1QQK A;  2RG9 B;  3O44 A;  4F83 A;  3CA0 A;  4LO7 C;  4GAI A;  3WA1 A;  3O5W B;  3FJ9 A;  4A7K A;  3AKG A;  3CRI A;  3CA1 A;  5EC5 A;  3V0B A;  2P23 A;  5BXT A;  3P6I A;  4CJM A;  4I6I A;  1EYL A;  3BAD A;  2NS2 A;  3K1X A;  1FGA A;  2X2T A;  4H9W A;  1S0G A;  4I8M A;  3HBW A;  4D0T A;  3QR5 A;  1TP0 A;  4OEF A;  4JRA A;  4JAW A;  5EG6 C;  5D62 A;  2AQZ A;  4LO2 A;  3H6S E;  4EKX B;  3H6Q A;  3I2X A;  3C9Z A;  4QC4 A;  5JMC A;  2GO2 A;  1BAR A;  1TTU A;  1AF9 A;  2Z49 A;  1ABR B;  1Z4S A;  1BFF A;  5BVP I;  3CQA A;  3H6R B;  8I1B A;  2F2F A;  4TLP A;  1EVT A;  3AH1 A;  3WIN C;  3FJF A;  1W3A A;  3CA6 A;  2ESU A;  3WO4 A;  3ZXD A;  5FNX A;  2LIE A;  1DIW A;  2D22 A;  1HKN A;  2DRE A;  2NYY A;  4Z8S B;  2MLL B;  1RZO B;  4IZE A;  2AFG A;  2MIB A;  2Y9X E;  5DSS B;  3V79 C;  3BB2 A;  4IQP A;  3JRR A;  3UJ4 A;  2Y9G A;  4KEK A;  3P6J A;  4X39 A;  2FFV A;  1II4 A;  3A07 A;  4DEN A;  3JUT A;  1HCD A;  1W3F A;  1G9C A;  4END A;  3V0A B;  1BFB A;  2MC2 A;  2AAI B;  3MPP G;  1EPW A;  3BAO A;  1IJT A;  1JLY A;  1WD4 A;  4Q9P A;  3UDA A;  2ZQO A;  4G6J A;  1FV2 A;  4LO3 A;  4WBC A;  1V6U A;  1XHB A;  3PHZ A;  1RML A;  2I1B A;  4MZF B;  3AKH A;  3CA5 A;  4XKI A;  5F8S A;  5GAQ A;  4EB2 B;  5BXP A;  4G1R A;  4Q91 A;  3LTQ A;  4GP0 A;  5BQU C;  3IM6 A;  3FJD A;  3VWC A;  1BFC A;  1FMM S;  3BAU A;  4I2S A;  4I4Q A;  5EHA A;  4QD2 C;  3R4U A;  2NM1 A;  4I4O A;  1JT5 A;  1M2T B;  3IM7 A;  3SNV A;  4I4Y A;  4AN7 B;  4QKS A;  1ISZ A;  2LIQ A;  3S8K A;  4Q9G A;  4LO1 A;  4I4P A;  1FV3 A;  1IHK A;  4QKR A;  5BXS A;  3HAL A;  4Z9W B;  1Z0H A;  4P0K A;  4L4H A;  5BP5 C;  2X2S A;  3V0B B;  3ZX7 A;  2XOA A;  1HWO B;  2AXM A;  1S0D A;  2F8X C;  1DJS B;  3RMY A;  3A22 A;  4OWK A;  4IHZ A;  1TWE A;  1ISW A;  4QAL A;  1Z2V A;  2E4M A;  3A21 A;  2DRY A;  3AZV A;  3ZC8 A;  1TIE A;  5BOW A;  1CVS A;  1MC9 A;  5HPZ A;  4EFQ A;  1SR4 A;  9ILB A;  1DFC A;  1S0E A;  3Q7X A;  2ERM A;  2R9K B;  1Q04 A;  1V6V A;  4GAF A;  4J2K A;  1AVU A;  1DQO A;  4EFR A;  3T8S A;  1FWV A;  4HR6 C;  4JP0 A;  2KKI A;  3NBE A;  1DQG A;  2VU9 A;  3BRD A;  4LO2 C;  4ISR A;  1HIB A;  3WO3 A;  1W3G A;  3CU1 B;  4KEI A;  2Z48 A;  3OGG A;  4GOY A;  5FZZ A;  1XZZ A;  2ZR1 B;  4P0J A;  4I0Y A;  3D7W B;  1NZK A;  4ION A;  2D44 A;  2L5X A;  3AKF A;  3S8J A;  2VLC A;  4X3A A;  4ZFY B;  7I1B A;  1Q1U A;  1IOB A;  2BFH A;  3ILA A;  4I4U A;  4II0 A;  4I3N A;  4ZFW B;  1JT4 A;  3OBR A;  4JKQ A;  1AVW B;  1G82 A;  1VCL A;  4I4V A;  2F2F C;  5B2H A;  1K5U A;  1PUM B;  3RMX A;  4EFP A;  2UUS A;  2GZB A;  1PUU B;  1YYN A;  3WMU A;  1IT0 A;  1M16 A;  2M49 A;  4QBV A;  3RTJ B;  2D7I A;  3N7L A;  3Q7Y A;  3UD9 A;  3FJK A;  3VT0 A;  31BI A;  1BLD A;  1G9B A;  4USO A;  3O4D A;  41BI A;  4A7Y A;  4H04 A;  2NP0 A;  4I1E A;  3O49 A;  1IRP A;  2K43 A;  1S0B A;  2D43 A;  4I1B A;  4OWL A;  3MAL A;  4KEJ A;  3BAV A;  4UY4 A;  3E8L C;  3AH2 A;  4D0Z A;  1BFG A;  1YTO A;  4QD2 B;  1D0H A;  3N0K A;  4P0L A;  4LO3 C;  4J2Y A;  2FO1 A;  1E0O A;  1R8O A;  5DUY A;  3BAG A;  3F1R A;  2D23 A;  3IIR A;  2K4A B;  1HWM B;  2FDB M;  1ISX A;  1ISV A;  3BA4 A;  5I1B A;  1S0C A;  4R6U B;  5JLV A;  1WBA A;  3OJV A;  4ZA3 B;  2DS0 A;  1HWN B;  2K8R A;  4YOL A;  1AVX B;  1PC8 B;  1BLA A;  4FVV A;  3FJH A;  1RY7 A;  2VXT I;  2NTD A;  4LO1 C;  3AJ6 A;  4MZG B;  3IAG C;  1T9F A;  3PG0 A;  4IY8 A;  1ILR 1;  3BA7 A;  3ZC9 A;  4LO0 A;  4LO8 B;  4I4X A;  3VUO A;  4MZH A;  21BI A;  5G00 A;  3BAH A;  2ZQN A;  4OW4 A;  4ZOT A;  3AKI A;  4X37 A;  3FJI A;  2HW9 A;  3BA5 A;  3BRG C;  1I1B A;  1YF8 B;  2E4M C;  4L4I A;  1AXM A;  2Q3N B;  1FQ9 A;  2Q9X A;  3FJ8 A;  1JTC A;  2HZ9 A;  2KH2 A;  4IZX A;  1I1E A;  1G9D A;  1SR4 C;  1JT7 A;  1DZC A;  3CA3 A;  2DRZ A;  1FMZ A;  1FN0 A;  1NUN A;  1RG8 A;  2IHO A;  2RST A;  2NZ9 A;  2HWA A;  1ONK B;  4I96 A;  2VSA A;  3I2A A;  1XG6 A;  3AZW A;  1CE7 B;  3N7J A;  1MD6 A;  3POK A;  4I7I A;  3I29 B;  3WMV A;  1N4K A;  3O4B A;  1S0L A;  2J3P A;  4G6M A;  4PC4 A;  2VSE A;  5F8Y A;  1J0S A;  1DZD A;  4ZKT B;  1IIL A;  1F31 A;  5D63 A;  1FWU A;  4I4S A;  4OEG A;  1KNM A;  2BEB A;  1SZ6 B;  3VSF A;  3CRG A;  4GP3 A;  4DEP A;  1UPS A;  5DVH A;  3Q7W A;  2KI4 A;  2YUG A;  4OWJ A;  1JLX A;  2D1Z A;  3LLP A;  1QQL A;  2KI6 B;  3VEQ A;  3VT2 A;  1XYF A;  2RQ9 A;  4USP A;  2FGF A;  2QN4 A;  1WD3 A;  4KC3 A;  2D24 A;  3RSJ A;  3BRF A;  4XFT A;  2NVH A;  3O4A A;  5BXR A;  3OGF A;  4HA2 A;  4X38 A;  1DLL A;  4ISQ A;  6I1B A;  3PUB A;  4OEE A;  4A7Z A;  1P63 A;  3FFZ A;  4GOV A;  1JQZ A;  1JY0 A;  3EF2 A;  1G9A A;  3HN1 A;  3HMY A;  4I4R A;  4QO3 A;  3NBC A;  3FJC A;  3N7M A;  1HCE A;  3P53 A;  1YBI A;  4J2S A;  4ZFU B;  4D8H A;  1AFC A;  3WIN A;  1GGP B;  2D20 A;  4ZBV B;  3O4C A;  3BAQ A;  1K5V A;  5D61 A;  4DCK C;  3AH4 A;  3VSZ A;  1HWP B;  2Y9W C;  4JQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...