3F2EA

Crystal structure of yellowstone sirv coat protein c-terminus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
83
structure length
83
Chain Sequence
b'FTAVAEQVSAVLSQYGITGPNRAIYQGFGLKVARALNRLGGGPALVNMINGLKAYYISAFNANPTVLDAVTDIITGSPTGYVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIRV coat protein
molecule tags Viral protein
source organism Sulfolobus islandicus rudivirus 1 variant ynp
publication title Synergy of NMR, computation, and X-ray crystallography for structural biology.
pubmed doi rcsb
total genus 30
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12193 Sulf_coat_C Sulfolobus virus coat protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.800 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3f2eA00
3FBLA 3F2EA 3J9X1 3FBZA
chains in the Genus database with same CATH superfamily
2H89A 1G73A 5AQUB 1J5WA 2KWIB 4DMVA 3VRBA 3O1IA 5AQOB 2A3DA 3ESLA 2JQHA 4YTPA 1XMQT 2MYSA 5FL0A 1QSDA 2V7JA 3JADA 4M1PA 1J5ET 4ZZBA 4PNIA 5LHIB 2CWYA 4QXHB 3RGLA 3UULA 2JQKA 5IHYA 2LOPA 1EZ3A 2XM2A 4DV3T 2Q9QA 5JDGA 5LNKA 3AXJB 1WYBA 2J62A 4XAXB 1ZV4X 3H3AA 5JR9B 1OEDA 2V8SV 1N36T 4HEAA 2HHHT 2BS2A 3K8PC 4P1NA 4HTEA 2LM9A 3EDUA 3E22E 1E2AA 4ZZCA 3AE8A 4CI1B 5LJNA 4AKLA 1YQ3A 4GK0E 2BG9B 3ZJ2A 3FB2A 4JI0T 5JQGE 3RYHE 3K3QC 2XAHB 5JTGA 3AECA 2W61A 5LB7B 3MACA 1I6ZA 1MNDA 3RC3A 2IMLA 1OEDC 3K1SA 4BJNA 3O9XA 2XSBA 3P4WA 2IC6A 2Q9QC 3CX7B 2MOZA 5HXCA 3SRZA 4U2ZA 4X62T 4WBOA 3MKDA 3AE9A 4PJLA 2PTFA 4ADZA 2UXBT 5EZYE 3VKGA 2WWUA 3I9WA 2L9QA 4U74A 3QC9A 4CQIA 5KXJA 5AQSB 3C51A 1D0XA 3ZN0B 2V7MA 2WDVA 3ANWA 2V7IA 3F31A 4X1KE 3X1DA 1WFDA 5J2UE 4HGAA 1MIVA 3O4XE 3NRXA 4MBQA 5FYMA 2YKSA 4IDPA 2RP4A 3AEGA 2CCQA 3EABA 2WY2A 4HFVA 4LMLA 4Q25A 3ZSSA 5JREA 1N32T 4NUVA 2XPKA 2XQ9A 2BZBA 2NR4A 1HX1B 4A5XA 3EUHA 3ZT6A 3SFDA 2LSIA 4HFEA 3OVUA 5ABHA 2CXFA 3KINB 5AQFB 4AXPA 4AKHA 3L8RA 1LVFA 4JI6T 2JRKA 5IWAT 4HKAA 4H9SE 4H63H 2PFVA 4OYJA 4QX7B 3RI5A 3UU3A 4C90A 4IE7A 4WNKA 3LK42 2VQFT 1WCRA 3AE1A 4LF9T 4K0UA 3HI2A 1UURA 5HYAA 3JCFA 5JRCA 4PJMA 3UT5E 3N5LA 3VHLA 2HN2A 4DO0A 4ZEYA 2D0TA 5LYJE 4DR1T 4ZS3A 1NAFA 2PBIA 2FBWA 2V5CA 3C50A 3PUGA 3PUVF 5BR8T 1UUSA 4IDZA 2UUCT 1D1BA 3SOLA 3CX8B 4F6RC 2CHNA 4O4HE 2XAQB 4HN9A 4TV9E 4EEDA 1HTJF 2DWKA 2CPTA 2LSYA 1MNEA 4WW0A 3ZCIA 4DR2T 1WLXA 1JNZA 2AE9A 3RH3A 1MMAA 4ERRA 2JMHA 2YK0A 2N1GA 3ZMVB 5LMUT 5FXVA 1SA0E 2X0LB 5JDMA 2P9BA 3UU8A 2WMNA 3QOFA 4P0AA 1XWMA 3ANWB 4H9OC 4WYVA 3ZC0A 3KV9A 3M3ZB 3QK6A 2WMOA 4N78D 2G0UA 4X65T 3T1YT 4LMJA 2XY8B 5DQVA 4X20E 4A56A 4EGWA 3GA8A 2AXDS 2QGSA 1ZOYA 1J1JA 4FI5A 4IREA 4UF0A 3CX6B 4TWDA 4ZXLA 5LBQB 4PAGA 4DUZT 2BKPA 3GMIA 3JAFA 3K3OA 3NRYA 3NVOA 1MIWA 2XQ7A 2QA7A 4JI2T 3HKDE 3KV4A 5LBMA 3RIFA 4EYUA 2C5IT 2VVNA 4JYAT 4UIGA 3RPUA 2YINA 3FZHB 4QHOA 5AQLB 3CK6A 5AQQB 3ZT7A 5ETWA 2ACXA 1KFYA 4IIJE 4U7YA 2B1EA 5F8PA 4JI3T 4DUYT 4ZOLE 2DI4A 2BBJA 2ZM6T 1IJ6A 1N33T 4ILBA 2X0YA 2IW5B 4UF0B 4YHJA 5JR9A 5AFUL 4CI3B 3IEEA 2YDQA 3AE4A 3RIAA 2VKOA 4YSXA 3P4SA 3AEAA 2V1DB 2E8IA 3PDYA 3P8CD 4J2CA 5HEHA 4TWHA 2EHOD 2ZM8A 5FL1A 2XQ8A 4HWFA 2EHOA 3A5XA 3MJXA 4IGUA 1S94A 3P7IA 3Q5WA 2WP9A 2CEAA 3O1JA 2OA5A 2UXNB 4HFIA 2BG9A 1W0BA 4ANJA 5F3JA 5L3BB 2CBIA 1T98A 3EAMA 2BVMA 1KEYA 5AQIB 1YKEB 3LJCA 4AI6A 2WM9A 4HWHA 5A1LA 4DR6T 1YKHB 3OJAA 4HWDA 2C5KT 1XDOA 2C5JA 3CMLA 4DV1T 2XSAA 3AXJA 2WDQA 3IF8B 3ZLIA 4EXTA 5HXSA 3WAJA 3AA6B 2SPCA 4QXBB 2X67A 5LHHB 2XQ3A 2XASB 4IDNA 4BA9A 2VKJA 1HG2A 2KLQA 4GYRA 2K3WA 4OHFA 4EZHA 4HFHA 2NTYA 3LBXB 3Q5EA 3R6NA 3BQIA 1ZHCA 2JPFA 3ZPOA 4DVDA 5JR9C 3OYXA 2W62A 3ZMSB 2LEHA 3ZT5A 3P4RA 3PUQA 2CHOA 3ETUA 3GN5B 3OPCA 1UGOA 3AE7A 3CPZA 4QX8B 3E08A 3ZMUB 4CN6A 2F4VT 2BG9C 1VRBA 2M67A 3RYFE 5LP6E 1HNWT 2ZLYA 2E9XC 4AQFC 5HXHA 2ZM0A 3ABVA 2W63A 1WR6A 2H3RA 2Y48B 5IUXA 4U31A 4EV6A 4GIWA 4LF5T 5L3EB 2NWBA 2CE7A 1NENA 1WR0A 1WRDA 2D5UA 2XTLA 3N9NA 5CA1E 3AEEA 2UXCT 4YJ2E 4WBNE 1IZNB 3J9X1 4ASKA 3KDSE 3E0ZA 2KXPB 4DV7T 2I59A 3AE6A 3O1HA 3VR9A 1QLBA 2NP9A 2X9YA 1XNRT 2X66A 2K9AA 2A9UA 2KZ7B 2NW7A 2X51A 3P4PA 3N2GE 4B3ST 4X66T 2A72A 4GYSA 2PG8A 4X1IE 5ABFB 3PURA 2WSSV 3BQLA 4PFPA 5AQRB 3RQUA 2B76A 3KBUA 3UUNA 1Y64B 4LFBT 2HH7A 1N34T 5FNVE 1X79A 2DLRA 2WU2A 2KSRA 4YFSA 3QB5K 4KP3C 1XDPA 3AE2A 2BS3A 1HF8A 3UU6A 1HG5A 4O4IE 1HR0T 3ZC1A 4LF6T 2LM2A 4ZI3D 2JJ9A 2L8KA 3AA7B 3AVRA 3V5UA 2CBJA 4DR5T 5LXTE 4YY3T 4UVCB 2YN6A 3AA0B 3UFEA 3PUWF 4QH4A 2XQYA 5L3CB 3DP7A 1G8XA 4G63A 4I55E 3I0QA 1I94T 4ZS2A 2WDRA 1M62A 2HPLA 3I0OA 5FY7A 4O2BE 5LHGB 1W09A 4HWIB 2XJ7A 4P0BA 5L3DB 3AB3B 2DNXA 2JQ9A 4EAHA 4JLEA 1XMOT 2IIUA 2V5DA 5C3JA 5LMNT 4EB6E 3N9QA 4JEUB 2GK9A 4YTNA 1FMVA 2CA5A 1SUMB 2D2SA 3IBPA 4UV9B 4XBFB 2BDEA 3DTOA 4PK6A 3ZJ1A 3N9MA 3RQWA 5LG4A 4TWFA 3K3NA 1FIOA 2LSKA 3CQXC 2IC9A 4Z91A 5L4HA 4GKKT 4AKIA 3N9OA 4JEHB 3RHWA 2VL0A 1UK5A 3LK2B 4CN1A 1H7CA 4LF4T 4EZ4A 1UX5A 1LKXA 2LT3A 3TLTA 3RRCA 2X68A 5KMGP 2QVAA 2BKNA 4H9PC 3G06A 2W66A 4I50E 3CVRA 4AQGA 3B57A 3H3MA 1VCTA 3VR8A 2V6XA 4U7IA 2KINB 1YW0A 2L3LA 2NOXA 1VCSA 4E7SA 4A98A 4IE0A 3IHRA 4UVAB 4BAYB 5KX5E 1WYCA 3OBVE 2VKDA 4UV8B 5LG3A 2FUPA 3C4ZA 4JI1T 3UQ7A 5HCMA 3PJAA 3HKBE 4KUMB 4NUUA 5FVKA 3RIUA 5CFBA 1IBMT 3CKDA 5AQHB 2V7LA 3NZPA 4UR9A 4H9QC 4DIDB 4ZHQE 1D0ZA 3RKGA 1W9RA 3AEDA 3J7Yq 2NW8A 2LSGA 3P50A 2M6BA 4JI5T 5HEUA 1OXZA 4CI2B 4IE4A 3RYCE 3FZFB 3C64A 2BS4A 4U33A 3GWHA 3FBLA 3HKCE 2XZEA 2LOSA 2W4XA 3PJAJ 2KWHA 5EK3A 1CHUA 2CLYC 2EHOB 2E2AA 3PUSA 1HX8A 3RX6A 1OWAA 4COFA 5L47A 3EVYA 2V6YA 3C4WA 2IHR1 3WAKA 3R84B 5LJMA 2Y6XA 4YT0A 4OYKA 3ZYMA 4I43B 4ILAA 4GOUA 5F5WA 5FVLA 5HXRA 1U4QA 3ZYLA 4AKRB 2JIWA 4LF7T 4BJMA 1BR1A 4GK5E 3NBXX 1HFAA 1M7KA 3AAEB 4IHJE 3I1AA 5CJ5A 5JDLA 3ONJA 1UX4A 1D1CA 2FJEA 3LDQB 4NPPA 5FMNA 4DR3T 3VU7H 2YDSA 3Q9DA 1V9DA 5LA6E 1D0YA 3JC6D 4IL9A 3C98B 4QWNB 4OX9T 1NEKA 3KVAA 2WAUA 5DQWA 2V7KA 1KNPA 4JV5T 3PV0F 1BR4A 3MZKB 4EOZB 3A8YC 3AAAB 3CQGB 1JNRA 2C0SA 3MK7C 3NZQA 1E1HB 2CWOA 2IUBA 4OFZA 3RKOA 1MMGA 4X64T 3FZLB 3PUAA 5ADXL 2CMRA 4DNDA 3DJBA 5JDFA 4AQYT 1HNZT 4TNWA 3ONLC 4UEMA 2WWVA 3T8OA 2VVSA 3AAIA 3FXDB 4QXCB 4QH1A 5AQJB 2UU9T 1OEDE 2J47A 4ISSA 3QB5A 2K48A 4JBWF 5DJQC 5JDHA 5H6RB 4UVBB 2MTQA 5LOVE 4DV2T 2LRLA 3N2OA 3JC6C 5JDQA 4DR4T 3N2KE 5E0OA 5LGUB 3L39A 3EDVA 2E9XB 2M6IA 4L5GA 1ZP0A 4C91A 2X0HA 2LSJA 4H63V 4P09A 2Q9QD 1HS7A 2WBLA 3F57A 4ISTA 4PK5A 2FJBA 3UUXB 2YEVC 4KHPT 4HE8A 4WZXA 2ACZA 2UXXB 4B3TT 4CZZB 3HKEE 2MBGA 1X9BA 2R6GF 3NKZA 4DMWA 2VWAA 4LF8T 1YQ4A 2DL1A 4ZI3C 3RF1A 5ABEA 2UUAT 1R8IA 3QUJA 4KBMB 3RYIE 4LFAT 5JRCB 2E9XD 5LGNB 1US7B 4MHCA 4FJOA 4YHHT 2YU2A 4F8HA 3EHZA 2X9WA 3TLUA 5LCYA 3OYZA 2RPAA 2BG9E 2WU5A 2BBHA 3UFGA 1GQEA 3RLFF 4O4LE 4G2AA 1LRZA 2XAJB 3LBXA 3PU3A 5L4EA 1IAPA 4ZI2C 2H7VC 5AQMB 3AEFA 1O3XA 3U78A 1UCUA 1Y01A 2VK9A 3UU5A 3RIUC 1E7PA 2HPJA 2XM1A 2VURA 4TN7B 4X1YE 4Z90A 3SS1A 2LJLA 3F2EA 1U5PA 3OKQA 3ZYKA 2D0UA 5LGTB 4JI7T 2W0GA 4O2AE 1SE7A 2DCFA 3JAEA 3L09A 5IYZE 1QUUA 2DWGA 3HA4A 4IE5A 3PUZF 4EEBA 4DV6T 3UU4A 4YTMA 4IDQA 5EK4A 4DV4T 3BQKA 2LKGA 3FHNA 4V1Av 5JDNA 4YXDA 1IBLT 1LVKA 3M65A 3LSVA 5HEGA 2J4GA 3I9YA 5AQKB 1AJ3A 4Z8XA 5L3GB 4DV5T 1CUNA 5AQPB 3ZMTB 3CIRA 3B5MA 4OK0A 5TAOA 1T72A 2WS3A 2ZM2A 3KVBA 3Q5DA 5AQNB 2WZIA 4B6XA 3ZN1B 4AKGA 1OEDB 4PFOA 1FMWA 3Q5XA 2HN1A 3AVSA 2Q9QB 3LG7A 3AE5A 3UUBA 2XAFB 4YSZA 4CXYA 4DR7T 2MPKA 4YLHA 3FBZA 4NXNT 4NIQA 3TLVA 2N2NA 2QYWA 5BMVE 1BR0A 2NTXA 3ONXA 4L0RA 2V26A 4QKNA 4X5TA 2N9DA 4H9RC 2LHNA 2XAGB 4KI0F 4TX5A 4K0KT 3B13A 2I6HA 2OV9A 2XUEA 2W00A 1KK7A 3FXEB 4TZ4C 5FXXA 3W15B 4AISA 3PUXF 3ZEFB 1KF6A 5GONE 4NXMT 5KDMC 2KNDA 3Q2MA 4XZCA 3CQCB 4B3RT 5CB4E 2LHRA 4L9IA 4HWCA 3ETVA 2RA1A 4PJJA 4KMCA 2I0MA 3UTKA 3UUMA 4EIWA 3ZKRA 4YJ3E 5CA0E 2YU1A 2YOEA 2JMKA 2LRKA 2DHRA 2FJDA 2FJAA 2J1DG 4HFDA 2LKHA 4MALA 4H9NC 4JUYA 4TNVA 5DABA 3CWZB 4IL4A 2D9DA 3KV5A 5HWXA 1BR2A 4O4JE 2W2UA 3C4XA 2CXLA 4KHZF 1MMDA 2UXDT 4ILUA 3AA1B 2VB6A 5C2TA 5FKYA 1XZYA 3N9LA 2E9XA 2W67A 2ODUA 4QH5A 4EYYR 5AQTB 2WB5A 3P4QA 5CGMA 2CXDA 3SWHA 2XQ6A 5L2LA 3FZKB 5FY1A 5J1GA 3UQ4A 4IE6A 3T1HT 3ZMZB 2K5BB 2PJQA 1HNXT 2K24A 4U3CA 1T8BA 5AQGB 5AQVB 3N9PA 4IDOA 3RRWA 4CN4A 5JH7E 2LE8A 5L3FB 3L3PA 3TKLB 4I0UA 5J2TE 2E5LT 1YD8G 4JI4T 1D1AA 3OTOT 3MXZA 1ZEEA 2X9XA 4LMKA 1FEWA 4UXNB 3LK3B 5HEOA 1YXRA 3H37A 4TUYE 2A2FX 5C8YE 4ZI7E 5M4YA 5H6QB 1B7TA 3V5SA 5EK2A 3FZMB 4AQFA 1VOMA 1HCIA 3VKHA 3S4UA 4LFCT 4MFRA 4U72A 4A97A 4ZI2D 2KMFA 2IDOB 2E5VA 3PE0A 1IJ5A 2OLTA 1ZKEA 1IBKT 5HWYA 5FXZA 1MMNA 2XHEB 3PU8A 4I4TE 3A7MA 2ES0A 4PK4A 5HAXA 1S35A 4IT4A 1W0AA 2ODVA 3AEBA 2LLYA 5FY0A 4JI8T 3KBTA 4HFCA 4GKJT 2WCAA 3TLWA 2VQET 3RC8A 5ABGA 3KV6A 4CXWA 1T7SA 2WQYA 3NWIA 4DBRA 2V6YB 1KNZA 4DV0T 3LFMA 3PTRB 2X9HA 1L0VA 3HL6A 2Y8DA 4TV8E 4KX6A 3D0TA 4U2YA 3QNUA 1KNRA 2MAWA 5JVDE 2YDRA 3BK9A 4PW8A 2EHOC 2CLYB 2XQ4A 5FXWA 2VKHA 5J0ZA 5ABFA 2VASA 1NWMX 4HFBA 4AIUA 2XQAA 1SHZC 3U3IA 3GN5A 1FJGT 3VRAA 4DBQA 4O8SA 4CXXA 3EI0A 4E7ZA 5HCJA 4ILCA 1XNQT 2CRBA 2UUBT 2CM0A 3PUYF 1MIYA 3TLSA 5HEJA 2BVLA 3WI3A 3IA3A 4PJNA 2XQ5A 2VL8A 2BKOA 3KFWX 3MA9A 2Z6EA 4UELA 2H88A 2WZHA 2NW9A 3ZCJA 3AE3A 4B3MT 1Z0PA 2H7OA 2KT9A 3SFEA 3ZSTA 5FP3A 5HXEA 2JQQA 1Z8UA 2ZMAA 1DU2A 3HR0A 4MLKA 4YSYA 2QRXA 2IAKA
chains in the Genus database with same CATH topology
1G73A 2KWIB 4DMVA 3O1IA 2A3DA 3ESLA 2MYSA 1QSDA 2V7JA 4M1PA 4PNIA 5LHIB 2CWYA 4QXHB 3UULA 5IHYA 2LOPA 1EZ3A 2Q9QA 5JDGA 5LNKA 1WYBA 4XAXB 1ZV4X 3H3AA 5JR9B 4HEAA 3K8PC 4HTEA 2LM9A 3EDUA 3E22E 4CI1B 5LJNA 4AKLA 4GK0E 3FB2A 5JQGE 3RYHE 3K3QC 2XAHB 2W61A 3MACA 1MNDA 3RC3A 4BJNA 3O9XA 2IC6A 2Q9QC 3CX7B 2MOZA 5HXCA 4WBOA 3MKDA 4PJLA 4ADZA 5EZYE 3VKGA 2WWUA 3I9WA 2L9QA 4U74A 3QC9A 4CQIA 3C51A 1D0XA 3ZN0B 2V7MA 3ANWA 2V7IA 3F31A 4X1KE 5J2UE 4HGAA 1MIVA 3O4XE 3NRXA 4MBQA 5FYMA 2RP4A 2CCQA 4HFVA 5JREA 4NUVA 2BZBA 3EUHA 2LSIA 2CXFA 3KINB 4AXPA 4AKHA 1LVFA 2JRKA 4HKAA 4H9SE 4H63H 2PFVA 4QX7B 4C90A 4IE7A 4WNKA 3LK42 4K0UA 3HI2A 5HYAA 5JRCA 4PJMA 3UT5E 3N5LA 3VHLA 4DO0A 5LYJE 2D0TA 4ZS3A 1NAFA 2PBIA 3C50A 3PUGA 4IDZA 1D1BA 3SOLA 3CX8B 4F6RC 4O4HE 2XAQB 4HN9A 4TV9E 1HTJF 2DWKA 2LSYA 1MNEA 4WW0A 3ZCIA 1WLXA 3RH3A 1MMAA 4ERRA 2JMHA 2YK0A 2N1GA 3ZMVB 5FXVA 1SA0E 2X0LB 5JDMA 2P9BA 2WMNA 3ANWB 4H9OC 3ZC0A 3KV9A 3QK6A 2WMOA 4N78D 2G0UA 5DQVA 4X20E 4A56A 3GA8A 2QGSA 4FI5A 4UF0A 5LBQB 3CX6B 4PAGA 3GMIA 3NRYA 3K3OA 1MIWA 2QA7A 3HKDE 3KV4A 5LBMA 4EYUA 2C5IT 4UIGA 3RPUA 2YINA 4QHOA 5ETWA 2ACXA 4IIJE 2B1EA 5F8PA 4ZOLE 2DI4A 1IJ6A 2IW5B 4UF0B 4YHJA 5JR9A 5AFUL 4CI3B 3IEEA 2VKOA 2V1DB 2E8IA 3PDYA 3P8CD 4J2CA 2EHOD 2ZM8A 2EHOA 3A5XA 3MJXA 4IGUA 1S94A 3P7IA 3Q5WA 2CEAA 3O1JA 2OA5A 2UXNB 5F3JA 4ANJA 5L3BB 1T98A 2BVMA 4AI6A 1YKEB 3LJCA 2WM9A 5A1LA 1YKHB 3OJAA 2C5KT 2C5JA 3CMLA 3ZLIA 3IF8B 4EXTA 3WAJA 5HXSA 3AA6B 2SPCA 4QXBB 2X67A 5LHHB 2XASB 4BA9A 2VKJA 1HG2A 2KLQA 4GYRA 4OHFA 4EZHA 2NTYA 3LBXB 3R6NA 5JR9C 3BQIA 1ZHCA 2JPFA 3ZPOA 4DVDA 3OYXA 2W62A 3ZMSB 2LEHA 3PUQA 3ETUA 3GN5B 4QX8B 3CPZA 3ZMUB 3E08A 2M67A 1VRBA 3RYFE 5LP6E 2ZLYA 2E9XC 4AQFC 5HXHA 2ZM0A 2W63A 1WR6A 2H3RA 2Y48B 4GIWA 5L3EB 2NWBA 2CE7A 5CA1E 1WRDA 2D5UA 2XTLA 3N9NA 4YJ2E 4WBNE 3J9X1 4ASKA 3KDSE 3E0ZA 2KXPB 2I59A 3O1HA 2NP9A 2X9YA 2X66A 2K9AA 2KZ7B 2X51A 2NW7A 3N2GE 2A72A 4GYSA 2PG8A 4X1IE 3PURA 2WSSV 3BQLA 4PFPA 3KBUA 3UUNA 1Y64B 2HH7A 5FNVE 1X79A 2DLRA 4YFSA 4KP3C 1HF8A 1HG5A 4O4IE 3ZC1A 4ZI3D 2JJ9A 2L8KA 3AA7B 3AVRA 3V5UA 5LXTE 4UVCB 3AA0B 3UFEA 2XQYA 5L3CB 3DP7A 1G8XA 4G63A 4I55E 3I0QA 4ZS2A 3I0OA 2HPLA 5FY7A 5LHGB 4O2BE 5L3DB 4P0BA 3AB3B 2DNXA 4EAHA 4JLEA 4EB6E 3N9QA 4JEUB 2GK9A 1FMVA 2CA5A 2D2SA 3IBPA 4UV9B 4XBFB 2BDEA 3DTOA 4PK6A 3ZJ1A 3N9MA 5LG4A 3K3NA 1FIOA 2LSKA 3CQXC 2IC9A 4AKIA 3N9OA 4JEHB 3LK2B 1H7CA 4EZ4A 1UX5A 1LKXA 2LT3A 3RRCA 2X68A 5KMGP 4H9PC 4I50E 3CVRA 4AQGA 3B57A 2KINB 1YW0A 2L3LA 2NOXA 4E7SA 4IE0A 3IHRA 4UVAB 4BAYB 5KX5E 1WYCA 3OBVE 2VKDA 4UV8B 3C4ZA 3HKBE 4KUMB 4NUUA 3CKDA 2V7LA 3NZPA 4H9QC 4ZHQE 1D0ZA 3J7Yq 2NW8A 2LSGA 1OXZA 4CI2B 4IE4A 3RYCE 3C64A 3GWHA 3FBLA 3HKCE 2LOSA 2KWHA 5EK3A 2EHOB 2CLYC 3PUSA 3RX6A 1HX8A 1OWAA 3EVYA 3C4WA 3WAKA 3R84B 5LJMA 2Y6XA 4OYKA 3ZYMA 4I43B 4GOUA 5HXRA 4AKRB 1U4QA 3ZYLA 4BJMA 1BR1A 4GK5E 3NBXX 1HFAA 3AAEB 4IHJE 3I1AA 5JDLA 1UX4A 1D1CA 5FMNA 3VU7H 3Q9DA 1V9DA 5LA6E 1D0YA 3JC6D 3C98B 4QWNB 3KVAA 2WAUA 5DQWA 2V7KA 1BR4A 3MZKB 4EOZB 3AAAB 3CQGB 3NZQA 2C0SA 3MK7C 4OFZA 1E1HB 2CWOA 4OYJA 3RKOA 1MMGA 3PUAA 5ADXL 2CMRA 4DNDA 3DJBA 5JDFA 3ZJ2A 4UEMA 3T8OA 4P0AA 3AAIA 3FXDB 4QXCB 3VKHA 4ISSA 2K48A 5DJQC 5JDHA 5H6RB 4UVBB 2MTQA 5LOVE 3N2OA 3JC6C 5JDQA 3N2KE 5E0OA 5LGUB 3EDVA 2E9XB 4L5GA 4C91A 2LSJA 4H63V 4P09A 2Q9QD 1HS7A 2WBLA 3F57A 4ISTA 4PK5A 3UUXB 2YEVC 4HE8A 2UXXB 4CZZB 3HKEE 2MBGA 4DMWA 2VWAA 4ZI3C 3QUJA 3RYIE 4KBMB 5JRCB 2E9XD 5LGNB 1US7B 4MHCA 4FJOA 2YU2A 2X9WA 5LCYA 3OYZA 4O4LE 4G2AA 1LRZA 2XAJB 3LBXA 3PU3A 1IAPA 4ZI2C 2H7VC 3U78A 1O3XA 1UCUA 2VK9A 4TN7B 2HPJA 3SS1A 4X1YE 5LGTB 2LJLA 3F2EA 1U5PA 3OKQA 3ZYKA 2D0UA 2W0GA 4O2AE 3SRZA 2DCFA 3L09A 5IYZE 1QUUA 2DWGA 3HA4A 4IE5A 5EK4A 3BQKA 3FHNA 4V1Av 5JDNA 1LVKA 3M65A 3I9YA 1AJ3A 4Z8XA 5L3GB 1CUNA 3ZMTB 4OK0A 5TAOA 3KVBA 2ZM2A 4AKGA 4B6XA 3ZN1B 4PFOA 1FMWA 3Q5XA 3AVSA 2Q9QB 3LG7A 4CXYA 2XAFB 4YLHA 3FBZA 2N2NA 5BMVE 2NTXA 3ONXA 4L0RA 2V26A 4QKNA 2N9DA 4H9RC 2LHNA 2XAGB 4TX5A 3B13A 5FXXA 2XUEA 2W00A 1KK7A 3FXEB 4TZ4C 3W15B 3ZEFB 5GONE 5KDMC 2KNDA 3Q2MA 4XZCA 3CQCB 5CB4E 2LHRA 4L9IA 3ETVA 2RA1A 4PJJA 4KMCA 3UTKA 3UUMA 4EIWA 5CA0E 1BR0A 4YJ3E 2YU1A 2JMKA 2DHRA 2J1DG 4MALA 5DABA 4H9NC 4JUYA 5HWXA 3CWZB 3KV5A 1BR2A 4O4JE 3C4XA 2CXLA 1MMDA 4ILUA 3AA1B 2VB6A 3N9LA 2E9XA 2ODUA 4EYYR 2CXDA 3SWHA 5L2LA 5FY1A 5J1GA 4IE6A 3ZMZB 2K5BB 2PJQA 2K24A 3RRWA 3N9PA 5JH7E 2LE8A 5L3FB 3L3PA 3TKLB 5J2TE 1YD8G 1D1AA 3MXZA 1ZEEA 2X9XA 1FEWA 4UXNB 3LK3B 4TUYE 3H37A 5C8YE 2A2FX 4ZI7E 5M4YA 5H6QB 1B7TA 3V5SA 5EK2A 4AQFA 1VOMA 1HCIA 3S4UA 4MFRA 4U72A 4ZI2D 2KMFA 3PE0A 1IJ5A 1ZKEA 5HWYA 5FXZA 1MMNA 2XHEB 3PU8A 4I4TE 2ES0A 4PK4A 5HAXA 1S35A 2ODVA 5FY0A 3KBTA 3RC8A 3KV6A 4CXWA 4DBRA 1KNZA 3LFMA 3PTRB 2X9HA 3HL6A 2Y8DA 4TV8E 3D0TA 5JVDE 3BK9A 4PW8A 2EHOC 2CLYB 5FXWA 2VKHA 2VASA 1NWMX 1SHZC 3U3IA 3GN5A 4DBQA 4O8SA 4CXXA 4E7ZA 2CM0A 1MIYA 2BVLA 3WI3A 4PJNA 2VL8A 3KFWX 3MA9A 4UELA 2Z6EA 3ZCJA 2NW9A 1Z0PA 2H7OA 2KT9A 5HXEA 5FP3A 2JQQA 2ZMAA 3HR0A 4MLKA 1IZNB 2IAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBL A;  3F2E A;  3J9X 1;  3FBZ A; 
#chains in the Genus database with same CATH topology
 2H89 A;  1G73 A;  5AQU B;  1J5W A;  2KWI B;  4DMV A;  3VRB A;  3O1I A;  5AQO B;  2A3D A;  3ESL A;  2JQH A;  4YTP A;  1XMQ T;  2MYS A;  5FL0 A;  1QSD A;  2V7J A;  3JAD A;  4M1P A;  1J5E T;  4ZZB A;  4PNI A;  5LHI B;  2CWY A;  4QXH B;  3RGL A;  3UUL A;  2JQK A;  5IHY A;  2LOP A;  1EZ3 A;  2XM2 A;  4DV3 T;  2Q9Q A;  5JDG A;  5LNK A;  3AXJ B;  1WYB A;  2J62 A;  4XAX B;  1ZV4 X;  3H3A A;  5JR9 B;  1OED A;  2V8S V;  1N36 T;  4HEA A;  2HHH T;  2BS2 A;  3K8P C;  4P1N A;  4HTE A;  2LM9 A;  3EDU A;  3E22 E;  1E2A A;  4ZZC A;  3AE8 A;  4CI1 B;  5LJN A;  4AKL A;  1YQ3 A;  4GK0 E;  2BG9 B;  3ZJ2 A;  3FB2 A;  4JI0 T;  5JQG E;  3RYH E;  3K3Q C;  2XAH B;  5JTG A;  3AEC A;  2W61 A;  5LB7 B;  3MAC A;  1I6Z A;  1MND A;  3RC3 A;  2IML A;  1OED C;  3K1S A;  4BJN A;  3O9X A;  2XSB A;  3P4W A;  2IC6 A;  2Q9Q C;  3CX7 B;  2MOZ A;  5HXC A;  3SRZ A;  4U2Z A;  4X62 T;  4WBO A;  3MKD A;  3AE9 A;  4PJL A;  2PTF A;  4ADZ A;  2UXB T;  5EZY E;  3VKG A;  2WWU A;  3I9W A;  2L9Q A;  4U74 A;  3QC9 A;  4CQI A;  5KXJ A;  5AQS B;  3C51 A;  1D0X A;  3ZN0 B;  2V7M A;  2WDV A;  3ANW A;  2V7I A;  3F31 A;  4X1K E;  3X1D A;  1WFD A;  5J2U E;  4HGA A;  1MIV A;  3O4X E;  3NRX A;  4MBQ A;  5FYM A;  2YKS A;  4IDP A;  2RP4 A;  3AEG A;  2CCQ A;  3EAB A;  2WY2 A;  4HFV A;  4LML A;  4Q25 A;  3ZSS A;  5JRE A;  1N32 T;  4NUV A;  2XPK A;  2XQ9 A;  2BZB A;  2NR4 A;  1HX1 B;  4A5X A;  3EUH A;  3ZT6 A;  3SFD A;  2LSI A;  4HFE A;  3OVU A;  5ABH A;  2CXF A;  3KIN B;  5AQF B;  4AXP A;  4AKH A;  3L8R A;  1LVF A;  4JI6 T;  2JRK A;  5IWA T;  4HKA A;  4H9S E;  4H63 H;  2PFV A;  4OYJ A;  4QX7 B;  3RI5 A;  3UU3 A;  4C90 A;  4IE7 A;  4WNK A;  3LK4 2;  2VQF T;  1WCR A;  3AE1 A;  4LF9 T;  4K0U A;  3HI2 A;  1UUR A;  5HYA A;  3JCF A;  5JRC A;  4PJM A;  3UT5 E;  3N5L A;  3VHL A;  2HN2 A;  4DO0 A;  4ZEY A;  2D0T A;  5LYJ E;  4DR1 T;  4ZS3 A;  1NAF A;  2PBI A;  2FBW A;  2V5C A;  3C50 A;  3PUG A;  3PUV F;  5BR8 T;  1UUS A;  4IDZ A;  2UUC T;  1D1B A;  3SOL A;  3CX8 B;  4F6R C;  2CHN A;  4O4H E;  2XAQ B;  4HN9 A;  4TV9 E;  4EED A;  1HTJ F;  2DWK A;  2CPT A;  2LSY A;  1MNE A;  4WW0 A;  3ZCI A;  4DR2 T;  1WLX A;  1JNZ A;  2AE9 A;  3RH3 A;  1MMA A;  4ERR A;  2JMH A;  2YK0 A;  2N1G A;  3ZMV B;  5LMU T;  5FXV A;  1SA0 E;  2X0L B;  5JDM A;  2P9B A;  3UU8 A;  2WMN A;  3QOF A;  4P0A A;  1XWM A;  3ANW B;  4H9O C;  4WYV A;  3ZC0 A;  3KV9 A;  3M3Z B;  3QK6 A;  2WMO A;  4N78 D;  2G0U A;  4X65 T;  3T1Y T;  4LMJ A;  2XY8 B;  5DQV A;  4X20 E;  4A56 A;  4EGW A;  3GA8 A;  2AXD S;  2QGS A;  1ZOY A;  1J1J A;  4FI5 A;  4IRE A;  4UF0 A;  3CX6 B;  4TWD A;  4ZXL A;  5LBQ B;  4PAG A;  4DUZ T;  2BKP A;  3GMI A;  3JAF A;  3K3O A;  3NRY A;  3NVO A;  1MIW A;  2XQ7 A;  2QA7 A;  4JI2 T;  3HKD E;  3KV4 A;  5LBM A;  3RIF A;  4EYU A;  2C5I T;  2VVN A;  4JYA T;  4UIG A;  3RPU A;  2YIN A;  3FZH B;  4QHO A;  5AQL B;  3CK6 A;  5AQQ B;  3ZT7 A;  5ETW A;  2ACX A;  1KFY A;  4IIJ E;  4U7Y A;  2B1E A;  5F8P A;  4JI3 T;  4DUY T;  4ZOL E;  2DI4 A;  2BBJ A;  2ZM6 T;  1IJ6 A;  1N33 T;  4ILB A;  2X0Y A;  2IW5 B;  4UF0 B;  4YHJ A;  5JR9 A;  5AFU L;  4CI3 B;  3IEE A;  2YDQ A;  3AE4 A;  3RIA A;  2VKO A;  4YSX A;  3P4S A;  3AEA A;  2V1D B;  2E8I A;  3PDY A;  3P8C D;  4J2C A;  5HEH A;  4TWH A;  2EHO D;  2ZM8 A;  5FL1 A;  2XQ8 A;  4HWF A;  2EHO A;  3A5X A;  3MJX A;  4IGU A;  1S94 A;  3P7I A;  3Q5W A;  2WP9 A;  2CEA A;  3O1J A;  2OA5 A;  2UXN B;  4HFI A;  2BG9 A;  1W0B A;  4ANJ A;  5F3J A;  5L3B B;  2CBI A;  1T98 A;  3EAM A;  2BVM A;  1KEY A;  5AQI B;  1YKE B;  3LJC A;  4AI6 A;  2WM9 A;  4HWH A;  5A1L A;  4DR6 T;  1YKH B;  3OJA A;  4HWD A;  2C5K T;  1XDO A;  2C5J A;  3CML A;  4DV1 T;  2XSA A;  3AXJ A;  2WDQ A;  3IF8 B;  3ZLI A;  4EXT A;  5HXS A;  3WAJ A;  3AA6 B;  2SPC A;  4QXB B;  2X67 A;  5LHH B;  2XQ3 A;  2XAS B;  4IDN A;  4BA9 A;  2VKJ A;  1HG2 A;  2KLQ A;  4GYR A;  2K3W A;  4OHF A;  4EZH A;  4HFH A;  2NTY A;  3LBX B;  3Q5E A;  3R6N A;  3BQI A;  1ZHC A;  2JPF A;  3ZPO A;  4DVD A;  5JR9 C;  3OYX A;  2W62 A;  3ZMS B;  2LEH A;  3ZT5 A;  3P4R A;  3PUQ A;  2CHO A;  3ETU A;  3GN5 B;  3OPC A;  1UGO A;  3AE7 A;  3CPZ A;  4QX8 B;  3E08 A;  3ZMU B;  4CN6 A;  2F4V T;  2BG9 C;  1VRB A;  2M67 A;  3RYF E;  5LP6 E;  1HNW T;  2ZLY A;  2E9X C;  4AQF C;  5HXH A;  2ZM0 A;  3ABV A;  2W63 A;  1WR6 A;  2H3R A;  2Y48 B;  5IUX A;  4U31 A;  4EV6 A;  4GIW A;  4LF5 T;  5L3E B;  2NWB A;  2CE7 A;  1NEN A;  1WR0 A;  1WRD A;  2D5U A;  2XTL A;  3N9N A;  5CA1 E;  3AEE A;  2UXC T;  4YJ2 E;  4WBN E;  1IZN B;  3J9X 1;  4ASK A;  3KDS E;  3E0Z A;  2KXP B;  4DV7 T;  2I59 A;  3AE6 A;  3O1H A;  3VR9 A;  1QLB A;  2NP9 A;  2X9Y A;  1XNR T;  2X66 A;  2K9A A;  2A9U A;  2KZ7 B;  2NW7 A;  2X51 A;  3P4P A;  3N2G E;  4B3S T;  4X66 T;  2A72 A;  4GYS A;  2PG8 A;  4X1I E;  5ABF B;  3PUR A;  2WSS V;  3BQL A;  4PFP A;  5AQR B;  3RQU A;  2B76 A;  3KBU A;  3UUN A;  1Y64 B;  4LFB T;  2HH7 A;  1N34 T;  5FNV E;  1X79 A;  2DLR A;  2WU2 A;  2KSR A;  4YFS A;  3QB5 K;  4KP3 C;  1XDP A;  3AE2 A;  2BS3 A;  1HF8 A;  3UU6 A;  1HG5 A;  4O4I E;  1HR0 T;  3ZC1 A;  4LF6 T;  2LM2 A;  4ZI3 D;  2JJ9 A;  2L8K A;  3AA7 B;  3AVR A;  3V5U A;  2CBJ A;  4DR5 T;  5LXT E;  4YY3 T;  4UVC B;  2YN6 A;  3AA0 B;  3UFE A;  3PUW F;  4QH4 A;  2XQY A;  5L3C B;  3DP7 A;  1G8X A;  4G63 A;  4I55 E;  3I0Q A;  1I94 T;  4ZS2 A;  2WDR A;  1M62 A;  2HPL A;  3I0O A;  5FY7 A;  4O2B E;  5LHG B;  1W09 A;  4HWI B;  2XJ7 A;  4P0B A;  5L3D B;  3AB3 B;  2DNX A;  2JQ9 A;  4EAH A;  4JLE A;  1XMO T;  2IIU A;  2V5D A;  5C3J A;  5LMN T;  4EB6 E;  3N9Q A;  4JEU B;  2GK9 A;  4YTN A;  1FMV A;  2CA5 A;  1SUM B;  2D2S A;  3IBP A;  4UV9 B;  4XBF B;  2BDE A;  3DTO A;  4PK6 A;  3ZJ1 A;  3N9M A;  3RQW A;  5LG4 A;  4TWF A;  3K3N A;  1FIO A;  2LSK A;  3CQX C;  2IC9 A;  4Z91 A;  5L4H A;  4GKK T;  4AKI A;  3N9O A;  4JEH B;  3RHW A;  2VL0 A;  1UK5 A;  3LK2 B;  4CN1 A;  1H7C A;  4LF4 T;  4EZ4 A;  1UX5 A;  1LKX A;  2LT3 A;  3TLT A;  3RRC A;  2X68 A;  5KMG P;  2QVA A;  2BKN A;  4H9P C;  3G06 A;  2W66 A;  4I50 E;  3CVR A;  4AQG A;  3B57 A;  3H3M A;  1VCT A;  3VR8 A;  2V6X A;  4U7I A;  2KIN B;  1YW0 A;  2L3L A;  2NOX A;  1VCS A;  4E7S A;  4A98 A;  4IE0 A;  3IHR A;  4UVA B;  4BAY B;  5KX5 E;  1WYC A;  3OBV E;  2VKD A;  4UV8 B;  5LG3 A;  2FUP A;  3C4Z A;  4JI1 T;  3UQ7 A;  5HCM A;  3PJA A;  3HKB E;  4KUM B;  4NUU A;  5FVK A;  3RIU A;  5CFB A;  1IBM T;  3CKD A;  5AQH B;  2V7L A;  3NZP A;  4UR9 A;  4H9Q C;  4DID B;  4ZHQ E;  1D0Z A;  3RKG A;  1W9R A;  3AED A;  3J7Y q;  2NW8 A;  2LSG A;  3P50 A;  2M6B A;  4JI5 T;  5HEU A;  1OXZ A;  4CI2 B;  4IE4 A;  3RYC E;  3FZF B;  3C64 A;  2BS4 A;  4U33 A;  3GWH A;  3FBL A;  3HKC E;  2XZE A;  2LOS A;  2W4X A;  3PJA J;  2KWH A;  5EK3 A;  1CHU A;  2CLY C;  2EHO B;  2E2A A;  3PUS A;  1HX8 A;  3RX6 A;  1OWA A;  4COF A;  5L47 A;  3EVY A;  2V6Y A;  3C4W A;  2IHR 1;  3WAK A;  3R84 B;  5LJM A;  2Y6X A;  4YT0 A;  4OYK A;  3ZYM A;  4I43 B;  4ILA A;  4GOU A;  5F5W A;  5FVL A;  5HXR A;  1U4Q A;  3ZYL A;  4AKR B;  2JIW A;  4LF7 T;  4BJM A;  1BR1 A;  4GK5 E;  3NBX X;  1HFA A;  1M7K A;  3AAE B;  4IHJ E;  3I1A A;  5CJ5 A;  5JDL A;  3ONJ A;  1UX4 A;  1D1C A;  2FJE A;  3LDQ B;  4NPP A;  5FMN A;  4DR3 T;  3VU7 H;  2YDS A;  3Q9D A;  1V9D A;  5LA6 E;  1D0Y A;  3JC6 D;  4IL9 A;  3C98 B;  4QWN B;  4OX9 T;  1NEK A;  3KVA A;  2WAU A;  5DQW A;  2V7K A;  1KNP A;  4JV5 T;  3PV0 F;  1BR4 A;  3MZK B;  4EOZ B;  3A8Y C;  3AAA B;  3CQG B;  1JNR A;  2C0S A;  3MK7 C;  3NZQ A;  1E1H B;  2CWO A;  2IUB A;  4OFZ A;  3RKO A;  1MMG A;  4X64 T;  3FZL B;  3PUA A;  5ADX L;  2CMR A;  4DND A;  3DJB A;  5JDF A;  4AQY T;  1HNZ T;  4TNW A;  3ONL C;  4UEM A;  2WWV A;  3T8O A;  2VVS A;  3AAI A;  3FXD B;  4QXC B;  4QH1 A;  5AQJ B;  2UU9 T;  1OED E;  2J47 A;  4ISS A;  3QB5 A;  2K48 A;  4JBW F;  5DJQ C;  5JDH A;  5H6R B;  4UVB B;  2MTQ A;  5LOV E;  4DV2 T;  2LRL A;  3N2O A;  3JC6 C;  5JDQ A;  4DR4 T;  3N2K E;  5E0O A;  5LGU B;  3L39 A;  3EDV A;  2E9X B;  2M6I A;  4L5G A;  1ZP0 A;  4C91 A;  2X0H A;  2LSJ A;  4H63 V;  4P09 A;  2Q9Q D;  1HS7 A;  2WBL A;  3F57 A;  4IST A;  4PK5 A;  2FJB A;  3UUX B;  2YEV C;  4KHP T;  4HE8 A;  4WZX A;  2ACZ A;  2UXX B;  4B3T T;  4CZZ B;  3HKE E;  2MBG A;  1X9B A;  2R6G F;  3NKZ A;  4DMW A;  2VWA A;  4LF8 T;  1YQ4 A;  2DL1 A;  4ZI3 C;  3RF1 A;  5ABE A;  2UUA T;  1R8I A;  3QUJ A;  4KBM B;  3RYI E;  4LFA T;  5JRC B;  2E9X D;  5LGN B;  1US7 B;  4MHC A;  4FJO A;  4YHH T;  2YU2 A;  4F8H A;  3EHZ A;  2X9W A;  3TLU A;  5LCY A;  3OYZ A;  2RPA A;  2BG9 E;  2WU5 A;  2BBH A;  3UFG A;  1GQE A;  3RLF F;  4O4L E;  4G2A A;  1LRZ A;  2XAJ B;  3LBX A;  3PU3 A;  5L4E A;  1IAP A;  4ZI2 C;  2H7V C;  5AQM B;  3AEF A;  1O3X A;  3U78 A;  1UCU A;  1Y01 A;  2VK9 A;  3UU5 A;  3RIU C;  1E7P A;  2HPJ A;  2XM1 A;  2VUR A;  4TN7 B;  4X1Y E;  4Z90 A;  3SS1 A;  2LJL A;  3F2E A;  1U5P A;  3OKQ A;  3ZYK A;  2D0U A;  5LGT B;  4JI7 T;  2W0G A;  4O2A E;  1SE7 A;  2DCF A;  3JAE A;  3L09 A;  5IYZ E;  1QUU A;  2DWG A;  3HA4 A;  4IE5 A;  3PUZ F;  4EEB A;  4DV6 T;  3UU4 A;  4YTM A;  4IDQ A;  5EK4 A;  4DV4 T;  3BQK A;  2LKG A;  3FHN A;  4V1A v;  5JDN A;  4YXD A;  1IBL T;  1LVK A;  3M65 A;  3LSV A;  5HEG A;  2J4G A;  3I9Y A;  5AQK B;  1AJ3 A;  4Z8X A;  5L3G B;  4DV5 T;  1CUN A;  5AQP B;  3ZMT B;  3CIR A;  3B5M A;  4OK0 A;  5TAO A;  1T72 A;  2WS3 A;  2ZM2 A;  3KVB A;  3Q5D A;  5AQN B;  2WZI A;  4B6X A;  3ZN1 B;  4AKG A;  1OED B;  4PFO A;  1FMW A;  3Q5X A;  2HN1 A;  3AVS A;  2Q9Q B;  3LG7 A;  3AE5 A;  3UUB A;  2XAF B;  4YSZ A;  4CXY A;  4DR7 T;  2MPK A;  4YLH A;  3FBZ A;  4NXN T;  4NIQ A;  3TLV A;  2N2N A;  2QYW A;  5BMV E;  1BR0 A;  2NTX A;  3ONX A;  4L0R A;  2V26 A;  4QKN A;  4X5T A;  2N9D A;  4H9R C;  2LHN A;  2XAG B;  4KI0 F;  4TX5 A;  4K0K T;  3B13 A;  2I6H A;  2OV9 A;  2XUE A;  2W00 A;  1KK7 A;  3FXE B;  4TZ4 C;  5FXX A;  3W15 B;  4AIS A;  3PUX F;  3ZEF B;  1KF6 A;  5GON E;  4NXM T;  5KDM C;  2KND A;  3Q2M A;  4XZC A;  3CQC B;  4B3R T;  5CB4 E;  2LHR A;  4L9I A;  4HWC A;  3ETV A;  2RA1 A;  4PJJ A;  4KMC A;  2I0M A;  3UTK A;  3UUM A;  4EIW A;  3ZKR A;  4YJ3 E;  5CA0 E;  2YU1 A;  2YOE A;  2JMK A;  2LRK A;  2DHR A;  2FJD A;  2FJA A;  2J1D G;  4HFD A;  2LKH A;  4MAL A;  4H9N C;  4JUY A;  4TNV A;  5DAB A;  3CWZ B;  4IL4 A;  2D9D A;  3KV5 A;  5HWX A;  1BR2 A;  4O4J E;  2W2U A;  3C4X A;  2CXL A;  4KHZ F;  1MMD A;  2UXD T;  4ILU A;  3AA1 B;  2VB6 A;  5C2T A;  5FKY A;  1XZY A;  3N9L A;  2E9X A;  2W67 A;  2ODU A;  4QH5 A;  4EYY R;  5AQT B;  2WB5 A;  3P4Q A;  5CGM A;  2CXD A;  3SWH A;  2XQ6 A;  5L2L A;  3FZK B;  5FY1 A;  5J1G A;  3UQ4 A;  4IE6 A;  3T1H T;  3ZMZ B;  2K5B B;  2PJQ A;  1HNX T;  2K24 A;  4U3C A;  1T8B A;  5AQG B;  5AQV B;  3N9P A;  4IDO A;  3RRW A;  4CN4 A;  5JH7 E;  2LE8 A;  5L3F B;  3L3P A;  3TKL B;  4I0U A;  5J2T E;  2E5L T;  1YD8 G;  4JI4 T;  1D1A A;  3OTO T;  3MXZ A;  1ZEE A;  2X9X A;  4LMK A;  1FEW A;  4UXN B;  3LK3 B;  5HEO A;  1YXR A;  3H37 A;  4TUY E;  2A2F X;  5C8Y E;  4ZI7 E;  5M4Y A;  5H6Q B;  1B7T A;  3V5S A;  5EK2 A;  3FZM B;  4AQF A;  1VOM A;  1HCI A;  3VKH A;  3S4U A;  4LFC T;  4MFR A;  4U72 A;  4A97 A;  4ZI2 D;  2KMF A;  2IDO B;  2E5V A;  3PE0 A;  1IJ5 A;  2OLT A;  1ZKE A;  1IBK T;  5HWY A;  5FXZ A;  1MMN A;  2XHE B;  3PU8 A;  4I4T E;  3A7M A;  2ES0 A;  4PK4 A;  5HAX A;  1S35 A;  4IT4 A;  1W0A A;  2ODV A;  3AEB A;  2LLY A;  5FY0 A;  4JI8 T;  3KBT A;  4HFC A;  4GKJ T;  2WCA A;  3TLW A;  2VQE T;  3RC8 A;  5ABG A;  3KV6 A;  4CXW A;  1T7S A;  2WQY A;  3NWI A;  4DBR A;  2V6Y B;  1KNZ A;  4DV0 T;  3LFM A;  3PTR B;  2X9H A;  1L0V A;  3HL6 A;  2Y8D A;  4TV8 E;  4KX6 A;  3D0T A;  4U2Y A;  3QNU A;  1KNR A;  2MAW A;  5JVD E;  2YDR A;  3BK9 A;  4PW8 A;  2EHO C;  2CLY B;  2XQ4 A;  5FXW A;  2VKH A;  5J0Z A;  5ABF A;  2VAS A;  1NWM X;  4HFB A;  4AIU A;  2XQA A;  1SHZ C;  3U3I A;  3GN5 A;  1FJG T;  3VRA A;  4DBQ A;  4O8S A;  4CXX A;  3EI0 A;  4E7Z A;  5HCJ A;  4ILC A;  1XNQ T;  2CRB A;  2UUB T;  2CM0 A;  3PUY F;  1MIY A;  3TLS A;  5HEJ A;  2BVL A;  3WI3 A;  3IA3 A;  4PJN A;  2XQ5 A;  2VL8 A;  2BKO A;  3KFW X;  3MA9 A;  2Z6E A;  4UEL A;  2H88 A;  2WZH A;  2NW9 A;  3ZCJ A;  3AE3 A;  4B3M T;  1Z0P A;  2H7O A;  2KT9 A;  3SFE A;  3ZST A;  5FP3 A;  5HXE A;  2JQQ A;  1Z8U A;  2ZMA A;  1DU2 A;  3HR0 A;  4MLK A;  4YSY A;  2QRX A;  2IAK A; 
#chains in the Genus database with same CATH homology
 1G73 A;  2KWI B;  4DMV A;  3O1I A;  2A3D A;  3ESL A;  2MYS A;  1QSD A;  2V7J A;  4M1P A;  4PNI A;  5LHI B;  2CWY A;  4QXH B;  3UUL A;  5IHY A;  2LOP A;  1EZ3 A;  2Q9Q A;  5JDG A;  5LNK A;  1WYB A;  4XAX B;  1ZV4 X;  3H3A A;  5JR9 B;  4HEA A;  3K8P C;  4HTE A;  2LM9 A;  3EDU A;  3E22 E;  4CI1 B;  5LJN A;  4AKL A;  4GK0 E;  3FB2 A;  5JQG E;  3RYH E;  3K3Q C;  2XAH B;  2W61 A;  3MAC A;  1MND A;  3RC3 A;  4BJN A;  3O9X A;  2IC6 A;  2Q9Q C;  3CX7 B;  2MOZ A;  5HXC A;  4WBO A;  3MKD A;  4PJL A;  4ADZ A;  5EZY E;  3VKG A;  2WWU A;  3I9W A;  2L9Q A;  4U74 A;  3QC9 A;  4CQI A;  3C51 A;  1D0X A;  3ZN0 B;  2V7M A;  3ANW A;  2V7I A;  3F31 A;  4X1K E;  5J2U E;  4HGA A;  1MIV A;  3O4X E;  3NRX A;  4MBQ A;  5FYM A;  2RP4 A;  2CCQ A;  4HFV A;  5JRE A;  4NUV A;  2BZB A;  3EUH A;  2LSI A;  2CXF A;  3KIN B;  4AXP A;  4AKH A;  1LVF A;  2JRK A;  4HKA A;  4H9S E;  4H63 H;  2PFV A;  4QX7 B;  4C90 A;  4IE7 A;  4WNK A;  3LK4 2;  4K0U A;  3HI2 A;  5HYA A;  5JRC A;  4PJM A;  3UT5 E;  3N5L A;  3VHL A;  4DO0 A;  5LYJ E;  2D0T A;  4ZS3 A;  1NAF A;  2PBI A;  3C50 A;  3PUG A;  4IDZ A;  1D1B A;  3SOL A;  3CX8 B;  4F6R C;  4O4H E;  2XAQ B;  4HN9 A;  4TV9 E;  1HTJ F;  2DWK A;  2LSY A;  1MNE A;  4WW0 A;  3ZCI A;  1WLX A;  3RH3 A;  1MMA A;  4ERR A;  2JMH A;  2YK0 A;  2N1G A;  3ZMV B;  5FXV A;  1SA0 E;  2X0L B;  5JDM A;  2P9B A;  2WMN A;  3ANW B;  4H9O C;  3ZC0 A;  3KV9 A;  3QK6 A;  2WMO A;  4N78 D;  2G0U A;  5DQV A;  4X20 E;  4A56 A;  3GA8 A;  2QGS A;  4FI5 A;  4UF0 A;  5LBQ B;  3CX6 B;  4PAG A;  3GMI A;  3NRY A;  3K3O A;  1MIW A;  2QA7 A;  3HKD E;  3KV4 A;  5LBM A;  4EYU A;  2C5I T;  4UIG A;  3RPU A;  2YIN A;  4QHO A;  5ETW A;  2ACX A;  4IIJ E;  2B1E A;  5F8P A;  4ZOL E;  2DI4 A;  1IJ6 A;  2IW5 B;  4UF0 B;  4YHJ A;  5JR9 A;  5AFU L;  4CI3 B;  3IEE A;  2VKO A;  2V1D B;  2E8I A;  3PDY A;  3P8C D;  4J2C A;  2EHO D;  2ZM8 A;  2EHO A;  3A5X A;  3MJX A;  4IGU A;  1S94 A;  3P7I A;  3Q5W A;  2CEA A;  3O1J A;  2OA5 A;  2UXN B;  5F3J A;  4ANJ A;  5L3B B;  1T98 A;  2BVM A;  4AI6 A;  1YKE B;  3LJC A;  2WM9 A;  5A1L A;  1YKH B;  3OJA A;  2C5K T;  2C5J A;  3CML A;  3ZLI A;  3IF8 B;  4EXT A;  3WAJ A;  5HXS A;  3AA6 B;  2SPC A;  4QXB B;  2X67 A;  5LHH B;  2XAS B;  4BA9 A;  2VKJ A;  1HG2 A;  2KLQ A;  4GYR A;  4OHF A;  4EZH A;  2NTY A;  3LBX B;  3R6N A;  5JR9 C;  3BQI A;  1ZHC A;  2JPF A;  3ZPO A;  4DVD A;  3OYX A;  2W62 A;  3ZMS B;  2LEH A;  3PUQ A;  3ETU A;  3GN5 B;  4QX8 B;  3CPZ A;  3ZMU B;  3E08 A;  2M67 A;  1VRB A;  3RYF E;  5LP6 E;  2ZLY A;  2E9X C;  4AQF C;  5HXH A;  2ZM0 A;  2W63 A;  1WR6 A;  2H3R A;  2Y48 B;  4GIW A;  5L3E B;  2NWB A;  2CE7 A;  5CA1 E;  1WRD A;  2D5U A;  2XTL A;  3N9N A;  4YJ2 E;  4WBN E;  3J9X 1;  4ASK A;  3KDS E;  3E0Z A;  2KXP B;  2I59 A;  3O1H A;  2NP9 A;  2X9Y A;  2X66 A;  2K9A A;  2KZ7 B;  2X51 A;  2NW7 A;  3N2G E;  2A72 A;  4GYS A;  2PG8 A;  4X1I E;  3PUR A;  2WSS V;  3BQL A;  4PFP A;  3KBU A;  3UUN A;  1Y64 B;  2HH7 A;  5FNV E;  1X79 A;  2DLR A;  4YFS A;  4KP3 C;  1HF8 A;  1HG5 A;  4O4I E;  3ZC1 A;  4ZI3 D;  2JJ9 A;  2L8K A;  3AA7 B;  3AVR A;  3V5U A;  5LXT E;  4UVC B;  3AA0 B;  3UFE A;  2XQY A;  5L3C B;  3DP7 A;  1G8X A;  4G63 A;  4I55 E;  3I0Q A;  4ZS2 A;  3I0O A;  2HPL A;  5FY7 A;  5LHG B;  4O2B E;  5L3D B;  4P0B A;  3AB3 B;  2DNX A;  4EAH A;  4JLE A;  4EB6 E;  3N9Q A;  4JEU B;  2GK9 A;  1FMV A;  2CA5 A;  2D2S A;  3IBP A;  4UV9 B;  4XBF B;  2BDE A;  3DTO A;  4PK6 A;  3ZJ1 A;  3N9M A;  5LG4 A;  3K3N A;  1FIO A;  2LSK A;  3CQX C;  2IC9 A;  4AKI A;  3N9O A;  4JEH B;  3LK2 B;  1H7C A;  4EZ4 A;  1UX5 A;  1LKX A;  2LT3 A;  3RRC A;  2X68 A;  5KMG P;  4H9P C;  4I50 E;  3CVR A;  4AQG A;  3B57 A;  2KIN B;  1YW0 A;  2L3L A;  2NOX A;  4E7S A;  4IE0 A;  3IHR A;  4UVA B;  4BAY B;  5KX5 E;  1WYC A;  3OBV E;  2VKD A;  4UV8 B;  3C4Z A;  3HKB E;  4KUM B;  4NUU A;  3CKD A;  2V7L A;  3NZP A;  4H9Q C;  4ZHQ E;  1D0Z A;  3J7Y q;  2NW8 A;  2LSG A;  1OXZ A;  4CI2 B;  4IE4 A;  3RYC E;  3C64 A;  3GWH A;  3FBL A;  3HKC E;  2LOS A;  2KWH A;  5EK3 A;  2EHO B;  2CLY C;  3PUS A;  3RX6 A;  1HX8 A;  1OWA A;  3EVY A;  3C4W A;  3WAK A;  3R84 B;  5LJM A;  2Y6X A;  4OYK A;  3ZYM A;  4I43 B;  4GOU A;  5HXR A;  4AKR B;  1U4Q A;  3ZYL A;  4BJM A;  1BR1 A;  4GK5 E;  3NBX X;  1HFA A;  3AAE B;  4IHJ E;  3I1A A;  5JDL A;  1UX4 A;  1D1C A;  5FMN A;  3VU7 H;  3Q9D A;  1V9D A;  5LA6 E;  1D0Y A;  3JC6 D;  3C98 B;  4QWN B;  3KVA A;  2WAU A;  5DQW A;  2V7K A;  1BR4 A;  3MZK B;  4EOZ B;  3AAA B;  3CQG B;  3NZQ A;  2C0S A;  3MK7 C;  4OFZ A;  1E1H B;  2CWO A;  4OYJ A;  3RKO A;  1MMG A;  3PUA A;  5ADX L;  2CMR A;  4DND A;  3DJB A;  5JDF A;  3ZJ2 A;  4UEM A;  3T8O A;  4P0A A;  3AAI A;  3FXD B;  4QXC B;  3VKH A;  4ISS A;  2K48 A;  5DJQ C;  5JDH A;  5H6R B;  4UVB B;  2MTQ A;  5LOV E;  3N2O A;  3JC6 C;  5JDQ A;  3N2K E;  5E0O A;  5LGU B;  3EDV A;  2E9X B;  4L5G A;  4C91 A;  2LSJ A;  4H63 V;  4P09 A;  2Q9Q D;  1HS7 A;  2WBL A;  3F57 A;  4IST A;  4PK5 A;  3UUX B;  2YEV C;  4HE8 A;  2UXX B;  4CZZ B;  3HKE E;  2MBG A;  4DMW A;  2VWA A;  4ZI3 C;  3QUJ A;  3RYI E;  4KBM B;  5JRC B;  2E9X D;  5LGN B;  1US7 B;  4MHC A;  4FJO A;  2YU2 A;  2X9W A;  5LCY A;  3OYZ A;  4O4L E;  4G2A A;  1LRZ A;  2XAJ B;  3LBX A;  3PU3 A;  1IAP A;  4ZI2 C;  2H7V C;  3U78 A;  1O3X A;  1UCU A;  2VK9 A;  4TN7 B;  2HPJ A;  3SS1 A;  4X1Y E;  5LGT B;  2LJL A;  3F2E A;  1U5P A;  3OKQ A;  3ZYK A;  2D0U A;  2W0G A;  4O2A E;  3SRZ A;  2DCF A;  3L09 A;  5IYZ E;  1QUU A;  2DWG A;  3HA4 A;  4IE5 A;  5EK4 A;  3BQK A;  3FHN A;  4V1A v;  5JDN A;  1LVK A;  3M65 A;  3I9Y A;  1AJ3 A;  4Z8X A;  5L3G B;  1CUN A;  3ZMT B;  4OK0 A;  5TAO A;  3KVB A;  2ZM2 A;  4AKG A;  4B6X A;  3ZN1 B;  4PFO A;  1FMW A;  3Q5X A;  3AVS A;  2Q9Q B;  3LG7 A;  4CXY A;  2XAF B;  4YLH A;  3FBZ A;  2N2N A;  5BMV E;  2NTX A;  3ONX A;  4L0R A;  2V26 A;  4QKN A;  2N9D A;  4H9R C;  2LHN A;  2XAG B;  4TX5 A;  3B13 A;  5FXX A;  2XUE A;  2W00 A;  1KK7 A;  3FXE B;  4TZ4 C;  3W15 B;  3ZEF B;  5GON E;  5KDM C;  2KND A;  3Q2M A;  4XZC A;  3CQC B;  5CB4 E;  2LHR A;  4L9I A;  3ETV A;  2RA1 A;  4PJJ A;  4KMC A;  3UTK A;  3UUM A;  4EIW A;  5CA0 E;  1BR0 A;  4YJ3 E;  2YU1 A;  2JMK A;  2DHR A;  2J1D G;  4MAL A;  5DAB A;  4H9N C;  4JUY A;  5HWX A;  3CWZ B;  3KV5 A;  1BR2 A;  4O4J E;  3C4X A;  2CXL A;  1MMD A;  4ILU A;  3AA1 B;  2VB6 A;  3N9L A;  2E9X A;  2ODU A;  4EYY R;  2CXD A;  3SWH A;  5L2L A;  5FY1 A;  5J1G A;  4IE6 A;  3ZMZ B;  2K5B B;  2PJQ A;  2K24 A;  3RRW A;  3N9P A;  5JH7 E;  2LE8 A;  5L3F B;  3L3P A;  3TKL B;  5J2T E;  1YD8 G;  1D1A A;  3MXZ A;  1ZEE A;  2X9X A;  1FEW A;  4UXN B;  3LK3 B;  4TUY E;  3H37 A;  5C8Y E;  2A2F X;  4ZI7 E;  5M4Y A;  5H6Q B;  1B7T A;  3V5S A;  5EK2 A;  4AQF A;  1VOM A;  1HCI A;  3S4U A;  4MFR A;  4U72 A;  4ZI2 D;  2KMF A;  3PE0 A;  1IJ5 A;  1ZKE A;  5HWY A;  5FXZ A;  1MMN A;  2XHE B;  3PU8 A;  4I4T E;  2ES0 A;  4PK4 A;  5HAX A;  1S35 A;  2ODV A;  5FY0 A;  3KBT A;  3RC8 A;  3KV6 A;  4CXW A;  4DBR A;  1KNZ A;  3LFM A;  3PTR B;  2X9H A;  3HL6 A;  2Y8D A;  4TV8 E;  3D0T A;  5JVD E;  3BK9 A;  4PW8 A;  2EHO C;  2CLY B;  5FXW A;  2VKH A;  2VAS A;  1NWM X;  1SHZ C;  3U3I A;  3GN5 A;  4DBQ A;  4O8S A;  4CXX A;  4E7Z A;  2CM0 A;  1MIY A;  2BVL A;  3WI3 A;  4PJN A;  2VL8 A;  3KFW X;  3MA9 A;  4UEL A;  2Z6E A;  3ZCJ A;  2NW9 A;  1Z0P A;  2H7O A;  2KT9 A;  5HXE A;  5FP3 A;  2JQQ A;  2ZMA A;  3HR0 A;  4MLK A;  1IZN B;  2IAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...