3F23A

Crystal structure of zalpha in complex with d(cggccg)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
b'SIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Double-stranded RNA-specific adenosine deaminase
publication title The structures of non-CG-repeat Z-DNAs co-crystallized with the Z-DNA-binding domain, hZ{alpha}ADAR1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f23A00
5E1ZB 4HA8A 2P5LC 2A5YB 4PZJA 3IC7A 1U2WA 2PBIA 2VBWA 2FRHA 2XHKA 4IRGA 3N97A 3GLXA 2A61A 1FPQA 3K2ZA 2RN7A 5IT9K 3DQVC 2PG4A 4U0YA 4FHTA 3WE2A 5K5OA 3FMRA 2ZNZA 4AIJA 2YX7A 2F5CA 3J7AO 5D8LB 5LRSA 2G9WA 4RAYA 1JHHA 1TNTA 4CICA 3WTXC 4GCVA 5BPIA 5DCMA 3GFIA 1E2XA 3G73A 1U78A 3L09A 1YG2A 5FD6A 1YQAA 1OYYA 4UUVA 2ZMEA 1FYMA 2DPUA 4A0XA 1WSUA 1ZAOA 5LEKA 2HQRA 2BEOA 2DLLA 5HLIA 1HQCA 2GZWA 4S05A 2IW5A 2FBHA 2D1VA 3CO7C 2HGCA 2RV8A 3TOBA 2MC3A 3COAC 1OR7A 4PDKA 4HDVA 2Z3YA 4CO8A 4G9YA 1GVJA 4A6EA 4M74A 4Q4ZF 3LAJA 3C3WA 1XMAA 2A6EF 3VEPA 1MJ9A 4XLPF 1KU7A 1J2XA 3E97A 1OYWA 5D5VB 1ZLKA 3HTSB 3O3KA 4G6DA 2CSOA 1U5TA 5CVJA 1ON2A 4NB5A 1T6SA 1KU2A 1IW7F 1ODDA 1ULYA 1FZPB 3ABTA 3HHGA 3AAFA 3S2WA 3KP4A 2PEXA 4A5NA 5DCFA 1ZRCA 3WGIA 5E17F 4M9SA 1XCBA 5F6FA 5KK1A 2H27A 4ESFA 4Z2YA 3RI4A 2FU4A 4F7ZA 2ZXJA 4RGXA 5CJ9A 5HDKA 4R8HA 3OOPA 3W6JB 2ZNYA 1D3YA 2QBYB 3ZMSA 4YIFA 4ETSA 2VC0A 4G6QA 5JHUA 3RKYA 4KT5C 2GIVA 3K9TA 2HTJA 2EFOA 3I0TA 1FSHA 2PQ8A 4LGWA 1KQ0A 3ZP5A 4UV9A 3RPQA 3P9IA 3L7WA 1KA8A 3T8TA 5ED4A 1FY7A 2UWMA 1SFEA 4U0VA 4FT8A 3JSPA 1U6GA 3K69A 5L3FA 3ZMUA 2MH2A 1JE8A 1SD4A 3HYIA 3JSOA 3T1BA 1SFUA 3IHUA 4EJUA 5CVIA 4KIBA 1Z1DA 4EVIA 2QQAA 1REPC 4A0YA 1PDNC 1BI1A 3BPVA 1MDMB 1XN7A 2X0LA 3KP7A 1HW2A 3E6BA 3RKXA 4AWXB 4O6JA 3CJNA 4PGGA 5E1WA 3LQQA 5LLQA 2IP2A 3KEQA 1UHMA 4WXDA 2ZO4A 2OZ6A 1UFMA 2MA3A 2Z5UA 4AIHA 4IRHA 4ENJA 1EV7A 4JK1X 5E20A 3TKYA 4L9TA 4RB3C 2KIMA 2RC4A 2VBXA 4LK0F 1P4XA 4M71A 1BI2A 3R60A 3BJ6A 4GYIA 3DF8A 1P92A 5IT9Z 2UZKA 3MCZA 4M6YA 2FXAA 4KMUX 4O5VA 5HOOA 2EWNA 1KGSA 3BPXA 1FSEA 2CGPA 1KU9A 2BE5F 4CGZA 2O6GE 2PMUA 4EJOA 2JZYA 3ULQB 2CW0F 2GWRA 4HBLA 2GXBA 3WE3A 1YS6A 1TLHB 3F8MA 2P5KA 2RQPA 2FSWA 2HOEA 2LSOA 2E1CA 3P9CA 2VBZA 5JI6A 1BOAA 1IN4A 4MEYF 4PGHA 1VTNC 1HKSA 4ZYHA 2A69F 3H92A 2M45A 4LB5A 1D5VA 1OPCA 1USSA 1ZYRF 2KRFA 1STZA 1K7AA 1ZG5A 1T0FA 3EYIA 3NRVA 5TRDA 3FMQA 2W57A 4XSXF 2NAZA 3JTHA 3ZMTA 1ZH5A 1B9NA 4R1HA 2MLKA 2ISZA 4HV5A 1OMIA 3WTWC 5EEHA 2OAZA 3C18A 2OQGA 1C0WA 3KLOA 2XROA 1ZG3A 1P2FA 4EGZA 2WV0A 5FLXK 2AXLA 1XDUA 3GYHX 1JGSA 4ASNA 4QLCU 1B59A 4JBAA 4KN4X 4K2EA 3WGHA 1QZYA 3FM3A 4A5MA 1TBXA 2QWWA 1CF7A 5HS8A 2FMYA 4M73A 4BYYA 2GA1A 4I0AA 4TV7A 1YS7A 3V7RA 5BS6A 5ICFA 2BYVE 3FF5A 2RKHA 4L9VA 4KMFA 2IA0A 3ZMDA 2A07F 5FFZA 1MD0A 2D45A 5J6XA 3B73A 4ENMA 1YIOA 4UXNA 1R36A 2KIFA 3GZ5A 2IVMA 2XAGA 4HF0A 1P4WA 2VBYA 4CDGA 5BOXA 4I0BA 4JQFA 2Z9OA 3HRTA 5D6FA 1EH8A 2EFPA 3ML6A 2QLZA 2HKOA 3BP8A 1S7OA 1WWXA 4E70A 2EJRA 3IWFA 3WTYC 5CVVA 2BGCA 2DW4A 2L4AA 5EEGA 3OV8A 2F5FA 1B6AA 5TJJA 2MLGA 1OYIA 4O3MA 2HKXA 3V7SA 1WRJA 2ZJ2A 4OOIA 1MDMA 1X3UA 3G3ZA 4BXUA 2G7HA 3E6CC 1W7PA 3HSEA 3EQLF 3JW4A 2R7DA 5F64A 1O3SA 1IF1A 2F5EA 3KZZA 1LEAA 3FWEA 3F8BA 3L9FA 4BAYA 1L0OC 1UCRA 2XASA 3DEUA 3GUDA 2HQNA 3MWMA 1IZ1A 3O6BB 2VC1A 1S7AA 5AIPA 1ONVA 2A6HF 1F9NA 2K7LA 2VXZA 1BI3A 3RYPA 3DPTA 4CXFA 3F72A 4AVPA 4ESJA 2EFWA 1FWZA 2DO7A 2O3FA 2P7VB 2KIUA 3E6DA 5BPDA 2EA4A 2P4WA 2CFXA 1S6LA 5DUKA 4I7HA 5D5XB 3R61A 2GQQA 3HTUA 1HBXG 3RPUA 2DU9A 1R23A 1WKMA 4MTEA 4G7ZF 2MBFA 1XGSA 2KJBA 3T8RA 3GWZA 4M6XA 1ZN2A 3KP6A 2X4HA 3R0JA 3ABUA 3EUHA 4G94A 4EGYA 2L3DA 3BROA 3GF2A 4RAZA 1MGTA 4BH9A 1GHCA 1J9IA 3KEOA 4EJVA 3CUQB 3E5QA 3SHFA 5FFXA 3HOSA 4P5OA 1TW2A 1FYKA 4L5JA 3I4PA 2XGXA 1LJ9A 3LA3A 1JXSA 1GXPA 1B9MA 4ZYEA 3M8FA 1I5ZA 4NHJA 3FZVA 1BC7C 2L54A 2QM3A 2WWYA 2V79A 3F6OA 2H6BA 5BMZA 1ON1A 3M7GA 1FP1D 4P96A 1FOKA 2ZBKA 3BOQA 3MAJA 3CO6C 4S04A 3KP3A 2A68F 1G3TA 5E1XA 3BDDA 3K0LA 4G8XA 4ON0A 5LGNA 1U8RA 2DPDA 2W85A 4PCQA 4L9JA 5DYMA 4U88A 1QO0D 1K6OA 3HRMA 1HW1A 4OIOF 3KP5A 2FQ3A 5FLXZ 3HRSA 1O7LA 1BI0A 4HQEA 4LMYA 3KLNA 3IRQA 2HS5A 3LFKA 5D5UB 3MFKA 2YU3A 2R3SA 3SQNA 3E3VA 4KN7X 1O3RA 2H09A 3J80K 2P6TA 1G3WA 1UHWA 2P8TA 1LDKB 2F2EA 4WF2A 3WTUC 2XVCA 2LF7A 1FBSA 3IKVA 1YW7A 2STTA 1MZBA 4BHCA 2IA1A 2P7CB 3LAPA 4KYWA 2PJPA 4P9FA 4Q5SF 4ZH4F 1FBQA 4Y13A 3SZPA 4I02A 1R22A 1ZARA 4OIPF 1IRFA 2W24A 1IXSB 3Q9SA 3ECOA 4M72A 1T98A 2IRFG 3DV8A 1E17A 3F8NA 2YSRA 2RDPA 3DFGA 3P9KA 1FX7A 2FF4A 2ESNA 3T0YA 3C1DA 2BBYA 1YO5C 4KNYA 3RTRA 4XSZF 3LA2A 3JAMK 1K78B 1KQ9A 4L0ZB 1W5TA 3I59A 4RGRA 4HYEA 2V1XA 1IN7A 1RIOH 2TDXA 3ZMZA 3E6MA 2NS0A 2VT2A 2DBBA 4HAMA 3BJAA 2AS5F 1AWCA 1L3LA 2JPBA 4N9HA 5AIQA 2VOPA 1G3YA 5ICCA 5ICEA 3E5XA 3EYYA 4ENKA 3RIRA 1HW5A 3GXOA 2PLYA 5HS7A 2ZFWA 1DPRA 1BC8C 3U9GA 2E7WA 1ZHFA 2EV0A 5ILSA 3TOAA 3BZ6A 3FHZA 4OU0A 4WXHA 2Y75A 1UB9A 2J5PA 3HUGA 3K1PA 1T2KA 1IXRC 1SFXA 2VT3A 3ROUA 4GXOA 4YFXF 3KFWX 4LD5A 3DXJF 3Q9VA 3VFZA 2WTEA 4BHBA 2IPQX 1XMKA 2V9VA 3ZQ7A 1V4RA 1DP7P 1MJBA 1B1BA 5E8IA 3BY6A 1IXCA 2XIGA 3V8LA 1IUYA 5ILVA 1Z05A 4P9UA 2EK5A 2M87A 4WXCA 2OZUA 2XAFA 4H0EA 3GFLA 1CGPA 1LEBA 1QBJA 4LLNA 4QWQA 1XB4A 3Q5FA 2FMLA 2MD5A 1W7PD 2DQLA 1R1VA 4AIKA 3O2PE 4RB1A 4KFCA 3TO9A 5L3EA 3LA7A 4LLLA 1U3EM 2Z99A 2XAQA 3GO5A 2IA2A 2CYYA 2OU2A 1YFHA 1S29A 2LKPA 3H3UA 3KCCA 4MHGA 2Q2EA 5LBQA 1BBYA 3T5XA 2YR2A 4P55A 4DNCA 5HDNA 4ENNA 3CUQC 1IN8A 1H9GA 5FO5A 2STWA 1TQPA 3WODF 2QENA 4ZYDA 3I53A 2V6CA 4UVBA 3W6KB 1BIBA 2DK5A 3RYRA 3ERED 3TDZC 4ZZDA 3KP2A 5LHIA 4KA4A 2PN6A 1R00A 4LLGF 2QVOA 3J81K 4B09A 1R58A 3K1NA 1OKRA 5ILUA 5IT3A 3SFZA 1XSXA 4N9IA 1JHFA 5BQTA 5DV5A 3J80Z 2QBYA 5LGTA 1V3FA 2VODA 4YIIA 1YW9A 2GA2A 2L02A 1U5TB 1EH6A 2COMA 5D4SA 5L3GA 4A2UA 1I1GA 2RVCA 1SAXA 3WU0A 4EM2A 5HS9A 4OIQF 4MEXF 3ELKA 2YPRA 3L00A 2VE9A 4HV6A 4HLYA 2UXNA 1J0RA 3WTZA 4U7DA 1J7KA 3L2CA 4Q47A 4MGRA 4A6DA 3QPHA 2JRTA 1O3QA 4HF2A 2G7UA 2NYXA 3F21A 1BIAA 2Q8KA 3JAMZ 5HVQC 3LQRA 1I6XA 5HDGA 4WK8F 1XSVA 1D8KA 4EM0B 4EQQA 4HZFA 4DQ2A 2YX4A 4GO1A 1Z6TA 3EDPA 3GW2A 2HYGD 1WQ2A 2JPCA 1QGPA 1XCVA 2CWEA 3I5UA 2FBKA 4LG0B 2FEZA 3R0AA 4ESBA 4HQMA 1IRGA 1A04A 3CUOA 4KIGA 5F1RA 3CLOA 1FYLA 1Z7UA 2GXGA 4WCGA 4GYGA 4RB0A 1NHAA 4NQWA 2O61A 4CHUA 4XLNF 1EH7A 3QPTA 5LEJA 2O0YA 2QQ9A 5K5RA 3HSFA 3EETA 2GAUA 4YFNF 2A3SA 1Z91A 1BM9A 2OQRA 4RGSA 5L3DA 1R5HA 3QP6A 4BNCA 1ZRDA 1GXQA 3KZYA 2V1UA 1PP8F 1KYZA 5JR3A 2QZ8A 2ESHA 2Y48A 3WG9A 1LDDA 1SD5A 2QUFA 2Y0MA 1IN5A 4N0BA 2FBIA 2JTVA 2OA4A 3CTAA 2XKPA 1DDNA 2VONA 1R5GA 2LDUA 3VOEA 2E1NA 3MZHA 3V4GA 2HYFA 3KE2A 1FBUA 2K86A 3U1DA 5CYVA 2DQRA 1G6NA 3LSTA 4IRIA 3R6SA 5D4RA 3TQNA 4HOBA 1RZ4A 2EV5A 3HRUA 5CVRA 4IXAA 3F3XA 2FE3A 2XV4S 4KDPA 2HZTA 1TNSA 3QP5A 4OIRF 1O7FA 1PP7U 1TW3A 1LNWA 3ECHA 1XD7A 5LGUA 2DK8A 1BN5A 1ZGAA 1W5SA 2PFBA 1RUOA 1G3SA 5ICGA 3IRRA 4BHPA 2EA2A 5DUIA 5FB2A 2OBPA 2VOOA 1HKQA 1I27A 2RGVA 2QYOA 4ZYGA 3F22A 4EM1A 2ETHA 1I1SA 3WGGA 4KIFA 3ZN1A 1QPMA 1TQIA 2LF8A 1T39A 1LDJA 2BV6A 1P6RA 4RB2C 2KKOA 1J59A 2JT1A 4HF1A 3M1EA 3V7CA 5L3BA 1YLFA 1FC3A 2K27A 2EB7A 1XDSA 5JVTA 3J81Z 2DI3A 3M9AA 2EV6A 3GX4X 2VE8A 5LHHA 3GFMA 4HX8A 3GEZA 4I98B 4Y17A 5A2QK 1FP2A 1IN6A 1YW8A 1RUNA 6PAXA 4U0WA 1K79A 3DP7A 3VODA 4HW0A 4IHTA 2FNPA 1R1UA 1B4AA 1CF7B 2B0LA 5DD4A 1Q1HA 1ZGJA 4G7OF 4EJWA 3U2RA 2F5DA 2VN2A 4G7HF 2D1HA 2LNBA 1Z9CA 3ZN0A 5KVRA 4HX7A 4IVNA 5DD8A 3FX3A 2CO5A 5K1YA 3D0SA 3REOA 4A12A 4UHTA 1H0MA 5ERIA 2FA5A 2WC2A 1ZREA 3FXQA 5LHGA 1P4AA 2L4MA 2NNYA 3QRFF 1R1TA 1U5TC 5H6RA 2M30A 3WTSC 2XAHA 1ZG1A 1XGNA 4LG0A 4AD9A 4L9NA 3WU1B 1YYVA 4YFKF 1FLIA 3H3ZA 3C7JA 2HEOA 4YG2F 3IL2A 1SMTA 3CDHA 5LRRA 1XGMA 2O03A 4LB6B 1HSJA 4OMZA 5D8KB 3F8FA 1F5TA 2H6CA 4M9XA 5D5WB 2HR3A 2CG4A 4RGUA 2OD5A 2DAOA 2H94A 2C6YA 1KYWA 3JTGA 2ZCWA 1AOYA 4XRFA 5AONA 1DUXC 3I58A 2ACJA 2O8XA 4ZZLA 1XSDA 4MQ9F 1KQ8A 1S3JA 2K02A 1HXDA 1MJAA 1W7PB 5J8CA 2IT0A 3R4KA 4UNOA 3HOTA 2DFIA 3IKTA 3FXUA 1J75A 4IF4A 4EJTA 4HX4A 1USTA 2XUBA 4D0PA 2R7FA 4GGGA 3CUQA 4BQAA 3TO6A 3K1MA 1O3TA 1FT9A 1T38A 4A0ZA 3QOPA 3QU6A 4RS8A 2M1BA 3F6VA 2XKOA 4XBFA 2E7XA 4WX9A 1HSTA 3MQ0A 5E8GA 4FX0A 5H20A 5DEQA 1W4MA 2XRNA 2HWVA 1PUEE 3RDIA 4HDUA 3D5LA 5CVUA 5K5QA 3BWGA 2K4JA 3NQOA 2NNNA 5FGMA 5HLHA 1R7JA 1H9TA 4I2OA 2KJCA 4OMYA 1S8NA 3TGNA 2ZKZA 2ELHA 2JSCA 5HLGA 3NEUA 1G4DA 2CQKA 2PMHA 3VB2A 2ISYA 4WWCA 5FD5A 5DCMB 2P6SA 1MKMA 2FNAA 3TDUC 4M9ZA 4CZZA 4L0YB 3N4MA 1HKTA 2FOKA 4I09A 2ZMEB 1XGOA 3ISPA 4FX4A 1QQIA 4IJAA 3KETA 4Q48A 2HFHA 5E18F 1LQ1A 3LWFA 4IHSA 2HTSA 1RI7A 5L3CA 4LK1F 2D2WA 2P5VA 5JFRA 3I54A 2ADUA 2DT5A 3GZ6A 4UV8A 1SD7A 4UVCA 4EMSA 1IAWA 1F4KA 1WI9A 4LJZF 4U7BA 2L01A 3DPLC 2UXXA 3BJOA 4L5IA 3WTVC 3SXYA 1KU3A 2RNJA 3HSRA 1FNNA 2XAJA 1QZZA 1YTYA 5DDGA 4MQVA 1F1ZA 1RNLA 5A2QZ 4KICA 2HDCA 3PQJA 1TTYA 2PI0A 4IPAA 3FM5A 3E5UA 5H6QA 1DPUA 3P7NA 5D6EA 4MNUA 1K78A 3RJPA 1ZLJA 3V8KA 3F8CA 2EFNA 4L18B 1Y0UA 3DKWA 1SD6A 3MZYA 2EFQA 5J8FA 4Y15A 1Z6RA 1TQMA 3V8JA 2V1DA 3MEXA 4I01A 1BJAA 4UVAA 3HIFA 3WTTC 5CLSA 3F23A 4EV0A 2M8EA 1SMYF 4LFUA 2K4BA 3FMSA 1D8JA 3GVAA 4MTDA 3I64A 2MH9A 2QQBA 3B02A 4CYDA 1O57A 2W25A 3FXRA 2DTRA 3M8EA 3ZMVA 3HHHA 1J5YA 2NRAC 4KUMA 3RKWA 2Q0OA 3QAHA 2M5WA 1ZRFA 3I59B 1LB2A 4OINF 2Z33A 4B8XA 1QNTA 2J5OA 3SZTA 3I71A 4R79A 3PFIA 2IJLA 1LVAA 3PQKA 3QU3A 3TO7A 3GFJA 3ZPLA 4HLXA 3IWZA 2W84A
chains in the Genus database with same CATH superfamily
1IJWC 3H9JA 3PNVA 4V2GA 5FKNA 5E1ZB 2DA2A 3A0BC 4HA8A 5CKTA 1YJ9I 2P5LC 2A5YB 4PZJA 4RDUA 3BG3A 1U2WA 3IC7A 4II2A 2PBIA 2VBWA 1T95A 2FRHA 2XHKA 4IRGA 1ZELA 1RPWA 2VIXA 5GPCA 3N97A 3GLXA 2A61A 2DA3A 2BHZA 1FPQA 2L5QA 3CC4I 2BY2A 1IO2A 3K2ZA 2RN7A 3PNYA 4UUSB 4PSXA 5IT9K 3DQVC 1EJ9A 2DA5A 4NC7A 4E7KA 2DYSH 2PG4A 3DBLB 3GTQJ 3NARA 3FXOA 2JSPA 3OYAA 4U0YA 4FHTA 1OCOH 3WE2A 5K5OA 3FMRA 2XF6A 2ZNZA 4AIJA 2YX7A 2F5CA 2K3PA 4AUXA 2R7WA 3J7AO 5K7HA 3ASNH 5D8LB 5LRSA 2G9WA 3V42A 2WA0A 3B6CA 4RAYA 1JHHA 3H5RA 4I76A 1TNTA 3MKWB 1UJ8A 3HB9A 4CICA 3WTXC 1SVLA 1S9HA 2QKMB 4GCVA 3HUGB 5BPIA 2XGDA 5DCMA 1MBGA 3GFIA 1E2XA 2NVUB 2VKVA 3G73A 5E79C 1U78A 1YITI 3L09A 4X6AJ 1YG2A 4IX7A 5FD6A 2E1MB 1YQAA 2IEKA 1X2MA 1OYYA 1A36A 4UUVA 2JUCA 2ZMEA 4XK4A 1FYMA 2HVSA 3AG1H 1ZR2A 2DPUA 2L0KA 2QQ8A 4A0XA 3JR9A 1R5ID 4BY7J 1WSUA 1ZAOA 2R7TA 5LEKA 2M4GA 2HQRA 3ESWB 1AKHB 3ERMA 5FRNA 5EZGA 2BEOA 3IUOA 2DLLA 5HLIA 1HQCA 4W97A 2GZWA 4F92B 4S05A 2IW5A 3FK7A 1BR1A 1IG7A 2CUEA 2FBHA 2HDWA 2D1VA 2L7ZA 3BTLA 4QSHA 2HGCA 3CO7C 2RV8A 3TOBA 1S5LC 1OCPA 2MC3A 3PUBA 3COAC 1OR7A 2K9NA 4PDKA 3OWTA 3Q0VA 4HDVA 3LSIA 2VQLA 2Z3YA 3CLQA 3LSPA 5JVGF 1F36A 2VI6A 4CO8A 3NWTA 3SJMA 4G9YA 2VKHA 2R5ZA 1GVJA 4A6EA 2Y9ZA 4M74A 4Q4ZF 3LAJA 1MBEA 3C3WA 1XMAA 3ABLH 2A6EF 4NC6A 1MJ9A 3VEPA 2DA4A 5LD2C 4XLPF 3CESA 1KU7A 4OAYA 1J2XA 2YUSA 1UHSA 2ECBA 3L2RA 3HGYA 3E97A 5F08A 3OYLA 5HODA 2LMDA 2R93J 3VPRA 1OYWA 2LVSA 3ZRGA 5D5VB 4FTHA 3OY9A 1ZLKA 3HTSB 5C4XJ 1BJZA 3BQZA 1W36D 1ETYA 3EUHC 3O3KA 1ZQ3P 1MBHA 4G6DA 2CSOA 4C3IJ 1U5TA 1Y8QB 2NVXJ 5CVJA 1ON2A 2ELKA 2KDOA 4XM3A 2WB1N 4NB5A 3NAUA 1T6SA 3PJRA 1KU2A 2R5YB 3GBGA 1WJ5A 3OYKA 1IW7F 2DOAA 1X4PA 4Z6YA 1ODDA 1ULYA 1SFOJ 1FZPB 3ABTA 2EPFA 3JRBA 3CC2I 3HHGA 3FK6A 4KITB 4GDFA 5EF6A 4DBRA 2WAEA 3AAFA 3AKZA 3S2WA 2YU9J 2IGOA 3KP4A 3H9GA 2XGEA 1VNDA 3HGGA 2PEXA 4BXFA 3OL3A 1GLNA 2V4JC 4A5NA 5DCFA 1ZRCA 2CS3A 3TW7A 3WGIA 2ZFUA 5E17F 4M9SA 2PJRA 1XCBA 5F6FA 1WCMJ 2F5VA 5KK1A 3D1NI 2H27A 2X51A 4ESFA 4Z2YA 2MD0A 4RAFA 3RI4A 1ETVA 2X1DA 3BG9A 2FU4A 5IPAA 4DW6A 4F7ZA 2VUMJ 3KIOA 4A3KJ 2ZXJA 4RGXA 1QVUA 5CJ9A 1H8AC 1OFCX 5HDKA 2HPIA 4R8HA 2JK3A 4XICA 2GOXB 3OOPA 1VQOI 1X1PA 3W6JB 2A05A 2ZNYA 1K83J 1D3YA 2QBYB 3ZMSA 4YIFA 4ETSA 2CQQA 2VC0A 2E34A 4G6QA 5JHUA 4IOAF 3RKYA 2JJ7A 4KT5C 1R4MB 2GIVA 3K9TA 4DOZA 2HTJA 3OMYA 1K61A 1LKXA 2EFOA 2AHQA 3I0TA 1FSHA 3JRIA 2PQ8A 4LGWA 1MNMC 1BOBA 3EPZA 2VLAA 2LTPA 1KQ0A 3ZP5A 4E4HA 4I99C 4UV9A 3RPQA 2HQAA 3P9IA 3AL0B 1XMXA 3L7WA 4BQQA 4J19A 1KA8A 1VQNI 2OCEA 2X9DA 2WY8Q 3T8TA 2HPMA 5ED4A 4XL9A 1LPQA 1FY7A 4QPOA 2UWMA 1P7IA 1SFEA 3G2BA 4U0VA 3IH2A 4FT8A 3JSPA 3S2HJ 2NVTJ 3MZ8A 2EH3A 4CA0A 1DQUA 1U6GA 1ZKGA 3FISA 3CCYA 1TP4A 1FMVA 3K69A 5L3FA 3S17J 2CQ7A 3ZMUA 2MH2A 1KONA 1D5YA 1JE8A 2O9LA 1W0TA 2EZKA 1SD4A 3C2BA 3HYIA 3JSOA 1IV8A 3T1BA 1SFUA 3IHUA 1O4XA 2IS1A 4EJUA 5CVIA 4KIBA 4XKBA 2M0MA 2OTJI 5F04A 1A6QA 1Z1DA 2WV1A 3HPGA 4EVIA 2QQAA 4BXXJ 1REPC 5FKMA 4A0YA 4DYRA 1F43A 2KT0A 1PDNC 1BI1A 3BPVA 5GP9A 2E19A 1MDMB 1XN7A 1GT0C 1XC5A 2X0LA 5C3EJ 3KP7A 3OR2C 1HW2A 3E6BA 3RKXA 4XRSA 4AWXB 3LOCA 4O6JA 1R71A 2E2HJ 3OYMA 3CJNA 4PGGA 3ZR8X 4A3BJ 5E1WA 2X48A 3LQQA 5LLQA 2Y2ZA 3JRDA 2W00A 2IP2A 3KEQA 1UHMA 4WXDA 2ZO4A 2EQRA 2OZ6A 1UFMA 2MA3A 2Z5UA 4AIHA 4IRHA 4ENJA 1EV7A 2E2JJ 4XRMA 1ETOA 4A3CJ 4JK1X 2WAQN 5E20A 2LR8A 3TKYA 4A93J 4L9TA 4RB3C 4BE0A 3M3YJ 2KIMA 5GAEJ 1OISA 2RC4A 2VBXA 4LK0F 4B43A 1P4XA 5JHFA 4X1EA 4M71A 3CMEI 2JA5J 1T56A 1BI2A 3R60A 3BJ6A 4GYIA 3DF8A 1P92A 3MKZA 2LBFA 5IT9Z 4IL6C 3SEZA 2UZKA 4PJJA 5J4VA 2IAIA 3MCZA 4M6YA 1W1WE 5M3FJ 1Z3YA 4NC8A 3W2WA 3OYBA 4MFDA 2FXAA 4KMUX 4O5VA 5HOOA 2EWNA 1KGSA 3BPXA 1FSEA 3G71I 2CGPA 1POGA 1KU9A 2BE5F 4CGZA 1FTZA 4BE2A 2O6GE 2PMUA 4EJOA 3HC7A 2JZYA 4B47A 3ULQB 4Y4RA 2RAEA 2CW0F 2GWRA 4HBLA 5GPAA 2GXBA 3WE3A 3MKLA 1RC9A 5F0CA 2VQGA 4PJNA 1YS6A 1TLHB 3F8MA 2P5KA 2RQPA 2FSWA 2HOEA 3ZQQA 4F55A 2LSOA 2E1CA 3JCUC 2RREA 2L2OA 3A1YA 3P9CA 2VBZA 1UZCA 3U21A 5JI6A 1BOAA 3CDIA 1IN4A 2COBA 4MEYF 3N05A 4PGHA 2QEXI 1VTNC 4GRIA 1HKSA 4ZYHA 2A69F 3H92A 2M45A 4LB5A 4B3AA 1D5VA 3H5AA 1GV2A 1OPCA 1USSA 1ZYRF 3S1QJ 2LD5A 3HBLA 3QWLA 2KRFA 2DA1A 1STZA 1K7AA 1ZG5A 1T0FA 3EYIA 3NRVA 2HDDA 4HPQA 1Z3XA 3BR0A 5TRDA 3FMQA 2L9SA 4BKXA 3S2DJ 2W57A 2NXNB 2NVYJ 4XSXF 2NAZA 4DIQA 1Y1WJ 2HYJA 3JTHA 3ZMTA 1ZH5A 1LUJB 1B9NA 2CUZA 4R1HA 2MLKA 2WBMA 4DZPA 2ISZA 1PYVA 4HV5A 1OMIA 2KHMA 2W82A 3WTWC 1H89C 3BR3A 5EEHA 3HOVJ 2XPWA 2OAZA 4CH7A 3A2KA 3K4NA 2MFZA 3C18A 4HNTA 2OQGA 1C0WA 3KLOA 2XROA 2E1MC 1ZG3A 1RR7A 3CJTB 3E7LA 1Z0XA 1P2FA 2X85A 4EGZA 3FIWA 4F3QA 3CC7I 2WV0A 5FLXK 2AXLA 1XDUA 3GYHX 1JGSA 1GVDA 4C30A 4ASNA 4QLCU 1B59A 3I3LA 1BL0A 4JBAA 4KN4X 4NDLA 2Y0SA 4K2EA 4N4NB 3WGHA 1QZYA 3FM3A 3CCEI 3J7AY 1TWFJ 4A5MA 3CDLA 1TBXA 2QWWA 1CF7A 5HS8A 2FMYA 2GXAA 4M73A 3RPUD 4BYYA 2GA1A 4IQ4A 2M0CA 3G4SI 4I0AA 4PFOA 4RA2A 4TV7A 1YS7A 3V7RA 5BS6A 5ICFA 2BYVE 2ELJA 2VASA 5B1AH 1W0UA 2K85A 3FF5A 2RKHA 4L9VA 4KMFA 1IDYA 2IA0A 3ZMDA 4BBSJ 4JOMA 1YX5A 4BQOA 1QA6A 2A07F 2B9SA 5FFZA 1LE8A 1SAUA 1MD0A 2EZIA 2ZXWH 2ME6A 2D45A 1FOXA 5J6XA 4I6ZA 2H1KA 3L2WA 5JLWA 1G2HA 1FJLA 2KRHA 2X6OA 3B73A 4C9YA 4ENMA 1YIOA 4UXNA 5FKKA 1R36A 3D5SC 4XR6A 2KIFA 3GZ5A 3OSGA 2MYSA 2IVMA 4BEHA 2D5VA 3CMAI 2XAGA 4HF0A 1P4WA 5GTHC 2VBYA 4CDGA 2M2EA 3DLLF 5BOXA 4RLFA 2ICWG 1PUFB 2LYCA 1R6RA 4A3IJ 2R7SA 2JVGA 4A3JJ 4I0BA 4KJZA 1ETKA 4JQFA 2Z9OA 3HRTA 3OR1C 1EF4A 4XOPA 2DCEA 5D6FA 1EH8A 1NK2P 2EFPA 2OJED 2DTZA 1GV5A 3H35A 3AG2H 2CJJA 3LMMA 2HNHA 3ML6A 2QLZA 2HKOA 3BP8A 1S7OA 1WWXA 3M07A 2G0EA 4E70A 1WJAA 2EJRA 3GTMJ 5M3MJ 3IWFA 3WTYC 3S14J 5CVVA 1UG0A 2BGCA 2DW4A 2QKLB 1X3ZB 2QSGX 2BW3A 3W3CA 2L4AA 4DGWB 3PSFA 3OV8A 5EEGA 1NK3P 2CUJA 2F5FA 2HOAA 3S32A 2KDZA 1B6AA 4HG2A 5TJJA 2L9RA 2MLGA 5F0FA 4BY1J 3HG9A 5FKOA 1OYIA 4O3MA 2DMNA 4LIUA 2HKXA 1WI3A 3CJQB 3GTPJ 2JA8J 3V7SA 1WRJA 2ZJ2A 4OOIA 4XORA 1MDMA 1X3UA 3G3ZA 4BXUA 2NVQJ 1GUUA 2H8RA 2G7HA 2OUMA 1HA8A 4BJ5C 2EILH 2DN0A 3E6CC 1HLVA 1W7PA 3HSEA 1XS9A 3EQLF 4XLAA 3JW4A 2R7DA 5F64A 3S3OA 1O3SA 4E6KG 1IF1A 2F5EA 2QCOA 3KZZA 1LEAA 3FWEA 3F8BA 3L9FA 4BAYA 4B48A 1L0OC 1UCRA 4UY8I 2XASA 3DEUA 1T33A 3RSNA 3GUDA 4F52A 2KP6A 5IOYA 2I10A 2FQ4A 2LY9A 2HQNA 3MWMA 3AL0C 3H0GJ 3ZQIA 9ANTA 1MIJA 2R7XA 1IZ1A 2KZGA 4FISA 3O6BB 1ORKA 2VC1A 1S7AA 2KFDA 5AIPA 1ONVA 2Z16A 2A6HF 4B44A 3BCAA 1F9NA 2K7LA 1OJLA 2VXZA 4XLHA 5CQEA 1BI3A 3RYPA 3DPTA 3ZGKA 2DOEA 4A69C 4CXFA 3F72A 5TGTA 3KZIC 4AVPA 4ESJA 4Y33A 2EFWA 1A6IA 1FWZA 2HI3A 2DO7A 2O3FA 2P7VB 2JWTA 2CV2A 4J01A 5CQGA 2KIUA 4IEJA 1V5GA 2AXTC 3BG6A 3E6DA 3CP2A 5BPDA 1JKQC 2EA4A 1U0JA 2CFXA 2P4WA 1S6LA 3KYLA 5DUKA 4I7HA 4M3BA 5F27A 5D5XB 1G8XA 4C2TA 3RZOJ 1JJ6C 3CZ6A 1JT0A 3R61A 2XSDC 4E7LA 1Z7LA 2GQQA 3HTUA 1TWHJ 1HBXG 4ZYAA 3RPUA 2DU9A 1R23A 5EGOB 3CCQI 1WKMA 4MTEA 4G7ZF 2MBFA 1XGSA 2KJBA 1YJWI 3T8RA 1N77A 2UUZA 3GMEA 3GWZA 4M6XA 1ZN2A 4CSWA 3KP6A 2X4HA 2KISA 3OYGA 1LFUP 5DM6F 3R0JA 1MMDA 3ABUA 3EUHA 1B72A 1FIAA 1MBKA 4G94A 4EGYA 1OLTA 2L3DA 3BTIA 3BROA 3HM5A 3GF2A 4RAZA 2CUFA 1JKRC 1MGTA 4B1RA 4BH9A 1GHCA 2R7OA 1ZTRA 1J9IA 3KEOA 4EJVA 3CUQB 3E5QA 2EBIA 2XB5A 1NG7A 3CF2A 3SHFA 1YHQI 1OQYA 3CMMA 5FFXA 4P5OA 3HOSA 3JREA 5B5EC 1TW2A 4GFBA 1FYKA 4L5JA 3I4PA 2XGXA 1LJ9A 3LA3A 1JXSA 2TRTA 1DU0A 2BOLA 4ZDPA 4V19K 4RBOA 1GXPA 1K4TA 4CYCB 1B9MA 1TT5B 3GTKJ 4ZYEA 3M8FA 4CCJA 4E7ZA 1I5ZA 4NHJA 2GIZA 3FZVA 2X6WA 3WHCA 4D9JA 3TW6A 1BC7C 4A3DJ 2L54A 3GZNB 2IGMA 2QM3A 2WWYA 2V79A 3TEDA 2VPRA 3F6OA 4XOTA 4D5CA 5HNHA 2H6BA 5BMZA 4D7NA 1FEXA 1ON1A 1YX3A 5FLMJ 3FXKA 3M7GA 5CPRB 2L7MP 1FP1D 1I3QJ 4P96A 2IGNA 5DS9A 3ZQLA 3S3NA 3CJRB 3CCVI 3SYTA 1FOKA 3RZDJ 2ZBKA 4G6TB 4AYBA 2Z1DA 1WJEA 3BOQA 3MAJA 3CO6C 4S04A 5IP9J 3KP3A 1YRNB 3K4LA 2A68F 1G3TA 4C2MJ 3JRAA 5E1XA 3BDDA 1HC8A 3I55I 3K0LA 4G8XA 1D1BA 1B8IA 4ON0A 5LGNA 1U8RA 2DPDA 2W85A 4PCQA 4L9JA 5DYMA 1H88C 1DP3A 4U88A 1QO0D 4LITA 3RCOA 1K6OA 2Q2EB 1MBJA 1HW1A 3HRMA 3KP5A 4ZTJA 4OIOF 2DJIA 2FQ3A 4E7IA 4E7SA 5FLXZ 1V5EA 3HRSA 1O7LA 1BI0A 4HQEA 3VYUB 3BR2A 3BTCA 4LMYA 3KLNA 4JX6A 5M5XJ 5E3MA 3IRQA 2X1EA 2HS5A 5GADJ 4E7HA 4ABZA 3LFKA 5D5UB 3HXLA 2V7FA 2YU3A 3MFKA 2R3SA 3SQNA 3E3VA 1A35A 4KN7X 1O3RA 4DBQA 2H09A 3J80K 2P6TA 1G3WA 3HOYJ 5F1JA 1UHWA 2P8TA 1LDKB 2F2EA 1JI8A 4WF2A 3WTUC 2XVCA 2LF7A 1FBSA 4XKWA 5B3SH 3IKVA 1YW7A 3ASOH 2DMTA 2STTA 1MZBA 4BHCA 1AA7A 2IA1A 3LAPA 5EG0A 2P7CB 4KYWA 1OCZH 2PJPA 4P9FA 4Q5SF 4ZH4F 1E3PA 4XLFA 1FBQA 4Y13A 3SZPA 1X3WB 1SC7A 3FXJA 4M3EA 4YIRX 2B7EA 4I02A 3VDXA 1R22A 1ZARA 4OIPF 4IHXA 2R4GA 1IRFA 5FROA 1VQMI 2W24A 4AIDA 1IXSB 3Q9SA 3ECOA 4M72A 4QTRA 1T98A 1R4NB 2Y0SN 3B6AA 3GCMA 1QVTA 2IRFG 3DV8A 1E17A 1RKWA 2CU7A 3F8NA 2CV1A 2IS4A 2YSRA 2RDPA 3DFGA 3P9KA 1FX7A 4ZC3A 4CCLA 1TWCJ 1ETWA 2EIMH 4ZTFA 2FF4A 1MSEC 2ESNA 4JX5A 3T0YA 5GAHJ 2X1CA 3C1DA 3QPLA 4F91B 2BBYA 1YO5C 3F9KA 4KNYA 4XLEA 2DODA 3ZOBA 2QSHX 2ID3A 3TL4X 3RTRA 4XSZF 3LA2A 3OYCA 2VKDA 1CQTA 3JAMK 1K78B 1KQ9A 4L0ZB 1W5TA 5J1RA 3I59A 4RGRA 4HYEA 2V1XA 1IN7A 5IYBJ 1RIOH 2TDXA 4A3FJ 3ZMZA 4XLCA 3E6MA 2NS0A 2HVQA 2M9HA 2VT2A 2DBBA 5FJ8J 1NH3A 4HAMA 4UUTA 2Y69H 3DTEA 3BJAA 4RM2A 2BHYA 1I6HJ 1APLC 4LG3A 2I8DA 4PJ0C 1IV6A 2AS5F 3BZKA 5F0HA 1AWCA 1JKPC 2JVHA 1U8BA 1L3LA 2JPBA 4L5EA 3OIOA 5K7ZA 4N9HA 2DDAA 2LP0A 1BA5A 5AIQA 2RNGA 1YI2I 2VOPA 3K70C 1G3YA 4UB8C 5ICCA 2CQNA 5ICEA 3E5XA 2MGQA 3EYYA 2JRMA 1Z21A 4ENKA 2HXOA 3RIRA 1Y0NA 1HW5A 4A3LJ 2FOWA 3GXOA 1X1DA 2DFHA 4M3FA 2PLYA 2DA7A 4UUSA 3IAS2 5HS7A 2ZFWA 4Y52J 3I4MJ 1DPRA 3OYFA 3H1CA 1BC8C 1VI0A 3G6EI 1Y39A 2V1NA 3U9GA 2E7WA 1ZHFA 2JN6A 2EV0A 5ILSA 2KLOA 3TOAA 3BZ6A 4BGDA 3FHZA 2K3FA 3LSJA 2BXYA 3QOEA 2W4SA 4OU0A 2OPTA 5IY5H 4WXHA 3SDGA 2Y75A 3VSLA 1UB9A 2J5PA 3HUGA 3K1PA 3O8GA 1T2KA 1IXRC 3FXMA 5B1BH 2LOOA 3FBIB 1SFXA 4A3MJ 2VT3A 1XTAA 3A01B 3ONQA 2X6YA 4NQWB 5TISC 4GXOA 3ROUA 3KFWX 4YFXF 5J1YA 4LD5A 2ZXHA 1FOYA 3DXJF 3Q9VA 1V5FA 5FKLA 3VFZA 3TP0A 4BBRJ 2E35A 2FJ1A 2WTEA 4BHBA 2IPQX 1XMKA 3OIQA 2AQEA 2V9VA 2M8GX 3ZQ7A 1V4RA 1DP7P 1MJBA 4CYCA 1B1BA 5E8IA 3BY6A 1IXCA 4NNJA 2XIGA 1AKHA 4FE4A 3V8LA 1IUYA 5ILVA 5KNLA 5KAIC 1Z05A 3ZQHA 2EK5A 4P9UA 2M87A 2E2IJ 4WXCA 2OZUA 4IOCF 2XAFA 2XC7A 4H0EA 2DT7B 1G59A 3GFLA 1JJ8C 1MH3A 1VQ9I 1CGPA 3ZQCA 2PX9A 4II3A 1LEBA 1QBJA 4LLNA 2K40A 2M4KA 3KYCB 1WH7A 4ZDLA 1Q1VA 3WHBA 3IP4B 4MLOA 4QWQA 4PFPA 3H3VK 1XB4A 3Q5FA 2R7UA 1T08B 4XKCA 3LSKA 2FMLA 2MD5A 1W7PD 2DQLA 1R1VA 4X0GA 1YRNA 4AIKA 3O2PE 4RB1A 4KFCA 3ABMH 3TO9A 5L3EA 1JUSA 4N4OB 3LA7A 1X2NA 2R0QC 2HZDA 2WB1A 4LLLA 1U3EM 2Z99A 2MC4A 2XAQA 3H9QA 3GO5A 3KX2A 2NOGA 5J47A 2IA2A 2CYYA 3I4NJ 2OU2A 1YFHA 1S29A 2LKPA 3LSGA 3H3UA 3KCCA 4C3JJ 5IYDJ 1WHUA 3IAM2 4JX4A 1VQ5I 3C2GA 2KMUA 2KRCA 2Q2EA 4MHGA 3DTIA 5LBQA 1BBYA 2MG4A 3T5XA 1JGGA 4BL0B 3ZQFA 2V9KA 2YR2A 4P55A 2R5YA 4U87A 4DNCA 1ACIA 5HDNA 1ITYA 4JP0A 1W36C 4ENNA 3CUQC 1IN8A 3PSIA 5E3OA 1R49A 5EJCA 1H9GA 3I9V2 5FO5A 2STWA 1TQPA 3WODF 1VQPI 4M3DA 2M7AA 2QENA 4CCKA 3P5JA 1MW7A 1VQ6I 2CW7A 3OYNA 4ZYDA 3X2QH 3I53A 4RMNA 2V6CA 2PMZA 4UVBA 3JRGA 1OCRH 3W6KB 1BIBA 1QRYA 4PK4A 2DK5A 2E60A 3RYRA 3ERED 3TDZC 4ZZDA 2ID6A 3KP2A 5LHIA 1SVMA 2P0WA 2MABA 3DU6A 4KA4A 1ZK8A 2PN6A 3K10A 2YS9A 3M4OJ 5LFAA 1R00A 2WADA 4LLGF 2QVOA 3J81K 4BACA 4B09A 1D0YA 1R58A 3K1NA 1FOWA 1OKRA 2EZLA 3PNTA 5ILUA 4S0HB 5IT3A 2W7NA 2R5ZB 2R7ZJ 2HXIA 5K7FA 3SFZA 1XSXA 4ZDOA 4N9IA 3PL8A 1JHFA 5BQTA 2GLOA 5DV5A 2BY3A 3J80Z 2QBYA 4BE1A 2E1OA 5LGTA 1V3FA 1MNDA 3A02A 3Q0WA 4AYBN 2VODA 1LFPA 3HKZA 4YIIA 2BVMA 1YW9A 2GA2A 4XONA 5DTDA 2LY1A 2L02A 4NUBA 3GTJJ 1TWGJ 1U5TB 3BR1A 4QPQA 2MSYA 1EH6A 5B66C 2COMA 3CCJI 5D4SA 5L3GA 2XB0X 4A2UA 1A31A 4ITVA 3BLYA 2L7FP 3BCBA 1QHHD 4HRIA 1I1GA 3JRFA 2RVCA 3DEWA 4YEJA 1SAXA 2E36A 3WU0A 4EM2A 5HS9A 4OIQF 3HOZJ 4MEXF 3K6GA 3ELKA 2YPRA 3OYEA 3L00A 2VE9A 1VQKI 4HV6A 2R92J 2B63J 1ZR4A 4HLYA 4XKVA 2UXNA 4OWRB 3E0JB 1J0RA 2BY0A 4XRSG 3KEYA 3WTZA 4PJMA 4U7DA 1J7KA 5IOZA 3PO2J 2QSFX 3LFUA 3L2CA 2PJRB 4Q47A 2F48A 5FRMA 4MGRA 3BT9A 4A6DA 3JRHA 3W2VA 3QPHA 1PJRA 2JRTA 1O3QA 4HF2A 2G7UA 4HSTA 2NYXA 3F21A 1BIAA 2UV1A 4EEFG 3PIOF 3HEFA 2VJJA 4KISA 2Q8KA 3JAMZ 5FLVA 5HVQC 3LQRA 1I6XA 4YELA 2ZC2A 2JQ7A 5HDGA 4WK8F 3L2QA 1XSVA 3QYBA 3TMOA 2MW8A 1D8KA 3G1MA 4EM0B 3BR5A 5E3NA 2JA6J 2K9SA 4EQQA 4HZFA 2XGCA 4DQ2A 1VZ0A 2XF5A 3DCFA 4DZJA 2YX4A 1X1CA 4GO1A 2VL8A 1Z6TA 4M3GA 3SDBA 3SFIA 3EDPA 3GW2A 5C4JJ 1MMNA 3CF5F 2HYGD 3S8PA 2W48A 1WQ2A 2JPCA 1QGPA 1XCVA 2CWEA 3I5UA 3UNGC 2FBKA 4LG0B 1BR2A 3OIPA 5M5WJ 2FEZA 3OYHA 3R0AA 4RAGA 4ESBA 4XIDA 1P7JA 4HQMA 1E0EA 1IRGA 1A04A 3CUOA 1K6YA 3FDYA 4KIGA 5F1RA 2H1LA 4XN3A 5GTIC 1ENHA 3ZCOA 4IKFA 3CLOA 1FYLA 3LSMA 1WJFA 1Z7UA 3LL7A 2GXGA 2OC6A 4WCGA 4GYGA 1X1AA 1NHAA 4RB0A 4NQWA 2O61A 3HOWJ 5J40A 3DLAA 4XLNF 4CHUA 3OOUA 1EH7A 1Z67A 3QPTA 1N75A 5LEJA 1W5CC 4OAZA 2O0YA 2QQ9A 4B3XA 5K5RA 2XSJC 4XN0A 3DBRB 1D1AA 3J7ZI 3CD6I 3TBIA 4BDZA 1WH5A 3HSFA 1EA3A 4BU2A 2HU9A 3EETA 2GAUA 4YFNF 2A3SA 1Z91A 3ZXSA 1YOVB 1BM9A 2OQRA 4RGSA 2EIJH 5L3DA 4AC0A 1R5HA 1TWAJ 3QP6A 4BNCA 1ZRDA 1GXQA 3KZYA 3SEQA 2V1UA 1PP8F 1TT0A 1WVRA 5E3LA 1KYZA 5JR3A 2N8GA 2QZ8A 3QPSA 2ZJQF 3H5NA 2ESHA 2Y48A 3WG9A 1LDDA 1SD5A 1VQ8I 2QUFA 2Y0MA 3CCMI 1IN5A 2EZHA 3K4CA 3HPHA 4N0BA 2FBIA 2W1OA 2JTVA 2OA4A 3DWLE 2ZJPF 4HSRA 1S72I 2H8WA 3CTAA 2XKPA 1DDNA 2VONA 1R5GA 2LDUA 3VOEA 2A6TA 2E1NA 1FMWA 3OS1A 3MZHA 3V4GA 2L9NA 3HZJA 1T8IA 2HYFA 3KE2A 1FBUA 4Y7NJ 3W6VA 2K86A 3U1DA 2Q1ZB 5KCMA 4AU7A 3G1LA 1XG1A 5CYVA 2DQRA 2F4IA 2KZVA 1Z77A 3GTGJ 1G6NA 3DKXA 4LOCA 3FBNB 3LSTA 4H4KC 4FETA 4IRIA 3R6SA 5D4RA 3TQNA 4HOBA 1RZ4A 3PIPF 4FE7A 4P1WA 2LBFB 2EV5A 4C2UA 4MO7A 3HRUA 5CVRA 4JYKA 2XDVA 4IXAA 2P81A 3F3XA 2FE3A 2XV4S 2JMWA 4KDPA 2HZTA 3PFYA 1TNSA 3QP5A 4OIRF 1O7FA 1VQLI 4BUPA 1PP7U 1TW3A 1LNWA 2BVLA 3DPUA 3ECHA 1XD7A 5LGUA 2CFOA 2DK8A 1BN5A 1ZGAA 5EZHA 2L7KA 1W5SA 1JT6A 2JA2A 2O5RA 3BC8A 5GAGJ 2K9LA 1LFBA 2OV7A 2PFBA 3OS0A 2K5CA 1RUOA 1G3SA 5ICGA 3IRRA 4ANJA 4BHPA 2EA2A 5DUIA 5FB2A 2OBPA 2LY2A 1DGRM 2VOOA 1HKQA 4CZCA 3LSRA 1I27A 2RGVA 4DYCA 2QYOA 4ZYGA 5M5YJ 2JA7J 3F22A 4CUGA 4EM1A 2TCTA 2ETHA 2XRLA 1I1SA 1OCCH 3VWBA 5J4YA 2HVRA 3L2VA 3WGGA 4KIFA 2Y9YA 3ZN1A 2BZTA 1QPMA 1TQIA 2LF8A 3DEEA 1HDPA 1T39A 1LDJA 2BV6A 1P6RA 4A3GJ 2K9MA 3TP3A 4RB2C 2KKOA 1J59A 2V6EA 2JT1A 4HF1A 3M1EA 3A03A 4BS9A 3V7CA 3LSHA 5L3BA 4Y3OA 1YLFA 1FC3A 2A5WA 2K27A 3UR3C 2HOTA 1V54H 2EB7A 1XDSA 5JVTA 2EIKH 2E5ZA 1DU6A 1PUFA 4IHWA 2IBDA 1UAAA 3J81Z 2AO9A 2DI3A 3M9AA 2EV6A 3GX4X 5DM7F 2VE8A 5LHHA 3HOXJ 1V55H 3GFMA 3SZGA 3ABKH 2NS7A 1OCTC 4HX8A 2ZMEC 3GEZA 4I98B 2XPUA 4Y17A 5A2QK 1FP2A 2QGUA 1TZLA 1IN6A 1YW8A 3NWSA 1RUNA 6PAXA 4U0WA 1K79A 3DP7A 3VODA 1XX5A 4HW0A 4IHTA 2FNPA 1R1UA 1B4AA 1WJBA 1X58A 4C3HJ 1ETQA 1X1BA 1RKTA 1CF7B 2B0LA 5DD4A 1Q1HA 1ETXA 1ZGJA 2VXDA 4EJWA 4G7OF 3U2RA 3K4MA 2PMZN 1OR7C 3S3MA 2F5DA 1X4OA 3A4CA 2VN2A 4G7HF 2D1HA 1JTXA 2LNBA 1Z9CA 3VSKA 3ZN0A 5KVRA 4HX7A 4IVNA 5DD8A 2LRDA 3FX3A 2CO5A 1LE8B 4KT6A 2O8KA 5K1YA 3D0SA 3REOA 4A12A 1U9OA 4UHTA 1H0MA 5ERIA 1EKEA 4FASD 5KAFC 4LIVA 2X6XA 3BG7A 1IRZA 2DFEA 4IO9F 1TC3C 4M6VA 1NG6A 2FA5A 2WC2A 1Y6IA 3H36A 1ZREA 3FXQA 5LHGA 1P4AA 1M1EB 2L4MA 1AHDP 3Q3SA 2NNYA 4BEHB 3QRFF 1R1TA 1U5TC 4D1QA 1HDDC 1A5JA 3HKZN 5H6RA 2M30A 3WTSC 2XAHA 1Y8RB 1WGXA 1ZG1A 1BW5A 1XGNA 2WAFA 4LG0A 4AD9A 4L9NA 3WU1B 3I56I 4BJTA 3K4BA 1YYVA 4YFKF 3MVPA 2V9PA 4W1UA 1SANA 1FLIA 3BZCA 3H3ZA 3ZQGA 3C7JA 2R7RA 2HEOA 4YG2F 3IL2A 1SMTA 3OS2A 3CDHA 5LRRA 1MMAA 1XGMA 1IC8A 3AG4H 3MN2A 4IZZA 2O03A 2KIQA 4LB6B 1MMGA 2DMPA 1JTYA 2IGKA 1HSJA 4OMZA 5D8KB 4CCMA 3BG5A 3F8FA 4A3EJ 1F5TA 2GOMA 2H6CA 4M9XA 2CH0A 2DDBA 5IP6A 2BW3B 5D5WB 2HR3A 2CG4A 4PUSA 4RGUA 2OD5A 3FKJA 5EEAA 3KPHA 3G1OA 2DAOA 2I5UA 2H94A 2C6YA 1KYWA 2V26A 2FD5A 2DFFA 3JTGA 1WPKA 1R9TJ 2ZCWA 5EGOA 1AOYA 2QF7A 1UG2A 4XRFA 4IHYA 2DT6A 3IH3A 2VJ5A 5AONA 1DUXC 3I58A 2ACJA 2O8XA 3CCSI 1X19A 4ZZLA 1XSDA 5J1UA 4MQ9F 2O7OA 1S3JA 2K02A 2ZSIB 1KQ8A 1HXDA 3OL4A 1MJAA 1RESA 1W7PB 5C44J 5J8CA 2IT0A 3R4KA 4UNOA 3HOTA 2KPMA 2DFIA 3IKTA 3FXUA 1RR8C 1J75A 3S1NJ 2NS8A 4IF4A 2LK2A 4EJTA 4HX4A 1FIPA 1USTA 2XUBA 4D0PA 5J3LA 4F93B 3GTLJ 2R7FA 4GGGA 3CUQA 1MBFA 1J09A 4BQAA 4DJAA 2LKSA 3TO6A 3K1MA 1NTCA 4QIWN 1O3TA 1FT9A 1T38A 2NOJB 4A0ZA 3QOPA 3CCUI 2DXIA 3HJEA 2DMQA 5BNGA 2DA6A 4AM3A 3KYDB 3QU6A 4RS8A 1QHGA 1SVOA 4HEA2 2M1BA 1SFKA 1MNEA 2XKOA 3F6VA 3BTJA 3S1RJ 4XBFA 2E7XA 4WX9A 1HSTA 1WJCA 3MQ0A 2FX0A 2VB6A 2ZB9A 5E8GA 2IXSA 1TL8A 4FX0A 5H20A 1BW6A 5DEQA 1VFCA 3RQIA 1W4MA 2XRNA 2HWVA 1PUEE 3RDIA 3PM1A 3D5LA 5CVUA 5K5QA 4HDUA 1JUPA 1I50J 4YRVA 3BWGA 2DJNA 2K4JA 2GM4A 1SEUA 3NQOA 3CCLI 3RKQA 4XMYA 1IDZA 2NNNA 5FGMA 5HLHA 1R7JA 1H9TA 4I2OA 2F4OB 3QODA 2KJCA 2VPLA 4OMYA 1S8NA 3QYEA 1UMQA 2KQRA 3CCRI 3TGNA 2K9QA 1VF9A 2ZKZA 3PUFA 4FQGA 2ELHA 2AQFA 3Q0UA 1VQ7I 4D7MA 2ZXIA 4CCNA 2JSCA 5HLGA 3NEUA 1G4DA 2LLKA 3DKYA 5HNFA 4J00A 3VYSB 4E7JA 2CQKA 1MSFC 3CQZJ 2PMHA 3VYRB 4MFEA 3MMYB 1B72B 3VB2A 2ISYA 1MMSA 3EUKL 2Z2SB 4WWCA 5FD5A 2LC2A 3MKYB 5DCMB 2P6SA 1I3AA 1QPIA 1MKMA 2FNAA 3GLLA 3TDUC 3C2HA 3FXLA 4M9ZA 4CZZA 3BQYA 2CV0A 4L0YB 3N4MA 2CW8A 1HKTA 1S7EA 3CMYA 2FOKA 4I09A 1YJNI 2ZMEB 2IS2A 1XGOA 2CRGA 2DMUA 3ISPA 4RM3A 4FX4A 3K4KA 1QQIA 4IJAA 3UKGA 3KETA 3PO3J 4Q48A 2HFHA 3EUAA 5E18F 3E1SA 1LQ1A 1YIJI 1P9QC 3LWFA 4IHSA 3W2AA 2HTSA 1RI7A 1IRXA 4LK1F 5L3CA 1HF0A 1RETA 1K4SA 2D2WA 4G12A 5IYCJ 2R7VA 2P5VA 5JFRA 2LG4A 3I54A 2VJ4A 2ADUA 2DT5A 3GZ6A 2M7BA 3JRCA 3FHNA 4UV8A 4IHVA 1SD7A 4PSWA 1IGNA 4UVCA 4EMSA 1FTTA 4UB6C 2ZJRF 1IAWA 1F4KA 1WI9A 1ERDA 2IS6A 4HNUA 4LJZF 2CQXA 4U7BA 2L01A 3DPLC 2UXXA 3BJOA 4L5IA 2ZSHB 4XNFA 3QYFA 3WTVC 3SXYA 2R7QA 1KU3A 2RNJA 1KZHA 2VKEA 3D5RC 1B8IB 3HSRA 1IUFA 1FNNA 1E3HA 4AVZA 2XAJA 1QZZA 3S15J 1YE9A 1WJDA 1YTYA 4BDYA 4V2FA 5DDGA 2JUGA 1WZ2A 4BQNA 4D5FA 3S16J 1QZEA 2ME0A 1Y1VJ 4MQVA 1F1ZA 2LFBA 1RNLA 5A2QZ 1BR4A 4KICA 2HDCA 3J7YJ 1D0ZA 3PQJA 1TTYA 4ZJZA 1N25A 2PI0A 4IPAA 3FM5A 1D1CA 3E5UA 5H6QA 3HOUJ 1DPUA 3P7NA 1T0FC 3M8JA 5D6EA 4PJLA 4MNUA 1K78A 3WG7H 3RJPA 2BXZA 2GBYA 1ZLJA 3F8CA 5JLXA 2EFNA 3V8KA 4L18B 4FCYA 1Y0UA 1N78A 3AFHA 3DKWA 3S1MJ 1MH4A 1SD6A 4RLQA 2WY7Q 3MZYA 2EFQA 3DU5A 5J8FA 3LNQA 2BY1A 2DOFA 4Y15A 1JUMA 3DBHB 2XF7A 1Z6RA 1TQMA 1PVEA 3V8JA 2V1DA 4XQFA 5EG0B 3MEXA 3HL2A 4I01A 3QQAA 3DTKA 3F0CA 3VYTB 1BJAA 4UVAA 2CMPA 2XPVA 2VQCA 3K7AJ 4HNVA 3HIFA 2OCCH 3WTTC 1GDTA 3IV5A 2EINH 5CLSA 3F23A 4DYQA 4EV0A 2M8EA 1SMYF 1QU3A 3U1KA 4LFUA 1Y56A 5HLTA 3L1PA 1AU7A 5EDNA 1HOMA 3WU2C 3S93A 2Y31A 2K4BA 3FMSA 1D8JA 2Y30A 5EYRA 2XAUA 3OYJA 3GVAA 2RQQA 1WFXA 4MTDA 3I64A 2HQ5A 3K2AA 2M34A 2FUG2 2F4MB 2LH9A 1E3OC 2F6CA 2HOSA 4B4CA 2MH9A 3MD2A 2QQBA 3B02A 1ZGWA 2WAQA 2OTLI 4CYDA 3OYIA 3CP8A 1I39A 2LREA 1O57A 2ECCA 2W25A 2OF7A 2KL4A 3HDDA 2L9VA 2E71A 4CCOA 1UELB 1VQ4I 3O8HA 4NBQA 4BJ6C 2VJIA 1U9NA 2DTRA 3FXRA 3BR6A 3M8EA 3M1CA 3ZMVA 3HHHA 3IH4A 1J5YA 1XPXA 2NRAC 4KUMA 3OSFA 3RKWA 5IP7J 1JKOC 2Q0OA 3QAHA 1RRJA 1LVKA 2M5WA 3AG3H 3I59B 1ZRFA 1LB2A 3A0HC 5H2FC 3H0DA 4OINF 2Z33A 1HCRA 3A01A 4B8XA 2VQHA 4EATA 1QNTA 1D0XA 2J5OA 2QA4I 3SZTA 3RQ4A 3I71A 4R79A 3PFIA 2IJLA 3K4JA 2E5NA 4MIMA 3FKIJ 1LVAA 3PQKA 3L2UA 3QU3A 3TO7A 3GFJA 2LKXA 3ZPLA 3OYDA 4HLXA 3K70D 3GTOJ 3IWZA 2DYRH 2M3AA 1DGWY 2W84A 4IQJA 5KHDA
chains in the Genus database with same CATH topology
5E1ZB 4HA8A 2P5LC 2A5YB 4PZJA 3IC7A 1U2WA 2PBIA 2VBWA 2FRHA 2XHKA 4IRGA 3N97A 3GLXA 2A61A 1FPQA 3K2ZA 2RN7A 5IT9K 3DQVC 2PG4A 4U0YA 4FHTA 3WE2A 5K5OA 3FMRA 2ZNZA 4AIJA 2YX7A 2F5CA 3J7AO 5D8LB 5LRSA 2G9WA 4RAYA 1JHHA 1TNTA 4CICA 3WTXC 4GCVA 5BPIA 5DCMA 3GFIA 1E2XA 3G73A 1U78A 3L09A 1YG2A 5FD6A 1YQAA 1OYYA 4UUVA 2ZMEA 1FYMA 2DPUA 4A0XA 1WSUA 1ZAOA 5LEKA 2HQRA 2BEOA 2DLLA 5HLIA 1HQCA 2GZWA 4S05A 2IW5A 2FBHA 2D1VA 3CO7C 2HGCA 2RV8A 3TOBA 2MC3A 3COAC 1OR7A 4PDKA 4HDVA 2Z3YA 4CO8A 4G9YA 1GVJA 4A6EA 4M74A 4Q4ZF 3LAJA 3C3WA 1XMAA 2A6EF 3VEPA 1MJ9A 4XLPF 1KU7A 1J2XA 3E97A 1OYWA 5D5VB 1ZLKA 3HTSB 3O3KA 4G6DA 2CSOA 1U5TA 5CVJA 1ON2A 4NB5A 1T6SA 1KU2A 1IW7F 1ODDA 1ULYA 1FZPB 3ABTA 3HHGA 3AAFA 3S2WA 3KP4A 2PEXA 4A5NA 5DCFA 1ZRCA 3WGIA 5E17F 4M9SA 1XCBA 5F6FA 5KK1A 2H27A 4ESFA 4Z2YA 3RI4A 2FU4A 4F7ZA 2ZXJA 4RGXA 5CJ9A 5HDKA 4R8HA 3OOPA 3W6JB 2ZNYA 1D3YA 2QBYB 3ZMSA 4YIFA 4ETSA 2VC0A 4G6QA 5JHUA 3RKYA 4KT5C 2GIVA 3K9TA 2HTJA 2EFOA 3I0TA 1FSHA 2PQ8A 4LGWA 1KQ0A 3ZP5A 4UV9A 3RPQA 3P9IA 3L7WA 1KA8A 3T8TA 5ED4A 1FY7A 2UWMA 1SFEA 4U0VA 4FT8A 3JSPA 1U6GA 3K69A 5L3FA 3ZMUA 2MH2A 1JE8A 1SD4A 3HYIA 3JSOA 3T1BA 1SFUA 3IHUA 4EJUA 5CVIA 4KIBA 1Z1DA 4EVIA 2QQAA 1REPC 4A0YA 1PDNC 1BI1A 3BPVA 1MDMB 1XN7A 2X0LA 3KP7A 1HW2A 3E6BA 3RKXA 4AWXB 4O6JA 3CJNA 4PGGA 5E1WA 3LQQA 5LLQA 2IP2A 3KEQA 1UHMA 4WXDA 2ZO4A 2OZ6A 1UFMA 2MA3A 2Z5UA 4AIHA 4IRHA 4ENJA 1EV7A 4JK1X 5E20A 3TKYA 4L9TA 4RB3C 2KIMA 2RC4A 2VBXA 4LK0F 1P4XA 4M71A 1BI2A 3R60A 3BJ6A 4GYIA 3DF8A 1P92A 5IT9Z 2UZKA 3MCZA 4M6YA 2FXAA 4KMUX 4O5VA 5HOOA 2EWNA 1KGSA 3BPXA 1FSEA 2CGPA 1KU9A 2BE5F 4CGZA 2O6GE 2PMUA 4EJOA 2JZYA 3ULQB 2CW0F 2GWRA 4HBLA 2GXBA 3WE3A 1YS6A 1TLHB 3F8MA 2P5KA 2RQPA 2FSWA 2HOEA 2LSOA 2E1CA 3P9CA 2VBZA 5JI6A 1BOAA 1IN4A 4MEYF 4PGHA 1VTNC 1HKSA 4ZYHA 2A69F 3H92A 2M45A 4LB5A 1D5VA 1OPCA 1USSA 1ZYRF 2KRFA 1STZA 1K7AA 1ZG5A 1T0FA 3EYIA 3NRVA 5TRDA 3FMQA 2W57A 4XSXF 2NAZA 3JTHA 3ZMTA 1ZH5A 1B9NA 4R1HA 2MLKA 2ISZA 4HV5A 1OMIA 3WTWC 5EEHA 2OAZA 3C18A 2OQGA 1C0WA 3KLOA 2XROA 1ZG3A 1P2FA 4EGZA 2WV0A 5FLXK 2AXLA 1XDUA 3GYHX 1JGSA 4ASNA 4QLCU 1B59A 4JBAA 4KN4X 4K2EA 3WGHA 1QZYA 3FM3A 4A5MA 1TBXA 2QWWA 1CF7A 5HS8A 2FMYA 4M73A 4BYYA 2GA1A 4I0AA 4TV7A 1YS7A 3V7RA 5BS6A 5ICFA 2BYVE 3FF5A 2RKHA 4L9VA 4KMFA 2IA0A 3ZMDA 2A07F 5FFZA 1MD0A 2D45A 5J6XA 3B73A 4ENMA 1YIOA 4UXNA 1R36A 2KIFA 3GZ5A 2IVMA 2XAGA 4HF0A 1P4WA 2VBYA 4CDGA 5BOXA 4I0BA 4JQFA 2Z9OA 3HRTA 5D6FA 1EH8A 2EFPA 3ML6A 2QLZA 2HKOA 3BP8A 1S7OA 1WWXA 4E70A 2EJRA 3IWFA 3WTYC 5CVVA 2BGCA 2DW4A 2L4AA 5EEGA 3OV8A 2F5FA 1B6AA 5TJJA 2MLGA 1OYIA 4O3MA 2HKXA 3V7SA 1WRJA 2ZJ2A 4OOIA 1MDMA 1X3UA 3G3ZA 4BXUA 2G7HA 3E6CC 1W7PA 3HSEA 3EQLF 3JW4A 2R7DA 5F64A 1O3SA 1IF1A 2F5EA 3KZZA 1LEAA 3FWEA 3F8BA 3L9FA 4BAYA 1L0OC 1UCRA 2XASA 3DEUA 3GUDA 2HQNA 3MWMA 1IZ1A 3O6BB 2VC1A 1S7AA 5AIPA 1ONVA 2A6HF 1F9NA 2K7LA 2VXZA 1BI3A 3RYPA 3DPTA 4CXFA 3F72A 4AVPA 4ESJA 2EFWA 1FWZA 2DO7A 2O3FA 2P7VB 2KIUA 3E6DA 5BPDA 2EA4A 2P4WA 2CFXA 1S6LA 5DUKA 4I7HA 5D5XB 3R61A 2GQQA 3HTUA 1HBXG 3RPUA 2DU9A 1R23A 1WKMA 4MTEA 4G7ZF 2MBFA 1XGSA 2KJBA 3T8RA 3GWZA 4M6XA 1ZN2A 3KP6A 2X4HA 3R0JA 3ABUA 3EUHA 4G94A 4EGYA 2L3DA 3BROA 3GF2A 4RAZA 1MGTA 4BH9A 1GHCA 1J9IA 3KEOA 4EJVA 3CUQB 3E5QA 3SHFA 5FFXA 3HOSA 4P5OA 1TW2A 1FYKA 4L5JA 3I4PA 2XGXA 1LJ9A 3LA3A 1JXSA 1GXPA 1B9MA 4ZYEA 3M8FA 1I5ZA 4NHJA 3FZVA 1BC7C 2L54A 2QM3A 2WWYA 2V79A 3F6OA 2H6BA 5BMZA 1ON1A 3M7GA 1FP1D 4P96A 1FOKA 2ZBKA 3BOQA 3MAJA 3CO6C 4S04A 3KP3A 2A68F 1G3TA 5E1XA 3BDDA 3K0LA 4G8XA 4ON0A 5LGNA 1U8RA 2DPDA 2W85A 4PCQA 4L9JA 5DYMA 4U88A 1QO0D 1K6OA 3HRMA 1HW1A 4OIOF 3KP5A 2FQ3A 5FLXZ 3HRSA 1O7LA 1BI0A 4HQEA 4LMYA 3KLNA 3IRQA 2HS5A 3LFKA 5D5UB 3MFKA 2YU3A 2R3SA 3SQNA 3E3VA 4KN7X 1O3RA 2H09A 3J80K 2P6TA 1G3WA 1UHWA 2P8TA 1LDKB 2F2EA 4WF2A 3WTUC 2XVCA 2LF7A 1FBSA 3IKVA 1YW7A 2STTA 1MZBA 4BHCA 2IA1A 2P7CB 3LAPA 4KYWA 2PJPA 4P9FA 4Q5SF 4ZH4F 1FBQA 4Y13A 3SZPA 4I02A 1R22A 1ZARA 4OIPF 1IRFA 2W24A 1IXSB 3Q9SA 3ECOA 4M72A 1T98A 2IRFG 3DV8A 1E17A 3F8NA 2YSRA 2RDPA 3DFGA 3P9KA 1FX7A 2FF4A 2ESNA 3T0YA 3C1DA 2BBYA 1YO5C 4KNYA 3RTRA 4XSZF 3LA2A 3JAMK 1K78B 1KQ9A 4L0ZB 1W5TA 3I59A 4RGRA 4HYEA 2V1XA 1IN7A 1RIOH 2TDXA 3ZMZA 3E6MA 2NS0A 2VT2A 2DBBA 4HAMA 3BJAA 2AS5F 1AWCA 1L3LA 2JPBA 4N9HA 5AIQA 2VOPA 1G3YA 5ICCA 5ICEA 3E5XA 3EYYA 4ENKA 3RIRA 1HW5A 3GXOA 2PLYA 5HS7A 2ZFWA 1DPRA 1BC8C 3U9GA 2E7WA 1ZHFA 2EV0A 5ILSA 3TOAA 3BZ6A 3FHZA 4OU0A 4WXHA 2Y75A 1UB9A 2J5PA 3HUGA 3K1PA 1T2KA 1IXRC 1SFXA 2VT3A 3ROUA 4GXOA 4YFXF 3KFWX 4LD5A 3DXJF 3Q9VA 3VFZA 2WTEA 4BHBA 2IPQX 1XMKA 2V9VA 3ZQ7A 1V4RA 1DP7P 1MJBA 1B1BA 5E8IA 3BY6A 1IXCA 2XIGA 3V8LA 1IUYA 5ILVA 1Z05A 4P9UA 2EK5A 2M87A 4WXCA 2OZUA 2XAFA 4H0EA 3GFLA 1CGPA 1LEBA 1QBJA 4LLNA 4QWQA 1XB4A 3Q5FA 2FMLA 2MD5A 1W7PD 2DQLA 1R1VA 4AIKA 3O2PE 4RB1A 4KFCA 3TO9A 5L3EA 3LA7A 4LLLA 1U3EM 2Z99A 2XAQA 3GO5A 2IA2A 2CYYA 2OU2A 1YFHA 1S29A 2LKPA 3H3UA 3KCCA 4MHGA 2Q2EA 5LBQA 1BBYA 3T5XA 2YR2A 4P55A 4DNCA 5HDNA 4ENNA 3CUQC 1IN8A 1H9GA 5FO5A 2STWA 1TQPA 3WODF 2QENA 4ZYDA 3I53A 2V6CA 4UVBA 3W6KB 1BIBA 2DK5A 3RYRA 3ERED 3TDZC 4ZZDA 3KP2A 5LHIA 4KA4A 2PN6A 1R00A 4LLGF 2QVOA 3J81K 4B09A 1R58A 3K1NA 1OKRA 5ILUA 5IT3A 3SFZA 1XSXA 4N9IA 1JHFA 5BQTA 5DV5A 3J80Z 2QBYA 5LGTA 1V3FA 2VODA 4YIIA 1YW9A 2GA2A 2L02A 1U5TB 1EH6A 2COMA 5D4SA 5L3GA 4A2UA 1I1GA 2RVCA 1SAXA 3WU0A 4EM2A 5HS9A 4OIQF 4MEXF 3ELKA 2YPRA 3L00A 2VE9A 4HV6A 4HLYA 2UXNA 1J0RA 3WTZA 4U7DA 1J7KA 3L2CA 4Q47A 4MGRA 4A6DA 3QPHA 2JRTA 1O3QA 4HF2A 2G7UA 2NYXA 3F21A 1BIAA 2Q8KA 3JAMZ 5HVQC 3LQRA 1I6XA 5HDGA 4WK8F 1XSVA 1D8KA 4EM0B 4EQQA 4HZFA 4DQ2A 2YX4A 4GO1A 1Z6TA 3EDPA 3GW2A 2HYGD 1WQ2A 2JPCA 1QGPA 1XCVA 2CWEA 3I5UA 2FBKA 4LG0B 2FEZA 3R0AA 4ESBA 4HQMA 1IRGA 1A04A 3CUOA 4KIGA 5F1RA 3CLOA 1FYLA 1Z7UA 2GXGA 4WCGA 4GYGA 4RB0A 1NHAA 4NQWA 2O61A 4CHUA 4XLNF 1EH7A 3QPTA 5LEJA 2O0YA 2QQ9A 5K5RA 3HSFA 3EETA 2GAUA 4YFNF 2A3SA 1Z91A 1BM9A 2OQRA 4RGSA 5L3DA 1R5HA 3QP6A 4BNCA 1ZRDA 1GXQA 3KZYA 2V1UA 1PP8F 1KYZA 5JR3A 2QZ8A 2ESHA 2Y48A 3WG9A 1LDDA 1SD5A 2QUFA 2Y0MA 1IN5A 4N0BA 2FBIA 2JTVA 2OA4A 3CTAA 2XKPA 1DDNA 2VONA 1R5GA 2LDUA 3VOEA 2E1NA 3MZHA 3V4GA 2HYFA 3KE2A 1FBUA 2K86A 3U1DA 5CYVA 2DQRA 1G6NA 3LSTA 4IRIA 3R6SA 5D4RA 3TQNA 4HOBA 1RZ4A 2EV5A 3HRUA 5CVRA 4IXAA 3F3XA 2FE3A 2XV4S 4KDPA 2HZTA 1TNSA 3QP5A 4OIRF 1O7FA 1PP7U 1TW3A 1LNWA 3ECHA 1XD7A 5LGUA 2DK8A 1BN5A 1ZGAA 1W5SA 2PFBA 1RUOA 1G3SA 5ICGA 3IRRA 4BHPA 2EA2A 5DUIA 5FB2A 2OBPA 2VOOA 1HKQA 1I27A 2RGVA 2QYOA 4ZYGA 3F22A 4EM1A 2ETHA 1I1SA 3WGGA 4KIFA 3ZN1A 1QPMA 1TQIA 2LF8A 1T39A 1LDJA 2BV6A 1P6RA 4RB2C 2KKOA 1J59A 2JT1A 4HF1A 3M1EA 3V7CA 5L3BA 1YLFA 1FC3A 2K27A 2EB7A 1XDSA 5JVTA 3J81Z 2DI3A 3M9AA 2EV6A 3GX4X 2VE8A 5LHHA 3GFMA 4HX8A 3GEZA 4I98B 4Y17A 5A2QK 1FP2A 1IN6A 1YW8A 1RUNA 6PAXA 4U0WA 1K79A 3DP7A 3VODA 4HW0A 4IHTA 2FNPA 1R1UA 1B4AA 1CF7B 2B0LA 5DD4A 1Q1HA 1ZGJA 4G7OF 4EJWA 3U2RA 2F5DA 2VN2A 4G7HF 2D1HA 2LNBA 1Z9CA 3ZN0A 5KVRA 4HX7A 4IVNA 5DD8A 3FX3A 2CO5A 5K1YA 3D0SA 3REOA 4A12A 4UHTA 1H0MA 5ERIA 2FA5A 2WC2A 1ZREA 3FXQA 5LHGA 1P4AA 2L4MA 2NNYA 3QRFF 1R1TA 1U5TC 5H6RA 2M30A 3WTSC 2XAHA 1ZG1A 1XGNA 4LG0A 4AD9A 4L9NA 3WU1B 1YYVA 4YFKF 1FLIA 3H3ZA 3C7JA 2HEOA 4YG2F 3IL2A 1SMTA 3CDHA 5LRRA 1XGMA 2O03A 4LB6B 1HSJA 4OMZA 5D8KB 3F8FA 1F5TA 2H6CA 4M9XA 5D5WB 2HR3A 2CG4A 4RGUA 2OD5A 2DAOA 2H94A 2C6YA 1KYWA 3JTGA 2ZCWA 1AOYA 4XRFA 5AONA 1DUXC 3I58A 2ACJA 2O8XA 4ZZLA 1XSDA 4MQ9F 1KQ8A 1S3JA 2K02A 1HXDA 1MJAA 1W7PB 5J8CA 2IT0A 3R4KA 4UNOA 3HOTA 2DFIA 3IKTA 3FXUA 1J75A 4IF4A 4EJTA 4HX4A 1USTA 2XUBA 4D0PA 2R7FA 4GGGA 3CUQA 4BQAA 3TO6A 3K1MA 1O3TA 1FT9A 1T38A 4A0ZA 3QOPA 3QU6A 4RS8A 2M1BA 3F6VA 2XKOA 4XBFA 2E7XA 4WX9A 1HSTA 3MQ0A 5E8GA 4FX0A 5H20A 5DEQA 1W4MA 2XRNA 2HWVA 1PUEE 3RDIA 4HDUA 3D5LA 5CVUA 5K5QA 3BWGA 2K4JA 3NQOA 2NNNA 5FGMA 5HLHA 1R7JA 1H9TA 4I2OA 2KJCA 4OMYA 1S8NA 3TGNA 2ZKZA 2ELHA 2JSCA 5HLGA 3NEUA 1G4DA 2CQKA 2PMHA 3VB2A 2ISYA 4WWCA 5FD5A 5DCMB 2P6SA 1MKMA 2FNAA 3TDUC 4M9ZA 4CZZA 4L0YB 3N4MA 1HKTA 2FOKA 4I09A 2ZMEB 1XGOA 3ISPA 4FX4A 1QQIA 4IJAA 3KETA 4Q48A 2HFHA 5E18F 1LQ1A 3LWFA 4IHSA 2HTSA 1RI7A 5L3CA 4LK1F 2D2WA 2P5VA 5JFRA 3I54A 2ADUA 2DT5A 3GZ6A 4UV8A 1SD7A 4UVCA 4EMSA 1IAWA 1F4KA 1WI9A 4LJZF 4U7BA 2L01A 3DPLC 2UXXA 3BJOA 4L5IA 3WTVC 3SXYA 1KU3A 2RNJA 3HSRA 1FNNA 2XAJA 1QZZA 1YTYA 5DDGA 4MQVA 1F1ZA 1RNLA 5A2QZ 4KICA 2HDCA 3PQJA 1TTYA 2PI0A 4IPAA 3FM5A 3E5UA 5H6QA 1DPUA 3P7NA 5D6EA 4MNUA 1K78A 3RJPA 1ZLJA 3V8KA 3F8CA 2EFNA 4L18B 1Y0UA 3DKWA 1SD6A 3MZYA 2EFQA 5J8FA 4Y15A 1Z6RA 1TQMA 3V8JA 2V1DA 3MEXA 4I01A 1BJAA 4UVAA 3HIFA 3WTTC 5CLSA 3F23A 4EV0A 2M8EA 1SMYF 4LFUA 2K4BA 3FMSA 1D8JA 3GVAA 4MTDA 3I64A 2MH9A 2QQBA 3B02A 4CYDA 1O57A 2W25A 3FXRA 2DTRA 3M8EA 3ZMVA 3HHHA 1J5YA 2NRAC 4KUMA 3RKWA 2Q0OA 3QAHA 2M5WA 1ZRFA 3I59B 1LB2A 4OINF 2Z33A 4B8XA 1QNTA 2J5OA 3SZTA 3I71A 4R79A 3PFIA 2IJLA 1LVAA 3PQKA 3QU3A 3TO7A 3GFJA 3ZPLA 4HLXA 3IWZA 2W84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E1Z B;  4HA8 A;  2P5L C;  2A5Y B;  4PZJ A;  3IC7 A;  1U2W A;  2PBI A;  2VBW A;  2FRH A;  2XHK A;  4IRG A;  3N97 A;  3GLX A;  2A61 A;  1FPQ A;  3K2Z A;  2RN7 A;  5IT9 K;  3DQV C;  2PG4 A;  4U0Y A;  4FHT A;  3WE2 A;  5K5O A;  3FMR A;  2ZNZ A;  4AIJ A;  2YX7 A;  2F5C A;  3J7A O;  5D8L B;  5LRS A;  2G9W A;  4RAY A;  1JHH A;  1TNT A;  4CIC A;  3WTX C;  4GCV A;  5BPI A;  5DCM A;  3GFI A;  1E2X A;  3G73 A;  1U78 A;  3L09 A;  1YG2 A;  5FD6 A;  1YQA A;  1OYY A;  4UUV A;  2ZME A;  1FYM A;  2DPU A;  4A0X A;  1WSU A;  1ZAO A;  5LEK A;  2HQR A;  2BEO A;  2DLL A;  5HLI A;  1HQC A;  2GZW A;  4S05 A;  2IW5 A;  2FBH A;  2D1V A;  3CO7 C;  2HGC A;  2RV8 A;  3TOB A;  2MC3 A;  3COA C;  1OR7 A;  4PDK A;  4HDV A;  2Z3Y A;  4CO8 A;  4G9Y A;  1GVJ A;  4A6E A;  4M74 A;  4Q4Z F;  3LAJ A;  3C3W A;  1XMA A;  2A6E F;  3VEP A;  1MJ9 A;  4XLP F;  1KU7 A;  1J2X A;  3E97 A;  1OYW A;  5D5V B;  1ZLK A;  3HTS B;  3O3K A;  4G6D A;  2CSO A;  1U5T A;  5CVJ A;  1ON2 A;  4NB5 A;  1T6S A;  1KU2 A;  1IW7 F;  1ODD A;  1ULY A;  1FZP B;  3ABT A;  3HHG A;  3AAF A;  3S2W A;  3KP4 A;  2PEX A;  4A5N A;  5DCF A;  1ZRC A;  3WGI A;  5E17 F;  4M9S A;  1XCB A;  5F6F A;  5KK1 A;  2H27 A;  4ESF A;  4Z2Y A;  3RI4 A;  2FU4 A;  4F7Z A;  2ZXJ A;  4RGX A;  5CJ9 A;  5HDK A;  4R8H A;  3OOP A;  3W6J B;  2ZNY A;  1D3Y A;  2QBY B;  3ZMS A;  4YIF A;  4ETS A;  2VC0 A;  4G6Q A;  5JHU A;  3RKY A;  4KT5 C;  2GIV A;  3K9T A;  2HTJ A;  2EFO A;  3I0T A;  1FSH A;  2PQ8 A;  4LGW A;  1KQ0 A;  3ZP5 A;  4UV9 A;  3RPQ A;  3P9I A;  3L7W A;  1KA8 A;  3T8T A;  5ED4 A;  1FY7 A;  2UWM A;  1SFE A;  4U0V A;  4FT8 A;  3JSP A;  1U6G A;  3K69 A;  5L3F A;  3ZMU A;  2MH2 A;  1JE8 A;  1SD4 A;  3HYI A;  3JSO A;  3T1B A;  1SFU A;  3IHU A;  4EJU A;  5CVI A;  4KIB A;  1Z1D A;  4EVI A;  2QQA A;  1REP C;  4A0Y A;  1PDN C;  1BI1 A;  3BPV A;  1MDM B;  1XN7 A;  2X0L A;  3KP7 A;  1HW2 A;  3E6B A;  3RKX A;  4AWX B;  4O6J A;  3CJN A;  4PGG A;  5E1W A;  3LQQ A;  5LLQ A;  2IP2 A;  3KEQ A;  1UHM A;  4WXD A;  2ZO4 A;  2OZ6 A;  1UFM A;  2MA3 A;  2Z5U A;  4AIH A;  4IRH A;  4ENJ A;  1EV7 A;  4JK1 X;  5E20 A;  3TKY A;  4L9T A;  4RB3 C;  2KIM A;  2RC4 A;  2VBX A;  4LK0 F;  1P4X A;  4M71 A;  1BI2 A;  3R60 A;  3BJ6 A;  4GYI A;  3DF8 A;  1P92 A;  5IT9 Z;  2UZK A;  3MCZ A;  4M6Y A;  2FXA A;  4KMU X;  4O5V A;  5HOO A;  2EWN A;  1KGS A;  3BPX A;  1FSE A;  2CGP A;  1KU9 A;  2BE5 F;  4CGZ A;  2O6G E;  2PMU A;  4EJO A;  2JZY A;  3ULQ B;  2CW0 F;  2GWR A;  4HBL A;  2GXB A;  3WE3 A;  1YS6 A;  1TLH B;  3F8M A;  2P5K A;  2RQP A;  2FSW A;  2HOE A;  2LSO A;  2E1C A;  3P9C A;  2VBZ A;  5JI6 A;  1BOA A;  1IN4 A;  4MEY F;  4PGH A;  1VTN C;  1HKS A;  4ZYH A;  2A69 F;  3H92 A;  2M45 A;  4LB5 A;  1D5V A;  1OPC A;  1USS A;  1ZYR F;  2KRF A;  1STZ A;  1K7A A;  1ZG5 A;  1T0F A;  3EYI A;  3NRV A;  5TRD A;  3FMQ A;  2W57 A;  4XSX F;  2NAZ A;  3JTH A;  3ZMT A;  1ZH5 A;  1B9N A;  4R1H A;  2MLK A;  2ISZ A;  4HV5 A;  1OMI A;  3WTW C;  5EEH A;  2OAZ A;  3C18 A;  2OQG A;  1C0W A;  3KLO A;  2XRO A;  1ZG3 A;  1P2F A;  4EGZ A;  2WV0 A;  5FLX K;  2AXL A;  1XDU A;  3GYH X;  1JGS A;  4ASN A;  4QLC U;  1B59 A;  4JBA A;  4KN4 X;  4K2E A;  3WGH A;  1QZY A;  3FM3 A;  4A5M A;  1TBX A;  2QWW A;  1CF7 A;  5HS8 A;  2FMY A;  4M73 A;  4BYY A;  2GA1 A;  4I0A A;  4TV7 A;  1YS7 A;  3V7R A;  5BS6 A;  5ICF A;  2BYV E;  3FF5 A;  2RKH A;  4L9V A;  4KMF A;  2IA0 A;  3ZMD A;  2A07 F;  5FFZ A;  1MD0 A;  2D45 A;  5J6X A;  3B73 A;  4ENM A;  1YIO A;  4UXN A;  1R36 A;  2KIF A;  3GZ5 A;  2IVM A;  2XAG A;  4HF0 A;  1P4W A;  2VBY A;  4CDG A;  5BOX A;  4I0B A;  4JQF A;  2Z9O A;  3HRT A;  5D6F A;  1EH8 A;  2EFP A;  3ML6 A;  2QLZ A;  2HKO A;  3BP8 A;  1S7O A;  1WWX A;  4E70 A;  2EJR A;  3IWF A;  3WTY C;  5CVV A;  2BGC A;  2DW4 A;  2L4A A;  5EEG A;  3OV8 A;  2F5F A;  1B6A A;  5TJJ A;  2MLG A;  1OYI A;  4O3M A;  2HKX A;  3V7S A;  1WRJ A;  2ZJ2 A;  4OOI A;  1MDM A;  1X3U A;  3G3Z A;  4BXU A;  2G7H A;  3E6C C;  1W7P A;  3HSE A;  3EQL F;  3JW4 A;  2R7D A;  5F64 A;  1O3S A;  1IF1 A;  2F5E A;  3KZZ A;  1LEA A;  3FWE A;  3F8B A;  3L9F A;  4BAY A;  1L0O C;  1UCR A;  2XAS A;  3DEU A;  3GUD A;  2HQN A;  3MWM A;  1IZ1 A;  3O6B B;  2VC1 A;  1S7A A;  5AIP A;  1ONV A;  2A6H F;  1F9N A;  2K7L A;  2VXZ A;  1BI3 A;  3RYP A;  3DPT A;  4CXF A;  3F72 A;  4AVP A;  4ESJ A;  2EFW A;  1FWZ A;  2DO7 A;  2O3F A;  2P7V B;  2KIU A;  3E6D A;  5BPD A;  2EA4 A;  2P4W A;  2CFX A;  1S6L A;  5DUK A;  4I7H A;  5D5X B;  3R61 A;  2GQQ A;  3HTU A;  1HBX G;  3RPU A;  2DU9 A;  1R23 A;  1WKM A;  4MTE A;  4G7Z F;  2MBF A;  1XGS A;  2KJB A;  3T8R A;  3GWZ A;  4M6X A;  1ZN2 A;  3KP6 A;  2X4H A;  3R0J A;  3ABU A;  3EUH A;  4G94 A;  4EGY A;  2L3D A;  3BRO A;  3GF2 A;  4RAZ A;  1MGT A;  4BH9 A;  1GHC A;  1J9I A;  3KEO A;  4EJV A;  3CUQ B;  3E5Q A;  3SHF A;  5FFX A;  3HOS A;  4P5O A;  1TW2 A;  1FYK A;  4L5J A;  3I4P A;  2XGX A;  1LJ9 A;  3LA3 A;  1JXS A;  1GXP A;  1B9M A;  4ZYE A;  3M8F A;  1I5Z A;  4NHJ A;  3FZV A;  1BC7 C;  2L54 A;  2QM3 A;  2WWY A;  2V79 A;  3F6O A;  2H6B A;  5BMZ A;  1ON1 A;  3M7G A;  1FP1 D;  4P96 A;  1FOK A;  2ZBK A;  3BOQ A;  3MAJ A;  3CO6 C;  4S04 A;  3KP3 A;  2A68 F;  1G3T A;  5E1X A;  3BDD A;  3K0L A;  4G8X A;  4ON0 A;  5LGN A;  1U8R A;  2DPD A;  2W85 A;  4PCQ A;  4L9J A;  5DYM A;  4U88 A;  1QO0 D;  1K6O A;  3HRM A;  1HW1 A;  4OIO F;  3KP5 A;  2FQ3 A;  5FLX Z;  3HRS A;  1O7L A;  1BI0 A;  4HQE A;  4LMY A;  3KLN A;  3IRQ A;  2HS5 A;  3LFK A;  5D5U B;  3MFK A;  2YU3 A;  2R3S A;  3SQN A;  3E3V A;  4KN7 X;  1O3R A;  2H09 A;  3J80 K;  2P6T A;  1G3W A;  1UHW A;  2P8T A;  1LDK B;  2F2E A;  4WF2 A;  3WTU C;  2XVC A;  2LF7 A;  1FBS A;  3IKV A;  1YW7 A;  2STT A;  1MZB A;  4BHC A;  2IA1 A;  2P7C B;  3LAP A;  4KYW A;  2PJP A;  4P9F A;  4Q5S F;  4ZH4 F;  1FBQ A;  4Y13 A;  3SZP A;  4I02 A;  1R22 A;  1ZAR A;  4OIP F;  1IRF A;  2W24 A;  1IXS B;  3Q9S A;  3ECO A;  4M72 A;  1T98 A;  2IRF G;  3DV8 A;  1E17 A;  3F8N A;  2YSR A;  2RDP A;  3DFG A;  3P9K A;  1FX7 A;  2FF4 A;  2ESN A;  3T0Y A;  3C1D A;  2BBY A;  1YO5 C;  4KNY A;  3RTR A;  4XSZ F;  3LA2 A;  3JAM K;  1K78 B;  1KQ9 A;  4L0Z B;  1W5T A;  3I59 A;  4RGR A;  4HYE A;  2V1X A;  1IN7 A;  1RIO H;  2TDX A;  3ZMZ A;  3E6M A;  2NS0 A;  2VT2 A;  2DBB A;  4HAM A;  3BJA A;  2AS5 F;  1AWC A;  1L3L A;  2JPB A;  4N9H A;  5AIQ A;  2VOP A;  1G3Y A;  5ICC A;  5ICE A;  3E5X A;  3EYY A;  4ENK A;  3RIR A;  1HW5 A;  3GXO A;  2PLY A;  5HS7 A;  2ZFW A;  1DPR A;  1BC8 C;  3U9G A;  2E7W A;  1ZHF A;  2EV0 A;  5ILS A;  3TOA A;  3BZ6 A;  3FHZ A;  4OU0 A;  4WXH A;  2Y75 A;  1UB9 A;  2J5P A;  3HUG A;  3K1P A;  1T2K A;  1IXR C;  1SFX A;  2VT3 A;  3ROU A;  4GXO A;  4YFX F;  3KFW X;  4LD5 A;  3DXJ F;  3Q9V A;  3VFZ A;  2WTE A;  4BHB A;  2IPQ X;  1XMK A;  2V9V A;  3ZQ7 A;  1V4R A;  1DP7 P;  1MJB A;  1B1B A;  5E8I A;  3BY6 A;  1IXC A;  2XIG A;  3V8L A;  1IUY A;  5ILV A;  1Z05 A;  4P9U A;  2EK5 A;  2M87 A;  4WXC A;  2OZU A;  2XAF A;  4H0E A;  3GFL A;  1CGP A;  1LEB A;  1QBJ A;  4LLN A;  4QWQ A;  1XB4 A;  3Q5F A;  2FML A;  2MD5 A;  1W7P D;  2DQL A;  1R1V A;  4AIK A;  3O2P E;  4RB1 A;  4KFC A;  3TO9 A;  5L3E A;  3LA7 A;  4LLL A;  1U3E M;  2Z99 A;  2XAQ A;  3GO5 A;  2IA2 A;  2CYY A;  2OU2 A;  1YFH A;  1S29 A;  2LKP A;  3H3U A;  3KCC A;  4MHG A;  2Q2E A;  5LBQ A;  1BBY A;  3T5X A;  2YR2 A;  4P55 A;  4DNC A;  5HDN A;  4ENN A;  3CUQ C;  1IN8 A;  1H9G A;  5FO5 A;  2STW A;  1TQP A;  3WOD F;  2QEN A;  4ZYD A;  3I53 A;  2V6C A;  4UVB A;  3W6K B;  1BIB A;  2DK5 A;  3RYR A;  3ERE D;  3TDZ C;  4ZZD A;  3KP2 A;  5LHI A;  4KA4 A;  2PN6 A;  1R00 A;  4LLG F;  2QVO A;  3J81 K;  4B09 A;  1R58 A;  3K1N A;  1OKR A;  5ILU A;  5IT3 A;  3SFZ A;  1XSX A;  4N9I A;  1JHF A;  5BQT A;  5DV5 A;  3J80 Z;  2QBY A;  5LGT A;  1V3F A;  2VOD A;  4YII A;  1YW9 A;  2GA2 A;  2L02 A;  1U5T B;  1EH6 A;  2COM A;  5D4S A;  5L3G A;  4A2U A;  1I1G A;  2RVC A;  1SAX A;  3WU0 A;  4EM2 A;  5HS9 A;  4OIQ F;  4MEX F;  3ELK A;  2YPR A;  3L00 A;  2VE9 A;  4HV6 A;  4HLY A;  2UXN A;  1J0R A;  3WTZ A;  4U7D A;  1J7K A;  3L2C A;  4Q47 A;  4MGR A;  4A6D A;  3QPH A;  2JRT A;  1O3Q A;  4HF2 A;  2G7U A;  2NYX A;  3F21 A;  1BIA A;  2Q8K A;  3JAM Z;  5HVQ C;  3LQR A;  1I6X A;  5HDG A;  4WK8 F;  1XSV A;  1D8K A;  4EM0 B;  4EQQ A;  4HZF A;  4DQ2 A;  2YX4 A;  4GO1 A;  1Z6T A;  3EDP A;  3GW2 A;  2HYG D;  1WQ2 A;  2JPC A;  1QGP A;  1XCV A;  2CWE A;  3I5U A;  2FBK A;  4LG0 B;  2FEZ A;  3R0A A;  4ESB A;  4HQM A;  1IRG A;  1A04 A;  3CUO A;  4KIG A;  5F1R A;  3CLO A;  1FYL A;  1Z7U A;  2GXG A;  4WCG A;  4GYG A;  4RB0 A;  1NHA A;  4NQW A;  2O61 A;  4CHU A;  4XLN F;  1EH7 A;  3QPT A;  5LEJ A;  2O0Y A;  2QQ9 A;  5K5R A;  3HSF A;  3EET A;  2GAU A;  4YFN F;  2A3S A;  1Z91 A;  1BM9 A;  2OQR A;  4RGS A;  5L3D A;  1R5H A;  3QP6 A;  4BNC A;  1ZRD A;  1GXQ A;  3KZY A;  2V1U A;  1PP8 F;  1KYZ A;  5JR3 A;  2QZ8 A;  2ESH A;  2Y48 A;  3WG9 A;  1LDD A;  1SD5 A;  2QUF A;  2Y0M A;  1IN5 A;  4N0B A;  2FBI A;  2JTV A;  2OA4 A;  3CTA A;  2XKP A;  1DDN A;  2VON A;  1R5G A;  2LDU A;  3VOE A;  2E1N A;  3MZH A;  3V4G A;  2HYF A;  3KE2 A;  1FBU A;  2K86 A;  3U1D A;  5CYV A;  2DQR A;  1G6N A;  3LST A;  4IRI A;  3R6S A;  5D4R A;  3TQN A;  4HOB A;  1RZ4 A;  2EV5 A;  3HRU A;  5CVR A;  4IXA A;  3F3X A;  2FE3 A;  2XV4 S;  4KDP A;  2HZT A;  1TNS A;  3QP5 A;  4OIR F;  1O7F A;  1PP7 U;  1TW3 A;  1LNW A;  3ECH A;  1XD7 A;  5LGU A;  2DK8 A;  1BN5 A;  1ZGA A;  1W5S A;  2PFB A;  1RUO A;  1G3S A;  5ICG A;  3IRR A;  4BHP A;  2EA2 A;  5DUI A;  5FB2 A;  2OBP A;  2VOO A;  1HKQ A;  1I27 A;  2RGV A;  2QYO A;  4ZYG A;  3F22 A;  4EM1 A;  2ETH A;  1I1S A;  3WGG A;  4KIF A;  3ZN1 A;  1QPM A;  1TQI A;  2LF8 A;  1T39 A;  1LDJ A;  2BV6 A;  1P6R A;  4RB2 C;  2KKO A;  1J59 A;  2JT1 A;  4HF1 A;  3M1E A;  3V7C A;  5L3B A;  1YLF A;  1FC3 A;  2K27 A;  2EB7 A;  1XDS A;  5JVT A;  3J81 Z;  2DI3 A;  3M9A A;  2EV6 A;  3GX4 X;  2VE8 A;  5LHH A;  3GFM A;  4HX8 A;  3GEZ A;  4I98 B;  4Y17 A;  5A2Q K;  1FP2 A;  1IN6 A;  1YW8 A;  1RUN A;  6PAX A;  4U0W A;  1K79 A;  3DP7 A;  3VOD A;  4HW0 A;  4IHT A;  2FNP A;  1R1U A;  1B4A A;  1CF7 B;  2B0L A;  5DD4 A;  1Q1H A;  1ZGJ A;  4G7O F;  4EJW A;  3U2R A;  2F5D A;  2VN2 A;  4G7H F;  2D1H A;  2LNB A;  1Z9C A;  3ZN0 A;  5KVR A;  4HX7 A;  4IVN A;  5DD8 A;  3FX3 A;  2CO5 A;  5K1Y A;  3D0S A;  3REO A;  4A12 A;  4UHT A;  1H0M A;  5ERI A;  2FA5 A;  2WC2 A;  1ZRE A;  3FXQ A;  5LHG A;  1P4A A;  2L4M A;  2NNY A;  3QRF F;  1R1T A;  1U5T C;  5H6R A;  2M30 A;  3WTS C;  2XAH A;  1ZG1 A;  1XGN A;  4LG0 A;  4AD9 A;  4L9N A;  3WU1 B;  1YYV A;  4YFK F;  1FLI A;  3H3Z A;  3C7J A;  2HEO A;  4YG2 F;  3IL2 A;  1SMT A;  3CDH A;  5LRR A;  1XGM A;  2O03 A;  4LB6 B;  1HSJ A;  4OMZ A;  5D8K B;  3F8F A;  1F5T A;  2H6C A;  4M9X A;  5D5W B;  2HR3 A;  2CG4 A;  4RGU A;  2OD5 A;  2DAO A;  2H94 A;  2C6Y A;  1KYW A;  3JTG A;  2ZCW A;  1AOY A;  4XRF A;  5AON A;  1DUX C;  3I58 A;  2ACJ A;  2O8X A;  4ZZL A;  1XSD A;  4MQ9 F;  1KQ8 A;  1S3J A;  2K02 A;  1HXD A;  1MJA A;  1W7P B;  5J8C A;  2IT0 A;  3R4K A;  4UNO A;  3HOT A;  2DFI A;  3IKT A;  3FXU A;  1J75 A;  4IF4 A;  4EJT A;  4HX4 A;  1UST A;  2XUB A;  4D0P A;  2R7F A;  4GGG A;  3CUQ A;  4BQA A;  3TO6 A;  3K1M A;  1O3T A;  1FT9 A;  1T38 A;  4A0Z A;  3QOP A;  3QU6 A;  4RS8 A;  2M1B A;  3F6V A;  2XKO A;  4XBF A;  2E7X A;  4WX9 A;  1HST A;  3MQ0 A;  5E8G A;  4FX0 A;  5H20 A;  5DEQ A;  1W4M A;  2XRN A;  2HWV A;  1PUE E;  3RDI A;  4HDU A;  3D5L A;  5CVU A;  5K5Q A;  3BWG A;  2K4J A;  3NQO A;  2NNN A;  5FGM A;  5HLH A;  1R7J A;  1H9T A;  4I2O A;  2KJC A;  4OMY A;  1S8N A;  3TGN A;  2ZKZ A;  2ELH A;  2JSC A;  5HLG A;  3NEU A;  1G4D A;  2CQK A;  2PMH A;  3VB2 A;  2ISY A;  4WWC A;  5FD5 A;  5DCM B;  2P6S A;  1MKM A;  2FNA A;  3TDU C;  4M9Z A;  4CZZ A;  4L0Y B;  3N4M A;  1HKT A;  2FOK A;  4I09 A;  2ZME B;  1XGO A;  3ISP A;  4FX4 A;  1QQI A;  4IJA A;  3KET A;  4Q48 A;  2HFH A;  5E18 F;  1LQ1 A;  3LWF A;  4IHS A;  2HTS A;  1RI7 A;  5L3C A;  4LK1 F;  2D2W A;  2P5V A;  5JFR A;  3I54 A;  2ADU A;  2DT5 A;  3GZ6 A;  4UV8 A;  1SD7 A;  4UVC A;  4EMS A;  1IAW A;  1F4K A;  1WI9 A;  4LJZ F;  4U7B A;  2L01 A;  3DPL C;  2UXX A;  3BJO A;  4L5I A;  3WTV C;  3SXY A;  1KU3 A;  2RNJ A;  3HSR A;  1FNN A;  2XAJ A;  1QZZ A;  1YTY A;  5DDG A;  4MQV A;  1F1Z A;  1RNL A;  5A2Q Z;  4KIC A;  2HDC A;  3PQJ A;  1TTY A;  2PI0 A;  4IPA A;  3FM5 A;  3E5U A;  5H6Q A;  1DPU A;  3P7N A;  5D6E A;  4MNU A;  1K78 A;  3RJP A;  1ZLJ A;  3V8K A;  3F8C A;  2EFN A;  4L18 B;  1Y0U A;  3DKW A;  1SD6 A;  3MZY A;  2EFQ A;  5J8F A;  4Y15 A;  1Z6R A;  1TQM A;  3V8J A;  2V1D A;  3MEX A;  4I01 A;  1BJA A;  4UVA A;  3HIF A;  3WTT C;  5CLS A;  3F23 A;  4EV0 A;  2M8E A;  1SMY F;  4LFU A;  2K4B A;  3FMS A;  1D8J A;  3GVA A;  4MTD A;  3I64 A;  2MH9 A;  2QQB A;  3B02 A;  4CYD A;  1O57 A;  2W25 A;  3FXR A;  2DTR A;  3M8E A;  3ZMV A;  3HHH A;  1J5Y A;  2NRA C;  4KUM A;  3RKW A;  2Q0O A;  3QAH A;  2M5W A;  1ZRF A;  3I59 B;  1LB2 A;  4OIN F;  2Z33 A;  4B8X A;  1QNT A;  2J5O A;  3SZT A;  3I71 A;  4R79 A;  3PFI A;  2IJL A;  1LVA A;  3PQK A;  3QU3 A;  3TO7 A;  3GFJ A;  3ZPL A;  4HLX A;  3IWZ A;  2W84 A; 
#chains in the Genus database with same CATH topology
 1IJW C;  3H9J A;  3PNV A;  4V2G A;  5FKN A;  5E1Z B;  2DA2 A;  3A0B C;  4HA8 A;  5CKT A;  1YJ9 I;  2P5L C;  2A5Y B;  4PZJ A;  4RDU A;  3BG3 A;  1U2W A;  3IC7 A;  4II2 A;  2PBI A;  2VBW A;  1T95 A;  2FRH A;  2XHK A;  4IRG A;  1ZEL A;  1RPW A;  2VIX A;  5GPC A;  3N97 A;  3GLX A;  2A61 A;  2DA3 A;  2BHZ A;  1FPQ A;  2L5Q A;  3CC4 I;  2BY2 A;  1IO2 A;  3K2Z A;  2RN7 A;  3PNY A;  4UUS B;  4PSX A;  5IT9 K;  3DQV C;  1EJ9 A;  2DA5 A;  4NC7 A;  4E7K A;  2DYS H;  2PG4 A;  3DBL B;  3GTQ J;  3NAR A;  3FXO A;  2JSP A;  3OYA A;  4U0Y A;  4FHT A;  1OCO H;  3WE2 A;  5K5O A;  3FMR A;  2XF6 A;  2ZNZ A;  4AIJ A;  2YX7 A;  2F5C A;  2K3P A;  4AUX A;  2R7W A;  3J7A O;  5K7H A;  3ASN H;  5D8L B;  5LRS A;  2G9W A;  3V42 A;  2WA0 A;  3B6C A;  4RAY A;  1JHH A;  3H5R A;  4I76 A;  1TNT A;  3MKW B;  1UJ8 A;  3HB9 A;  4CIC A;  3WTX C;  1SVL A;  1S9H A;  2QKM B;  4GCV A;  3HUG B;  5BPI A;  2XGD A;  5DCM A;  1MBG A;  3GFI A;  1E2X A;  2NVU B;  2VKV A;  3G73 A;  5E79 C;  1U78 A;  1YIT I;  3L09 A;  4X6A J;  1YG2 A;  4IX7 A;  5FD6 A;  2E1M B;  1YQA A;  2IEK A;  1X2M A;  1OYY A;  1A36 A;  4UUV A;  2JUC A;  2ZME A;  4XK4 A;  1FYM A;  2HVS A;  3AG1 H;  1ZR2 A;  2DPU A;  2L0K A;  2QQ8 A;  4A0X A;  3JR9 A;  1R5I D;  4BY7 J;  1WSU A;  1ZAO A;  2R7T A;  5LEK A;  2M4G A;  2HQR A;  3ESW B;  1AKH B;  3ERM A;  5FRN A;  5EZG A;  2BEO A;  3IUO A;  2DLL A;  5HLI A;  1HQC A;  4W97 A;  2GZW A;  4F92 B;  4S05 A;  2IW5 A;  3FK7 A;  1BR1 A;  1IG7 A;  2CUE A;  2FBH A;  2HDW A;  2D1V A;  2L7Z A;  3BTL A;  4QSH A;  2HGC A;  3CO7 C;  2RV8 A;  3TOB A;  1S5L C;  1OCP A;  2MC3 A;  3PUB A;  3COA C;  1OR7 A;  2K9N A;  4PDK A;  3OWT A;  3Q0V A;  4HDV A;  3LSI A;  2VQL A;  2Z3Y A;  3CLQ A;  3LSP A;  5JVG F;  1F36 A;  2VI6 A;  4CO8 A;  3NWT A;  3SJM A;  4G9Y A;  2VKH A;  2R5Z A;  1GVJ A;  4A6E A;  2Y9Z A;  4M74 A;  4Q4Z F;  3LAJ A;  1MBE A;  3C3W A;  1XMA A;  3ABL H;  2A6E F;  4NC6 A;  1MJ9 A;  3VEP A;  2DA4 A;  5LD2 C;  4XLP F;  3CES A;  1KU7 A;  4OAY A;  1J2X A;  2YUS A;  1UHS A;  2ECB A;  3L2R A;  3HGY A;  3E97 A;  5F08 A;  3OYL A;  5HOD A;  2LMD A;  2R93 J;  3VPR A;  1OYW A;  2LVS A;  3ZRG A;  5D5V B;  4FTH A;  3OY9 A;  1ZLK A;  3HTS B;  5C4X J;  1BJZ A;  3BQZ A;  1W36 D;  1ETY A;  3EUH C;  3O3K A;  1ZQ3 P;  1MBH A;  4G6D A;  2CSO A;  4C3I J;  1U5T A;  1Y8Q B;  2NVX J;  5CVJ A;  1ON2 A;  2ELK A;  2KDO A;  4XM3 A;  2WB1 N;  4NB5 A;  3NAU A;  1T6S A;  3PJR A;  1KU2 A;  2R5Y B;  3GBG A;  1WJ5 A;  3OYK A;  1IW7 F;  2DOA A;  1X4P A;  4Z6Y A;  1ODD A;  1ULY A;  1SFO J;  1FZP B;  3ABT A;  2EPF A;  3JRB A;  3CC2 I;  3HHG A;  3FK6 A;  4KIT B;  4GDF A;  5EF6 A;  4DBR A;  2WAE A;  3AAF A;  3AKZ A;  3S2W A;  2YU9 J;  2IGO A;  3KP4 A;  3H9G A;  2XGE A;  1VND A;  3HGG A;  2PEX A;  4BXF A;  3OL3 A;  1GLN A;  2V4J C;  4A5N A;  5DCF A;  1ZRC A;  2CS3 A;  3TW7 A;  3WGI A;  2ZFU A;  5E17 F;  4M9S A;  2PJR A;  1XCB A;  5F6F A;  1WCM J;  2F5V A;  5KK1 A;  3D1N I;  2H27 A;  2X51 A;  4ESF A;  4Z2Y A;  2MD0 A;  4RAF A;  3RI4 A;  1ETV A;  2X1D A;  3BG9 A;  2FU4 A;  5IPA A;  4DW6 A;  4F7Z A;  2VUM J;  3KIO A;  4A3K J;  2ZXJ A;  4RGX A;  1QVU A;  5CJ9 A;  1H8A C;  1OFC X;  5HDK A;  2HPI A;  4R8H A;  2JK3 A;  4XIC A;  2GOX B;  3OOP A;  1VQO I;  1X1P A;  3W6J B;  2A05 A;  2ZNY A;  1K83 J;  1D3Y A;  2QBY B;  3ZMS A;  4YIF A;  4ETS A;  2CQQ A;  2VC0 A;  2E34 A;  4G6Q A;  5JHU A;  4IOA F;  3RKY A;  2JJ7 A;  4KT5 C;  1R4M B;  2GIV A;  3K9T A;  4DOZ A;  2HTJ A;  3OMY A;  1K61 A;  1LKX A;  2EFO A;  2AHQ A;  3I0T A;  1FSH A;  3JRI A;  2PQ8 A;  4LGW A;  1MNM C;  1BOB A;  3EPZ A;  2VLA A;  2LTP A;  1KQ0 A;  3ZP5 A;  4E4H A;  4I99 C;  4UV9 A;  3RPQ A;  2HQA A;  3P9I A;  3AL0 B;  1XMX A;  3L7W A;  4BQQ A;  4J19 A;  1KA8 A;  1VQN I;  2OCE A;  2X9D A;  2WY8 Q;  3T8T A;  2HPM A;  5ED4 A;  4XL9 A;  1LPQ A;  1FY7 A;  4QPO A;  2UWM A;  1P7I A;  1SFE A;  3G2B A;  4U0V A;  3IH2 A;  4FT8 A;  3JSP A;  3S2H J;  2NVT J;  3MZ8 A;  2EH3 A;  4CA0 A;  1DQU A;  1U6G A;  1ZKG A;  3FIS A;  3CCY A;  1TP4 A;  1FMV A;  3K69 A;  5L3F A;  3S17 J;  2CQ7 A;  3ZMU A;  2MH2 A;  1KON A;  1D5Y A;  1JE8 A;  2O9L A;  1W0T A;  2EZK A;  1SD4 A;  3C2B A;  3HYI A;  3JSO A;  1IV8 A;  3T1B A;  1SFU A;  3IHU A;  1O4X A;  2IS1 A;  4EJU A;  5CVI A;  4KIB A;  4XKB A;  2M0M A;  2OTJ I;  5F04 A;  1A6Q A;  1Z1D A;  2WV1 A;  3HPG A;  4EVI A;  2QQA A;  4BXX J;  1REP C;  5FKM A;  4A0Y A;  4DYR A;  1F43 A;  2KT0 A;  1PDN C;  1BI1 A;  3BPV A;  5GP9 A;  2E19 A;  1MDM B;  1XN7 A;  1GT0 C;  1XC5 A;  2X0L A;  5C3E J;  3KP7 A;  3OR2 C;  1HW2 A;  3E6B A;  3RKX A;  4XRS A;  4AWX B;  3LOC A;  4O6J A;  1R71 A;  2E2H J;  3OYM A;  3CJN A;  4PGG A;  3ZR8 X;  4A3B J;  5E1W A;  2X48 A;  3LQQ A;  5LLQ A;  2Y2Z A;  3JRD A;  2W00 A;  2IP2 A;  3KEQ A;  1UHM A;  4WXD A;  2ZO4 A;  2EQR A;  2OZ6 A;  1UFM A;  2MA3 A;  2Z5U A;  4AIH A;  4IRH A;  4ENJ A;  1EV7 A;  2E2J J;  4XRM A;  1ETO A;  4A3C J;  4JK1 X;  2WAQ N;  5E20 A;  2LR8 A;  3TKY A;  4A93 J;  4L9T A;  4RB3 C;  4BE0 A;  3M3Y J;  2KIM A;  5GAE J;  1OIS A;  2RC4 A;  2VBX A;  4LK0 F;  4B43 A;  1P4X A;  5JHF A;  4X1E A;  4M71 A;  3CME I;  2JA5 J;  1T56 A;  1BI2 A;  3R60 A;  3BJ6 A;  4GYI A;  3DF8 A;  1P92 A;  3MKZ A;  2LBF A;  5IT9 Z;  4IL6 C;  3SEZ A;  2UZK A;  4PJJ A;  5J4V A;  2IAI A;  3MCZ A;  4M6Y A;  1W1W E;  5M3F J;  1Z3Y A;  4NC8 A;  3W2W A;  3OYB A;  4MFD A;  2FXA A;  4KMU X;  4O5V A;  5HOO A;  2EWN A;  1KGS A;  3BPX A;  1FSE A;  3G71 I;  2CGP A;  1POG A;  1KU9 A;  2BE5 F;  4CGZ A;  1FTZ A;  4BE2 A;  2O6G E;  2PMU A;  4EJO A;  3HC7 A;  2JZY A;  4B47 A;  3ULQ B;  4Y4R A;  2RAE A;  2CW0 F;  2GWR A;  4HBL A;  5GPA A;  2GXB A;  3WE3 A;  3MKL A;  1RC9 A;  5F0C A;  2VQG A;  4PJN A;  1YS6 A;  1TLH B;  3F8M A;  2P5K A;  2RQP A;  2FSW A;  2HOE A;  3ZQQ A;  4F55 A;  2LSO A;  2E1C A;  3JCU C;  2RRE A;  2L2O A;  3A1Y A;  3P9C A;  2VBZ A;  1UZC A;  3U21 A;  5JI6 A;  1BOA A;  3CDI A;  1IN4 A;  2COB A;  4MEY F;  3N05 A;  4PGH A;  2QEX I;  1VTN C;  4GRI A;  1HKS A;  4ZYH A;  2A69 F;  3H92 A;  2M45 A;  4LB5 A;  4B3A A;  1D5V A;  3H5A A;  1GV2 A;  1OPC A;  1USS A;  1ZYR F;  3S1Q J;  2LD5 A;  3HBL A;  3QWL A;  2KRF A;  2DA1 A;  1STZ A;  1K7A A;  1ZG5 A;  1T0F A;  3EYI A;  3NRV A;  2HDD A;  4HPQ A;  1Z3X A;  3BR0 A;  5TRD A;  3FMQ A;  2L9S A;  4BKX A;  3S2D J;  2W57 A;  2NXN B;  2NVY J;  4XSX F;  2NAZ A;  4DIQ A;  1Y1W J;  2HYJ A;  3JTH A;  3ZMT A;  1ZH5 A;  1LUJ B;  1B9N A;  2CUZ A;  4R1H A;  2MLK A;  2WBM A;  4DZP A;  2ISZ A;  1PYV A;  4HV5 A;  1OMI A;  2KHM A;  2W82 A;  3WTW C;  1H89 C;  3BR3 A;  5EEH A;  3HOV J;  2XPW A;  2OAZ A;  4CH7 A;  3A2K A;  3K4N A;  2MFZ A;  3C18 A;  4HNT A;  2OQG A;  1C0W A;  3KLO A;  2XRO A;  2E1M C;  1ZG3 A;  1RR7 A;  3CJT B;  3E7L A;  1Z0X A;  1P2F A;  2X85 A;  4EGZ A;  3FIW A;  4F3Q A;  3CC7 I;  2WV0 A;  5FLX K;  2AXL A;  1XDU A;  3GYH X;  1JGS A;  1GVD A;  4C30 A;  4ASN A;  4QLC U;  1B59 A;  3I3L A;  1BL0 A;  4JBA A;  4KN4 X;  4NDL A;  2Y0S A;  4K2E A;  4N4N B;  3WGH A;  1QZY A;  3FM3 A;  3CCE I;  3J7A Y;  1TWF J;  4A5M A;  3CDL A;  1TBX A;  2QWW A;  1CF7 A;  5HS8 A;  2FMY A;  2GXA A;  4M73 A;  3RPU D;  4BYY A;  2GA1 A;  4IQ4 A;  2M0C A;  3G4S I;  4I0A A;  4PFO A;  4RA2 A;  4TV7 A;  1YS7 A;  3V7R A;  5BS6 A;  5ICF A;  2BYV E;  2ELJ A;  2VAS A;  5B1A H;  1W0U A;  2K85 A;  3FF5 A;  2RKH A;  4L9V A;  4KMF A;  1IDY A;  2IA0 A;  3ZMD A;  4BBS J;  4JOM A;  1YX5 A;  4BQO A;  1QA6 A;  2A07 F;  2B9S A;  5FFZ A;  1LE8 A;  1SAU A;  1MD0 A;  2EZI A;  2ZXW H;  2ME6 A;  2D45 A;  1FOX A;  5J6X A;  4I6Z A;  2H1K A;  3L2W A;  5JLW A;  1G2H A;  1FJL A;  2KRH A;  2X6O A;  3B73 A;  4C9Y A;  4ENM A;  1YIO A;  4UXN A;  5FKK A;  1R36 A;  3D5S C;  4XR6 A;  2KIF A;  3GZ5 A;  3OSG A;  2MYS A;  2IVM A;  4BEH A;  2D5V A;  3CMA I;  2XAG A;  4HF0 A;  1P4W A;  5GTH C;  2VBY A;  4CDG A;  2M2E A;  3DLL F;  5BOX A;  4RLF A;  2ICW G;  1PUF B;  2LYC A;  1R6R A;  4A3I J;  2R7S A;  2JVG A;  4A3J J;  4I0B A;  4KJZ A;  1ETK A;  4JQF A;  2Z9O A;  3HRT A;  3OR1 C;  1EF4 A;  4XOP A;  2DCE A;  5D6F A;  1EH8 A;  1NK2 P;  2EFP A;  2OJE D;  2DTZ A;  1GV5 A;  3H35 A;  3AG2 H;  2CJJ A;  3LMM A;  2HNH A;  3ML6 A;  2QLZ A;  2HKO A;  3BP8 A;  1S7O A;  1WWX A;  3M07 A;  2G0E A;  4E70 A;  1WJA A;  2EJR A;  3GTM J;  5M3M J;  3IWF A;  3WTY C;  3S14 J;  5CVV A;  1UG0 A;  2BGC A;  2DW4 A;  2QKL B;  1X3Z B;  2QSG X;  2BW3 A;  3W3C A;  2L4A A;  4DGW B;  3PSF A;  3OV8 A;  5EEG A;  1NK3 P;  2CUJ A;  2F5F A;  2HOA A;  3S32 A;  2KDZ A;  1B6A A;  4HG2 A;  5TJJ A;  2L9R A;  2MLG A;  5F0F A;  4BY1 J;  3HG9 A;  5FKO A;  1OYI A;  4O3M A;  2DMN A;  4LIU A;  2HKX A;  1WI3 A;  3CJQ B;  3GTP J;  2JA8 J;  3V7S A;  1WRJ A;  2ZJ2 A;  4OOI A;  4XOR A;  1MDM A;  1X3U A;  3G3Z A;  4BXU A;  2NVQ J;  1GUU A;  2H8R A;  2G7H A;  2OUM A;  1HA8 A;  4BJ5 C;  2EIL H;  2DN0 A;  3E6C C;  1HLV A;  1W7P A;  3HSE A;  1XS9 A;  3EQL F;  4XLA A;  3JW4 A;  2R7D A;  5F64 A;  3S3O A;  1O3S A;  4E6K G;  1IF1 A;  2F5E A;  2QCO A;  3KZZ A;  1LEA A;  3FWE A;  3F8B A;  3L9F A;  4BAY A;  4B48 A;  1L0O C;  1UCR A;  4UY8 I;  2XAS A;  3DEU A;  1T33 A;  3RSN A;  3GUD A;  4F52 A;  2KP6 A;  5IOY A;  2I10 A;  2FQ4 A;  2LY9 A;  2HQN A;  3MWM A;  3AL0 C;  3H0G J;  3ZQI A;  9ANT A;  1MIJ A;  2R7X A;  1IZ1 A;  2KZG A;  4FIS A;  3O6B B;  1ORK A;  2VC1 A;  1S7A A;  2KFD A;  5AIP A;  1ONV A;  2Z16 A;  2A6H F;  4B44 A;  3BCA A;  1F9N A;  2K7L A;  1OJL A;  2VXZ A;  4XLH A;  5CQE A;  1BI3 A;  3RYP A;  3DPT A;  3ZGK A;  2DOE A;  4A69 C;  4CXF A;  3F72 A;  5TGT A;  3KZI C;  4AVP A;  4ESJ A;  4Y33 A;  2EFW A;  1A6I A;  1FWZ A;  2HI3 A;  2DO7 A;  2O3F A;  2P7V B;  2JWT A;  2CV2 A;  4J01 A;  5CQG A;  2KIU A;  4IEJ A;  1V5G A;  2AXT C;  3BG6 A;  3E6D A;  3CP2 A;  5BPD A;  1JKQ C;  2EA4 A;  1U0J A;  2CFX A;  2P4W A;  1S6L A;  3KYL A;  5DUK A;  4I7H A;  4M3B A;  5F27 A;  5D5X B;  1G8X A;  4C2T A;  3RZO J;  1JJ6 C;  3CZ6 A;  1JT0 A;  3R61 A;  2XSD C;  4E7L A;  1Z7L A;  2GQQ A;  3HTU A;  1TWH J;  1HBX G;  4ZYA A;  3RPU A;  2DU9 A;  1R23 A;  5EGO B;  3CCQ I;  1WKM A;  4MTE A;  4G7Z F;  2MBF A;  1XGS A;  2KJB A;  1YJW I;  3T8R A;  1N77 A;  2UUZ A;  3GME A;  3GWZ A;  4M6X A;  1ZN2 A;  4CSW A;  3KP6 A;  2X4H A;  2KIS A;  3OYG A;  1LFU P;  5DM6 F;  3R0J A;  1MMD A;  3ABU A;  3EUH A;  1B72 A;  1FIA A;  1MBK A;  4G94 A;  4EGY A;  1OLT A;  2L3D A;  3BTI A;  3BRO A;  3HM5 A;  3GF2 A;  4RAZ A;  2CUF A;  1JKR C;  1MGT A;  4B1R A;  4BH9 A;  1GHC A;  2R7O A;  1ZTR A;  1J9I A;  3KEO A;  4EJV A;  3CUQ B;  3E5Q A;  2EBI A;  2XB5 A;  1NG7 A;  3CF2 A;  3SHF A;  1YHQ I;  1OQY A;  3CMM A;  5FFX A;  4P5O A;  3HOS A;  3JRE A;  5B5E C;  1TW2 A;  4GFB A;  1FYK A;  4L5J A;  3I4P A;  2XGX A;  1LJ9 A;  3LA3 A;  1JXS A;  2TRT A;  1DU0 A;  2BOL A;  4ZDP A;  4V19 K;  4RBO A;  1GXP A;  1K4T A;  4CYC B;  1B9M A;  1TT5 B;  3GTK J;  4ZYE A;  3M8F A;  4CCJ A;  4E7Z A;  1I5Z A;  4NHJ A;  2GIZ A;  3FZV A;  2X6W A;  3WHC A;  4D9J A;  3TW6 A;  1BC7 C;  4A3D J;  2L54 A;  3GZN B;  2IGM A;  2QM3 A;  2WWY A;  2V79 A;  3TED A;  2VPR A;  3F6O A;  4XOT A;  4D5C A;  5HNH A;  2H6B A;  5BMZ A;  4D7N A;  1FEX A;  1ON1 A;  1YX3 A;  5FLM J;  3FXK A;  3M7G A;  5CPR B;  2L7M P;  1FP1 D;  1I3Q J;  4P96 A;  2IGN A;  5DS9 A;  3ZQL A;  3S3N A;  3CJR B;  3CCV I;  3SYT A;  1FOK A;  3RZD J;  2ZBK A;  4G6T B;  4AYB A;  2Z1D A;  1WJE A;  3BOQ A;  3MAJ A;  3CO6 C;  4S04 A;  5IP9 J;  3KP3 A;  1YRN B;  3K4L A;  2A68 F;  1G3T A;  4C2M J;  3JRA A;  5E1X A;  3BDD A;  1HC8 A;  3I55 I;  3K0L A;  4G8X A;  1D1B A;  1B8I A;  4ON0 A;  5LGN A;  1U8R A;  2DPD A;  2W85 A;  4PCQ A;  4L9J A;  5DYM A;  1H88 C;  1DP3 A;  4U88 A;  1QO0 D;  4LIT A;  3RCO A;  1K6O A;  2Q2E B;  1MBJ A;  1HW1 A;  3HRM A;  3KP5 A;  4ZTJ A;  4OIO F;  2DJI A;  2FQ3 A;  4E7I A;  4E7S A;  5FLX Z;  1V5E A;  3HRS A;  1O7L A;  1BI0 A;  4HQE A;  3VYU B;  3BR2 A;  3BTC A;  4LMY A;  3KLN A;  4JX6 A;  5M5X J;  5E3M A;  3IRQ A;  2X1E A;  2HS5 A;  5GAD J;  4E7H A;  4ABZ A;  3LFK A;  5D5U B;  3HXL A;  2V7F A;  2YU3 A;  3MFK A;  2R3S A;  3SQN A;  3E3V A;  1A35 A;  4KN7 X;  1O3R A;  4DBQ A;  2H09 A;  3J80 K;  2P6T A;  1G3W A;  3HOY J;  5F1J A;  1UHW A;  2P8T A;  1LDK B;  2F2E A;  1JI8 A;  4WF2 A;  3WTU C;  2XVC A;  2LF7 A;  1FBS A;  4XKW A;  5B3S H;  3IKV A;  1YW7 A;  3ASO H;  2DMT A;  2STT A;  1MZB A;  4BHC A;  1AA7 A;  2IA1 A;  3LAP A;  5EG0 A;  2P7C B;  4KYW A;  1OCZ H;  2PJP A;  4P9F A;  4Q5S F;  4ZH4 F;  1E3P A;  4XLF A;  1FBQ A;  4Y13 A;  3SZP A;  1X3W B;  1SC7 A;  3FXJ A;  4M3E A;  4YIR X;  2B7E A;  4I02 A;  3VDX A;  1R22 A;  1ZAR A;  4OIP F;  4IHX A;  2R4G A;  1IRF A;  5FRO A;  1VQM I;  2W24 A;  4AID A;  1IXS B;  3Q9S A;  3ECO A;  4M72 A;  4QTR A;  1T98 A;  1R4N B;  2Y0S N;  3B6A A;  3GCM A;  1QVT A;  2IRF G;  3DV8 A;  1E17 A;  1RKW A;  2CU7 A;  3F8N A;  2CV1 A;  2IS4 A;  2YSR A;  2RDP A;  3DFG A;  3P9K A;  1FX7 A;  4ZC3 A;  4CCL A;  1TWC J;  1ETW A;  2EIM H;  4ZTF A;  2FF4 A;  1MSE C;  2ESN A;  4JX5 A;  3T0Y A;  5GAH J;  2X1C A;  3C1D A;  3QPL A;  4F91 B;  2BBY A;  1YO5 C;  3F9K A;  4KNY A;  4XLE A;  2DOD A;  3ZOB A;  2QSH X;  2ID3 A;  3TL4 X;  3RTR A;  4XSZ F;  3LA2 A;  3OYC A;  2VKD A;  1CQT A;  3JAM K;  1K78 B;  1KQ9 A;  4L0Z B;  1W5T A;  5J1R A;  3I59 A;  4RGR A;  4HYE A;  2V1X A;  1IN7 A;  5IYB J;  1RIO H;  2TDX A;  4A3F J;  3ZMZ A;  4XLC A;  3E6M A;  2NS0 A;  2HVQ A;  2M9H A;  2VT2 A;  2DBB A;  5FJ8 J;  1NH3 A;  4HAM A;  4UUT A;  2Y69 H;  3DTE A;  3BJA A;  4RM2 A;  2BHY A;  1I6H J;  1APL C;  4LG3 A;  2I8D A;  4PJ0 C;  1IV6 A;  2AS5 F;  3BZK A;  5F0H A;  1AWC A;  1JKP C;  2JVH A;  1U8B A;  1L3L A;  2JPB A;  4L5E A;  3OIO A;  5K7Z A;  4N9H A;  2DDA A;  2LP0 A;  1BA5 A;  5AIQ A;  2RNG A;  1YI2 I;  2VOP A;  3K70 C;  1G3Y A;  4UB8 C;  5ICC A;  2CQN A;  5ICE A;  3E5X A;  2MGQ A;  3EYY A;  2JRM A;  1Z21 A;  4ENK A;  2HXO A;  3RIR A;  1Y0N A;  1HW5 A;  4A3L J;  2FOW A;  3GXO A;  1X1D A;  2DFH A;  4M3F A;  2PLY A;  2DA7 A;  4UUS A;  3IAS 2;  5HS7 A;  2ZFW A;  4Y52 J;  3I4M J;  1DPR A;  3OYF A;  3H1C A;  1BC8 C;  1VI0 A;  3G6E I;  1Y39 A;  2V1N A;  3U9G A;  2E7W A;  1ZHF A;  2JN6 A;  2EV0 A;  5ILS A;  2KLO A;  3TOA A;  3BZ6 A;  4BGD A;  3FHZ A;  2K3F A;  3LSJ A;  2BXY A;  3QOE A;  2W4S A;  4OU0 A;  2OPT A;  5IY5 H;  4WXH A;  3SDG A;  2Y75 A;  3VSL A;  1UB9 A;  2J5P A;  3HUG A;  3K1P A;  3O8G A;  1T2K A;  1IXR C;  3FXM A;  5B1B H;  2LOO A;  3FBI B;  1SFX A;  4A3M J;  2VT3 A;  1XTA A;  3A01 B;  3ONQ A;  2X6Y A;  4NQW B;  5TIS C;  4GXO A;  3ROU A;  3KFW X;  4YFX F;  5J1Y A;  4LD5 A;  2ZXH A;  1FOY A;  3DXJ F;  3Q9V A;  1V5F A;  5FKL A;  3VFZ A;  3TP0 A;  4BBR J;  2E35 A;  2FJ1 A;  2WTE A;  4BHB A;  2IPQ X;  1XMK A;  3OIQ A;  2AQE A;  2V9V A;  2M8G X;  3ZQ7 A;  1V4R A;  1DP7 P;  1MJB A;  4CYC A;  1B1B A;  5E8I A;  3BY6 A;  1IXC A;  4NNJ A;  2XIG A;  1AKH A;  4FE4 A;  3V8L A;  1IUY A;  5ILV A;  5KNL A;  5KAI C;  1Z05 A;  3ZQH A;  2EK5 A;  4P9U A;  2M87 A;  2E2I J;  4WXC A;  2OZU A;  4IOC F;  2XAF A;  2XC7 A;  4H0E A;  2DT7 B;  1G59 A;  3GFL A;  1JJ8 C;  1MH3 A;  1VQ9 I;  1CGP A;  3ZQC A;  2PX9 A;  4II3 A;  1LEB A;  1QBJ A;  4LLN A;  2K40 A;  2M4K A;  3KYC B;  1WH7 A;  4ZDL A;  1Q1V A;  3WHB A;  3IP4 B;  4MLO A;  4QWQ A;  4PFP A;  3H3V K;  1XB4 A;  3Q5F A;  2R7U A;  1T08 B;  4XKC A;  3LSK A;  2FML A;  2MD5 A;  1W7P D;  2DQL A;  1R1V A;  4X0G A;  1YRN A;  4AIK A;  3O2P E;  4RB1 A;  4KFC A;  3ABM H;  3TO9 A;  5L3E A;  1JUS A;  4N4O B;  3LA7 A;  1X2N A;  2R0Q C;  2HZD A;  2WB1 A;  4LLL A;  1U3E M;  2Z99 A;  2MC4 A;  2XAQ A;  3H9Q A;  3GO5 A;  3KX2 A;  2NOG A;  5J47 A;  2IA2 A;  2CYY A;  3I4N J;  2OU2 A;  1YFH A;  1S29 A;  2LKP A;  3LSG A;  3H3U A;  3KCC A;  4C3J J;  5IYD J;  1WHU A;  3IAM 2;  4JX4 A;  1VQ5 I;  3C2G A;  2KMU A;  2KRC A;  2Q2E A;  4MHG A;  3DTI A;  5LBQ A;  1BBY A;  2MG4 A;  3T5X A;  1JGG A;  4BL0 B;  3ZQF A;  2V9K A;  2YR2 A;  4P55 A;  2R5Y A;  4U87 A;  4DNC A;  1ACI A;  5HDN A;  1ITY A;  4JP0 A;  1W36 C;  4ENN A;  3CUQ C;  1IN8 A;  3PSI A;  5E3O A;  1R49 A;  5EJC A;  1H9G A;  3I9V 2;  5FO5 A;  2STW A;  1TQP A;  3WOD F;  1VQP I;  4M3D A;  2M7A A;  2QEN A;  4CCK A;  3P5J A;  1MW7 A;  1VQ6 I;  2CW7 A;  3OYN A;  4ZYD A;  3X2Q H;  3I53 A;  4RMN A;  2V6C A;  2PMZ A;  4UVB A;  3JRG A;  1OCR H;  3W6K B;  1BIB A;  1QRY A;  4PK4 A;  2DK5 A;  2E60 A;  3RYR A;  3ERE D;  3TDZ C;  4ZZD A;  2ID6 A;  3KP2 A;  5LHI A;  1SVM A;  2P0W A;  2MAB A;  3DU6 A;  4KA4 A;  1ZK8 A;  2PN6 A;  3K10 A;  2YS9 A;  3M4O J;  5LFA A;  1R00 A;  2WAD A;  4LLG F;  2QVO A;  3J81 K;  4BAC A;  4B09 A;  1D0Y A;  1R58 A;  3K1N A;  1FOW A;  1OKR A;  2EZL A;  3PNT A;  5ILU A;  4S0H B;  5IT3 A;  2W7N A;  2R5Z B;  2R7Z J;  2HXI A;  5K7F A;  3SFZ A;  1XSX A;  4ZDO A;  4N9I A;  3PL8 A;  1JHF A;  5BQT A;  2GLO A;  5DV5 A;  2BY3 A;  3J80 Z;  2QBY A;  4BE1 A;  2E1O A;  5LGT A;  1V3F A;  1MND A;  3A02 A;  3Q0W A;  4AYB N;  2VOD A;  1LFP A;  3HKZ A;  4YII A;  2BVM A;  1YW9 A;  2GA2 A;  4XON A;  5DTD A;  2LY1 A;  2L02 A;  4NUB A;  3GTJ J;  1TWG J;  1U5T B;  3BR1 A;  4QPQ A;  2MSY A;  1EH6 A;  5B66 C;  2COM A;  3CCJ I;  5D4S A;  5L3G A;  2XB0 X;  4A2U A;  1A31 A;  4ITV A;  3BLY A;  2L7F P;  3BCB A;  1QHH D;  4HRI A;  1I1G A;  3JRF A;  2RVC A;  3DEW A;  4YEJ A;  1SAX A;  2E36 A;  3WU0 A;  4EM2 A;  5HS9 A;  4OIQ F;  3HOZ J;  4MEX F;  3K6G A;  3ELK A;  2YPR A;  3OYE A;  3L00 A;  2VE9 A;  1VQK I;  4HV6 A;  2R92 J;  2B63 J;  1ZR4 A;  4HLY A;  4XKV A;  2UXN A;  4OWR B;  3E0J B;  1J0R A;  2BY0 A;  4XRS G;  3KEY A;  3WTZ A;  4PJM A;  4U7D A;  1J7K A;  5IOZ A;  3PO2 J;  2QSF X;  3LFU A;  3L2C A;  2PJR B;  4Q47 A;  2F48 A;  5FRM A;  4MGR A;  3BT9 A;  4A6D A;  3JRH A;  3W2V A;  3QPH A;  1PJR A;  2JRT A;  1O3Q A;  4HF2 A;  2G7U A;  4HST A;  2NYX A;  3F21 A;  1BIA A;  2UV1 A;  4EEF G;  3PIO F;  3HEF A;  2VJJ A;  4KIS A;  2Q8K A;  3JAM Z;  5FLV A;  5HVQ C;  3LQR A;  1I6X A;  4YEL A;  2ZC2 A;  2JQ7 A;  5HDG A;  4WK8 F;  3L2Q A;  1XSV A;  3QYB A;  3TMO A;  2MW8 A;  1D8K A;  3G1M A;  4EM0 B;  3BR5 A;  5E3N A;  2JA6 J;  2K9S A;  4EQQ A;  4HZF A;  2XGC A;  4DQ2 A;  1VZ0 A;  2XF5 A;  3DCF A;  4DZJ A;  2YX4 A;  1X1C A;  4GO1 A;  2VL8 A;  1Z6T A;  4M3G A;  3SDB A;  3SFI A;  3EDP A;  3GW2 A;  5C4J J;  1MMN A;  3CF5 F;  2HYG D;  3S8P A;  2W48 A;  1WQ2 A;  2JPC A;  1QGP A;  1XCV A;  2CWE A;  3I5U A;  3UNG C;  2FBK A;  4LG0 B;  1BR2 A;  3OIP A;  5M5W J;  2FEZ A;  3OYH A;  3R0A A;  4RAG A;  4ESB A;  4XID A;  1P7J A;  4HQM A;  1E0E A;  1IRG A;  1A04 A;  3CUO A;  1K6Y A;  3FDY A;  4KIG A;  5F1R A;  2H1L A;  4XN3 A;  5GTI C;  1ENH A;  3ZCO A;  4IKF A;  3CLO A;  1FYL A;  3LSM A;  1WJF A;  1Z7U A;  3LL7 A;  2GXG A;  2OC6 A;  4WCG A;  4GYG A;  1X1A A;  1NHA A;  4RB0 A;  4NQW A;  2O61 A;  3HOW J;  5J40 A;  3DLA A;  4XLN F;  4CHU A;  3OOU A;  1EH7 A;  1Z67 A;  3QPT A;  1N75 A;  5LEJ A;  1W5C C;  4OAZ A;  2O0Y A;  2QQ9 A;  4B3X A;  5K5R A;  2XSJ C;  4XN0 A;  3DBR B;  1D1A A;  3J7Z I;  3CD6 I;  3TBI A;  4BDZ A;  1WH5 A;  3HSF A;  1EA3 A;  4BU2 A;  2HU9 A;  3EET A;  2GAU A;  4YFN F;  2A3S A;  1Z91 A;  3ZXS A;  1YOV B;  1BM9 A;  2OQR A;  4RGS A;  2EIJ H;  5L3D A;  4AC0 A;  1R5H A;  1TWA J;  3QP6 A;  4BNC A;  1ZRD A;  1GXQ A;  3KZY A;  3SEQ A;  2V1U A;  1PP8 F;  1TT0 A;  1WVR A;  5E3L A;  1KYZ A;  5JR3 A;  2N8G A;  2QZ8 A;  3QPS A;  2ZJQ F;  3H5N A;  2ESH A;  2Y48 A;  3WG9 A;  1LDD A;  1SD5 A;  1VQ8 I;  2QUF A;  2Y0M A;  3CCM I;  1IN5 A;  2EZH A;  3K4C A;  3HPH A;  4N0B A;  2FBI A;  2W1O A;  2JTV A;  2OA4 A;  3DWL E;  2ZJP F;  4HSR A;  1S72 I;  2H8W A;  3CTA A;  2XKP A;  1DDN A;  2VON A;  1R5G A;  2LDU A;  3VOE A;  2A6T A;  2E1N A;  1FMW A;  3OS1 A;  3MZH A;  3V4G A;  2L9N A;  3HZJ A;  1T8I A;  2HYF A;  3KE2 A;  1FBU A;  4Y7N J;  3W6V A;  2K86 A;  3U1D A;  2Q1Z B;  5KCM A;  4AU7 A;  3G1L A;  1XG1 A;  5CYV A;  2DQR A;  2F4I A;  2KZV A;  1Z77 A;  3GTG J;  1G6N A;  3DKX A;  4LOC A;  3FBN B;  3LST A;  4H4K C;  4FET A;  4IRI A;  3R6S A;  5D4R A;  3TQN A;  4HOB A;  1RZ4 A;  3PIP F;  4FE7 A;  4P1W A;  2LBF B;  2EV5 A;  4C2U A;  4MO7 A;  3HRU A;  5CVR A;  4JYK A;  2XDV A;  4IXA A;  2P81 A;  3F3X A;  2FE3 A;  2XV4 S;  2JMW A;  4KDP A;  2HZT A;  3PFY A;  1TNS A;  3QP5 A;  4OIR F;  1O7F A;  1VQL I;  4BUP A;  1PP7 U;  1TW3 A;  1LNW A;  2BVL A;  3DPU A;  3ECH A;  1XD7 A;  5LGU A;  2CFO A;  2DK8 A;  1BN5 A;  1ZGA A;  5EZH A;  2L7K A;  1W5S A;  1JT6 A;  2JA2 A;  2O5R A;  3BC8 A;  5GAG J;  2K9L A;  1LFB A;  2OV7 A;  2PFB A;  3OS0 A;  2K5C A;  1RUO A;  1G3S A;  5ICG A;  3IRR A;  4ANJ A;  4BHP A;  2EA2 A;  5DUI A;  5FB2 A;  2OBP A;  2LY2 A;  1DGR M;  2VOO A;  1HKQ A;  4CZC A;  3LSR A;  1I27 A;  2RGV A;  4DYC A;  2QYO A;  4ZYG A;  5M5Y J;  2JA7 J;  3F22 A;  4CUG A;  4EM1 A;  2TCT A;  2ETH A;  2XRL A;  1I1S A;  1OCC H;  3VWB A;  5J4Y A;  2HVR A;  3L2V A;  3WGG A;  4KIF A;  2Y9Y A;  3ZN1 A;  2BZT A;  1QPM A;  1TQI A;  2LF8 A;  3DEE A;  1HDP A;  1T39 A;  1LDJ A;  2BV6 A;  1P6R A;  4A3G J;  2K9M A;  3TP3 A;  4RB2 C;  2KKO A;  1J59 A;  2V6E A;  2JT1 A;  4HF1 A;  3M1E A;  3A03 A;  4BS9 A;  3V7C A;  3LSH A;  5L3B A;  4Y3O A;  1YLF A;  1FC3 A;  2A5W A;  2K27 A;  3UR3 C;  2HOT A;  1V54 H;  2EB7 A;  1XDS A;  5JVT A;  2EIK H;  2E5Z A;  1DU6 A;  1PUF A;  4IHW A;  2IBD A;  1UAA A;  3J81 Z;  2AO9 A;  2DI3 A;  3M9A A;  2EV6 A;  3GX4 X;  5DM7 F;  2VE8 A;  5LHH A;  3HOX J;  1V55 H;  3GFM A;  3SZG A;  3ABK H;  2NS7 A;  1OCT C;  4HX8 A;  2ZME C;  3GEZ A;  4I98 B;  2XPU A;  4Y17 A;  5A2Q K;  1FP2 A;  2QGU A;  1TZL A;  1IN6 A;  1YW8 A;  3NWS A;  1RUN A;  6PAX A;  4U0W A;  1K79 A;  3DP7 A;  3VOD A;  1XX5 A;  4HW0 A;  4IHT A;  2FNP A;  1R1U A;  1B4A A;  1WJB A;  1X58 A;  4C3H J;  1ETQ A;  1X1B A;  1RKT A;  1CF7 B;  2B0L A;  5DD4 A;  1Q1H A;  1ETX A;  1ZGJ A;  2VXD A;  4EJW A;  4G7O F;  3U2R A;  3K4M A;  2PMZ N;  1OR7 C;  3S3M A;  2F5D A;  1X4O A;  3A4C A;  2VN2 A;  4G7H F;  2D1H A;  1JTX A;  2LNB A;  1Z9C A;  3VSK A;  3ZN0 A;  5KVR A;  4HX7 A;  4IVN A;  5DD8 A;  2LRD A;  3FX3 A;  2CO5 A;  1LE8 B;  4KT6 A;  2O8K A;  5K1Y A;  3D0S A;  3REO A;  4A12 A;  1U9O A;  4UHT A;  1H0M A;  5ERI A;  1EKE A;  4FAS D;  5KAF C;  4LIV A;  2X6X A;  3BG7 A;  1IRZ A;  2DFE A;  4IO9 F;  1TC3 C;  4M6V A;  1NG6 A;  2FA5 A;  2WC2 A;  1Y6I A;  3H36 A;  1ZRE A;  3FXQ A;  5LHG A;  1P4A A;  1M1E B;  2L4M A;  1AHD P;  3Q3S A;  2NNY A;  4BEH B;  3QRF F;  1R1T A;  1U5T C;  4D1Q A;  1HDD C;  1A5J A;  3HKZ N;  5H6R A;  2M30 A;  3WTS C;  2XAH A;  1Y8R B;  1WGX A;  1ZG1 A;  1BW5 A;  1XGN A;  2WAF A;  4LG0 A;  4AD9 A;  4L9N A;  3WU1 B;  3I56 I;  4BJT A;  3K4B A;  1YYV A;  4YFK F;  3MVP A;  2V9P A;  4W1U A;  1SAN A;  1FLI A;  3BZC A;  3H3Z A;  3ZQG A;  3C7J A;  2R7R A;  2HEO A;  4YG2 F;  3IL2 A;  1SMT A;  3OS2 A;  3CDH A;  5LRR A;  1MMA A;  1XGM A;  1IC8 A;  3AG4 H;  3MN2 A;  4IZZ A;  2O03 A;  2KIQ A;  4LB6 B;  1MMG A;  2DMP A;  1JTY A;  2IGK A;  1HSJ A;  4OMZ A;  5D8K B;  4CCM A;  3BG5 A;  3F8F A;  4A3E J;  1F5T A;  2GOM A;  2H6C A;  4M9X A;  2CH0 A;  2DDB A;  5IP6 A;  2BW3 B;  5D5W B;  2HR3 A;  2CG4 A;  4PUS A;  4RGU A;  2OD5 A;  3FKJ A;  5EEA A;  3KPH A;  3G1O A;  2DAO A;  2I5U A;  2H94 A;  2C6Y A;  1KYW A;  2V26 A;  2FD5 A;  2DFF A;  3JTG A;  1WPK A;  1R9T J;  2ZCW A;  5EGO A;  1AOY A;  2QF7 A;  1UG2 A;  4XRF A;  4IHY A;  2DT6 A;  3IH3 A;  2VJ5 A;  5AON A;  1DUX C;  3I58 A;  2ACJ A;  2O8X A;  3CCS I;  1X19 A;  4ZZL A;  1XSD A;  5J1U A;  4MQ9 F;  2O7O A;  1S3J A;  2K02 A;  2ZSI B;  1KQ8 A;  1HXD A;  3OL4 A;  1MJA A;  1RES A;  1W7P B;  5C44 J;  5J8C A;  2IT0 A;  3R4K A;  4UNO A;  3HOT A;  2KPM A;  2DFI A;  3IKT A;  3FXU A;  1RR8 C;  1J75 A;  3S1N J;  2NS8 A;  4IF4 A;  2LK2 A;  4EJT A;  4HX4 A;  1FIP A;  1UST A;  2XUB A;  4D0P A;  5J3L A;  4F93 B;  3GTL J;  2R7F A;  4GGG A;  3CUQ A;  1MBF A;  1J09 A;  4BQA A;  4DJA A;  2LKS A;  3TO6 A;  3K1M A;  1NTC A;  4QIW N;  1O3T A;  1FT9 A;  1T38 A;  2NOJ B;  4A0Z A;  3QOP A;  3CCU I;  2DXI A;  3HJE A;  2DMQ A;  5BNG A;  2DA6 A;  4AM3 A;  3KYD B;  3QU6 A;  4RS8 A;  1QHG A;  1SVO A;  4HEA 2;  2M1B A;  1SFK A;  1MNE A;  2XKO A;  3F6V A;  3BTJ A;  3S1R J;  4XBF A;  2E7X A;  4WX9 A;  1HST A;  1WJC A;  3MQ0 A;  2FX0 A;  2VB6 A;  2ZB9 A;  5E8G A;  2IXS A;  1TL8 A;  4FX0 A;  5H20 A;  1BW6 A;  5DEQ A;  1VFC A;  3RQI A;  1W4M A;  2XRN A;  2HWV A;  1PUE E;  3RDI A;  3PM1 A;  3D5L A;  5CVU A;  5K5Q A;  4HDU A;  1JUP A;  1I50 J;  4YRV A;  3BWG A;  2DJN A;  2K4J A;  2GM4 A;  1SEU A;  3NQO A;  3CCL I;  3RKQ A;  4XMY A;  1IDZ A;  2NNN A;  5FGM A;  5HLH A;  1R7J A;  1H9T A;  4I2O A;  2F4O B;  3QOD A;  2KJC A;  2VPL A;  4OMY A;  1S8N A;  3QYE A;  1UMQ A;  2KQR A;  3CCR I;  3TGN A;  2K9Q A;  1VF9 A;  2ZKZ A;  3PUF A;  4FQG A;  2ELH A;  2AQF A;  3Q0U A;  1VQ7 I;  4D7M A;  2ZXI A;  4CCN A;  2JSC A;  5HLG A;  3NEU A;  1G4D A;  2LLK A;  3DKY A;  5HNF A;  4J00 A;  3VYS B;  4E7J A;  2CQK A;  1MSF C;  3CQZ J;  2PMH A;  3VYR B;  4MFE A;  3MMY B;  1B72 B;  3VB2 A;  2ISY A;  1MMS A;  3EUK L;  2Z2S B;  4WWC A;  5FD5 A;  2LC2 A;  3MKY B;  5DCM B;  2P6S A;  1I3A A;  1QPI A;  1MKM A;  2FNA A;  3GLL A;  3TDU C;  3C2H A;  3FXL A;  4M9Z A;  4CZZ A;  3BQY A;  2CV0 A;  4L0Y B;  3N4M A;  2CW8 A;  1HKT A;  1S7E A;  3CMY A;  2FOK A;  4I09 A;  1YJN I;  2ZME B;  2IS2 A;  1XGO A;  2CRG A;  2DMU A;  3ISP A;  4RM3 A;  4FX4 A;  3K4K A;  1QQI A;  4IJA A;  3UKG A;  3KET A;  3PO3 J;  4Q48 A;  2HFH A;  3EUA A;  5E18 F;  3E1S A;  1LQ1 A;  1YIJ I;  1P9Q C;  3LWF A;  4IHS A;  3W2A A;  2HTS A;  1RI7 A;  1IRX A;  4LK1 F;  5L3C A;  1HF0 A;  1RET A;  1K4S A;  2D2W A;  4G12 A;  5IYC J;  2R7V A;  2P5V A;  5JFR A;  2LG4 A;  3I54 A;  2VJ4 A;  2ADU A;  2DT5 A;  3GZ6 A;  2M7B A;  3JRC A;  3FHN A;  4UV8 A;  4IHV A;  1SD7 A;  4PSW A;  1IGN A;  4UVC A;  4EMS A;  1FTT A;  4UB6 C;  2ZJR F;  1IAW A;  1F4K A;  1WI9 A;  1ERD A;  2IS6 A;  4HNU A;  4LJZ F;  2CQX A;  4U7B A;  2L01 A;  3DPL C;  2UXX A;  3BJO A;  4L5I A;  2ZSH B;  4XNF A;  3QYF A;  3WTV C;  3SXY A;  2R7Q A;  1KU3 A;  2RNJ A;  1KZH A;  2VKE A;  3D5R C;  1B8I B;  3HSR A;  1IUF A;  1FNN A;  1E3H A;  4AVZ A;  2XAJ A;  1QZZ A;  3S15 J;  1YE9 A;  1WJD A;  1YTY A;  4BDY A;  4V2F A;  5DDG A;  2JUG A;  1WZ2 A;  4BQN A;  4D5F A;  3S16 J;  1QZE A;  2ME0 A;  1Y1V J;  4MQV A;  1F1Z A;  2LFB A;  1RNL A;  5A2Q Z;  1BR4 A;  4KIC A;  2HDC A;  3J7Y J;  1D0Z A;  3PQJ A;  1TTY A;  4ZJZ A;  1N25 A;  2PI0 A;  4IPA A;  3FM5 A;  1D1C A;  3E5U A;  5H6Q A;  3HOU J;  1DPU A;  3P7N A;  1T0F C;  3M8J A;  5D6E A;  4PJL A;  4MNU A;  1K78 A;  3WG7 H;  3RJP A;  2BXZ A;  2GBY A;  1ZLJ A;  3F8C A;  5JLX A;  2EFN A;  3V8K A;  4L18 B;  4FCY A;  1Y0U A;  1N78 A;  3AFH A;  3DKW A;  3S1M J;  1MH4 A;  1SD6 A;  4RLQ A;  2WY7 Q;  3MZY A;  2EFQ A;  3DU5 A;  5J8F A;  3LNQ A;  2BY1 A;  2DOF A;  4Y15 A;  1JUM A;  3DBH B;  2XF7 A;  1Z6R A;  1TQM A;  1PVE A;  3V8J A;  2V1D A;  4XQF A;  5EG0 B;  3MEX A;  3HL2 A;  4I01 A;  3QQA A;  3DTK A;  3F0C A;  3VYT B;  1BJA A;  4UVA A;  2CMP A;  2XPV A;  2VQC A;  3K7A J;  4HNV A;  3HIF A;  2OCC H;  3WTT C;  1GDT A;  3IV5 A;  2EIN H;  5CLS A;  3F23 A;  4DYQ A;  4EV0 A;  2M8E A;  1SMY F;  1QU3 A;  3U1K A;  4LFU A;  1Y56 A;  5HLT A;  3L1P A;  1AU7 A;  5EDN A;  1HOM A;  3WU2 C;  3S93 A;  2Y31 A;  2K4B A;  3FMS A;  1D8J A;  2Y30 A;  5EYR A;  2XAU A;  3OYJ A;  3GVA A;  2RQQ A;  1WFX A;  4MTD A;  3I64 A;  2HQ5 A;  3K2A A;  2M34 A;  2FUG 2;  2F4M B;  2LH9 A;  1E3O C;  2F6C A;  2HOS A;  4B4C A;  2MH9 A;  3MD2 A;  2QQB A;  3B02 A;  1ZGW A;  2WAQ A;  2OTL I;  4CYD A;  3OYI A;  3CP8 A;  1I39 A;  2LRE A;  1O57 A;  2ECC A;  2W25 A;  2OF7 A;  2KL4 A;  3HDD A;  2L9V A;  2E71 A;  4CCO A;  1UEL B;  1VQ4 I;  3O8H A;  4NBQ A;  4BJ6 C;  2VJI A;  1U9N A;  2DTR A;  3FXR A;  3BR6 A;  3M8E A;  3M1C A;  3ZMV A;  3HHH A;  3IH4 A;  1J5Y A;  1XPX A;  2NRA C;  4KUM A;  3OSF A;  3RKW A;  5IP7 J;  1JKO C;  2Q0O A;  3QAH A;  1RRJ A;  1LVK A;  2M5W A;  3AG3 H;  3I59 B;  1ZRF A;  1LB2 A;  3A0H C;  5H2F C;  3H0D A;  4OIN F;  2Z33 A;  1HCR A;  3A01 A;  4B8X A;  2VQH A;  4EAT A;  1QNT A;  1D0X A;  2J5O A;  2QA4 I;  3SZT A;  3RQ4 A;  3I71 A;  4R79 A;  3PFI A;  2IJL A;  3K4J A;  2E5N A;  4MIM A;  3FKI J;  1LVA A;  3PQK A;  3L2U A;  3QU3 A;  3TO7 A;  3GFJ A;  2LKX A;  3ZPL A;  3OYD A;  4HLX A;  3K70 D;  3GTO J;  3IWZ A;  2DYR H;  2M3A A;  1DGW Y;  2W84 A;  4IQJ A;  5KHD A; 
#chains in the Genus database with same CATH homology
 5E1Z B;  4HA8 A;  2P5L C;  2A5Y B;  4PZJ A;  3IC7 A;  1U2W A;  2PBI A;  2VBW A;  2FRH A;  2XHK A;  4IRG A;  3N97 A;  3GLX A;  2A61 A;  1FPQ A;  3K2Z A;  2RN7 A;  5IT9 K;  3DQV C;  2PG4 A;  4U0Y A;  4FHT A;  3WE2 A;  5K5O A;  3FMR A;  2ZNZ A;  4AIJ A;  2YX7 A;  2F5C A;  3J7A O;  5D8L B;  5LRS A;  2G9W A;  4RAY A;  1JHH A;  1TNT A;  4CIC A;  3WTX C;  4GCV A;  5BPI A;  5DCM A;  3GFI A;  1E2X A;  3G73 A;  1U78 A;  3L09 A;  1YG2 A;  5FD6 A;  1YQA A;  1OYY A;  4UUV A;  2ZME A;  1FYM A;  2DPU A;  4A0X A;  1WSU A;  1ZAO A;  5LEK A;  2HQR A;  2BEO A;  2DLL A;  5HLI A;  1HQC A;  2GZW A;  4S05 A;  2IW5 A;  2FBH A;  2D1V A;  3CO7 C;  2HGC A;  2RV8 A;  3TOB A;  2MC3 A;  3COA C;  1OR7 A;  4PDK A;  4HDV A;  2Z3Y A;  4CO8 A;  4G9Y A;  1GVJ A;  4A6E A;  4M74 A;  4Q4Z F;  3LAJ A;  3C3W A;  1XMA A;  2A6E F;  3VEP A;  1MJ9 A;  4XLP F;  1KU7 A;  1J2X A;  3E97 A;  1OYW A;  5D5V B;  1ZLK A;  3HTS B;  3O3K A;  4G6D A;  2CSO A;  1U5T A;  5CVJ A;  1ON2 A;  4NB5 A;  1T6S A;  1KU2 A;  1IW7 F;  1ODD A;  1ULY A;  1FZP B;  3ABT A;  3HHG A;  3AAF A;  3S2W A;  3KP4 A;  2PEX A;  4A5N A;  5DCF A;  1ZRC A;  3WGI A;  5E17 F;  4M9S A;  1XCB A;  5F6F A;  5KK1 A;  2H27 A;  4ESF A;  4Z2Y A;  3RI4 A;  2FU4 A;  4F7Z A;  2ZXJ A;  4RGX A;  5CJ9 A;  5HDK A;  4R8H A;  3OOP A;  3W6J B;  2ZNY A;  1D3Y A;  2QBY B;  3ZMS A;  4YIF A;  4ETS A;  2VC0 A;  4G6Q A;  5JHU A;  3RKY A;  4KT5 C;  2GIV A;  3K9T A;  2HTJ A;  2EFO A;  3I0T A;  1FSH A;  2PQ8 A;  4LGW A;  1KQ0 A;  3ZP5 A;  4UV9 A;  3RPQ A;  3P9I A;  3L7W A;  1KA8 A;  3T8T A;  5ED4 A;  1FY7 A;  2UWM A;  1SFE A;  4U0V A;  4FT8 A;  3JSP A;  1U6G A;  3K69 A;  5L3F A;  3ZMU A;  2MH2 A;  1JE8 A;  1SD4 A;  3HYI A;  3JSO A;  3T1B A;  1SFU A;  3IHU A;  4EJU A;  5CVI A;  4KIB A;  1Z1D A;  4EVI A;  2QQA A;  1REP C;  4A0Y A;  1PDN C;  1BI1 A;  3BPV A;  1MDM B;  1XN7 A;  2X0L A;  3KP7 A;  1HW2 A;  3E6B A;  3RKX A;  4AWX B;  4O6J A;  3CJN A;  4PGG A;  5E1W A;  3LQQ A;  5LLQ A;  2IP2 A;  3KEQ A;  1UHM A;  4WXD A;  2ZO4 A;  2OZ6 A;  1UFM A;  2MA3 A;  2Z5U A;  4AIH A;  4IRH A;  4ENJ A;  1EV7 A;  4JK1 X;  5E20 A;  3TKY A;  4L9T A;  4RB3 C;  2KIM A;  2RC4 A;  2VBX A;  4LK0 F;  1P4X A;  4M71 A;  1BI2 A;  3R60 A;  3BJ6 A;  4GYI A;  3DF8 A;  1P92 A;  5IT9 Z;  2UZK A;  3MCZ A;  4M6Y A;  2FXA A;  4KMU X;  4O5V A;  5HOO A;  2EWN A;  1KGS A;  3BPX A;  1FSE A;  2CGP A;  1KU9 A;  2BE5 F;  4CGZ A;  2O6G E;  2PMU A;  4EJO A;  2JZY A;  3ULQ B;  2CW0 F;  2GWR A;  4HBL A;  2GXB A;  3WE3 A;  1YS6 A;  1TLH B;  3F8M A;  2P5K A;  2RQP A;  2FSW A;  2HOE A;  2LSO A;  2E1C A;  3P9C A;  2VBZ A;  5JI6 A;  1BOA A;  1IN4 A;  4MEY F;  4PGH A;  1VTN C;  1HKS A;  4ZYH A;  2A69 F;  3H92 A;  2M45 A;  4LB5 A;  1D5V A;  1OPC A;  1USS A;  1ZYR F;  2KRF A;  1STZ A;  1K7A A;  1ZG5 A;  1T0F A;  3EYI A;  3NRV A;  5TRD A;  3FMQ A;  2W57 A;  4XSX F;  2NAZ A;  3JTH A;  3ZMT A;  1ZH5 A;  1B9N A;  4R1H A;  2MLK A;  2ISZ A;  4HV5 A;  1OMI A;  3WTW C;  5EEH A;  2OAZ A;  3C18 A;  2OQG A;  1C0W A;  3KLO A;  2XRO A;  1ZG3 A;  1P2F A;  4EGZ A;  2WV0 A;  5FLX K;  2AXL A;  1XDU A;  3GYH X;  1JGS A;  4ASN A;  4QLC U;  1B59 A;  4JBA A;  4KN4 X;  4K2E A;  3WGH A;  1QZY A;  3FM3 A;  4A5M A;  1TBX A;  2QWW A;  1CF7 A;  5HS8 A;  2FMY A;  4M73 A;  4BYY A;  2GA1 A;  4I0A A;  4TV7 A;  1YS7 A;  3V7R A;  5BS6 A;  5ICF A;  2BYV E;  3FF5 A;  2RKH A;  4L9V A;  4KMF A;  2IA0 A;  3ZMD A;  2A07 F;  5FFZ A;  1MD0 A;  2D45 A;  5J6X A;  3B73 A;  4ENM A;  1YIO A;  4UXN A;  1R36 A;  2KIF A;  3GZ5 A;  2IVM A;  2XAG A;  4HF0 A;  1P4W A;  2VBY A;  4CDG A;  5BOX A;  4I0B A;  4JQF A;  2Z9O A;  3HRT A;  5D6F A;  1EH8 A;  2EFP A;  3ML6 A;  2QLZ A;  2HKO A;  3BP8 A;  1S7O A;  1WWX A;  4E70 A;  2EJR A;  3IWF A;  3WTY C;  5CVV A;  2BGC A;  2DW4 A;  2L4A A;  5EEG A;  3OV8 A;  2F5F A;  1B6A A;  5TJJ A;  2MLG A;  1OYI A;  4O3M A;  2HKX A;  3V7S A;  1WRJ A;  2ZJ2 A;  4OOI A;  1MDM A;  1X3U A;  3G3Z A;  4BXU A;  2G7H A;  3E6C C;  1W7P A;  3HSE A;  3EQL F;  3JW4 A;  2R7D A;  5F64 A;  1O3S A;  1IF1 A;  2F5E A;  3KZZ A;  1LEA A;  3FWE A;  3F8B A;  3L9F A;  4BAY A;  1L0O C;  1UCR A;  2XAS A;  3DEU A;  3GUD A;  2HQN A;  3MWM A;  1IZ1 A;  3O6B B;  2VC1 A;  1S7A A;  5AIP A;  1ONV A;  2A6H F;  1F9N A;  2K7L A;  2VXZ A;  1BI3 A;  3RYP A;  3DPT A;  4CXF A;  3F72 A;  4AVP A;  4ESJ A;  2EFW A;  1FWZ A;  2DO7 A;  2O3F A;  2P7V B;  2KIU A;  3E6D A;  5BPD A;  2EA4 A;  2P4W A;  2CFX A;  1S6L A;  5DUK A;  4I7H A;  5D5X B;  3R61 A;  2GQQ A;  3HTU A;  1HBX G;  3RPU A;  2DU9 A;  1R23 A;  1WKM A;  4MTE A;  4G7Z F;  2MBF A;  1XGS A;  2KJB A;  3T8R A;  3GWZ A;  4M6X A;  1ZN2 A;  3KP6 A;  2X4H A;  3R0J A;  3ABU A;  3EUH A;  4G94 A;  4EGY A;  2L3D A;  3BRO A;  3GF2 A;  4RAZ A;  1MGT A;  4BH9 A;  1GHC A;  1J9I A;  3KEO A;  4EJV A;  3CUQ B;  3E5Q A;  3SHF A;  5FFX A;  3HOS A;  4P5O A;  1TW2 A;  1FYK A;  4L5J A;  3I4P A;  2XGX A;  1LJ9 A;  3LA3 A;  1JXS A;  1GXP A;  1B9M A;  4ZYE A;  3M8F A;  1I5Z A;  4NHJ A;  3FZV A;  1BC7 C;  2L54 A;  2QM3 A;  2WWY A;  2V79 A;  3F6O A;  2H6B A;  5BMZ A;  1ON1 A;  3M7G A;  1FP1 D;  4P96 A;  1FOK A;  2ZBK A;  3BOQ A;  3MAJ A;  3CO6 C;  4S04 A;  3KP3 A;  2A68 F;  1G3T A;  5E1X A;  3BDD A;  3K0L A;  4G8X A;  4ON0 A;  5LGN A;  1U8R A;  2DPD A;  2W85 A;  4PCQ A;  4L9J A;  5DYM A;  4U88 A;  1QO0 D;  1K6O A;  3HRM A;  1HW1 A;  4OIO F;  3KP5 A;  2FQ3 A;  5FLX Z;  3HRS A;  1O7L A;  1BI0 A;  4HQE A;  4LMY A;  3KLN A;  3IRQ A;  2HS5 A;  3LFK A;  5D5U B;  3MFK A;  2YU3 A;  2R3S A;  3SQN A;  3E3V A;  4KN7 X;  1O3R A;  2H09 A;  3J80 K;  2P6T A;  1G3W A;  1UHW A;  2P8T A;  1LDK B;  2F2E A;  4WF2 A;  3WTU C;  2XVC A;  2LF7 A;  1FBS A;  3IKV A;  1YW7 A;  2STT A;  1MZB A;  4BHC A;  2IA1 A;  2P7C B;  3LAP A;  4KYW A;  2PJP A;  4P9F A;  4Q5S F;  4ZH4 F;  1FBQ A;  4Y13 A;  3SZP A;  4I02 A;  1R22 A;  1ZAR A;  4OIP F;  1IRF A;  2W24 A;  1IXS B;  3Q9S A;  3ECO A;  4M72 A;  1T98 A;  2IRF G;  3DV8 A;  1E17 A;  3F8N A;  2YSR A;  2RDP A;  3DFG A;  3P9K A;  1FX7 A;  2FF4 A;  2ESN A;  3T0Y A;  3C1D A;  2BBY A;  1YO5 C;  4KNY A;  3RTR A;  4XSZ F;  3LA2 A;  3JAM K;  1K78 B;  1KQ9 A;  4L0Z B;  1W5T A;  3I59 A;  4RGR A;  4HYE A;  2V1X A;  1IN7 A;  1RIO H;  2TDX A;  3ZMZ A;  3E6M A;  2NS0 A;  2VT2 A;  2DBB A;  4HAM A;  3BJA A;  2AS5 F;  1AWC A;  1L3L A;  2JPB A;  4N9H A;  5AIQ A;  2VOP A;  1G3Y A;  5ICC A;  5ICE A;  3E5X A;  3EYY A;  4ENK A;  3RIR A;  1HW5 A;  3GXO A;  2PLY A;  5HS7 A;  2ZFW A;  1DPR A;  1BC8 C;  3U9G A;  2E7W A;  1ZHF A;  2EV0 A;  5ILS A;  3TOA A;  3BZ6 A;  3FHZ A;  4OU0 A;  4WXH A;  2Y75 A;  1UB9 A;  2J5P A;  3HUG A;  3K1P A;  1T2K A;  1IXR C;  1SFX A;  2VT3 A;  3ROU A;  4GXO A;  4YFX F;  3KFW X;  4LD5 A;  3DXJ F;  3Q9V A;  3VFZ A;  2WTE A;  4BHB A;  2IPQ X;  1XMK A;  2V9V A;  3ZQ7 A;  1V4R A;  1DP7 P;  1MJB A;  1B1B A;  5E8I A;  3BY6 A;  1IXC A;  2XIG A;  3V8L A;  1IUY A;  5ILV A;  1Z05 A;  4P9U A;  2EK5 A;  2M87 A;  4WXC A;  2OZU A;  2XAF A;  4H0E A;  3GFL A;  1CGP A;  1LEB A;  1QBJ A;  4LLN A;  4QWQ A;  1XB4 A;  3Q5F A;  2FML A;  2MD5 A;  1W7P D;  2DQL A;  1R1V A;  4AIK A;  3O2P E;  4RB1 A;  4KFC A;  3TO9 A;  5L3E A;  3LA7 A;  4LLL A;  1U3E M;  2Z99 A;  2XAQ A;  3GO5 A;  2IA2 A;  2CYY A;  2OU2 A;  1YFH A;  1S29 A;  2LKP A;  3H3U A;  3KCC A;  4MHG A;  2Q2E A;  5LBQ A;  1BBY A;  3T5X A;  2YR2 A;  4P55 A;  4DNC A;  5HDN A;  4ENN A;  3CUQ C;  1IN8 A;  1H9G A;  5FO5 A;  2STW A;  1TQP A;  3WOD F;  2QEN A;  4ZYD A;  3I53 A;  2V6C A;  4UVB A;  3W6K B;  1BIB A;  2DK5 A;  3RYR A;  3ERE D;  3TDZ C;  4ZZD A;  3KP2 A;  5LHI A;  4KA4 A;  2PN6 A;  1R00 A;  4LLG F;  2QVO A;  3J81 K;  4B09 A;  1R58 A;  3K1N A;  1OKR A;  5ILU A;  5IT3 A;  3SFZ A;  1XSX A;  4N9I A;  1JHF A;  5BQT A;  5DV5 A;  3J80 Z;  2QBY A;  5LGT A;  1V3F A;  2VOD A;  4YII A;  1YW9 A;  2GA2 A;  2L02 A;  1U5T B;  1EH6 A;  2COM A;  5D4S A;  5L3G A;  4A2U A;  1I1G A;  2RVC A;  1SAX A;  3WU0 A;  4EM2 A;  5HS9 A;  4OIQ F;  4MEX F;  3ELK A;  2YPR A;  3L00 A;  2VE9 A;  4HV6 A;  4HLY A;  2UXN A;  1J0R A;  3WTZ A;  4U7D A;  1J7K A;  3L2C A;  4Q47 A;  4MGR A;  4A6D A;  3QPH A;  2JRT A;  1O3Q A;  4HF2 A;  2G7U A;  2NYX A;  3F21 A;  1BIA A;  2Q8K A;  3JAM Z;  5HVQ C;  3LQR A;  1I6X A;  5HDG A;  4WK8 F;  1XSV A;  1D8K A;  4EM0 B;  4EQQ A;  4HZF A;  4DQ2 A;  2YX4 A;  4GO1 A;  1Z6T A;  3EDP A;  3GW2 A;  2HYG D;  1WQ2 A;  2JPC A;  1QGP A;  1XCV A;  2CWE A;  3I5U A;  2FBK A;  4LG0 B;  2FEZ A;  3R0A A;  4ESB A;  4HQM A;  1IRG A;  1A04 A;  3CUO A;  4KIG A;  5F1R A;  3CLO A;  1FYL A;  1Z7U A;  2GXG A;  4WCG A;  4GYG A;  4RB0 A;  1NHA A;  4NQW A;  2O61 A;  4CHU A;  4XLN F;  1EH7 A;  3QPT A;  5LEJ A;  2O0Y A;  2QQ9 A;  5K5R A;  3HSF A;  3EET A;  2GAU A;  4YFN F;  2A3S A;  1Z91 A;  1BM9 A;  2OQR A;  4RGS A;  5L3D A;  1R5H A;  3QP6 A;  4BNC A;  1ZRD A;  1GXQ A;  3KZY A;  2V1U A;  1PP8 F;  1KYZ A;  5JR3 A;  2QZ8 A;  2ESH A;  2Y48 A;  3WG9 A;  1LDD A;  1SD5 A;  2QUF A;  2Y0M A;  1IN5 A;  4N0B A;  2FBI A;  2JTV A;  2OA4 A;  3CTA A;  2XKP A;  1DDN A;  2VON A;  1R5G A;  2LDU A;  3VOE A;  2E1N A;  3MZH A;  3V4G A;  2HYF A;  3KE2 A;  1FBU A;  2K86 A;  3U1D A;  5CYV A;  2DQR A;  1G6N A;  3LST A;  4IRI A;  3R6S A;  5D4R A;  3TQN A;  4HOB A;  1RZ4 A;  2EV5 A;  3HRU A;  5CVR A;  4IXA A;  3F3X A;  2FE3 A;  2XV4 S;  4KDP A;  2HZT A;  1TNS A;  3QP5 A;  4OIR F;  1O7F A;  1PP7 U;  1TW3 A;  1LNW A;  3ECH A;  1XD7 A;  5LGU A;  2DK8 A;  1BN5 A;  1ZGA A;  1W5S A;  2PFB A;  1RUO A;  1G3S A;  5ICG A;  3IRR A;  4BHP A;  2EA2 A;  5DUI A;  5FB2 A;  2OBP A;  2VOO A;  1HKQ A;  1I27 A;  2RGV A;  2QYO A;  4ZYG A;  3F22 A;  4EM1 A;  2ETH A;  1I1S A;  3WGG A;  4KIF A;  3ZN1 A;  1QPM A;  1TQI A;  2LF8 A;  1T39 A;  1LDJ A;  2BV6 A;  1P6R A;  4RB2 C;  2KKO A;  1J59 A;  2JT1 A;  4HF1 A;  3M1E A;  3V7C A;  5L3B A;  1YLF A;  1FC3 A;  2K27 A;  2EB7 A;  1XDS A;  5JVT A;  3J81 Z;  2DI3 A;  3M9A A;  2EV6 A;  3GX4 X;  2VE8 A;  5LHH A;  3GFM A;  4HX8 A;  3GEZ A;  4I98 B;  4Y17 A;  5A2Q K;  1FP2 A;  1IN6 A;  1YW8 A;  1RUN A;  6PAX A;  4U0W A;  1K79 A;  3DP7 A;  3VOD A;  4HW0 A;  4IHT A;  2FNP A;  1R1U A;  1B4A A;  1CF7 B;  2B0L A;  5DD4 A;  1Q1H A;  1ZGJ A;  4G7O F;  4EJW A;  3U2R A;  2F5D A;  2VN2 A;  4G7H F;  2D1H A;  2LNB A;  1Z9C A;  3ZN0 A;  5KVR A;  4HX7 A;  4IVN A;  5DD8 A;  3FX3 A;  2CO5 A;  5K1Y A;  3D0S A;  3REO A;  4A12 A;  4UHT A;  1H0M A;  5ERI A;  2FA5 A;  2WC2 A;  1ZRE A;  3FXQ A;  5LHG A;  1P4A A;  2L4M A;  2NNY A;  3QRF F;  1R1T A;  1U5T C;  5H6R A;  2M30 A;  3WTS C;  2XAH A;  1ZG1 A;  1XGN A;  4LG0 A;  4AD9 A;  4L9N A;  3WU1 B;  1YYV A;  4YFK F;  1FLI A;  3H3Z A;  3C7J A;  2HEO A;  4YG2 F;  3IL2 A;  1SMT A;  3CDH A;  5LRR A;  1XGM A;  2O03 A;  4LB6 B;  1HSJ A;  4OMZ A;  5D8K B;  3F8F A;  1F5T A;  2H6C A;  4M9X A;  5D5W B;  2HR3 A;  2CG4 A;  4RGU A;  2OD5 A;  2DAO A;  2H94 A;  2C6Y A;  1KYW A;  3JTG A;  2ZCW A;  1AOY A;  4XRF A;  5AON A;  1DUX C;  3I58 A;  2ACJ A;  2O8X A;  4ZZL A;  1XSD A;  4MQ9 F;  1KQ8 A;  1S3J A;  2K02 A;  1HXD A;  1MJA A;  1W7P B;  5J8C A;  2IT0 A;  3R4K A;  4UNO A;  3HOT A;  2DFI A;  3IKT A;  3FXU A;  1J75 A;  4IF4 A;  4EJT A;  4HX4 A;  1UST A;  2XUB A;  4D0P A;  2R7F A;  4GGG A;  3CUQ A;  4BQA A;  3TO6 A;  3K1M A;  1O3T A;  1FT9 A;  1T38 A;  4A0Z A;  3QOP A;  3QU6 A;  4RS8 A;  2M1B A;  3F6V A;  2XKO A;  4XBF A;  2E7X A;  4WX9 A;  1HST A;  3MQ0 A;  5E8G A;  4FX0 A;  5H20 A;  5DEQ A;  1W4M A;  2XRN A;  2HWV A;  1PUE E;  3RDI A;  4HDU A;  3D5L A;  5CVU A;  5K5Q A;  3BWG A;  2K4J A;  3NQO A;  2NNN A;  5FGM A;  5HLH A;  1R7J A;  1H9T A;  4I2O A;  2KJC A;  4OMY A;  1S8N A;  3TGN A;  2ZKZ A;  2ELH A;  2JSC A;  5HLG A;  3NEU A;  1G4D A;  2CQK A;  2PMH A;  3VB2 A;  2ISY A;  4WWC A;  5FD5 A;  5DCM B;  2P6S A;  1MKM A;  2FNA A;  3TDU C;  4M9Z A;  4CZZ A;  4L0Y B;  3N4M A;  1HKT A;  2FOK A;  4I09 A;  2ZME B;  1XGO A;  3ISP A;  4FX4 A;  1QQI A;  4IJA A;  3KET A;  4Q48 A;  2HFH A;  5E18 F;  1LQ1 A;  3LWF A;  4IHS A;  2HTS A;  1RI7 A;  5L3C A;  4LK1 F;  2D2W A;  2P5V A;  5JFR A;  3I54 A;  2ADU A;  2DT5 A;  3GZ6 A;  4UV8 A;  1SD7 A;  4UVC A;  4EMS A;  1IAW A;  1F4K A;  1WI9 A;  4LJZ F;  4U7B A;  2L01 A;  3DPL C;  2UXX A;  3BJO A;  4L5I A;  3WTV C;  3SXY A;  1KU3 A;  2RNJ A;  3HSR A;  1FNN A;  2XAJ A;  1QZZ A;  1YTY A;  5DDG A;  4MQV A;  1F1Z A;  1RNL A;  5A2Q Z;  4KIC A;  2HDC A;  3PQJ A;  1TTY A;  2PI0 A;  4IPA A;  3FM5 A;  3E5U A;  5H6Q A;  1DPU A;  3P7N A;  5D6E A;  4MNU A;  1K78 A;  3RJP A;  1ZLJ A;  3V8K A;  3F8C A;  2EFN A;  4L18 B;  1Y0U A;  3DKW A;  1SD6 A;  3MZY A;  2EFQ A;  5J8F A;  4Y15 A;  1Z6R A;  1TQM A;  3V8J A;  2V1D A;  3MEX A;  4I01 A;  1BJA A;  4UVA A;  3HIF A;  3WTT C;  5CLS A;  3F23 A;  4EV0 A;  2M8E A;  1SMY F;  4LFU A;  2K4B A;  3FMS A;  1D8J A;  3GVA A;  4MTD A;  3I64 A;  2MH9 A;  2QQB A;  3B02 A;  4CYD A;  1O57 A;  2W25 A;  3FXR A;  2DTR A;  3M8E A;  3ZMV A;  3HHH A;  1J5Y A;  2NRA C;  4KUM A;  3RKW A;  2Q0O A;  3QAH A;  2M5W A;  1ZRF A;  3I59 B;  1LB2 A;  4OIN F;  2Z33 A;  4B8X A;  1QNT A;  2J5O A;  3SZT A;  3I71 A;  4R79 A;  3PFI A;  2IJL A;  1LVA A;  3PQK A;  3QU3 A;  3TO7 A;  3GFJ A;  3ZPL A;  4HLX A;  3IWZ A;  2W84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...