3F2EA

Crystal structure of yellowstone sirv coat protein c-terminus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
83
structure length
83
Chain Sequence
FTAVAEQVSAVLSQYGITGPNRAIYQGFGLKVARALNRLGGGPALVNMINGLKAYYISAFNANPTVLDAVTDIITGSPTGYVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIRV coat protein
publication title Synergy of NMR, computation, and X-ray crystallography for structural biology.
pubmed doi rcsb
source organism Sulfolobus islandicus rudivirus 1 variant ynp
molecule tags Viral protein
total genus 30
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12193 Sulf_coat_C Sulfolobus virus coat protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.800 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3f2eA00
3J9X1 3FBZA 3FBLA 3F2EA
chains in the Genus database with same CATH superfamily
3CX6B 4EEDA 2B76A 2WB5A 2JQKA 2ODUA 1X79A 3UTKA 4Q25A 3R84B 3UQ4A 4I43B 4PJMA 3BK9A 2LOPA 2KINB 5L2LA 3AEFA 4YTPA 3W15B 3M65A 4JYAT 2NW9A 3CQCB 5FKYA 2Y8DA 5HCMA 4EZ4A 3HR0A 5KX5E 2UUBT 2H7OA 3LK3B 2QGSA 4DMWA 2BBJA 2WDVA 4MLKA 5HWYA 4I0UA 4CN1A 4V1Av 4EOZB 2VQET 4P09A 3N9QA 4MFRA 2V5DA 4TWDA 1T8BA 3EHZA 4AQGA 4X5TA 1O3XA 5L47A 4AKGA 1OWAA 3C4ZA 4U31A 2L3LA 5FMNA 4WW0A 4YSZA 2VWAA 5LXTE 4ISSA 2ES0A 3Q2MA 2XAFB 4O8SA 4LMJA 2X9YA 4KP3C 4DUYT 4DV7T 4LF4T 2YKSA 1HCIA 1E7PA 3ZMSB 3Q5EA 4K0UA 3AA1B 3RYHE 2IC6A 2J1DG 3JC6C 4EIWA 2CPTA 2D5UA 2DWKA 4PW8A 4OYKA 2D0TA 4U72A 4IDOA 2A3DA 3KV6A 3VKGA 2YINA 2CLYC 5EK3A 5AQMB 5JDNA 2WS3A 3MJXA 1HG2A 3ZMZB 3PUSA 5FXXA 3PUVF 4CXYA 5AQGB 3KVAA 2X68A 2MAWA 5L3DB 3KV5A 2L9QA 2M6IA 2V1DB 2XASB 4ILBA 2WU2A 1UCUA 5C3JA 3MACA 1J5ET 4ZI3C 4QXHB 5IHYA 2UU9T 3H3AA 5L3CB 4G2AA 3B13A 4F6RC 2YEVC 3LBXB 2Q9QC 4OHFA 5C8YE 3RIFA 3DTOA 5FY7A 4A98A 1NEKA 4ZZBA 2BS3A 1UURA 3I0QA 3CKDA 3UU4A 3C64A 2CXLA 2VL8A 5JDMA 3ZYMA 2IHR1 5HEJA 2IC9A 4LFCT 1HF8A 3UFEA 3ONJA 1ZKEA 1MMDA 4LMLA 3I0OA 1UUSA 4U3CA 1S94A 3MKDA 3WI3A 3ZKRA 2WQYA 3RH3A 2J62A 4H63V 2HN2A 2WDQA 5L3EB 4YHJA 3BQKA 3ETUA 3TLVA 4DBQA 3OKQA 4B6XA 3JC6D 3ZMTB 3AB3B 5CFBA 2WZHA 4UV9B 5AQLB 4GIWA 2K9AA 4HFIA 1V9DA 1BR1A 2KXPB 2NP9A 3RYIE 5CA0E 1IAPA 4GK0E 4BJNA 1MNEA 2LKGA 3N5LA 3AA7B 5KXJA 2FBWA 1FMWA 3PUZF 3Q5WA 5HXSA 2CWOA 4X64T 5JRCB 4UELA 4ZI3D 3P4QA 2V7LA 4GK5E 4IIJE 2NTYA 5C2TA 1ZV4X 5KDMC 4E7SA 3RIUC 4COFA 2QVAA 5JDFA 3AAAB 4H9OC 4X66T 2Q9QD 2H7VC 2XQ3A 5LJMA 4TZ4C 4H9PC 1BR0A 4PK4A 3EUHA 1FMVA 2E9XC 2FUPA 4MBQA 3HKCE 4YTNA 5ABEA 5JDHA 4NUUA 1LVKA 2IUBA 2QA7A 2D2SA 1ZEEA 2C0SA 2Q9QB 3AE9A 3PU8A 4LF6T 3N9LA 3AVRA 5ABFB 5LBQB 3UU5A 2CRBA 2N9DA 2K3WA 4DO0A 5JDLA 1YQ3A 3SOLA 3I1AA 1W09A 3C50A 3U3IA 2UXDT 3U78A 2XAQB 2VKJA 2X9XA 4L5GA 4QX8B 2Q9QA 4ANJA 5HCJA 3AEGA 2XQ8A 3K1SA 4LMKA 3SWHA 1KNZA 2WP9A 4F8HA 2RA1A 3PUAA 4JEHB 2IIUA 3AAEB 3ZLIA 3H3MA 2KMFA 5EK2A 1ZP0A 3SFEA 2HN1A 3L3PA 3LK2B 3IBPA 5LGTB 4BAYB 2DNXA 2VURA 4C90A 5FXWA 4EGWA 4XAXB 4PNIA 4PJLA 2V7KA 4JEUB 4ZZCA 1XWMA 3EDUA 3KBTA 4BJMA 4E7ZA 2V7IA 2FJEA 3DJBA 2FJAA 2NWBA 4C91A 4H9RC 4WZXA 5LA6E 1QUUA 1D1CA 5CGMA 3AAIA 3PUGA 5HEUA 2WM9A 4PK5A 4L9IA 4ISTA 2JIWA 4GKJT 4YXDA 2WZIA 4JI3T 2JRKA 4X62T 5LG4A 1CUNA 4PJNA 2ACXA 3HKDE 4EEBA 4KMCA 4JUYA 2CHNA 4LFAT 2LRKA 4B3TT 5ABHA 2E9XD 4HFBA 4DV6T 4N78D 3TLWA 2NW8A 1E1HB 4JI8T 4YSXA 4EV6A 4ILAA 2VQFT 1Z0PA 2CXDA 5HXHA 4CI1B 4WBNE 3LG7A 4IDZA 3M3ZB 4O4HE 3NBXX 1UX5A 2E9XB 5F5WA 5JREA 2UUAT 4O2AE 2BVMA 2Z6EA 4TNVA 5FL1A 3AE1A 4WYVA 3NVOA 3RHWA 5L3GB 4AKIA 2OA5A 2XQ9A 3VKHA 1H7CA 4HWHA 3FZFB 3RIUA 4M1PA 2JPFA 5F8PA 2KLQA 3QB5K 4EAHA 3Q9DA 2DCFA 3FXEB 3N9PA 3H37A 2P9BA 2E9XA 2JQQA 3AVSA 1SE7A 5FXVA 3UU6A 5HXRA 3RYFE 4JV5T 2M6BA 4ZOLE 4DR4T 5FXZA 4PK6A 5LNKA 3E22E 1HG5A 1WLXA 3GN5B 3HI2A 4YY3T 3F57A 2DL1A 1KEYA 1HX8A 1EZ3A 2BZBA 3VHLA 3UUMA 3CIRA 2NW7A 3P50A 3AECA 4UEMA 4YHHT 1VCSA 4AKHA 3KINB 4NPPA 1YW0A 5A1LA 2WU5A 3O9XA 1OEDB 2XSBA 1N33T 1UGOA 5F3JA 3J7Yq 3GN5A 1NWMX 2KSRA 2I0MA 4IE0A 3A7MA 1IBKT 3NRYA 5LMNT 1MMGA 2K24A 5AQTB 2LSJA 4OX9T 2F4VT 3WAJA 4P0BA 3ZCJA 5KMGP 4H63H 5GONE 3L39A 3E0ZA 3P4WA 4YLHA 3IF8B 2D0UA 5HWXA 2X51A 4LF9T 2E5VA 2BBHA 3AEBA 3F2EA 1LKXA 4EXTA 2A9UA 5LB7B 2ZM0A 5ABGA 3AE7A 1FEWA 4IDNA 4Z90A 1YKHB 3PUQA 5EZYE 3LK42 4H9QC 3MA9A 4IDQA 4DR1T 2Y6XA 5ETWA 2YDRA 4UVAB 2CCQA 3AEAA 3SRZA 1Y01A 4O2BE 3RQWA 1FJGT 5HEGA 5H6RB 3ZEFB 5JTGA 2VB6A 4QXCB 1N36T 3ZPOA 3CPZA 1KNRA 2K5BB 2PFVA 5JVDE 5IYZE 4WBOA 2BG9C 1XNRT 1HX1B 4KBMB 2W2UA 3BQLA 2XTLA 2SPCA 4A97A 3F31A 2AE9A 3PURA 2BDEA 3N2OA 3AE2A 3R6NA 2ZMAA 2LE8A 3AE5A 3GA8A 2XUEA 2A2FX 3Q5DA 1WYCA 3KFWX 2G0UA 1IZNB 2BKOA 3N9MA 4ZHQE 4L0RA 2HHHT 4AKLA 4UIGA 2DWGA 3TLTA 5FP3A 5HAXA 1FIOA 3O1HA 3OJAA 3CMLA 4DR3T 1I94T 3ZSSA 1VOMA 3ABVA 1D1BA 2LSGA 2BG9E 1Y64B 1SUMB 2LHNA 3PE0A 2WDRA 3QNUA 4JI7T 2UXXB 5L3BB 5E0OA 4IE5A 4AIUA 1U5PA 1IJ6A 3P4PA 1KNPA 2KNDA 3LBXA 4XZCA 4DV4T 5CA1E 4ZS2A 2DI4A 1YQ4A 3PUWF 1XDPA 3K3OA 4HN9A 1L0VA 2ODVA 4B3RT 3T1HT 1D0XA 2VKHA 2BS2A 2BKNA 4KX6A 1XMOT 2UUCT 3MZKB 3CK6A 4AKRB 2AXDS 2VVSA 3C51A 2E8IA 4DV3T 5LG3A 4GYRA 5FVLA 2LSYA 3EI0A 2W4XA 1KF6A 2NTXA 4TX5A 5TAOA 3AXJB 3J9X1 5BMVE 4JI2T 2DLRA 3OPCA 4QX7B 4QH4A 1UK5A 4HWDA 3AEEA 2ZM6T 4KHPT 2XQ4A 2IAKA 1HFAA 3FZKB 3N9NA 1SHZC 3JCFA 2WWVA 2XJ7A 4OFZA 2J4GA 3AXJA 1T98A 3HKBE 1D0YA 2W67A 4UXNB 5JQGE 3ZT5A 3CX7B 2BG9B 5AQUB 1BR2A 1T72A 2XSAA 3UULA 1SA0E 1MIVA 4ZXLA 3E08A 3JADA 2W63A 1GQEA 2KWHA 2MPKA 3O4XE 3ZN1B 2CBJA 4IL4A 4NIQA 3KDSE 1JNZA 2XQ6A 3RKOA 2YOEA 5JRCA 1D0ZA 3C4XA 4WNKA 4TUYE 3OYXA 2FJBA 3UUNA 4QKNA 2BG9A 1IBLT 3C98B 3IHRA 3AE6A 2V7MA 1KK7A 1W0BA 5LP6E 3O1IA 3FBZA 2XQ5A 1MNDA 4FJOA 1U4QA 3ONLC 3ZC1A 5FVKA 4X20E 3QC9A 3TLUA 4HWIB 5LBMA 5LHHB 2LSKA 4JI4T 4CN4A 1J5WA 2LKHA 1KFYA 4U74A 3RC3A 4DBRA 4UVCB 1IJ5A 3MXZA 2GK9A 4IDPA 2YU1A 5DABA 3FZMB 3KV4A 2LRLA 4PFPA 4CQIA 4TWHA 5ABFA 2LM2A 3HA4A 2JJ9A 2MYSA 1HNZT 2VK9A 4H9SE 3UQ7A 3NRXA 2X9WA 4CI2B 2W0GA 1OEDC 3ZCIA 5HXEA 3NWIA 2CXFA 1G8XA 2ZLYA 5J1GA 5CB4E 2WAUA 5HEHA 3V5UA 4AQYT 2CM0A 4ILUA 1IBMT 2UXCT 2OLTA 3VR8A 3B5MA 2WMNA 4LFBT 2A72A 5HXCA 4TWFA 3BQIA 3UFGA 1HTJF 4KHZF 1B7TA 1QSDA 2DHRA 2VVNA 5M4YA 4ZI2C 1OEDE 4ASKA 2CWYA 4H9NC 1M62A 2WMOA 1XZYA 2KZ7B 3Q5XA 4HTEA 2YK0A 4X1YE 2LHRA 4UF0B 4U2ZA 4PFOA 4K0KT 4LF7T 2N2NA 2E2AA 2H89A 3O1JA 3EDVA 3ONXA 2QRXA 1W0AA 4CI3B 2QYWA 3ZYLA 2PJQA 3RRCA 2LSIA 3FZLB 1XMQT 2XQ7A 1ZHCA 1MIWA 4DV1T 5HYAA 2ACZA 4A56A 2X0LB 4DV0T 4FI5A 4UF0A 3ZN0B 1N34T 3IA3A 3N2KE 2V6YB 4QXBB 4JI1T 3UUXB 4NXMT 3GMIA 3OYZA 4HFEA 2LLYA 3AEDA 2NOXA 2XQYA 2JMHA 4AISA 1W9RA 2ZM2A 4EYUA 1R8IA 2PBIA 3FXDB 2VKDA 2OV9A 4NUVA 2HH7A 3G06A 4UV8B 2V6YA 2YN6A 3RYCE 3QUJA 3ZMVB 3GWHA 2H3RA 2C5KT 3NZPA 2D9DA 3RKGA 5AQHB 3QB5A 3UU3A 5HEOA 4CZZB 2PTFA 2WY2A 3MK7C 3P4RA 4ZS3A 2V8SV 2CMRA 2HPJA 4YT0A 3ZJ1A 4EZHA 3VR9A 1NAFA 4ZI2D 1N32T 4X65T 3UT5E 2VKOA 3T1YT 3I9WA 3TLSA 1XNQT 3RI5A 4HWCA 5AQVB 5LGUB 3SFDA 4IE7A 1LVFA 2HPLA 5J2UE 1OEDA 2W66A 2C5JA 2JMKA 2KT9A 5L4HA 2W00A 3PDYA 3AA0B 2V5CA 4YTMA 3ESLA 5AQRB 1WYBA 1ZOYA 1VCTA 3FHNA 4O4IE 2UXNB 1AJ3A 2YDQA 2EHOD 1YKEB 4YSYA 2KWIB 4I55E 4JI6T 3RC8A 4LF8T 2MTQA 3HKEE 4U7IA 5FY0A 2X0YA 4JI0T 2CHOA 5AQFB 4GYSA 4JLEA 4GOUA 4HFHA 4QHOA 2EHOB 3DP7A 4KUMB 5AQSB 4TNWA 4EB6E 2IW5B 5JR9C 3LSVA 3K3NA 4U33A 3ZYKA 4TV8E 3PV0F 4UR9A 2LJLA 4JBWF 4Z91A 5BR8T 4DIDB 4PAGA 4DR5T 3P7IA 1YD8G 4IT4A 5FNVE 3CQXC 2PG8A 1MMNA 2EHOA 1G73A 2LOSA 3CWZB 1MMAA 4QH5A 5IUXA 2XM2A 4I50E 1WR0A 3ZT6A 4X1KE 4O4LE 2X67A 4CXXA 4U2YA 3AE8A 3VRAA 3RF1A 1I6ZA 2JQHA 5J2TE 2MBGA 3AA6B 3CVRA 4ZI7E 3PTRB 3JAFA 2I59A 4HGAA 4DV2T 5LMUT 5AQJB 3UUBA 1UX4A 2VL0A 3A5XA 5LYJE 3VRBA 4HFCA 3OTOT 3D0TA 2I6HA 2WWUA 3FBLA 3RRWA 5H6QB 3LDQB 3OBVE 2X0HA 2LT3A 4J2CA 5J0ZA 4DMVA 2K48A 3HL6A 4TV9E 2Y48B 4NXNT 4OK0A 2BS4A 2V7JA 4AQFC 3QK6A 5L3FB 5EK4A 3AE3A 1MIYA 4GKKT 4IL9A 4A5XA 4MALA 5AQQB 3S4UA 2J47A 5LJNA 5LHGB 4P1NA 3ZMUB 2MOZA 3RQUA 3IEEA 4XBFB 1E2AA 3ZC0A 3ETVA 1NENA 4ZEYA 5DQVA 3VU7H 2BKPA 2XY8B 3OVUA 1QLBA 1T7SA 4MHCA 5FYMA 5JR9B 2XAHB 1WR6A 2M67A 1CHUA 2ZM8A 3ZJ2A 5JDGA 2CLYB 3QOFA 3AE4A 4HWFA 1S35A 3B57A 4G63A 4CN6A 5ADXL 4IHJE 5DQWA 2RP4A 3FB2A 5LHIB 3ZT7A 4IE4A 5JDQA 1VRBA 3PU3A 4HFVA 5JR9A 4EYYR 1Z8UA 4IE6A 2CE7A 4DV5T 1XDOA 1YXRA 4B3MT 3PUYF 3K3QC 3RIAA 2XAGB 3CX8B 2CA5A 5AQIB 5IWAT 5AQOB 1LRZA 2YDSA 3KV9A 2XQAA 4AI6A 5LCYA 1HR0T 2IMLA 3EABA 4LF5T 4QWNB 1X9BA 5JH7E 2R6GF 2XM1A 4UVBB 4TN7B 2B1EA 4DVDA 4HKAA 4JI5T 3KBUA 4B3ST 5DJQC 3T8OA 4QH1A 3TKLB 2WSSV 2RPAA 4YFSA 4PJJA 4DR7T 3RX6A 1J1JA 4DNDA 3EAMA 4ILCA 2XPKA 4CXWA 4P0AA 3KVBA 3SS1A 3V5SA 3NZQA 2WCAA 3JAEA 5LGNB 4YJ3E 3A8YC 1BR4A 2XZEA 3L8RA 5AFUL 4KI0F 1HS7A 1M7KA 3K8PC 4AQFA 1WRDA 1OXZA 2V26A 4AXPA 5CJ5A 4U7YA 4I4TE 3FZHB 2IDOB 3PUXF 1HNXT 3RGLA 5FY1A 1HNWT 2BVLA 3N2GE 3P4SA 2XAJB 4HFDA 3PJAJ 2YU2A 3WAKA 3UU8A 2X66A 2N1GA 3RLFF 4Z8XA 2FJDA 2LM9A 4BA9A 4OYJA 1WCRA 4DR2T 2H88A 3ANWB 2EHOC 4YJ2E 2LEHA 4DR6T 1WFDA 5AQNB 2L8KA 2V6XA 2XHEB 3X1DA 3ZSTA 3NKZA 3EVYA 3I9YA 4ERRA 5L4EA 3P8CD 1US7B 3C4WA 2W61A 2NR4A 4ADZA 5FL0A 2WBLA 4HEAA 2CEAA 2W62A 1D1AA 3ANWA 2X9HA 2CBIA 2UXBT 2E5LT 5AQPB 3RPUA 5AQKB 3LJCA 3CQGB 5LOVE 3LFMA 4HE8A 1DU2A 3PJAA 2JQ9A 2VASA 3N9OA 2C5IT 3L09A 4DUZT 4IREA 1JNRA 4O4JE 4IGUA 4X1IE
chains in the Genus database with same CATH topology
3CX6B 5FNVE 3CQXC 2PG8A 1MMNA 4JEUB 1T98A 2EHOA 1G73A 3HKBE 2LOSA 1D0YA 3CWZB 3EDUA 3KBTA 1MMAA 2ODUA 1X79A 4BJMA 3UTKA 4E7ZA 2V7IA 3R84B 3DJBA 4UXNB 5JQGE 3CX7B 4I43B 4PJMA 3BK9A 2NWBA 4C91A 2LOPA 4H9RC 1BR2A 2KINB 5LA6E 1QUUA 4I50E 3UULA 1D1CA 1SA0E 5L2LA 1MIVA 3AAIA 3PUGA 3E08A 2WM9A 2W63A 4PK5A 4L9IA 3M65A 3W15B 2KWHA 4ISTA 3O4XE 3ZN1B 2NW9A 4X1KE 3CQCB 4O4LE 2Y8DA 4EZ4A 2X67A 2JRKA 3HR0A 3KDSE 1CUNA 4PJNA 4CXXA 5KX5E 5LG4A 2ACXA 2H7OA 3HKDE 5J2TE 2MBGA 3LK3B 3RKOA 2QGSA 3AA6B 4KMCA 4JUYA 3CVRA 4DMWA 3PTRB 4ZI7E 5JRCA 1D0ZA 2I59A 4HGAA 2E9XD 3C4XA 4WNKA 4N78D 4TUYE 3OYXA 1UX4A 2NW8A 3UUNA 1E1HB 4QKNA 3A5XA 4MLKA 5HWYA 5LYJE 3C98B 3D0TA 3IHRA 2WWUA 2V7MA 1Z0PA 2CXDA 4V1Av 4EOZB 1KK7A 5HXHA 3FBLA 3RRWA 4P09A 3N9QA 5LP6E 4CI1B 5H6QB 3O1IA 4MFRA 4WBNE 3LG7A 4IDZA 3FBZA 3OBVE 1MNDA 4AQGA 4FJOA 4O4HE 1O3XA 4AKGA 1U4QA 1OWAA 3C4ZA 2LT3A 3ZC1A 3NBXX 2L3LA 1UX5A 5FMNA 4WW0A 4J2CA 2VWAA 2E9XB 5LXTE 4X20E 4ISSA 2ES0A 3QC9A 4DMVA 5JREA 2K48A 5LBMA 4O2AE 2BVMA 2XAFB 3Q2MA 2Z6EA 5LHHB 4O8SA 2LSKA 5L3GB 2X9YA 4KP3C 4AKIA 2OA5A 3VKHA 3HL6A 4TV9E 1H7CA 2Y48B 1HCIA 4U74A 3RC3A 4M1PA 4DBRA 4OK0A 2JPFA 3ZMSB 4K0UA 4UVCB 1IJ5A 3MXZA 2V7JA 3AA1B 2GK9A 4AQFC 5F8PA 2KLQA 2YU1A 3QK6A 3RYHE 5L3FB 5EK4A 5DABA 4EAHA 3KV4A 3Q9DA 2DCFA 4PFPA 2IC6A 2J1DG 3FXEB 3JC6C 4EIWA 2D5UA 2DWKA 3N9PA 4PW8A 4CQIA 4OYKA 1MIYA 2D0TA 3H37A 3HA4A 2JJ9A 4U72A 2P9BA 2MYSA 2A3DA 2E9XA 2JQQA 3AVSA 3KV6A 5FXVA 4MALA 3S4UA 5HXRA 2VK9A 3RYFE 5LJNA 5LHGB 4ZOLE 3VKGA 4H9SE 2YINA 2CLYC 3NRXA 5FXZA 2X9WA 4CI2B 4PK6A 2W0GA 3ZMUB 5LNKA 2MOZA 3E22E 1HG5A 1WLXA 3GN5B 3IEEA 5EK3A 3ZCIA 4XBFB 3HI2A 3F57A 5HXEA 5JDNA 3MJXA 3ZC0A 3ETVA 1HG2A 1HX8A 3ZMZB 1EZ3A 3PUSA 5FXXA 2CXFA 1G8XA 2ZLYA 2BZBA 5DQVA 3VU7H 3VHLA 3UUMA 5J1GA 4CXYA 5CB4E 2NW7A 2WAUA 3KVAA 2X68A 3V5UA 4UEMA 5L3DB 3KV5A 2CM0A 2L9QA 4ILUA 2V1DB 4MHCA 5FYMA 5JR9B 2XAHB 2XASB 3KINB 4AKHA 1WR6A 2M67A 1UCUA 2ZM8A 3ZJ2A 2WMNA 5JDGA 2CLYB 3MACA 2A72A 1YW0A 5HXCA 4ZI3C 5A1LA 3O9XA 4QXHB 5IHYA 3H3AA 5L3CB 4G2AA 3BQIA 1S35A 5F3JA 1HTJF 3J7Yq 3GN5A 1B7TA 3B13A 1QSDA 4F6RC 2DHRA 2YEVC 3B57A 3LBXB 1NWMX 5M4YA 4ZI2C 4G63A 4IE0A 5ADXL 4IHJE 2Q9QC 2CWYA 4H9NC 2RP4A 2WMOA 5DQWA 3NRYA 4OHFA 4ASKA 5C8YE 1MMGA 2KZ7B 3FB2A 2K24A 3DTOA 3Q5XA 2YK0A 4HTEA 5FY7A 5LHIB 2LSJA 4IE4A 4X1YE 2LHRA 3WAJA 4P0BA 5JDQA 1VRBA 3PU3A 4HFVA 5JR9A 4EYYR 3I0QA 3ZCJA 4UF0B 3CKDA 4PFOA 5KMGP 3C64A 4H63H 4IE6A 2CE7A 2N2NA 5GONE 2CXLA 2VL8A 3O1JA 3EDVA 3E0ZA 3ONXA 4CI3B 3ZYLA 2PJQA 3K3QC 4YLHA 3RRCA 2LSIA 2XAGB 5JDMA 3CX8B 3IF8B 1ZHCA 2CA5A 3ZYMA 2D0UA 2IC9A 5HWXA 1MIWA 5HYAA 1LRZA 2X51A 3KV9A 1HF8A 4AI6A 4A56A 5LCYA 3UFEA 2X0LB 1ZKEA 1MMDA 3I0OA 3F2EA 4QWNB 1LKXA 4EXTA 1S94A 3MKDA 2ZM0A 3WI3A 4FI5A 4UF0A 3RH3A 1FEWA 3ZN0B 1YKHB 5JH7E 4H63V 3PUQA 5EZYE 3LK42 4UVBB 4H9QC 3MA9A 4YHJA 3BQKA 4TN7B 5L3EB 2B1EA 3ETUA 2Y6XA 3N2KE 5ETWA 4DBQA 3OKQA 4QXBB 4DVDA 4UVAB 3UUXB 2CCQA 4HKAA 3GMIA 3SRZA 4B6XA 3JC6D 3OYZA 4O2BE 3ZMTB 3AB3B 4UV9B 3KBUA 4GIWA 2NOXA 5H6RB 5DJQC 3ZEFB 3T8OA 2K9AA 2XQYA 2VB6A 3TKLB 2JMHA 4QXCB 2WSSV 3ZPOA 4YFSA 3CPZA 1V9DA 4PJJA 2ZM2A 4EYUA 3RX6A 2PBIA 1BR1A 2KXPB 3FXDB 2K5BB 2NP9A 3RYIE 5CA0E 2VKDA 4DNDA 2PFVA 5JVDE 4NUVA 5IYZE 4WBOA 2HH7A 4CXWA 4P0AA 4UV8B 1IAPA 3KVBA 4GK0E 4PJLA 4KBMB 3BQLA 4BJNA 3RYCE 2XTLA 2SPCA 3SS1A 3QUJA 1MNEA 3V5SA 3GWHA 3NZQA 3ZMVB 3F31A 2H3RA 3PURA 2C5KT 3N5LA 2BDEA 3N2OA 3AA7B 5LGNB 3R6NA 2ZMAA 2LE8A 4YJ3E 1FMWA 3NZPA 3GA8A 1BR4A 3Q5WA 5HXSA 2XUEA 2A2FX 4CZZB 2CWOA 1WYCA 3KFWX 5JRCB 2G0UA 5AFUL 3MK7C 1IZNB 4UELA 3N9MA 4ZHQE 4L0RA 4ZS3A 4ZI3D 1HS7A 2CMRA 2HPJA 4AKLA 3ZJ1A 4UIGA 2DWGA 4EZHA 3K8PC 1WRDA 1OXZA 1NAFA 2V7LA 4GK5E 4AQFA 2V26A 4IIJE 2NTYA 5FP3A 5HAXA 1ZV4X 4AXPA 5KDMC 1FIOA 4E7SA 3O1HA 3OJAA 3CMLA 4ZI2D 5JDFA 3AAAB 4H9OC 1VOMA 3UT5E 1D1BA 2LSGA 2VKOA 2Q9QD 2H7VC 4I4TE 1Y64B 2LHNA 3I9WA 3PE0A 5LJMA 4TZ4C 4H9PC 2UXXB 5FY1A 5L3BB 5LGUB 1BR0A 2BVLA 4PK4A 4IE7A 1LVFA 3EUHA 5E0OA 3N2GE 4IE5A 2HPLA 1FMVA 2E9XC 5J2UE 2XAJB 4MBQA 3HKCE 5JDHA 4NUUA 2C5JA 1LVKA 2JMKA 1U5PA 1IJ6A 2QA7A 2YU2A 2KT9A 2W00A 2D2SA 2KNDA 3LBXA 4XZCA 1ZEEA 2C0SA 3WAKA 2Q9QB 5CA1E 4ZS2A 2DI4A 2X66A 2N1GA 3PDYA 3AA0B 3K3OA 4HN9A 4Z8XA 3PU8A 2LM9A 4BA9A 4OYJA 3ESLA 3ANWB 2ODVA 1WYBA 2EHOC 4YJ2E 3FHNA 3N9LA 2LEHA 4O4IE 2UXNB 3AVRA 1AJ3A 5LBQB 2EHOD 1YKEB 2KWIB 4I55E 2N9DA 4DO0A 5JDLA 1D0XA 2VKHA 4X1IE 3SOLA 3I1AA 3RC8A 2L8KA 2MTQA 2XHEB 3MZKB 3HKEE 3EVYA 4AKRB 3C50A 3I9YA 3C51A 4ERRA 2E8IA 5FY0A 4GYRA 3P8CD 1US7B 3C4WA 3U3IA 3U78A 2XAQB 2VKJA 2W61A 2X9XA 4L5GA 4QX8B 2LSYA 4ADZA 2Q9QA 2WBLA 4GYSA 4ANJA 4JLEA 4HEAA 2NTXA 4TX5A 2CEAA 5TAOA 3SWHA 4GOUA 1KNZA 2W62A 4QHOA 2EHOB 3J9X1 3DP7A 5BMVE 1D1AA 2DLRA 2RA1A 3PUAA 3ANWA 4JEHB 3AAEB 2X9HA 4QX7B 3ZLIA 2KMFA 5EK2A 4KUMB 3RPUA 4EB6E 3LJCA 3CQGB 5LOVE 3L3PA 2IW5B 3LFMA 5JR9C 4HE8A 3K3NA 3ZYKA 4TV8E 3LK2B 2IAKA 2LJLA 1HFAA 2VASA 3IBPA 4BAYB 5LGTB 3N9OA 2C5IT 2DNXA 3L09A 4PAGA 3N9NA 1SHZC 4C90A 5FXWA 3P7IA 4O4JE 4XAXB 1YD8G 4IGUA 4OFZA 4PNIA 2V7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J9X 1;  3FBZ A;  3FBL A;  3F2E A; 
#chains in the Genus database with same CATH topology
 3CX6 B;  4EED A;  2B76 A;  2WB5 A;  2JQK A;  2ODU A;  1X79 A;  3UTK A;  4Q25 A;  3R84 B;  3UQ4 A;  4I43 B;  4PJM A;  3BK9 A;  2LOP A;  2KIN B;  5L2L A;  3AEF A;  4YTP A;  3W15 B;  3M65 A;  4JYA T;  2NW9 A;  3CQC B;  5FKY A;  2Y8D A;  5HCM A;  4EZ4 A;  3HR0 A;  5KX5 E;  2UUB T;  2H7O A;  3LK3 B;  2QGS A;  4DMW A;  2BBJ A;  2WDV A;  4MLK A;  5HWY A;  4I0U A;  4CN1 A;  4V1A v;  4EOZ B;  2VQE T;  4P09 A;  3N9Q A;  4MFR A;  2V5D A;  4TWD A;  1T8B A;  3EHZ A;  4AQG A;  4X5T A;  1O3X A;  5L47 A;  4AKG A;  1OWA A;  3C4Z A;  4U31 A;  2L3L A;  5FMN A;  4WW0 A;  4YSZ A;  2VWA A;  5LXT E;  4ISS A;  2ES0 A;  3Q2M A;  2XAF B;  4O8S A;  4LMJ A;  2X9Y A;  4KP3 C;  4DUY T;  4DV7 T;  4LF4 T;  2YKS A;  1HCI A;  1E7P A;  3ZMS B;  3Q5E A;  4K0U A;  3AA1 B;  3RYH E;  2IC6 A;  2J1D G;  3JC6 C;  4EIW A;  2CPT A;  2D5U A;  2DWK A;  4PW8 A;  4OYK A;  2D0T A;  4U72 A;  4IDO A;  2A3D A;  3KV6 A;  3VKG A;  2YIN A;  2CLY C;  5EK3 A;  5AQM B;  5JDN A;  2WS3 A;  3MJX A;  1HG2 A;  3ZMZ B;  3PUS A;  5FXX A;  3PUV F;  4CXY A;  5AQG B;  3KVA A;  2X68 A;  2MAW A;  5L3D B;  3KV5 A;  2L9Q A;  2M6I A;  2V1D B;  2XAS B;  4ILB A;  2WU2 A;  1UCU A;  5C3J A;  3MAC A;  1J5E T;  4ZI3 C;  4QXH B;  5IHY A;  2UU9 T;  3H3A A;  5L3C B;  4G2A A;  3B13 A;  4F6R C;  2YEV C;  3LBX B;  2Q9Q C;  4OHF A;  5C8Y E;  3RIF A;  3DTO A;  5FY7 A;  4A98 A;  1NEK A;  4ZZB A;  2BS3 A;  1UUR A;  3I0Q A;  3CKD A;  3UU4 A;  3C64 A;  2CXL A;  2VL8 A;  5JDM A;  3ZYM A;  2IHR 1;  5HEJ A;  2IC9 A;  4LFC T;  1HF8 A;  3UFE A;  3ONJ A;  1ZKE A;  1MMD A;  4LML A;  3I0O A;  1UUS A;  4U3C A;  1S94 A;  3MKD A;  3WI3 A;  3ZKR A;  2WQY A;  3RH3 A;  2J62 A;  4H63 V;  2HN2 A;  2WDQ A;  5L3E B;  4YHJ A;  3BQK A;  3ETU A;  3TLV A;  4DBQ A;  3OKQ A;  4B6X A;  3JC6 D;  3ZMT B;  3AB3 B;  5CFB A;  2WZH A;  4UV9 B;  5AQL B;  4GIW A;  2K9A A;  4HFI A;  1V9D A;  1BR1 A;  2KXP B;  2NP9 A;  3RYI E;  5CA0 E;  1IAP A;  4GK0 E;  4BJN A;  1MNE A;  2LKG A;  3N5L A;  3AA7 B;  5KXJ A;  2FBW A;  1FMW A;  3PUZ F;  3Q5W A;  5HXS A;  2CWO A;  4X64 T;  5JRC B;  4UEL A;  4ZI3 D;  3P4Q A;  2V7L A;  4GK5 E;  4IIJ E;  2NTY A;  5C2T A;  1ZV4 X;  5KDM C;  4E7S A;  3RIU C;  4COF A;  2QVA A;  5JDF A;  3AAA B;  4H9O C;  4X66 T;  2Q9Q D;  2H7V C;  2XQ3 A;  5LJM A;  4TZ4 C;  4H9P C;  1BR0 A;  4PK4 A;  3EUH A;  1FMV A;  2E9X C;  2FUP A;  4MBQ A;  3HKC E;  4YTN A;  5ABE A;  5JDH A;  4NUU A;  1LVK A;  2IUB A;  2QA7 A;  2D2S A;  1ZEE A;  2C0S A;  2Q9Q B;  3AE9 A;  3PU8 A;  4LF6 T;  3N9L A;  3AVR A;  5ABF B;  5LBQ B;  3UU5 A;  2CRB A;  2N9D A;  2K3W A;  4DO0 A;  5JDL A;  1YQ3 A;  3SOL A;  3I1A A;  1W09 A;  3C50 A;  3U3I A;  2UXD T;  3U78 A;  2XAQ B;  2VKJ A;  2X9X A;  4L5G A;  4QX8 B;  2Q9Q A;  4ANJ A;  5HCJ A;  3AEG A;  2XQ8 A;  3K1S A;  4LMK A;  3SWH A;  1KNZ A;  2WP9 A;  4F8H A;  2RA1 A;  3PUA A;  4JEH B;  2IIU A;  3AAE B;  3ZLI A;  3H3M A;  2KMF A;  5EK2 A;  1ZP0 A;  3SFE A;  2HN1 A;  3L3P A;  3LK2 B;  3IBP A;  5LGT B;  4BAY B;  2DNX A;  2VUR A;  4C90 A;  5FXW A;  4EGW A;  4XAX B;  4PNI A;  4PJL A;  2V7K A;  4JEU B;  4ZZC A;  1XWM A;  3EDU A;  3KBT A;  4BJM A;  4E7Z A;  2V7I A;  2FJE A;  3DJB A;  2FJA A;  2NWB A;  4C91 A;  4H9R C;  4WZX A;  5LA6 E;  1QUU A;  1D1C A;  5CGM A;  3AAI A;  3PUG A;  5HEU A;  2WM9 A;  4PK5 A;  4L9I A;  4IST A;  2JIW A;  4GKJ T;  4YXD A;  2WZI A;  4JI3 T;  2JRK A;  4X62 T;  5LG4 A;  1CUN A;  4PJN A;  2ACX A;  3HKD E;  4EEB A;  4KMC A;  4JUY A;  2CHN A;  4LFA T;  2LRK A;  4B3T T;  5ABH A;  2E9X D;  4HFB A;  4DV6 T;  4N78 D;  3TLW A;  2NW8 A;  1E1H B;  4JI8 T;  4YSX A;  4EV6 A;  4ILA A;  2VQF T;  1Z0P A;  2CXD A;  5HXH A;  4CI1 B;  4WBN E;  3LG7 A;  4IDZ A;  3M3Z B;  4O4H E;  3NBX X;  1UX5 A;  2E9X B;  5F5W A;  5JRE A;  2UUA T;  4O2A E;  2BVM A;  2Z6E A;  4TNV A;  5FL1 A;  3AE1 A;  4WYV A;  3NVO A;  3RHW A;  5L3G B;  4AKI A;  2OA5 A;  2XQ9 A;  3VKH A;  1H7C A;  4HWH A;  3FZF B;  3RIU A;  4M1P A;  2JPF A;  5F8P A;  2KLQ A;  3QB5 K;  4EAH A;  3Q9D A;  2DCF A;  3FXE B;  3N9P A;  3H37 A;  2P9B A;  2E9X A;  2JQQ A;  3AVS A;  1SE7 A;  5FXV A;  3UU6 A;  5HXR A;  3RYF E;  4JV5 T;  2M6B A;  4ZOL E;  4DR4 T;  5FXZ A;  4PK6 A;  5LNK A;  3E22 E;  1HG5 A;  1WLX A;  3GN5 B;  3HI2 A;  4YY3 T;  3F57 A;  2DL1 A;  1KEY A;  1HX8 A;  1EZ3 A;  2BZB A;  3VHL A;  3UUM A;  3CIR A;  2NW7 A;  3P50 A;  3AEC A;  4UEM A;  4YHH T;  1VCS A;  4AKH A;  3KIN B;  4NPP A;  1YW0 A;  5A1L A;  2WU5 A;  3O9X A;  1OED B;  2XSB A;  1N33 T;  1UGO A;  5F3J A;  3J7Y q;  3GN5 A;  1NWM X;  2KSR A;  2I0M A;  4IE0 A;  3A7M A;  1IBK T;  3NRY A;  5LMN T;  1MMG A;  2K24 A;  5AQT B;  2LSJ A;  4OX9 T;  2F4V T;  3WAJ A;  4P0B A;  3ZCJ A;  5KMG P;  4H63 H;  5GON E;  3L39 A;  3E0Z A;  3P4W A;  4YLH A;  3IF8 B;  2D0U A;  5HWX A;  2X51 A;  4LF9 T;  2E5V A;  2BBH A;  3AEB A;  3F2E A;  1LKX A;  4EXT A;  2A9U A;  5LB7 B;  2ZM0 A;  5ABG A;  3AE7 A;  1FEW A;  4IDN A;  4Z90 A;  1YKH B;  3PUQ A;  5EZY E;  3LK4 2;  4H9Q C;  3MA9 A;  4IDQ A;  4DR1 T;  2Y6X A;  5ETW A;  2YDR A;  4UVA B;  2CCQ A;  3AEA A;  3SRZ A;  1Y01 A;  4O2B E;  3RQW A;  1FJG T;  5HEG A;  5H6R B;  3ZEF B;  5JTG A;  2VB6 A;  4QXC B;  1N36 T;  3ZPO A;  3CPZ A;  1KNR A;  2K5B B;  2PFV A;  5JVD E;  5IYZ E;  4WBO A;  2BG9 C;  1XNR T;  1HX1 B;  4KBM B;  2W2U A;  3BQL A;  2XTL A;  2SPC A;  4A97 A;  3F31 A;  2AE9 A;  3PUR A;  2BDE A;  3N2O A;  3AE2 A;  3R6N A;  2ZMA A;  2LE8 A;  3AE5 A;  3GA8 A;  2XUE A;  2A2F X;  3Q5D A;  1WYC A;  3KFW X;  2G0U A;  1IZN B;  2BKO A;  3N9M A;  4ZHQ E;  4L0R A;  2HHH T;  4AKL A;  4UIG A;  2DWG A;  3TLT A;  5FP3 A;  5HAX A;  1FIO A;  3O1H A;  3OJA A;  3CML A;  4DR3 T;  1I94 T;  3ZSS A;  1VOM A;  3ABV A;  1D1B A;  2LSG A;  2BG9 E;  1Y64 B;  1SUM B;  2LHN A;  3PE0 A;  2WDR A;  3QNU A;  4JI7 T;  2UXX B;  5L3B B;  5E0O A;  4IE5 A;  4AIU A;  1U5P A;  1IJ6 A;  3P4P A;  1KNP A;  2KND A;  3LBX A;  4XZC A;  4DV4 T;  5CA1 E;  4ZS2 A;  2DI4 A;  1YQ4 A;  3PUW F;  1XDP A;  3K3O A;  4HN9 A;  1L0V A;  2ODV A;  4B3R T;  3T1H T;  1D0X A;  2VKH A;  2BS2 A;  2BKN A;  4KX6 A;  1XMO T;  2UUC T;  3MZK B;  3CK6 A;  4AKR B;  2AXD S;  2VVS A;  3C51 A;  2E8I A;  4DV3 T;  5LG3 A;  4GYR A;  5FVL A;  2LSY A;  3EI0 A;  2W4X A;  1KF6 A;  2NTX A;  4TX5 A;  5TAO A;  3AXJ B;  3J9X 1;  5BMV E;  4JI2 T;  2DLR A;  3OPC A;  4QX7 B;  4QH4 A;  1UK5 A;  4HWD A;  3AEE A;  2ZM6 T;  4KHP T;  2XQ4 A;  2IAK A;  1HFA A;  3FZK B;  3N9N A;  1SHZ C;  3JCF A;  2WWV A;  2XJ7 A;  4OFZ A;  2J4G A;  3AXJ A;  1T98 A;  3HKB E;  1D0Y A;  2W67 A;  4UXN B;  5JQG E;  3ZT5 A;  3CX7 B;  2BG9 B;  5AQU B;  1BR2 A;  1T72 A;  2XSA A;  3UUL A;  1SA0 E;  1MIV A;  4ZXL A;  3E08 A;  3JAD A;  2W63 A;  1GQE A;  2KWH A;  2MPK A;  3O4X E;  3ZN1 B;  2CBJ A;  4IL4 A;  4NIQ A;  3KDS E;  1JNZ A;  2XQ6 A;  3RKO A;  2YOE A;  5JRC A;  1D0Z A;  3C4X A;  4WNK A;  4TUY E;  3OYX A;  2FJB A;  3UUN A;  4QKN A;  2BG9 A;  1IBL T;  3C98 B;  3IHR A;  3AE6 A;  2V7M A;  1KK7 A;  1W0B A;  5LP6 E;  3O1I A;  3FBZ A;  2XQ5 A;  1MND A;  4FJO A;  1U4Q A;  3ONL C;  3ZC1 A;  5FVK A;  4X20 E;  3QC9 A;  3TLU A;  4HWI B;  5LBM A;  5LHH B;  2LSK A;  4JI4 T;  4CN4 A;  1J5W A;  2LKH A;  1KFY A;  4U74 A;  3RC3 A;  4DBR A;  4UVC B;  1IJ5 A;  3MXZ A;  2GK9 A;  4IDP A;  2YU1 A;  5DAB A;  3FZM B;  3KV4 A;  2LRL A;  4PFP A;  4CQI A;  4TWH A;  5ABF A;  2LM2 A;  3HA4 A;  2JJ9 A;  2MYS A;  1HNZ T;  2VK9 A;  4H9S E;  3UQ7 A;  3NRX A;  2X9W A;  4CI2 B;  2W0G A;  1OED C;  3ZCI A;  5HXE A;  3NWI A;  2CXF A;  1G8X A;  2ZLY A;  5J1G A;  5CB4 E;  2WAU A;  5HEH A;  3V5U A;  4AQY T;  2CM0 A;  4ILU A;  1IBM T;  2UXC T;  2OLT A;  3VR8 A;  3B5M A;  2WMN A;  4LFB T;  2A72 A;  5HXC A;  4TWF A;  3BQI A;  3UFG A;  1HTJ F;  4KHZ F;  1B7T A;  1QSD A;  2DHR A;  2VVN A;  5M4Y A;  4ZI2 C;  1OED E;  4ASK A;  2CWY A;  4H9N C;  1M62 A;  2WMO A;  1XZY A;  2KZ7 B;  3Q5X A;  4HTE A;  2YK0 A;  4X1Y E;  2LHR A;  4UF0 B;  4U2Z A;  4PFO A;  4K0K T;  4LF7 T;  2N2N A;  2E2A A;  2H89 A;  3O1J A;  3EDV A;  3ONX A;  2QRX A;  1W0A A;  4CI3 B;  2QYW A;  3ZYL A;  2PJQ A;  3RRC A;  2LSI A;  3FZL B;  1XMQ T;  2XQ7 A;  1ZHC A;  1MIW A;  4DV1 T;  5HYA A;  2ACZ A;  4A56 A;  2X0L B;  4DV0 T;  4FI5 A;  4UF0 A;  3ZN0 B;  1N34 T;  3IA3 A;  3N2K E;  2V6Y B;  4QXB B;  4JI1 T;  3UUX B;  4NXM T;  3GMI A;  3OYZ A;  4HFE A;  2LLY A;  3AED A;  2NOX A;  2XQY A;  2JMH A;  4AIS A;  1W9R A;  2ZM2 A;  4EYU A;  1R8I A;  2PBI A;  3FXD B;  2VKD A;  2OV9 A;  4NUV A;  2HH7 A;  3G06 A;  4UV8 B;  2V6Y A;  2YN6 A;  3RYC E;  3QUJ A;  3ZMV B;  3GWH A;  2H3R A;  2C5K T;  3NZP A;  2D9D A;  3RKG A;  5AQH B;  3QB5 A;  3UU3 A;  5HEO A;  4CZZ B;  2PTF A;  2WY2 A;  3MK7 C;  3P4R A;  4ZS3 A;  2V8S V;  2CMR A;  2HPJ A;  4YT0 A;  3ZJ1 A;  4EZH A;  3VR9 A;  1NAF A;  4ZI2 D;  1N32 T;  4X65 T;  3UT5 E;  2VKO A;  3T1Y T;  3I9W A;  3TLS A;  1XNQ T;  3RI5 A;  4HWC A;  5AQV B;  5LGU B;  3SFD A;  4IE7 A;  1LVF A;  2HPL A;  5J2U E;  1OED A;  2W66 A;  2C5J A;  2JMK A;  2KT9 A;  5L4H A;  2W00 A;  3PDY A;  3AA0 B;  2V5C A;  4YTM A;  3ESL A;  5AQR B;  1WYB A;  1ZOY A;  1VCT A;  3FHN A;  4O4I E;  2UXN B;  1AJ3 A;  2YDQ A;  2EHO D;  1YKE B;  4YSY A;  2KWI B;  4I55 E;  4JI6 T;  3RC8 A;  4LF8 T;  2MTQ A;  3HKE E;  4U7I A;  5FY0 A;  2X0Y A;  4JI0 T;  2CHO A;  5AQF B;  4GYS A;  4JLE A;  4GOU A;  4HFH A;  4QHO A;  2EHO B;  3DP7 A;  4KUM B;  5AQS B;  4TNW A;  4EB6 E;  2IW5 B;  5JR9 C;  3LSV A;  3K3N A;  4U33 A;  3ZYK A;  4TV8 E;  3PV0 F;  4UR9 A;  2LJL A;  4JBW F;  4Z91 A;  5BR8 T;  4DID B;  4PAG A;  4DR5 T;  3P7I A;  1YD8 G;  4IT4 A;  5FNV E;  3CQX C;  2PG8 A;  1MMN A;  2EHO A;  1G73 A;  2LOS A;  3CWZ B;  1MMA A;  4QH5 A;  5IUX A;  2XM2 A;  4I50 E;  1WR0 A;  3ZT6 A;  4X1K E;  4O4L E;  2X67 A;  4CXX A;  4U2Y A;  3AE8 A;  3VRA A;  3RF1 A;  1I6Z A;  2JQH A;  5J2T E;  2MBG A;  3AA6 B;  3CVR A;  4ZI7 E;  3PTR B;  3JAF A;  2I59 A;  4HGA A;  4DV2 T;  5LMU T;  5AQJ B;  3UUB A;  1UX4 A;  2VL0 A;  3A5X A;  5LYJ E;  3VRB A;  4HFC A;  3OTO T;  3D0T A;  2I6H A;  2WWU A;  3FBL A;  3RRW A;  5H6Q B;  3LDQ B;  3OBV E;  2X0H A;  2LT3 A;  4J2C A;  5J0Z A;  4DMV A;  2K48 A;  3HL6 A;  4TV9 E;  2Y48 B;  4NXN T;  4OK0 A;  2BS4 A;  2V7J A;  4AQF C;  3QK6 A;  5L3F B;  5EK4 A;  3AE3 A;  1MIY A;  4GKK T;  4IL9 A;  4A5X A;  4MAL A;  5AQQ B;  3S4U A;  2J47 A;  5LJN A;  5LHG B;  4P1N A;  3ZMU B;  2MOZ A;  3RQU A;  3IEE A;  4XBF B;  1E2A A;  3ZC0 A;  3ETV A;  1NEN A;  4ZEY A;  5DQV A;  3VU7 H;  2BKP A;  2XY8 B;  3OVU A;  1QLB A;  1T7S A;  4MHC A;  5FYM A;  5JR9 B;  2XAH B;  1WR6 A;  2M67 A;  1CHU A;  2ZM8 A;  3ZJ2 A;  5JDG A;  2CLY B;  3QOF A;  3AE4 A;  4HWF A;  1S35 A;  3B57 A;  4G63 A;  4CN6 A;  5ADX L;  4IHJ E;  5DQW A;  2RP4 A;  3FB2 A;  5LHI B;  3ZT7 A;  4IE4 A;  5JDQ A;  1VRB A;  3PU3 A;  4HFV A;  5JR9 A;  4EYY R;  1Z8U A;  4IE6 A;  2CE7 A;  4DV5 T;  1XDO A;  1YXR A;  4B3M T;  3PUY F;  3K3Q C;  3RIA A;  2XAG B;  3CX8 B;  2CA5 A;  5AQI B;  5IWA T;  5AQO B;  1LRZ A;  2YDS A;  3KV9 A;  2XQA A;  4AI6 A;  5LCY A;  1HR0 T;  2IML A;  3EAB A;  4LF5 T;  4QWN B;  1X9B A;  5JH7 E;  2R6G F;  2XM1 A;  4UVB B;  4TN7 B;  2B1E A;  4DVD A;  4HKA A;  4JI5 T;  3KBU A;  4B3S T;  5DJQ C;  3T8O A;  4QH1 A;  3TKL B;  2WSS V;  2RPA A;  4YFS A;  4PJJ A;  4DR7 T;  3RX6 A;  1J1J A;  4DND A;  3EAM A;  4ILC A;  2XPK A;  4CXW A;  4P0A A;  3KVB A;  3SS1 A;  3V5S A;  3NZQ A;  2WCA A;  3JAE A;  5LGN B;  4YJ3 E;  3A8Y C;  1BR4 A;  2XZE A;  3L8R A;  5AFU L;  4KI0 F;  1HS7 A;  1M7K A;  3K8P C;  4AQF A;  1WRD A;  1OXZ A;  2V26 A;  4AXP A;  5CJ5 A;  4U7Y A;  4I4T E;  3FZH B;  2IDO B;  3PUX F;  1HNX T;  3RGL A;  5FY1 A;  1HNW T;  2BVL A;  3N2G E;  3P4S A;  2XAJ B;  4HFD A;  3PJA J;  2YU2 A;  3WAK A;  3UU8 A;  2X66 A;  2N1G A;  3RLF F;  4Z8X A;  2FJD A;  2LM9 A;  4BA9 A;  4OYJ A;  1WCR A;  4DR2 T;  2H88 A;  3ANW B;  2EHO C;  4YJ2 E;  2LEH A;  4DR6 T;  1WFD A;  5AQN B;  2L8K A;  2V6X A;  2XHE B;  3X1D A;  3ZST A;  3NKZ A;  3EVY A;  3I9Y A;  4ERR A;  5L4E A;  3P8C D;  1US7 B;  3C4W A;  2W61 A;  2NR4 A;  4ADZ A;  5FL0 A;  2WBL A;  4HEA A;  2CEA A;  2W62 A;  1D1A A;  3ANW A;  2X9H A;  2CBI A;  2UXB T;  2E5L T;  5AQP B;  3RPU A;  5AQK B;  3LJC A;  3CQG B;  5LOV E;  3LFM A;  4HE8 A;  1DU2 A;  3PJA A;  2JQ9 A;  2VAS A;  3N9O A;  2C5I T;  3L09 A;  4DUZ T;  4IRE A;  1JNR A;  4O4J E;  4IGU A;  4X1I E; 
#chains in the Genus database with same CATH homology
 3CX6 B;  5FNV E;  3CQX C;  2PG8 A;  1MMN A;  4JEU B;  1T98 A;  2EHO A;  1G73 A;  3HKB E;  2LOS A;  1D0Y A;  3CWZ B;  3EDU A;  3KBT A;  1MMA A;  2ODU A;  1X79 A;  4BJM A;  3UTK A;  4E7Z A;  2V7I A;  3R84 B;  3DJB A;  4UXN B;  5JQG E;  3CX7 B;  4I43 B;  4PJM A;  3BK9 A;  2NWB A;  4C91 A;  2LOP A;  4H9R C;  1BR2 A;  2KIN B;  5LA6 E;  1QUU A;  4I50 E;  3UUL A;  1D1C A;  1SA0 E;  5L2L A;  1MIV A;  3AAI A;  3PUG A;  3E08 A;  2WM9 A;  2W63 A;  4PK5 A;  4L9I A;  3M65 A;  3W15 B;  2KWH A;  4IST A;  3O4X E;  3ZN1 B;  2NW9 A;  4X1K E;  3CQC B;  4O4L E;  2Y8D A;  4EZ4 A;  2X67 A;  2JRK A;  3HR0 A;  3KDS E;  1CUN A;  4PJN A;  4CXX A;  5KX5 E;  5LG4 A;  2ACX A;  2H7O A;  3HKD E;  5J2T E;  2MBG A;  3LK3 B;  3RKO A;  2QGS A;  3AA6 B;  4KMC A;  4JUY A;  3CVR A;  4DMW A;  3PTR B;  4ZI7 E;  5JRC A;  1D0Z A;  2I59 A;  4HGA A;  2E9X D;  3C4X A;  4WNK A;  4N78 D;  4TUY E;  3OYX A;  1UX4 A;  2NW8 A;  3UUN A;  1E1H B;  4QKN A;  3A5X A;  4MLK A;  5HWY A;  5LYJ E;  3C98 B;  3D0T A;  3IHR A;  2WWU A;  2V7M A;  1Z0P A;  2CXD A;  4V1A v;  4EOZ B;  1KK7 A;  5HXH A;  3FBL A;  3RRW A;  4P09 A;  3N9Q A;  5LP6 E;  4CI1 B;  5H6Q B;  3O1I A;  4MFR A;  4WBN E;  3LG7 A;  4IDZ A;  3FBZ A;  3OBV E;  1MND A;  4AQG A;  4FJO A;  4O4H E;  1O3X A;  4AKG A;  1U4Q A;  1OWA A;  3C4Z A;  2LT3 A;  3ZC1 A;  3NBX X;  2L3L A;  1UX5 A;  5FMN A;  4WW0 A;  4J2C A;  2VWA A;  2E9X B;  5LXT E;  4X20 E;  4ISS A;  2ES0 A;  3QC9 A;  4DMV A;  5JRE A;  2K48 A;  5LBM A;  4O2A E;  2BVM A;  2XAF B;  3Q2M A;  2Z6E A;  5LHH B;  4O8S A;  2LSK A;  5L3G B;  2X9Y A;  4KP3 C;  4AKI A;  2OA5 A;  3VKH A;  3HL6 A;  4TV9 E;  1H7C A;  2Y48 B;  1HCI A;  4U74 A;  3RC3 A;  4M1P A;  4DBR A;  4OK0 A;  2JPF A;  3ZMS B;  4K0U A;  4UVC B;  1IJ5 A;  3MXZ A;  2V7J A;  3AA1 B;  2GK9 A;  4AQF C;  5F8P A;  2KLQ A;  2YU1 A;  3QK6 A;  3RYH E;  5L3F B;  5EK4 A;  5DAB A;  4EAH A;  3KV4 A;  3Q9D A;  2DCF A;  4PFP A;  2IC6 A;  2J1D G;  3FXE B;  3JC6 C;  4EIW A;  2D5U A;  2DWK A;  3N9P A;  4PW8 A;  4CQI A;  4OYK A;  1MIY A;  2D0T A;  3H37 A;  3HA4 A;  2JJ9 A;  4U72 A;  2P9B A;  2MYS A;  2A3D A;  2E9X A;  2JQQ A;  3AVS A;  3KV6 A;  5FXV A;  4MAL A;  3S4U A;  5HXR A;  2VK9 A;  3RYF E;  5LJN A;  5LHG B;  4ZOL E;  3VKG A;  4H9S E;  2YIN A;  2CLY C;  3NRX A;  5FXZ A;  2X9W A;  4CI2 B;  4PK6 A;  2W0G A;  3ZMU B;  5LNK A;  2MOZ A;  3E22 E;  1HG5 A;  1WLX A;  3GN5 B;  3IEE A;  5EK3 A;  3ZCI A;  4XBF B;  3HI2 A;  3F57 A;  5HXE A;  5JDN A;  3MJX A;  3ZC0 A;  3ETV A;  1HG2 A;  1HX8 A;  3ZMZ B;  1EZ3 A;  3PUS A;  5FXX A;  2CXF A;  1G8X A;  2ZLY A;  2BZB A;  5DQV A;  3VU7 H;  3VHL A;  3UUM A;  5J1G A;  4CXY A;  5CB4 E;  2NW7 A;  2WAU A;  3KVA A;  2X68 A;  3V5U A;  4UEM A;  5L3D B;  3KV5 A;  2CM0 A;  2L9Q A;  4ILU A;  2V1D B;  4MHC A;  5FYM A;  5JR9 B;  2XAH B;  2XAS B;  3KIN B;  4AKH A;  1WR6 A;  2M67 A;  1UCU A;  2ZM8 A;  3ZJ2 A;  2WMN A;  5JDG A;  2CLY B;  3MAC A;  2A72 A;  1YW0 A;  5HXC A;  4ZI3 C;  5A1L A;  3O9X A;  4QXH B;  5IHY A;  3H3A A;  5L3C B;  4G2A A;  3BQI A;  1S35 A;  5F3J A;  1HTJ F;  3J7Y q;  3GN5 A;  1B7T A;  3B13 A;  1QSD A;  4F6R C;  2DHR A;  2YEV C;  3B57 A;  3LBX B;  1NWM X;  5M4Y A;  4ZI2 C;  4G63 A;  4IE0 A;  5ADX L;  4IHJ E;  2Q9Q C;  2CWY A;  4H9N C;  2RP4 A;  2WMO A;  5DQW A;  3NRY A;  4OHF A;  4ASK A;  5C8Y E;  1MMG A;  2KZ7 B;  3FB2 A;  2K24 A;  3DTO A;  3Q5X A;  2YK0 A;  4HTE A;  5FY7 A;  5LHI B;  2LSJ A;  4IE4 A;  4X1Y E;  2LHR A;  3WAJ A;  4P0B A;  5JDQ A;  1VRB A;  3PU3 A;  4HFV A;  5JR9 A;  4EYY R;  3I0Q A;  3ZCJ A;  4UF0 B;  3CKD A;  4PFO A;  5KMG P;  3C64 A;  4H63 H;  4IE6 A;  2CE7 A;  2N2N A;  5GON E;  2CXL A;  2VL8 A;  3O1J A;  3EDV A;  3E0Z A;  3ONX A;  4CI3 B;  3ZYL A;  2PJQ A;  3K3Q C;  4YLH A;  3RRC A;  2LSI A;  2XAG B;  5JDM A;  3CX8 B;  3IF8 B;  1ZHC A;  2CA5 A;  3ZYM A;  2D0U A;  2IC9 A;  5HWX A;  1MIW A;  5HYA A;  1LRZ A;  2X51 A;  3KV9 A;  1HF8 A;  4AI6 A;  4A56 A;  5LCY A;  3UFE A;  2X0L B;  1ZKE A;  1MMD A;  3I0O A;  3F2E A;  4QWN B;  1LKX A;  4EXT A;  1S94 A;  3MKD A;  2ZM0 A;  3WI3 A;  4FI5 A;  4UF0 A;  3RH3 A;  1FEW A;  3ZN0 B;  1YKH B;  5JH7 E;  4H63 V;  3PUQ A;  5EZY E;  3LK4 2;  4UVB B;  4H9Q C;  3MA9 A;  4YHJ A;  3BQK A;  4TN7 B;  5L3E B;  2B1E A;  3ETU A;  2Y6X A;  3N2K E;  5ETW A;  4DBQ A;  3OKQ A;  4QXB B;  4DVD A;  4UVA B;  3UUX B;  2CCQ A;  4HKA A;  3GMI A;  3SRZ A;  4B6X A;  3JC6 D;  3OYZ A;  4O2B E;  3ZMT B;  3AB3 B;  4UV9 B;  3KBU A;  4GIW A;  2NOX A;  5H6R B;  5DJQ C;  3ZEF B;  3T8O A;  2K9A A;  2XQY A;  2VB6 A;  3TKL B;  2JMH A;  4QXC B;  2WSS V;  3ZPO A;  4YFS A;  3CPZ A;  1V9D A;  4PJJ A;  2ZM2 A;  4EYU A;  3RX6 A;  2PBI A;  1BR1 A;  2KXP B;  3FXD B;  2K5B B;  2NP9 A;  3RYI E;  5CA0 E;  2VKD A;  4DND A;  2PFV A;  5JVD E;  4NUV A;  5IYZ E;  4WBO A;  2HH7 A;  4CXW A;  4P0A A;  4UV8 B;  1IAP A;  3KVB A;  4GK0 E;  4PJL A;  4KBM B;  3BQL A;  4BJN A;  3RYC E;  2XTL A;  2SPC A;  3SS1 A;  3QUJ A;  1MNE A;  3V5S A;  3GWH A;  3NZQ A;  3ZMV B;  3F31 A;  2H3R A;  3PUR A;  2C5K T;  3N5L A;  2BDE A;  3N2O A;  3AA7 B;  5LGN B;  3R6N A;  2ZMA A;  2LE8 A;  4YJ3 E;  1FMW A;  3NZP A;  3GA8 A;  1BR4 A;  3Q5W A;  5HXS A;  2XUE A;  2A2F X;  4CZZ B;  2CWO A;  1WYC A;  3KFW X;  5JRC B;  2G0U A;  5AFU L;  3MK7 C;  1IZN B;  4UEL A;  3N9M A;  4ZHQ E;  4L0R A;  4ZS3 A;  4ZI3 D;  1HS7 A;  2CMR A;  2HPJ A;  4AKL A;  3ZJ1 A;  4UIG A;  2DWG A;  4EZH A;  3K8P C;  1WRD A;  1OXZ A;  1NAF A;  2V7L A;  4GK5 E;  4AQF A;  2V26 A;  4IIJ E;  2NTY A;  5FP3 A;  5HAX A;  1ZV4 X;  4AXP A;  5KDM C;  1FIO A;  4E7S A;  3O1H A;  3OJA A;  3CML A;  4ZI2 D;  5JDF A;  3AAA B;  4H9O C;  1VOM A;  3UT5 E;  1D1B A;  2LSG A;  2VKO A;  2Q9Q D;  2H7V C;  4I4T E;  1Y64 B;  2LHN A;  3I9W A;  3PE0 A;  5LJM A;  4TZ4 C;  4H9P C;  2UXX B;  5FY1 A;  5L3B B;  5LGU B;  1BR0 A;  2BVL A;  4PK4 A;  4IE7 A;  1LVF A;  3EUH A;  5E0O A;  3N2G E;  4IE5 A;  2HPL A;  1FMV A;  2E9X C;  5J2U E;  2XAJ B;  4MBQ A;  3HKC E;  5JDH A;  4NUU A;  2C5J A;  1LVK A;  2JMK A;  1U5P A;  1IJ6 A;  2QA7 A;  2YU2 A;  2KT9 A;  2W00 A;  2D2S A;  2KND A;  3LBX A;  4XZC A;  1ZEE A;  2C0S A;  3WAK A;  2Q9Q B;  5CA1 E;  4ZS2 A;  2DI4 A;  2X66 A;  2N1G A;  3PDY A;  3AA0 B;  3K3O A;  4HN9 A;  4Z8X A;  3PU8 A;  2LM9 A;  4BA9 A;  4OYJ A;  3ESL A;  3ANW B;  2ODV A;  1WYB A;  2EHO C;  4YJ2 E;  3FHN A;  3N9L A;  2LEH A;  4O4I E;  2UXN B;  3AVR A;  1AJ3 A;  5LBQ B;  2EHO D;  1YKE B;  2KWI B;  4I55 E;  2N9D A;  4DO0 A;  5JDL A;  1D0X A;  2VKH A;  4X1I E;  3SOL A;  3I1A A;  3RC8 A;  2L8K A;  2MTQ A;  2XHE B;  3MZK B;  3HKE E;  3EVY A;  4AKR B;  3C50 A;  3I9Y A;  3C51 A;  4ERR A;  2E8I A;  5FY0 A;  4GYR A;  3P8C D;  1US7 B;  3C4W A;  3U3I A;  3U78 A;  2XAQ B;  2VKJ A;  2W61 A;  2X9X A;  4L5G A;  4QX8 B;  2LSY A;  4ADZ A;  2Q9Q A;  2WBL A;  4GYS A;  4ANJ A;  4JLE A;  4HEA A;  2NTX A;  4TX5 A;  2CEA A;  5TAO A;  3SWH A;  4GOU A;  1KNZ A;  2W62 A;  4QHO A;  2EHO B;  3J9X 1;  3DP7 A;  5BMV E;  1D1A A;  2DLR A;  2RA1 A;  3PUA A;  3ANW A;  4JEH B;  3AAE B;  2X9H A;  4QX7 B;  3ZLI A;  2KMF A;  5EK2 A;  4KUM B;  3RPU A;  4EB6 E;  3LJC A;  3CQG B;  5LOV E;  3L3P A;  2IW5 B;  3LFM A;  5JR9 C;  4HE8 A;  3K3N A;  3ZYK A;  4TV8 E;  3LK2 B;  2IAK A;  2LJL A;  1HFA A;  2VAS A;  3IBP A;  4BAY B;  5LGT B;  3N9O A;  2C5I T;  2DNX A;  3L09 A;  4PAG A;  3N9N A;  1SHZ C;  4C90 A;  5FXW A;  3P7I A;  4O4J E;  4XAX B;  1YD8 G;  4IGU A;  4OFZ A;  4PNI A;  2V7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...