3F2EA

Crystal structure of yellowstone sirv coat protein c-terminus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
83
structure length
83
Chain Sequence
FTAVAEQVSAVLSQYGITGPNRAIYQGFGLKVARALNRLGGGPALVNMINGLKAYYISAFNANPTVLDAVTDIITGSPTGYVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synergy of NMR, computation, and X-ray crystallography for structural biology.
pubmed doi rcsb
source organism Sulfolobus islandicus rudivirus 1 variant ynp
molecule tags Viral protein
molecule keywords SIRV coat protein
total genus 30
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12193 Sulf_coat_C Sulfolobus virus coat protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.800 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3f2eA00
3F2EA 3FBLA 3J9X1 3FBZA
chains in the Genus database with same CATH superfamily
2LRLA 2J1DG 3P4QA 4Z8XA 5IWAT 3Q5EA 4IL4A 2VKOA 3PUWF 4U3CA 2JRKA 4TNWA 4WNKA 3PUYF 5H6QB 1B7TA 3U3IA 2KT9A 1YQ4A 3AE5A 1KNPA 4H63V 4AQYT 5CB4E 2CBJA 4AKGA 4H9SE 3KFWX 3WAKA 4ILAA 4OYJA 4X1YE 5FYMA 2R6GF 4KX6A 4AKIA 4HWHA 1ZV4X 4K0UA 3CPZA 2E9XA 2WMOA 3LFMA 3KV4A 3OJAA 2IDOB 4EAHA 4TUYE 2BVLA 2QYWA 4I55E 3RRWA 2X68A 1D1CA 3FZFB 3N5LA 2OA5A 2C5IT 5JR9A 4NXNT 2XASB 3A8YC 2LE8A 2UXXB 3HA4A 3P4PA 5FXZA 2BS4A 4BJMA 2PJQA 2SPCA 4JI5T 4YY3T 5JRCA 3RIUA 5KMGP 2ZLYA 3ZMZB 1ZOYA 3RC8A 2JQHA 3GN5B 3T8OA 4MLKA 2UU9T 1OEDA 2OV9A 4L9IA 2XAJB 2E9XD 3HL6A 4AIUA 4EZ4A 4UF0A 3EDUA 4U74A 4EEBA 3R84B 3ZMSB 4CI2B 3P7IA 2E5LT 2D2SA 3LBXA 3UQ7A 2CWYA 2LT3A 5HXEA 1ZHCA 2LEHA 4MHCA 5AQKB 5CJ5A 2WS3A 4ISSA 4UV9B 1MNDA 2CXFA 1KFYA 1SHZC 4O4LE 5ABEA 3RHWA 5HYAA 2YU1A 2QGSA 3PJAA 2YU2A 2WU2A 3LSVA 4WBOA 3RIFA 3J7Yq 4JI1T 1E2AA 2BS3A 4U7YA 2KXPB 5AFUL 2DNXA 5EK4A 4DR5T 2LSKA 1SA0E 4YSXA 4LF9T 2JPFA 4ZI2D 4JI6T 5GONE 2MYSA 2LSIA 5AQPB 3EAMA 3AA0B 5LBMA 4P0BA 1N34T 5L3CB 3EVYA 4B6XA 4YTPA 3CX7B 3ZYMA 2KLQA 4DBRA 3FBLA 3VRAA 4PJNA 1N36T 5HCJA 2I0MA 2EHOB 5FMNA 2ODUA 2V7MA 1W0BA 2KINB 2YDQA 2Z6EA 4IDPA 5M4YA 2L9QA 2C5JA 2QA7A 4I0UA 3KV9A 5JH7E 4ASKA 3JC6D 4FI5A 2XQ8A 4Z91A 3RLFF 1U5PA 5JDMA 5IHYA 5TAOA 4DR2T 3MA9A 5LA6E 5LP6E 1T8BA 2VKHA 2V1DB 3PJAJ 5JTGA 2FJBA 5JDLA 3O9XA 3HKBE 4DUZT 4E7ZA 5ADXL 3KINB 2W67A 2W00A 2VB6A 1IBMT 2JMHA 3VHLA 4NIQA 3OYZA 4ILBA 1XDOA 4P1NA 4AXPA 5LJNA 2XQ3A 3CQXC 4U2ZA 3UULA 3MKDA 1MIYA 1DU2A 1G73A 3ZYLA 2V26A 3MACA 3B5MA 3FZHB 4HFBA 3GN5A 2MOZA 3JADA 4PJLA 5LMNT 5KXJA 2NW8A 4KMCA 4ZI3C 5L47A 5FY1A 3GMIA 3ZLIA 4B3MT 4QX7B 1IZNB 3ONXA 1MMNA 1FIOA 5JQGE 3KBUA 3UFGA 2BG9C 3ZT5A 4QWNB 3HKEE 3TLVA 4NPPA 4QH4A 4TV8E 2LSYA 4HFCA 3SRZA 5ABHA 2ZM2A 3M65A 2IW5B 1KNRA 2LM9A 2DL1A 1BR2A 2J47A 2K48A 2V6YB 2XJ7A 2JQQA 4GKKT 4TV9E 3D0TA 5ABGA 1LRZA 4TN7B 4HKAA 1KK7A 1Y01A 4KUMB 5J2TE 3KV5A 3Q5XA 3UU8A 2V7IA 3PU8A 2MBGA 4AKLA 1HNZT 2D0TA 4JYAT 2M6IA 2W62A 4IDOA 3ABVA 4DO0A 2CLYB 2N1GA 3FHNA 1D1BA 1FJGT 3KBTA 2M6BA 1WRDA 5JRCB 3I9YA 1M7KA 2NTXA 4ERRA 2PTFA 3UU6A 2Q9QC 4GKJT 2VKJA 1HG5A 2G0UA 3JC6C 4U7IA 5L2LA 1J5ET 2K5BB 2XPKA 3HKCE 3JAFA 5LGNB 4LF6T 3BQIA 2YOEA 4UELA 2WZIA 2H89A 3ETVA 4NUUA 4ZXLA 4ZZCA 2BG9A 4TNVA 3V5SA 3L39A 5IUXA 3QOFA 2B1EA 2JJ9A 1UCUA 2RA1A 3JCFA 2J62A 4KHZF 2DCFA 3C51A 3OPCA 3AEEA 5HEHA 2PG8A 5FNVE 4EIWA 2FJDA 2YKSA 2LHRA 2EHOD 3LK3B 5CFBA 2IHR1 3PURA 2Q9QA 4ZS2A 3N9NA 5J0ZA 1YKHB 2CCQA 2IIUA 3AVSA 2ACZA 4LF4T 2VKDA 3FB2A 3MJXA 4ZEYA 2YDSA 5AQHB 4TWDA 3ZMVB 2V7KA 2OLTA 5C2TA 4UR9A 3SFEA 1OXZA 3HKDE 2V5CA 4IHJE 4EEDA 2ZM0A 4YJ3E 4DV0T 2WU5A 4U31A 2MPKA 3PV0F 2E2AA 1J1JA 2JQ9A 4F6RC 5ABFB 5F5WA 4X65T 4AISA 1HX8A 3N9OA 3P8CD 3K3OA 4COFA 5L3FB 3C4ZA 3CQCB 4X20E 3RC3A 1HX1B 1WR0A 2UUBT 2ZM6T 3CKDA 4IIJE 1HFAA 3PUQA 4UIGA 3DP7A 4X64T 3AE9A 2BZBA 2X51A 3H3MA 3EUHA 4CQIA 2W61A 2N2NA 1CUNA 3N2KE 5L3GB 4DV1T 1AJ3A 4H9NC 3KVBA 3O4XE 5DJQC 1N32T 3RRCA 2BKPA 4PNIA 2WP9A 2BKOA 1WLXA 3E08A 5FVLA 1UUSA 4AQFA 1D1AA 4O4JE 3RYFE 2CE7A 3RYHE 1FMWA 1ZP0A 1MIWA 3AB3B 3KDSE 5LBQB 3ZN0B 3ONLC 1XNRT 2X9YA 3LG7A 4HFEA 3TLWA 3WI3A 5EK3A 1MMGA 2YDRA 4DR4T 3E0ZA 3G06A 1WFDA 2JIWA 5LHHB 4LF8T 4MFRA 2NW7A 2HHHT 3PUAA 3ZPOA 4X1IE 5AQVB 5DABA 3ZSTA 1I6ZA 5HEJA 3OTOT 2Y8DA 1W9RA 5FY0A 1H7CA 5AQJB 1W0AA 2XQ5A 4GOUA 4IL9A 3Q9DA 4QXCB 4EB6E 4F8HA 2X9XA 3OVUA 4CN4A 2D0UA 3GA8A 4H9OC 2BBHA 3O1HA 4O4IE 3VKHA 2IC6A 5FXVA 2A9UA 4ILCA 3L09A 2CHNA 1YXRA 1U4QA 1Y64B 4LMJA 1LVKA 5HEOA 4ANJA 3ZJ1A 2YN6A 4I50E 3UT5E 4H9QC 4AI6A 2WCAA 2KNDA 2K3WA 1W09A 4IE7A 5FKYA 1JNRA 3EABA 4JI4T 1KF6A 4YTMA 3MXZA 4HEAA 4ADZA 4AKRB 5AQQB 3V5UA 2VL0A 4AQFC 3EHZA 2XQYA 2VURA 2EHOC 1XMOT 4EZHA 5HXHA 3AAAB 2L3LA 4IGUA 4ILUA 2XTLA 2ACXA 2NOXA 1IJ6A 2YEVC 4MBQA 3ZC0A 2IUBA 1N33T 2CWOA 3ETUA 3IF8B 2V7LA 2VVNA 5HCMA 4B3ST 4H63H 1BR4A 1D0YA 3Q5DA 4A5XA 3TLUA 5L3EB 2AXDS 3ANWA 3N2OA 2XAFB 3ZCIA 3PUZF 2XQ7A 4LMKA 4DV4T 2V6YA 2NP9A 5LHGB 2HPJA 3F57A 4OFZA 5EK2A 3ZMTB 4DR6T 5AQFB 2MTQA 3AXJA 3NWIA 3WAJA 4H9RC 1YQ3A 2ZMAA 3RIAA 3UFEA 5AQOB 3AAIA 2BG9B 2CEAA 2X9HA 5HAXA 2QRXA 3PE0A 1HTJF 5CGMA 3FXDB 1ZEEA 4QKNA 3TLTA 5HXCA 4GYRA 5HXRA 1GQEA 4P0AA 3NRXA 1X9BA 3PUGA 5AQLB 3PUSA 4UEMA 4DNDA 4ZI2C 4DUYT 2VASA 4HFIA 4LF7T 5FL0A 3VKGA 4AQGA 3I1AA 1SUMB 2CHOA 3MZKB 3FZMB 5ABFA 3M3ZB 1IJ5A 2KZ7B 2LSGA 2W63A 4TX5A 3UQ4A 5LG4A 1YW0A 1QLBA 3P4RA 2XM1A 3IBPA 2XUEA 5HWXA 3KV6A 2XAGB 1MIVA 2VQET 4O2AE 3K3QC 5A1LA 4ZI3D 4PW8A 2CMRA 3VR8A 4G63A 1UURA 2CM0A 3AA6B 2NR4A 5L4HA 2BDEA 2C5KT 2CLYC 2WWUA 4JEUB 4PJJA 4QXHB 2X67A 1YKEB 3HI2A 2E8IA 1OEDE 4L0RA 3ZSSA 2VQFT 4AKHA 2X66A 2YINA 4HGAA 5BR8T 1VCSA 3QB5A 3X1DA 3ONJA 3UUBA 1D0ZA 3NRYA 4IDZA 5FP3A 3N2GE 2P9BA 2XAQB 4PK6A 4CN6A 3DTOA 4B3TT 2Q9QB 1JNZA 2D9DA 4UXNB 3QB5K 4N78D 2RPAA 4CZZB 4CXXA 3K1SA 4LFBT 2HH7A 3SWHA 1S94A 4PFPA 1J5WA 2WBLA 3FBZA 5FY7A 4BAYB 2IMLA 2WWVA 3AE3A 3H3AA 5AQMB 5HWYA 2LKHA 3RX6A 2GK9A 3ESLA 3OYXA 1D0XA 3P4SA 3PTRB 4PK5A 4BA9A 4YLHA 2WMNA 4EV6A 2W4XA 3PUVF 1UGOA 1VOMA 4QH1A 3ZT6A 4TZ4C 3ZC1A 3ZJ2A 2H7VC 4O2BE 4C90A 3ZEFB 2HN1A 4H9PC 3RYCE 2F4VT 3BQKA 4DV6T 5HXSA 5JDGA 2WDRA 2Y6XA 3BQLA 3CK6A 3CQGB 4YHJA 4LFAT 3AE8A 2LOPA 4L5GA 5FVKA 5JVDE 4GIWA 3UTKA 2W66A 4IDQA 4EXTA 2AE9A 4CXWA 2KWIB 1I94T 3O1IA 2WSSV 2H3RA 4JI3T 1WCRA 2I6HA 2X0LB 3AE2A 2L8KA 5LGUB 1XNQT 1OWAA 3RI5A 1XWMA 2NWBA 2K9AA 3N9QA 3AAEB 4PFOA 3UUMA 5LXTE 3AE1A 4DV7T 3K8PC 3LDQB 1X79A 2VVSA 2LJLA 1OEDC 3Q5WA 2CA5A 3AE6A 4HWIB 4PK4A 4U72A 4XAXB 3TLSA 2RP4A 5C8YE 5LNKA 2CXDA 2X0YA 4G2AA 3SS1A 4ZS3A 1MMDA 2FJAA 4DMVA 4KBMB 5DQVA 3ZKRA 4YT0A 3ZCJA 4YSYA 1HF8A 1S35A 2WB5A 2XY8B 3BK9A 4FJOA 4NUVA 4C91A 3T1HT 3LK42 4KHPT 2VK9A 3DJBA 2PFVA 4DVDA 2V7JA 4ZZBA 5CA0E 4Z90A 4JI7T 4V1Av 2H7OA 3JAEA 4O8SA 2LLYA 4HTEA 4X66T 2IC9A 2D5UA 3AEGA 3LK2B 5ETWA 2MAWA 3O1JA 2XM2A 2CXLA 2XQ4A 4WW0A 5E0OA 5IYZE 3F31A 3QNUA 4OX9T 4CN1A 1T98A 3QK6A 3R6NA 4XBFB 3L3PA 4O4HE 4I4TE 2ES0A 3RKOA 1LKXA 4NXMT 2DLRA 3B57A 2BVMA 3NKZA 2UXBT 2EHOA 4IDNA 2DWKA 2VL8A 2I59A 2XAHB 3I9WA 2Q9QD 3QC9A 1MMAA 3W15B 2E5VA 4A98A 2UUAT 2BBJA 2XZEA 4P09A 4DV2T 2LKGA 2WM9A 2WDVA 3B13A 1NEKA 1XDPA 4DR7T 1E7PA 3CMLA 4QHOA 1T72A 3AEBA 3NVOA 4EOZB 2XSAA 4JI0T 5JREA 2E9XB 5LYJE 2X0HA 3IA3A 1IBKT 4OK0A 3A7MA 1BR1A 1R8IA 1NWMX 2JMKA 5C3JA 2ZM8A 3ANWB 1MNEA 2LSJA 4DV3T 2A3DA 2XQ9A 4U2YA 4IE4A 1QUUA 2WZHA 1V9DA 1XZYA 2XHEB 3CX6B 3LJCA 4UVAB 5DQWA 3J9X1 1IBLT 4LF5T 2KMFA 3KVAA 3PU3A 4GK5E 3TKLB 4EYYR 4TWFA 5LHIB 1WYBA 2LOSA 2B76A 3I0QA 3GWHA 4DR3T 4GYSA 4B3RT 3E22E 2N9DA 3Q2MA 1XMQT 4IE0A 4YTNA 3AEDA 5L3BB 4HFDA 3NZQA 3PUXF 4HWCA 4IT4A 3UUNA 5CA1E 3RQUA 1HS7A 4JV5T 1O3XA 2BKNA 5LJMA 1EZ3A 4J2CA 4X62T 1YD8G 1KEYA 1US7B 5F8PA 5JDFA 2A72A 1OEDB 4A97A 1HNXT 2HN2A 4BJNA 1HG2A 4HN9A 2E9XC 4YJ2E 4IREA 4CXYA 1HR0T 4E7SA 5BMVE 5LGTB 1HNWT 3OKQA 2WAUA 3P50A 3RQWA 5L3DB 3UU4A 4QH5A 4DMWA 3AE7A 3MK7C 5JDQA 2UXNB 1Z0PA 3C98B 4WZXA 5H6RB 3VRBA 2W2UA 4CI1B 2Y48B 4HFVA 4DV5T 3ZYKA 3C4XA 4OHFA 3U78A 5LCYA 3UU5A 3N9MA 3RF1A 3EDVA 1NENA 4JLEA 5JDHA 3PDYA 1M62A 5J1GA 1L0VA 4DR1T 2C0SA 1IAPA 5AQTB 2NTYA 5JR9B 4WBNE 2ODVA 3FZKB 4U33A 4I43B 3SOLA 4YFSA 2LRKA 3L8RA 2M67A 5AQSB 4LFCT 5LB7B 3CIRA 3EI0A 4QX8B 3VR9A 4CI3B 4KP3C 2UXCT 2UXDT 4A56A 4DBQA 2WQYA 3C4WA 4PJMA 1WYCA 2FUPA 2V5DA 4JUYA 3UUXB 3RKGA 1NAFA 3RPUA 1LVFA 4TWHA 4JEHB 4JI2T 2VWAA 1QSDA 3A5XA 2V6XA 5J2UE 2W0GA 5EZYE 5LMUT 5AQIB 4DIDB 4XZCA 4ZOLE 1VRBA 2LM2A 2V8SV 2XQ6A 1T7SA 3FXEB 4IE6A 2FJEA 4HWFA 1SE7A 4YHHT 3NBXX 4K0KT 2HPLA 4X5TA 2X9WA 3AXJB 3N9PA 3IHRA 4EGWA 4UV8B 3RH3A 2CPTA 4KI0F 1Z8UA 5AQNB 1E1HB 1FMVA 3AE4A 3IEEA 5KX5E 2A2FX 2DHRA 4YSZA 3C50A 3CX8B 3K3NA 5FXWA 3UU3A 5FL1A 2YK0A 4M1PA 4HWDA 3RGLA 3HR0A 2NW9A 3VU7H 4Q25A 3AECA 4HFHA 2BS2A 3AEAA 1ZKEA 2QVAA 5LG3A 4MALA 5JR9C 3RYIE 2UUCT 2H88A 5AQGB 3QUJA 2WY2A 3N9LA 3NZPA 5AQUB 4OYKA 4UVCB 2JQKA 1CHUA 4LMLA 4YXDA 1BR0A 3C64A 3AA7B 5AQRB 4EYUA 2KWHA 1UX5A 5HEUA 3LBXB 3ZT7A 4JI8T 2LHNA 3H37A 3P4WA 4IE5A 2KSRA 5KDMC 3F2EA 4QXBB 2WDQA 3FZLB 5HEGA 1WR6A 4HE8A 1HCIA 4JBWF 4WYVA 3OBVE 3CVRA 2CRBA 4UVBB 1UX4A 3S4UA 5F3JA 2PBIA 5L4EA 2FBWA 3T1YT 3AA1B 1VCTA 2DWGA 3AVRA 2DI4A 3RIUC 4ISTA 4ZI7E 4X1KE 5JDNA 3I0OA 4ZHQE 2J4GA 3ZN1B 4UF0B 5FXXA 3ZMUB 1FEWA 1G8XA 2K24A 2XSBA 4PAGA 3AEFA 2CBIA 2XQAA 2BG9E 1UK5A 3CWZB 5LOVE 4GK0E 1KNZA 3SFDA 2IAKA
chains in the Genus database with same CATH topology
2J1DG 4Z8XA 1KNZA 2VKOA 3U3IA 2JRKA 4WNKA 5H6QB 1B7TA 2KT9A 4H63V 5CB4E 4AKGA 4H9SE 3KFWX 3WAKA 4OYJA 4X1YE 5FYMA 4AKIA 4K0UA 1ZV4X 4EAHA 3CPZA 2E9XA 2WMOA 3LFMA 3KV4A 3OJAA 4TUYE 2BVLA 4I55E 3RRWA 2X68A 1D1CA 5JR9A 3N5LA 2OA5A 2C5IT 2XASB 2LE8A 2UXXB 3HA4A 5FXZA 4BJMA 2PJQA 2SPCA 5JRCA 5KMGP 2ZLYA 3ZMZB 3RC8A 3GN5B 3T8OA 4MLKA 4L9IA 2XAJB 2E9XD 3HL6A 4EZ4A 4UF0A 3EDUA 4U74A 3R84B 3ZMSB 4CI2B 3P7IA 2D2SA 3LBXA 2CWYA 2LT3A 5HXEA 1ZHCA 2LEHA 4MHCA 4ISSA 4UV9B 1MNDA 2CXFA 1SHZC 4O4LE 5HYAA 2YU1A 2QGSA 4WBOA 2YU2A 3J7Yq 2KXPB 5AFUL 2DNXA 5EK4A 2LSKA 1SA0E 2JPFA 4ZI2D 5GONE 2MYSA 2LSIA 3AA0B 5LBMA 4P0BA 5L3CB 3EVYA 3CX7B 3ZYMA 2KLQA 4DBRA 3FBLA 4PJNA 2EHOB 5FMNA 2ODUA 2V7MA 2KINB 2Z6EA 5M4YA 2L9QA 2C5JA 2QA7A 3KV9A 5JH7E 4ASKA 3JC6D 4FI5A 5JDMA 1U5PA 5IHYA 5TAOA 3MA9A 5LA6E 5LP6E 3O9XA 2VKHA 2V1DB 5JDLA 3HKBE 4E7ZA 5ADXL 3KINB 2W00A 2VB6A 2JMHA 3VHLA 3OYZA 5LJNA 4AXPA 3CQXC 3UULA 3MKDA 1MIYA 1G73A 3ZYLA 2V26A 3MACA 3GN5A 2MOZA 4PJLA 2NW8A 4KMCA 4ZI3C 5FY1A 3GMIA 3ZLIA 4QX7B 1IZNB 3ONXA 1MMNA 1FIOA 5JQGE 3KBUA 4QWNB 3HKEE 4TV8E 2LSYA 3SRZA 2ZM2A 3M65A 2IW5B 2LM9A 1BR2A 2K48A 2JQQA 4TV9E 3D0TA 1LRZA 4TN7B 4HKAA 1KK7A 4KUMB 5J2TE 3KV5A 3Q5XA 2V7IA 3PU8A 2MBGA 4AKLA 2D0TA 2W62A 4DO0A 2CLYB 2N1GA 3FHNA 1D1BA 3KBTA 1WRDA 5JRCB 3I9YA 2NTXA 4ERRA 2Q9QC 2VKJA 1HG5A 2G0UA 3JC6C 5L2LA 2K5BB 3HKCE 5LGNB 3BQIA 4UELA 3ETVA 4NUUA 3V5SA 2B1EA 2JJ9A 1UCUA 2RA1A 2DCFA 3C51A 2PG8A 5FNVE 4EIWA 2LHRA 2EHOD 3LK3B 3PURA 2Q9QA 4ZS2A 3N9NA 1YKHB 2CCQA 3AVSA 2VKDA 3FB2A 3MJXA 3ZMVB 2V7KA 1OXZA 3HKDE 4IHJE 2ZM0A 4YJ3E 4F6RC 1HX8A 3N9OA 3P8CD 3K3OA 5L3FB 3C4ZA 3CQCB 4X20E 3RC3A 3CKDA 4IIJE 1HFAA 3PUQA 4UIGA 3DP7A 2BZBA 2X51A 3EUHA 4CQIA 2W61A 2N2NA 1CUNA 3N2KE 5L3GB 1AJ3A 4H9NC 3KVBA 3O4XE 5DJQC 3RRCA 4PNIA 1WLXA 3E08A 4AQFA 1D1AA 4O4JE 3RYFE 2CE7A 3RYHE 1FMWA 3AB3B 1MIWA 3ZN0B 3KDSE 5LBQB 2X9YA 3LG7A 3WI3A 5EK3A 1MMGA 3E0ZA 5LHHB 4MFRA 2NW7A 3PUAA 3ZPOA 4X1IE 5DABA 2Y8DA 5FY0A 1H7CA 3WAJA 4GOUA 3Q9DA 4QXCB 4EB6E 2X9XA 2D0UA 3GA8A 4H9OC 3O1HA 4O4IE 3VKHA 2IC6A 5FXVA 3L09A 1U4QA 1Y64B 1LVKA 4ANJA 3ZJ1A 4I50E 3UT5E 4H9QC 4AI6A 2KNDA 4IE7A 3MXZA 4HEAA 4ADZA 4AKRB 3V5UA 4AQFC 2XQYA 2EHOC 4EZHA 5HXHA 3AAAB 2L3LA 4IGUA 4ILUA 2XTLA 2ACXA 2NOXA 1IJ6A 2YEVC 4MBQA 3ZC0A 2CWOA 3ETUA 3IF8B 2V7LA 4H63H 1BR4A 1D0YA 5L3EB 3ANWA 3N2OA 2XAFB 3ZCIA 2NP9A 5LHGB 3F57A 2HPJA 4OFZA 5EK2A 3ZMTB 2MTQA 4H9RC 2ZMAA 3UFEA 3AAIA 2CEAA 5LJMA 2X9HA 5HAXA 3PE0A 1HTJF 3FXDB 1ZEEA 4QKNA 5HXCA 4GYRA 5HXRA 4P0AA 3NRXA 3PUGA 4DNDA 4ZI2C 3PUSA 4UEMA 2VASA 3VKGA 4AQGA 3I1AA 3MZKB 1IJ5A 2KZ7B 2LSGA 2W63A 4TX5A 1YW0A 3IBPA 2XUEA 5HWXA 3KV6A 2XAGB 1MIVA 4O2AE 3K3QC 5A1LA 4ZI3D 4PW8A 2CMRA 4G63A 2CM0A 3AA6B 2BDEA 2C5KT 2CLYC 2WWUA 4JEUB 4PJJA 4QXHB 2X67A 1YKEB 3HI2A 2E8IA 4AKHA 4L0RA 2X66A 2YINA 4HGAA 1D0ZA 3NRYA 4IDZA 5FP3A 3N2GE 2P9BA 2XAQB 4PK6A 3DTOA 2Q9QB 4UXNB 4N78D 4CZZB 4CXXA 2HH7A 3SWHA 1S94A 4PFPA 2WBLA 3FBZA 4BAYB 5FY7A 3RX6A 3H3AA 5HWYA 2GK9A 3ESLA 3OYXA 1D0XA 3PTRB 4PK5A 4YLHA 2WMNA 1VOMA 4TZ4C 3ZC1A 3ZJ2A 2H7VC 4O2BE 4C90A 3ZEFB 4H9PC 3RYCE 5C8YE 3BQKA 5HXSA 5JDGA 2Y6XA 3BQLA 3CQGB 4YHJA 5JVDE 2LOPA 4L5GA 3UTKA 4GIWA 4EXTA 4CXWA 2KWIB 3O1IA 2WSSV 2H3RA 2X0LB 2L8KA 5LGUB 1OWAA 2NWBA 2K9AA 3N9QA 3AAEB 4PFOA 3UUMA 5LXTE 3K8PC 4BA9A 1X79A 4B6XA 2LJLA 3Q5WA 4XAXB 2CA5A 4PK4A 4U72A 2RP4A 5LNKA 2CXDA 4G2AA 3SS1A 4ZS3A 1MMDA 4DMVA 4KBMB 5DQVA 1HS7A 3ZCJA 1HF8A 1S35A 4NUVA 4C91A 3BK9A 4FJOA 3LK42 2VK9A 3DJBA 2PFVA 4DVDA 2V7JA 5CA0E 4V1Av 2H7OA 4O8SA 4HTEA 2IC9A 2D5UA 3LK2B 5ETWA 3O1JA 2CXLA 4WW0A 5E0OA 5IYZE 3F31A 1T98A 3QK6A 3R6NA 4XBFB 3L3PA 4O4HE 4I4TE 2ES0A 3RKOA 1LKXA 2DLRA 3B57A 2BVMA 2EHOA 2DWKA 2VL8A 2I59A 2XAHB 3I9WA 2Q9QD 3QC9A 1MMAA 3W15B 4P09A 2WM9A 3B13A 3CMLA 4QHOA 4EOZB 5JREA 2E9XB 4OK0A 1BR1A 1NWMX 2JMKA 2ZM8A 3ANWB 1MNEA 2LSJA 2A3DA 4IE4A 1QUUA 4UVAB 2XHEB 1V9DA 3CX6B 3LJCA 3J9X1 5DQWA 2KMFA 3KVAA 3PU3A 4GK5E 3TKLB 4EYYR 5LHIB 1WYBA 2LOSA 3I0QA 3GWHA 4GYSA 3E22E 2N9DA 3Q2MA 4IE0A 5L3BB 3NZQA 3UUNA 5CA1E 1O3XA 1EZ3A 4J2CA 1YD8G 1US7B 5JDFA 5F8PA 2A72A 4BJNA 1HG2A 4HN9A 2E9XC 4YJ2E 4CXYA 4E7SA 5BMVE 5LGTB 3OKQA 2WAUA 5L3DB 4DMWA 3MK7C 5JDQA 2UXNB 1Z0PA 3C98B 5H6RB 4CI1B 2Y48B 4HFVA 3ZYKA 3C4XA 4OHFA 3U78A 5LCYA 3N9MA 3EDVA 4JLEA 5JDHA 3PDYA 5J1GA 2C0SA 1IAPA 2NTYA 5JR9B 4WBNE 2ODVA 4I43B 3SOLA 4YFSA 2M67A 4QX8B 4CI3B 4KP3C 4A56A 4DBQA 3C4WA 4PJMA 1WYCA 4JUYA 3UUXB 1NAFA 3RPUA 1LVFA 4JEHB 2VWAA 1QSDA 3A5XA 5J2UE 2W0GA 5EZYE 4XZCA 4ZOLE 1VRBA 4IE6A 3FXEB 3NBXX 2HPLA 2X9WA 3N9PA 3IHRA 4UV8B 3RH3A 1E1HB 1FMVA 3IEEA 5KX5E 2A2FX 2DHRA 3C50A 3CX8B 3K3NA 5FXWA 2YK0A 4M1PA 3HR0A 2NW9A 3VU7H 1ZKEA 4MALA 5JR9C 3RYIE 3QUJA 3N9LA 3NZPA 4OYKA 4UVCB 1BR0A 3C64A 3AA7B 4EYUA 2KWHA 1UX5A 3LBXB 2LHNA 3H37A 4IE5A 5KDMC 3F2EA 4QXBB 1WR6A 4HE8A 1HCIA 5F3JA 3S4UA 3OBVE 3CVRA 4UVBB 1UX4A 2PBIA 3AA1B 3AVRA 2DWGA 4ZI7E 2DI4A 5JDNA 4ISTA 5LYJE 4X1KE 3I0OA 4ZHQE 3ZN1B 4UF0B 5FXXA 3ZMUB 1FEWA 1G8XA 2K24A 4PAGA 5LOVE 3CWZB 4GK0E 5LG4A 2IAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2E A;  3FBL A;  3J9X 1;  3FBZ A; 
#chains in the Genus database with same CATH topology
 2LRL A;  2J1D G;  3P4Q A;  4Z8X A;  5IWA T;  3Q5E A;  4IL4 A;  2VKO A;  3PUW F;  4U3C A;  2JRK A;  4TNW A;  4WNK A;  3PUY F;  5H6Q B;  1B7T A;  3U3I A;  2KT9 A;  1YQ4 A;  3AE5 A;  1KNP A;  4H63 V;  4AQY T;  5CB4 E;  2CBJ A;  4AKG A;  4H9S E;  3KFW X;  3WAK A;  4ILA A;  4OYJ A;  4X1Y E;  5FYM A;  2R6G F;  4KX6 A;  4AKI A;  4HWH A;  1ZV4 X;  4K0U A;  3CPZ A;  2E9X A;  2WMO A;  3LFM A;  3KV4 A;  3OJA A;  2IDO B;  4EAH A;  4TUY E;  2BVL A;  2QYW A;  4I55 E;  3RRW A;  2X68 A;  1D1C A;  3FZF B;  3N5L A;  2OA5 A;  2C5I T;  5JR9 A;  4NXN T;  2XAS B;  3A8Y C;  2LE8 A;  2UXX B;  3HA4 A;  3P4P A;  5FXZ A;  2BS4 A;  4BJM A;  2PJQ A;  2SPC A;  4JI5 T;  4YY3 T;  5JRC A;  3RIU A;  5KMG P;  2ZLY A;  3ZMZ B;  1ZOY A;  3RC8 A;  2JQH A;  3GN5 B;  3T8O A;  4MLK A;  2UU9 T;  1OED A;  2OV9 A;  4L9I A;  2XAJ B;  2E9X D;  3HL6 A;  4AIU A;  4EZ4 A;  4UF0 A;  3EDU A;  4U74 A;  4EEB A;  3R84 B;  3ZMS B;  4CI2 B;  3P7I A;  2E5L T;  2D2S A;  3LBX A;  3UQ7 A;  2CWY A;  2LT3 A;  5HXE A;  1ZHC A;  2LEH A;  4MHC A;  5AQK B;  5CJ5 A;  2WS3 A;  4ISS A;  4UV9 B;  1MND A;  2CXF A;  1KFY A;  1SHZ C;  4O4L E;  5ABE A;  3RHW A;  5HYA A;  2YU1 A;  2QGS A;  3PJA A;  2YU2 A;  2WU2 A;  3LSV A;  4WBO A;  3RIF A;  3J7Y q;  4JI1 T;  1E2A A;  2BS3 A;  4U7Y A;  2KXP B;  5AFU L;  2DNX A;  5EK4 A;  4DR5 T;  2LSK A;  1SA0 E;  4YSX A;  4LF9 T;  2JPF A;  4ZI2 D;  4JI6 T;  5GON E;  2MYS A;  2LSI A;  5AQP B;  3EAM A;  3AA0 B;  5LBM A;  4P0B A;  1N34 T;  5L3C B;  3EVY A;  4B6X A;  4YTP A;  3CX7 B;  3ZYM A;  2KLQ A;  4DBR A;  3FBL A;  3VRA A;  4PJN A;  1N36 T;  5HCJ A;  2I0M A;  2EHO B;  5FMN A;  2ODU A;  2V7M A;  1W0B A;  2KIN B;  2YDQ A;  2Z6E A;  4IDP A;  5M4Y A;  2L9Q A;  2C5J A;  2QA7 A;  4I0U A;  3KV9 A;  5JH7 E;  4ASK A;  3JC6 D;  4FI5 A;  2XQ8 A;  4Z91 A;  3RLF F;  1U5P A;  5JDM A;  5IHY A;  5TAO A;  4DR2 T;  3MA9 A;  5LA6 E;  5LP6 E;  1T8B A;  2VKH A;  2V1D B;  3PJA J;  5JTG A;  2FJB A;  5JDL A;  3O9X A;  3HKB E;  4DUZ T;  4E7Z A;  5ADX L;  3KIN B;  2W67 A;  2W00 A;  2VB6 A;  1IBM T;  2JMH A;  3VHL A;  4NIQ A;  3OYZ A;  4ILB A;  1XDO A;  4P1N A;  4AXP A;  5LJN A;  2XQ3 A;  3CQX C;  4U2Z A;  3UUL A;  3MKD A;  1MIY A;  1DU2 A;  1G73 A;  3ZYL A;  2V26 A;  3MAC A;  3B5M A;  3FZH B;  4HFB A;  3GN5 A;  2MOZ A;  3JAD A;  4PJL A;  5LMN T;  5KXJ A;  2NW8 A;  4KMC A;  4ZI3 C;  5L47 A;  5FY1 A;  3GMI A;  3ZLI A;  4B3M T;  4QX7 B;  1IZN B;  3ONX A;  1MMN A;  1FIO A;  5JQG E;  3KBU A;  3UFG A;  2BG9 C;  3ZT5 A;  4QWN B;  3HKE E;  3TLV A;  4NPP A;  4QH4 A;  4TV8 E;  2LSY A;  4HFC A;  3SRZ A;  5ABH A;  2ZM2 A;  3M65 A;  2IW5 B;  1KNR A;  2LM9 A;  2DL1 A;  1BR2 A;  2J47 A;  2K48 A;  2V6Y B;  2XJ7 A;  2JQQ A;  4GKK T;  4TV9 E;  3D0T A;  5ABG A;  1LRZ A;  4TN7 B;  4HKA A;  1KK7 A;  1Y01 A;  4KUM B;  5J2T E;  3KV5 A;  3Q5X A;  3UU8 A;  2V7I A;  3PU8 A;  2MBG A;  4AKL A;  1HNZ T;  2D0T A;  4JYA T;  2M6I A;  2W62 A;  4IDO A;  3ABV A;  4DO0 A;  2CLY B;  2N1G A;  3FHN A;  1D1B A;  1FJG T;  3KBT A;  2M6B A;  1WRD A;  5JRC B;  3I9Y A;  1M7K A;  2NTX A;  4ERR A;  2PTF A;  3UU6 A;  2Q9Q C;  4GKJ T;  2VKJ A;  1HG5 A;  2G0U A;  3JC6 C;  4U7I A;  5L2L A;  1J5E T;  2K5B B;  2XPK A;  3HKC E;  3JAF A;  5LGN B;  4LF6 T;  3BQI A;  2YOE A;  4UEL A;  2WZI A;  2H89 A;  3ETV A;  4NUU A;  4ZXL A;  4ZZC A;  2BG9 A;  4TNV A;  3V5S A;  3L39 A;  5IUX A;  3QOF A;  2B1E A;  2JJ9 A;  1UCU A;  2RA1 A;  3JCF A;  2J62 A;  4KHZ F;  2DCF A;  3C51 A;  3OPC A;  3AEE A;  5HEH A;  2PG8 A;  5FNV E;  4EIW A;  2FJD A;  2YKS A;  2LHR A;  2EHO D;  3LK3 B;  5CFB A;  2IHR 1;  3PUR A;  2Q9Q A;  4ZS2 A;  3N9N A;  5J0Z A;  1YKH B;  2CCQ A;  2IIU A;  3AVS A;  2ACZ A;  4LF4 T;  2VKD A;  3FB2 A;  3MJX A;  4ZEY A;  2YDS A;  5AQH B;  4TWD A;  3ZMV B;  2V7K A;  2OLT A;  5C2T A;  4UR9 A;  3SFE A;  1OXZ A;  3HKD E;  2V5C A;  4IHJ E;  4EED A;  2ZM0 A;  4YJ3 E;  4DV0 T;  2WU5 A;  4U31 A;  2MPK A;  3PV0 F;  2E2A A;  1J1J A;  2JQ9 A;  4F6R C;  5ABF B;  5F5W A;  4X65 T;  4AIS A;  1HX8 A;  3N9O A;  3P8C D;  3K3O A;  4COF A;  5L3F B;  3C4Z A;  3CQC B;  4X20 E;  3RC3 A;  1HX1 B;  1WR0 A;  2UUB T;  2ZM6 T;  3CKD A;  4IIJ E;  1HFA A;  3PUQ A;  4UIG A;  3DP7 A;  4X64 T;  3AE9 A;  2BZB A;  2X51 A;  3H3M A;  3EUH A;  4CQI A;  2W61 A;  2N2N A;  1CUN A;  3N2K E;  5L3G B;  4DV1 T;  1AJ3 A;  4H9N C;  3KVB A;  3O4X E;  5DJQ C;  1N32 T;  3RRC A;  2BKP A;  4PNI A;  2WP9 A;  2BKO A;  1WLX A;  3E08 A;  5FVL A;  1UUS A;  4AQF A;  1D1A A;  4O4J E;  3RYF E;  2CE7 A;  3RYH E;  1FMW A;  1ZP0 A;  1MIW A;  3AB3 B;  3KDS E;  5LBQ B;  3ZN0 B;  3ONL C;  1XNR T;  2X9Y A;  3LG7 A;  4HFE A;  3TLW A;  3WI3 A;  5EK3 A;  1MMG A;  2YDR A;  4DR4 T;  3E0Z A;  3G06 A;  1WFD A;  2JIW A;  5LHH B;  4LF8 T;  4MFR A;  2NW7 A;  2HHH T;  3PUA A;  3ZPO A;  4X1I E;  5AQV B;  5DAB A;  3ZST A;  1I6Z A;  5HEJ A;  3OTO T;  2Y8D A;  1W9R A;  5FY0 A;  1H7C A;  5AQJ B;  1W0A A;  2XQ5 A;  4GOU A;  4IL9 A;  3Q9D A;  4QXC B;  4EB6 E;  4F8H A;  2X9X A;  3OVU A;  4CN4 A;  2D0U A;  3GA8 A;  4H9O C;  2BBH A;  3O1H A;  4O4I E;  3VKH A;  2IC6 A;  5FXV A;  2A9U A;  4ILC A;  3L09 A;  2CHN A;  1YXR A;  1U4Q A;  1Y64 B;  4LMJ A;  1LVK A;  5HEO A;  4ANJ A;  3ZJ1 A;  2YN6 A;  4I50 E;  3UT5 E;  4H9Q C;  4AI6 A;  2WCA A;  2KND A;  2K3W A;  1W09 A;  4IE7 A;  5FKY A;  1JNR A;  3EAB A;  4JI4 T;  1KF6 A;  4YTM A;  3MXZ A;  4HEA A;  4ADZ A;  4AKR B;  5AQQ B;  3V5U A;  2VL0 A;  4AQF C;  3EHZ A;  2XQY A;  2VUR A;  2EHO C;  1XMO T;  4EZH A;  5HXH A;  3AAA B;  2L3L A;  4IGU A;  4ILU A;  2XTL A;  2ACX A;  2NOX A;  1IJ6 A;  2YEV C;  4MBQ A;  3ZC0 A;  2IUB A;  1N33 T;  2CWO A;  3ETU A;  3IF8 B;  2V7L A;  2VVN A;  5HCM A;  4B3S T;  4H63 H;  1BR4 A;  1D0Y A;  3Q5D A;  4A5X A;  3TLU A;  5L3E B;  2AXD S;  3ANW A;  3N2O A;  2XAF B;  3ZCI A;  3PUZ F;  2XQ7 A;  4LMK A;  4DV4 T;  2V6Y A;  2NP9 A;  5LHG B;  2HPJ A;  3F57 A;  4OFZ A;  5EK2 A;  3ZMT B;  4DR6 T;  5AQF B;  2MTQ A;  3AXJ A;  3NWI A;  3WAJ A;  4H9R C;  1YQ3 A;  2ZMA A;  3RIA A;  3UFE A;  5AQO B;  3AAI A;  2BG9 B;  2CEA A;  2X9H A;  5HAX A;  2QRX A;  3PE0 A;  1HTJ F;  5CGM A;  3FXD B;  1ZEE A;  4QKN A;  3TLT A;  5HXC A;  4GYR A;  5HXR A;  1GQE A;  4P0A A;  3NRX A;  1X9B A;  3PUG A;  5AQL B;  3PUS A;  4UEM A;  4DND A;  4ZI2 C;  4DUY T;  2VAS A;  4HFI A;  4LF7 T;  5FL0 A;  3VKG A;  4AQG A;  3I1A A;  1SUM B;  2CHO A;  3MZK B;  3FZM B;  5ABF A;  3M3Z B;  1IJ5 A;  2KZ7 B;  2LSG A;  2W63 A;  4TX5 A;  3UQ4 A;  5LG4 A;  1YW0 A;  1QLB A;  3P4R A;  2XM1 A;  3IBP A;  2XUE A;  5HWX A;  3KV6 A;  2XAG B;  1MIV A;  2VQE T;  4O2A E;  3K3Q C;  5A1L A;  4ZI3 D;  4PW8 A;  2CMR A;  3VR8 A;  4G63 A;  1UUR A;  2CM0 A;  3AA6 B;  2NR4 A;  5L4H A;  2BDE A;  2C5K T;  2CLY C;  2WWU A;  4JEU B;  4PJJ A;  4QXH B;  2X67 A;  1YKE B;  3HI2 A;  2E8I A;  1OED E;  4L0R A;  3ZSS A;  2VQF T;  4AKH A;  2X66 A;  2YIN A;  4HGA A;  5BR8 T;  1VCS A;  3QB5 A;  3X1D A;  3ONJ A;  3UUB A;  1D0Z A;  3NRY A;  4IDZ A;  5FP3 A;  3N2G E;  2P9B A;  2XAQ B;  4PK6 A;  4CN6 A;  3DTO A;  4B3T T;  2Q9Q B;  1JNZ A;  2D9D A;  4UXN B;  3QB5 K;  4N78 D;  2RPA A;  4CZZ B;  4CXX A;  3K1S A;  4LFB T;  2HH7 A;  3SWH A;  1S94 A;  4PFP A;  1J5W A;  2WBL A;  3FBZ A;  5FY7 A;  4BAY B;  2IML A;  2WWV A;  3AE3 A;  3H3A A;  5AQM B;  5HWY A;  2LKH A;  3RX6 A;  2GK9 A;  3ESL A;  3OYX A;  1D0X A;  3P4S A;  3PTR B;  4PK5 A;  4BA9 A;  4YLH A;  2WMN A;  4EV6 A;  2W4X A;  3PUV F;  1UGO A;  1VOM A;  4QH1 A;  3ZT6 A;  4TZ4 C;  3ZC1 A;  3ZJ2 A;  2H7V C;  4O2B E;  4C90 A;  3ZEF B;  2HN1 A;  4H9P C;  3RYC E;  2F4V T;  3BQK A;  4DV6 T;  5HXS A;  5JDG A;  2WDR A;  2Y6X A;  3BQL A;  3CK6 A;  3CQG B;  4YHJ A;  4LFA T;  3AE8 A;  2LOP A;  4L5G A;  5FVK A;  5JVD E;  4GIW A;  3UTK A;  2W66 A;  4IDQ A;  4EXT A;  2AE9 A;  4CXW A;  2KWI B;  1I94 T;  3O1I A;  2WSS V;  2H3R A;  4JI3 T;  1WCR A;  2I6H A;  2X0L B;  3AE2 A;  2L8K A;  5LGU B;  1XNQ T;  1OWA A;  3RI5 A;  1XWM A;  2NWB A;  2K9A A;  3N9Q A;  3AAE B;  4PFO A;  3UUM A;  5LXT E;  3AE1 A;  4DV7 T;  3K8P C;  3LDQ B;  1X79 A;  2VVS A;  2LJL A;  1OED C;  3Q5W A;  2CA5 A;  3AE6 A;  4HWI B;  4PK4 A;  4U72 A;  4XAX B;  3TLS A;  2RP4 A;  5C8Y E;  5LNK A;  2CXD A;  2X0Y A;  4G2A A;  3SS1 A;  4ZS3 A;  1MMD A;  2FJA A;  4DMV A;  4KBM B;  5DQV A;  3ZKR A;  4YT0 A;  3ZCJ A;  4YSY A;  1HF8 A;  1S35 A;  2WB5 A;  2XY8 B;  3BK9 A;  4FJO A;  4NUV A;  4C91 A;  3T1H T;  3LK4 2;  4KHP T;  2VK9 A;  3DJB A;  2PFV A;  4DVD A;  2V7J A;  4ZZB A;  5CA0 E;  4Z90 A;  4JI7 T;  4V1A v;  2H7O A;  3JAE A;  4O8S A;  2LLY A;  4HTE A;  4X66 T;  2IC9 A;  2D5U A;  3AEG A;  3LK2 B;  5ETW A;  2MAW A;  3O1J A;  2XM2 A;  2CXL A;  2XQ4 A;  4WW0 A;  5E0O A;  5IYZ E;  3F31 A;  3QNU A;  4OX9 T;  4CN1 A;  1T98 A;  3QK6 A;  3R6N A;  4XBF B;  3L3P A;  4O4H E;  4I4T E;  2ES0 A;  3RKO A;  1LKX A;  4NXM T;  2DLR A;  3B57 A;  2BVM A;  3NKZ A;  2UXB T;  2EHO A;  4IDN A;  2DWK A;  2VL8 A;  2I59 A;  2XAH B;  3I9W A;  2Q9Q D;  3QC9 A;  1MMA A;  3W15 B;  2E5V A;  4A98 A;  2UUA T;  2BBJ A;  2XZE A;  4P09 A;  4DV2 T;  2LKG A;  2WM9 A;  2WDV A;  3B13 A;  1NEK A;  1XDP A;  4DR7 T;  1E7P A;  3CML A;  4QHO A;  1T72 A;  3AEB A;  3NVO A;  4EOZ B;  2XSA A;  4JI0 T;  5JRE A;  2E9X B;  5LYJ E;  2X0H A;  3IA3 A;  1IBK T;  4OK0 A;  3A7M A;  1BR1 A;  1R8I A;  1NWM X;  2JMK A;  5C3J A;  2ZM8 A;  3ANW B;  1MNE A;  2LSJ A;  4DV3 T;  2A3D A;  2XQ9 A;  4U2Y A;  4IE4 A;  1QUU A;  2WZH A;  1V9D A;  1XZY A;  2XHE B;  3CX6 B;  3LJC A;  4UVA B;  5DQW A;  3J9X 1;  1IBL T;  4LF5 T;  2KMF A;  3KVA A;  3PU3 A;  4GK5 E;  3TKL B;  4EYY R;  4TWF A;  5LHI B;  1WYB A;  2LOS A;  2B76 A;  3I0Q A;  3GWH A;  4DR3 T;  4GYS A;  4B3R T;  3E22 E;  2N9D A;  3Q2M A;  1XMQ T;  4IE0 A;  4YTN A;  3AED A;  5L3B B;  4HFD A;  3NZQ A;  3PUX F;  4HWC A;  4IT4 A;  3UUN A;  5CA1 E;  3RQU A;  1HS7 A;  4JV5 T;  1O3X A;  2BKN A;  5LJM A;  1EZ3 A;  4J2C A;  4X62 T;  1YD8 G;  1KEY A;  1US7 B;  5F8P A;  5JDF A;  2A72 A;  1OED B;  4A97 A;  1HNX T;  2HN2 A;  4BJN A;  1HG2 A;  4HN9 A;  2E9X C;  4YJ2 E;  4IRE A;  4CXY A;  1HR0 T;  4E7S A;  5BMV E;  5LGT B;  1HNW T;  3OKQ A;  2WAU A;  3P50 A;  3RQW A;  5L3D B;  3UU4 A;  4QH5 A;  4DMW A;  3AE7 A;  3MK7 C;  5JDQ A;  2UXN B;  1Z0P A;  3C98 B;  4WZX A;  5H6R B;  3VRB A;  2W2U A;  4CI1 B;  2Y48 B;  4HFV A;  4DV5 T;  3ZYK A;  3C4X A;  4OHF A;  3U78 A;  5LCY A;  3UU5 A;  3N9M A;  3RF1 A;  3EDV A;  1NEN A;  4JLE A;  5JDH A;  3PDY A;  1M62 A;  5J1G A;  1L0V A;  4DR1 T;  2C0S A;  1IAP A;  5AQT B;  2NTY A;  5JR9 B;  4WBN E;  2ODV A;  3FZK B;  4U33 A;  4I43 B;  3SOL A;  4YFS A;  2LRK A;  3L8R A;  2M67 A;  5AQS B;  4LFC T;  5LB7 B;  3CIR A;  3EI0 A;  4QX8 B;  3VR9 A;  4CI3 B;  4KP3 C;  2UXC T;  2UXD T;  4A56 A;  4DBQ A;  2WQY A;  3C4W A;  4PJM A;  1WYC A;  2FUP A;  2V5D A;  4JUY A;  3UUX B;  3RKG A;  1NAF A;  3RPU A;  1LVF A;  4TWH A;  4JEH B;  4JI2 T;  2VWA A;  1QSD A;  3A5X A;  2V6X A;  5J2U E;  2W0G A;  5EZY E;  5LMU T;  5AQI B;  4DID B;  4XZC A;  4ZOL E;  1VRB A;  2LM2 A;  2V8S V;  2XQ6 A;  1T7S A;  3FXE B;  4IE6 A;  2FJE A;  4HWF A;  1SE7 A;  4YHH T;  3NBX X;  4K0K T;  2HPL A;  4X5T A;  2X9W A;  3AXJ B;  3N9P A;  3IHR A;  4EGW A;  4UV8 B;  3RH3 A;  2CPT A;  4KI0 F;  1Z8U A;  5AQN B;  1E1H B;  1FMV A;  3AE4 A;  3IEE A;  5KX5 E;  2A2F X;  2DHR A;  4YSZ A;  3C50 A;  3CX8 B;  3K3N A;  5FXW A;  3UU3 A;  5FL1 A;  2YK0 A;  4M1P A;  4HWD A;  3RGL A;  3HR0 A;  2NW9 A;  3VU7 H;  4Q25 A;  3AEC A;  4HFH A;  2BS2 A;  3AEA A;  1ZKE A;  2QVA A;  5LG3 A;  4MAL A;  5JR9 C;  3RYI E;  2UUC T;  2H88 A;  5AQG B;  3QUJ A;  2WY2 A;  3N9L A;  3NZP A;  5AQU B;  4OYK A;  4UVC B;  2JQK A;  1CHU A;  4LML A;  4YXD A;  1BR0 A;  3C64 A;  3AA7 B;  5AQR B;  4EYU A;  2KWH A;  1UX5 A;  5HEU A;  3LBX B;  3ZT7 A;  4JI8 T;  2LHN A;  3H37 A;  3P4W A;  4IE5 A;  2KSR A;  5KDM C;  3F2E A;  4QXB B;  2WDQ A;  3FZL B;  5HEG A;  1WR6 A;  4HE8 A;  1HCI A;  4JBW F;  4WYV A;  3OBV E;  3CVR A;  2CRB A;  4UVB B;  1UX4 A;  3S4U A;  5F3J A;  2PBI A;  5L4E A;  2FBW A;  3T1Y T;  3AA1 B;  1VCT A;  2DWG A;  3AVR A;  2DI4 A;  3RIU C;  4IST A;  4ZI7 E;  4X1K E;  5JDN A;  3I0O A;  4ZHQ E;  2J4G A;  3ZN1 B;  4UF0 B;  5FXX A;  3ZMU B;  1FEW A;  1G8X A;  2K24 A;  2XSB A;  4PAG A;  3AEF A;  2CBI A;  2XQA A;  2BG9 E;  1UK5 A;  3CWZ B;  5LOV E;  4GK0 E;  1KNZ A;  3SFD A;  2IAK A; 
#chains in the Genus database with same CATH homology
 2J1D G;  4Z8X A;  1KNZ A;  2VKO A;  3U3I A;  2JRK A;  4WNK A;  5H6Q B;  1B7T A;  2KT9 A;  4H63 V;  5CB4 E;  4AKG A;  4H9S E;  3KFW X;  3WAK A;  4OYJ A;  4X1Y E;  5FYM A;  4AKI A;  4K0U A;  1ZV4 X;  4EAH A;  3CPZ A;  2E9X A;  2WMO A;  3LFM A;  3KV4 A;  3OJA A;  4TUY E;  2BVL A;  4I55 E;  3RRW A;  2X68 A;  1D1C A;  5JR9 A;  3N5L A;  2OA5 A;  2C5I T;  2XAS B;  2LE8 A;  2UXX B;  3HA4 A;  5FXZ A;  4BJM A;  2PJQ A;  2SPC A;  5JRC A;  5KMG P;  2ZLY A;  3ZMZ B;  3RC8 A;  3GN5 B;  3T8O A;  4MLK A;  4L9I A;  2XAJ B;  2E9X D;  3HL6 A;  4EZ4 A;  4UF0 A;  3EDU A;  4U74 A;  3R84 B;  3ZMS B;  4CI2 B;  3P7I A;  2D2S A;  3LBX A;  2CWY A;  2LT3 A;  5HXE A;  1ZHC A;  2LEH A;  4MHC A;  4ISS A;  4UV9 B;  1MND A;  2CXF A;  1SHZ C;  4O4L E;  5HYA A;  2YU1 A;  2QGS A;  4WBO A;  2YU2 A;  3J7Y q;  2KXP B;  5AFU L;  2DNX A;  5EK4 A;  2LSK A;  1SA0 E;  2JPF A;  4ZI2 D;  5GON E;  2MYS A;  2LSI A;  3AA0 B;  5LBM A;  4P0B A;  5L3C B;  3EVY A;  3CX7 B;  3ZYM A;  2KLQ A;  4DBR A;  3FBL A;  4PJN A;  2EHO B;  5FMN A;  2ODU A;  2V7M A;  2KIN B;  2Z6E A;  5M4Y A;  2L9Q A;  2C5J A;  2QA7 A;  3KV9 A;  5JH7 E;  4ASK A;  3JC6 D;  4FI5 A;  5JDM A;  1U5P A;  5IHY A;  5TAO A;  3MA9 A;  5LA6 E;  5LP6 E;  3O9X A;  2VKH A;  2V1D B;  5JDL A;  3HKB E;  4E7Z A;  5ADX L;  3KIN B;  2W00 A;  2VB6 A;  2JMH A;  3VHL A;  3OYZ A;  5LJN A;  4AXP A;  3CQX C;  3UUL A;  3MKD A;  1MIY A;  1G73 A;  3ZYL A;  2V26 A;  3MAC A;  3GN5 A;  2MOZ A;  4PJL A;  2NW8 A;  4KMC A;  4ZI3 C;  5FY1 A;  3GMI A;  3ZLI A;  4QX7 B;  1IZN B;  3ONX A;  1MMN A;  1FIO A;  5JQG E;  3KBU A;  4QWN B;  3HKE E;  4TV8 E;  2LSY A;  3SRZ A;  2ZM2 A;  3M65 A;  2IW5 B;  2LM9 A;  1BR2 A;  2K48 A;  2JQQ A;  4TV9 E;  3D0T A;  1LRZ A;  4TN7 B;  4HKA A;  1KK7 A;  4KUM B;  5J2T E;  3KV5 A;  3Q5X A;  2V7I A;  3PU8 A;  2MBG A;  4AKL A;  2D0T A;  2W62 A;  4DO0 A;  2CLY B;  2N1G A;  3FHN A;  1D1B A;  3KBT A;  1WRD A;  5JRC B;  3I9Y A;  2NTX A;  4ERR A;  2Q9Q C;  2VKJ A;  1HG5 A;  2G0U A;  3JC6 C;  5L2L A;  2K5B B;  3HKC E;  5LGN B;  3BQI A;  4UEL A;  3ETV A;  4NUU A;  3V5S A;  2B1E A;  2JJ9 A;  1UCU A;  2RA1 A;  2DCF A;  3C51 A;  2PG8 A;  5FNV E;  4EIW A;  2LHR A;  2EHO D;  3LK3 B;  3PUR A;  2Q9Q A;  4ZS2 A;  3N9N A;  1YKH B;  2CCQ A;  3AVS A;  2VKD A;  3FB2 A;  3MJX A;  3ZMV B;  2V7K A;  1OXZ A;  3HKD E;  4IHJ E;  2ZM0 A;  4YJ3 E;  4F6R C;  1HX8 A;  3N9O A;  3P8C D;  3K3O A;  5L3F B;  3C4Z A;  3CQC B;  4X20 E;  3RC3 A;  3CKD A;  4IIJ E;  1HFA A;  3PUQ A;  4UIG A;  3DP7 A;  2BZB A;  2X51 A;  3EUH A;  4CQI A;  2W61 A;  2N2N A;  1CUN A;  3N2K E;  5L3G B;  1AJ3 A;  4H9N C;  3KVB A;  3O4X E;  5DJQ C;  3RRC A;  4PNI A;  1WLX A;  3E08 A;  4AQF A;  1D1A A;  4O4J E;  3RYF E;  2CE7 A;  3RYH E;  1FMW A;  3AB3 B;  1MIW A;  3ZN0 B;  3KDS E;  5LBQ B;  2X9Y A;  3LG7 A;  3WI3 A;  5EK3 A;  1MMG A;  3E0Z A;  5LHH B;  4MFR A;  2NW7 A;  3PUA A;  3ZPO A;  4X1I E;  5DAB A;  2Y8D A;  5FY0 A;  1H7C A;  3WAJ A;  4GOU A;  3Q9D A;  4QXC B;  4EB6 E;  2X9X A;  2D0U A;  3GA8 A;  4H9O C;  3O1H A;  4O4I E;  3VKH A;  2IC6 A;  5FXV A;  3L09 A;  1U4Q A;  1Y64 B;  1LVK A;  4ANJ A;  3ZJ1 A;  4I50 E;  3UT5 E;  4H9Q C;  4AI6 A;  2KND A;  4IE7 A;  3MXZ A;  4HEA A;  4ADZ A;  4AKR B;  3V5U A;  4AQF C;  2XQY A;  2EHO C;  4EZH A;  5HXH A;  3AAA B;  2L3L A;  4IGU A;  4ILU A;  2XTL A;  2ACX A;  2NOX A;  1IJ6 A;  2YEV C;  4MBQ A;  3ZC0 A;  2CWO A;  3ETU A;  3IF8 B;  2V7L A;  4H63 H;  1BR4 A;  1D0Y A;  5L3E B;  3ANW A;  3N2O A;  2XAF B;  3ZCI A;  2NP9 A;  5LHG B;  3F57 A;  2HPJ A;  4OFZ A;  5EK2 A;  3ZMT B;  2MTQ A;  4H9R C;  2ZMA A;  3UFE A;  3AAI A;  2CEA A;  5LJM A;  2X9H A;  5HAX A;  3PE0 A;  1HTJ F;  3FXD B;  1ZEE A;  4QKN A;  5HXC A;  4GYR A;  5HXR A;  4P0A A;  3NRX A;  3PUG A;  4DND A;  4ZI2 C;  3PUS A;  4UEM A;  2VAS A;  3VKG A;  4AQG A;  3I1A A;  3MZK B;  1IJ5 A;  2KZ7 B;  2LSG A;  2W63 A;  4TX5 A;  1YW0 A;  3IBP A;  2XUE A;  5HWX A;  3KV6 A;  2XAG B;  1MIV A;  4O2A E;  3K3Q C;  5A1L A;  4ZI3 D;  4PW8 A;  2CMR A;  4G63 A;  2CM0 A;  3AA6 B;  2BDE A;  2C5K T;  2CLY C;  2WWU A;  4JEU B;  4PJJ A;  4QXH B;  2X67 A;  1YKE B;  3HI2 A;  2E8I A;  4AKH A;  4L0R A;  2X66 A;  2YIN A;  4HGA A;  1D0Z A;  3NRY A;  4IDZ A;  5FP3 A;  3N2G E;  2P9B A;  2XAQ B;  4PK6 A;  3DTO A;  2Q9Q B;  4UXN B;  4N78 D;  4CZZ B;  4CXX A;  2HH7 A;  3SWH A;  1S94 A;  4PFP A;  2WBL A;  3FBZ A;  4BAY B;  5FY7 A;  3RX6 A;  3H3A A;  5HWY A;  2GK9 A;  3ESL A;  3OYX A;  1D0X A;  3PTR B;  4PK5 A;  4YLH A;  2WMN A;  1VOM A;  4TZ4 C;  3ZC1 A;  3ZJ2 A;  2H7V C;  4O2B E;  4C90 A;  3ZEF B;  4H9P C;  3RYC E;  5C8Y E;  3BQK A;  5HXS A;  5JDG A;  2Y6X A;  3BQL A;  3CQG B;  4YHJ A;  5JVD E;  2LOP A;  4L5G A;  3UTK A;  4GIW A;  4EXT A;  4CXW A;  2KWI B;  3O1I A;  2WSS V;  2H3R A;  2X0L B;  2L8K A;  5LGU B;  1OWA A;  2NWB A;  2K9A A;  3N9Q A;  3AAE B;  4PFO A;  3UUM A;  5LXT E;  3K8P C;  4BA9 A;  1X79 A;  4B6X A;  2LJL A;  3Q5W A;  4XAX B;  2CA5 A;  4PK4 A;  4U72 A;  2RP4 A;  5LNK A;  2CXD A;  4G2A A;  3SS1 A;  4ZS3 A;  1MMD A;  4DMV A;  4KBM B;  5DQV A;  1HS7 A;  3ZCJ A;  1HF8 A;  1S35 A;  4NUV A;  4C91 A;  3BK9 A;  4FJO A;  3LK4 2;  2VK9 A;  3DJB A;  2PFV A;  4DVD A;  2V7J A;  5CA0 E;  4V1A v;  2H7O A;  4O8S A;  4HTE A;  2IC9 A;  2D5U A;  3LK2 B;  5ETW A;  3O1J A;  2CXL A;  4WW0 A;  5E0O A;  5IYZ E;  3F31 A;  1T98 A;  3QK6 A;  3R6N A;  4XBF B;  3L3P A;  4O4H E;  4I4T E;  2ES0 A;  3RKO A;  1LKX A;  2DLR A;  3B57 A;  2BVM A;  2EHO A;  2DWK A;  2VL8 A;  2I59 A;  2XAH B;  3I9W A;  2Q9Q D;  3QC9 A;  1MMA A;  3W15 B;  4P09 A;  2WM9 A;  3B13 A;  3CML A;  4QHO A;  4EOZ B;  5JRE A;  2E9X B;  4OK0 A;  1BR1 A;  1NWM X;  2JMK A;  2ZM8 A;  3ANW B;  1MNE A;  2LSJ A;  2A3D A;  4IE4 A;  1QUU A;  4UVA B;  2XHE B;  1V9D A;  3CX6 B;  3LJC A;  3J9X 1;  5DQW A;  2KMF A;  3KVA A;  3PU3 A;  4GK5 E;  3TKL B;  4EYY R;  5LHI B;  1WYB A;  2LOS A;  3I0Q A;  3GWH A;  4GYS A;  3E22 E;  2N9D A;  3Q2M A;  4IE0 A;  5L3B B;  3NZQ A;  3UUN A;  5CA1 E;  1O3X A;  1EZ3 A;  4J2C A;  1YD8 G;  1US7 B;  5JDF A;  5F8P A;  2A72 A;  4BJN A;  1HG2 A;  4HN9 A;  2E9X C;  4YJ2 E;  4CXY A;  4E7S A;  5BMV E;  5LGT B;  3OKQ A;  2WAU A;  5L3D B;  4DMW A;  3MK7 C;  5JDQ A;  2UXN B;  1Z0P A;  3C98 B;  5H6R B;  4CI1 B;  2Y48 B;  4HFV A;  3ZYK A;  3C4X A;  4OHF A;  3U78 A;  5LCY A;  3N9M A;  3EDV A;  4JLE A;  5JDH A;  3PDY A;  5J1G A;  2C0S A;  1IAP A;  2NTY A;  5JR9 B;  4WBN E;  2ODV A;  4I43 B;  3SOL A;  4YFS A;  2M67 A;  4QX8 B;  4CI3 B;  4KP3 C;  4A56 A;  4DBQ A;  3C4W A;  4PJM A;  1WYC A;  4JUY A;  3UUX B;  1NAF A;  3RPU A;  1LVF A;  4JEH B;  2VWA A;  1QSD A;  3A5X A;  5J2U E;  2W0G A;  5EZY E;  4XZC A;  4ZOL E;  1VRB A;  4IE6 A;  3FXE B;  3NBX X;  2HPL A;  2X9W A;  3N9P A;  3IHR A;  4UV8 B;  3RH3 A;  1E1H B;  1FMV A;  3IEE A;  5KX5 E;  2A2F X;  2DHR A;  3C50 A;  3CX8 B;  3K3N A;  5FXW A;  2YK0 A;  4M1P A;  3HR0 A;  2NW9 A;  3VU7 H;  1ZKE A;  4MAL A;  5JR9 C;  3RYI E;  3QUJ A;  3N9L A;  3NZP A;  4OYK A;  4UVC B;  1BR0 A;  3C64 A;  3AA7 B;  4EYU A;  2KWH A;  1UX5 A;  3LBX B;  2LHN A;  3H37 A;  4IE5 A;  5KDM C;  3F2E A;  4QXB B;  1WR6 A;  4HE8 A;  1HCI A;  5F3J A;  3S4U A;  3OBV E;  3CVR A;  4UVB B;  1UX4 A;  2PBI A;  3AA1 B;  3AVR A;  2DWG A;  4ZI7 E;  2DI4 A;  5JDN A;  4IST A;  5LYJ E;  4X1K E;  3I0O A;  4ZHQ E;  3ZN1 B;  4UF0 B;  5FXX A;  3ZMU B;  1FEW A;  1G8X A;  2K24 A;  4PAG A;  5LOV E;  3CWZ B;  4GK0 E;  5LG4 A;  2IAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...