3F2EA

Crystal structure of yellowstone sirv coat protein c-terminus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
83
structure length
83
Chain Sequence
b'FTAVAEQVSAVLSQYGITGPNRAIYQGFGLKVARALNRLGGGPALVNMINGLKAYYISAFNANPTVLDAVTDIITGSPTGYVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIRV coat protein
publication title Synergy of NMR, computation, and X-ray crystallography for structural biology.
pubmed doi rcsb
source organism Sulfolobus islandicus rudivirus 1 variant ynp
molecule tags Viral protein
total genus 30
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12193 Sulf_coat_C Sulfolobus virus coat protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.800 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3f2eA00
3FBZA 3F2EA 3J9X1 3FBLA
chains in the Genus database with same CATH superfamily
2V6YB 2ACXA 1FMWA 3AA0B 5JDFA 4CI2B 2XQ9A 4ISTA 2XHEB 4B3MT 3HL6A 3TLVA 1LVKA 3UU6A 2YINA 3OJAA 1WRDA 3OTOT 1T7SA 2X68A 2X0LB 2J47A 4H9QC 1O3XA 4WW0A 2CXDA 4H9SE 5C3JA 3RKOA 3EAMA 3RIFA 4DBRA 2MYSA 3N9OA 3AA6B 3K1SA 3N9NA 2KINB 4O8SA 5HXHA 3MACA 5DABA 5IWAT 5EK2A 2A9UA 2GK9A 4U33A 2QYWA 2BG9C 4PW8A 3BQLA 1KF6A 3C98B 4AKRB 2BKPA 1CHUA 2H7OA 3AE3A 4I50E 4V1Av 4YXDA 2HN1A 4AI6A 5IHYA 2WP9A 3PE0A 4YTNA 2XPKA 1MMDA 4EAHA 4COFA 1MMAA 1SUMB 2EHOD 3CVRA 4DMWA 5CA0E 3RIUA 5FL0A 4TV8E 5HXSA 2LEHA 3ZSSA 1DU2A 4CN4A 1Y64B 4ANJA 2X9YA 2V8SV 4TN7B 3P4WA 3UU4A 2CM0A 4IL9A 4OHFA 2XQ3A 4B6XA 4EZ4A 3AEEA 1XDPA 2LSGA 3ZMVB 3VKHA 5AQJB 1FIOA 3Q5DA 2NW8A 2XAGB 4YTPA 3VKGA 4LMJA 2D2SA 2EHOC 2V5CA 3BQIA 2CE7A 4AQFC 4CZZB 2D0TA 4KMCA 2CLYC 4TZ4C 1H7CA 2X9HA 5HWXA 2CXFA 2WMOA 3JAFA 1XNQT 4QXBB 3O1HA 5AFUL 2IHR1 2VK9A 3UQ7A 3GN5A 3NZPA 4GKJT 5HEJA 3AXJB 3AEDA 2KWIB 5CFBA 1UX5A 5H6QB 3UFEA 5DQWA 3ZYKA 3UU3A 4C91A 2Y6XA 3TLWA 4QWNB 4DR2T 2VWAA 5LGUB 3RC8A 2LSJA 4PFPA 3KV6A 3AE8A 3ONJA 3LSVA 4H63H 2W4XA 5BMVE 5LMNT 4X62T 3A5XA 4G2AA 5L2LA 4IL4A 4LMKA 4EB6E 3IA3A 3Q9DA 3LG7A 4KUMB 1OXZA 4GKKT 2JQQA 4OYJA 5JDHA 2WDRA 3CIRA 4AKGA 2WDQA 2ZM0A 1SE7A 2LM2A 5JDNA 1BR0A 5L3EB 2KSRA 4X66T 1HNXT 2K5BB 3AEBA 4IE4A 1MMNA 4OYKA 5C8YE 1OEDE 4A97A 2JMHA 3RLFF 1SA0E 3FXEB 2CWYA 2FJEA 4JI7T 2LSIA 3CMLA 2ES0A 4PJMA 4JUYA 3ZN0B 3FZHB 1MNEA 1KNPA 2VURA 5EK4A 2E2AA 3JADA 3LFMA 3CPZA 2ODVA 5FVKA 4IDZA 3Q5WA 4UELA 2E8IA 3ZYLA 5JREA 4QX8B 4WZXA 4L0RA 2NP9A 3OPCA 2BVLA 3IHRA 2K3WA 1YKEB 1MNDA 2VL8A 3UULA 5FKYA 5FY0A 4OX9T 4L5GA 2VKOA 4O4LE 1N33T 4DV2T 4X5TA 4AXPA 3ZKRA 4IE5A 2L9QA 2FUPA 3PU3A 4ILAA 5AQUB 1WYCA 2NTXA 3UU8A 3C4ZA 3LDQB 1JNZA 5L3BB 2Q9QB 2KXPB 2K48A 2V7IA 4ZS3A 4JV5T 3T1YT 2OLTA 2XAJB 3AXJA 4YSZA 2ZM8A 4PJJA 2L3LA 4EGWA 3J7Yq 3RKGA 3PURA 3K3QC 5HYAA 2ZLYA 2CEAA 1KK7A 3AA7B 1OEDC 4H63V 4HEAA 2OV9A 4AQYT 3NWIA 4GK5E 3AVRA 2CBJA 4U74A 2V7JA 3LJCA 4BAYB 1U4QA 3P4QA 5ABHA 4IT4A 4QH1A 3UTKA 3N2OA 4UF0A 2BG9B 4IIJE 1KNZA 2DWGA 3F57A 4Z90A 4Q25A 4PK6A 2PBIA 2UXDT 4ASKA 4HFVA 3VRAA 3RYIE 2DLRA 4O4IE 3RQUA 4JI8T 3JCFA 2J62A 5GONE 2X66A 5CB4E 4HN9A 1V9DA 3MZKB 3VU7H 3ABVA 5JQGE 2LM9A 5J2TE 4O2BE 4A98A 1G73A 2QGSA 5FXXA 3WAJA 4CXYA 4I43B 2AXDS 2KNDA 2W66A 2BKOA 2KT9A 3DJBA 5FVLA 2IW5B 3IEEA 2IC6A 3ZMZB 1R8IA 4JI5T 1SHZC 2LKHA 2EHOB 1VCSA 3HKDE 5HCJA 5LBQB 5LXTE 2XTLA 4JYAT 4X20E 2CLYB 3RYFE 4ZEYA 2H89A 2MPKA 3P4PA 2UUCT 4CI1B 2IIUA 2PG8A 4IREA 2FJBA 3AAIA 3TKLB 4LFAT 3LK3B 4YT0A 2NW7A 2YN6A 3AB3B 4HWDA 3WI3A 4NIQA 5LG3A 2IDOB 4UR9A 5AQRB 4IDPA 5ABEA 2UU9T 3UUNA 2LHRA 4YJ3E 2Q9QA 2XQAA 1D1CA 3CX6B 1FMVA 3Q5EA 4LF4T 5JDQA 5ABFA 5M4YA 2YOEA 4ZI2D 3AAEB 3OBVE 1HR0T 5JDLA 2Y8DA 3X1DA 5DQVA 2JIWA 4EIWA 3V5SA 3ZSTA 2R6GF 4QHOA 1HFAA 2C5KT 4DV6T 4K0KT 3EDVA 4A5XA 1I6ZA 3PDYA 3R84B 5AQVB 5A1LA 5FY1A 2X9XA 3K3OA 5LHIB 2A3DA 2DCFA 5HWYA 3LBXB 4CN1A 3ANWA 1HCIA 1Y01A 4ZI2C 4XBFB 2BG9A 2ODUA 4I0UA 5AQIB 1D1AA 4O4JE 3ESLA 4ISSA 3I0OA 4IGUA 3DP7A 3CX7B 2D5UA 3B5MA 4HWIB 3KDSE 4DV1T 3ZC1A 2K24A 3C51A 5HEHA 5LOVE 2FJDA 2MAWA 4JI2T 2VL0A 3KVAA 4U72A 4G63A 2N9DA 3QNUA 1VCTA 3KINB 1UK5A 3MKDA 4HKAA 4TWHA 2IAKA 5HEUA 4YLHA 3QUJA 4LF9T 2Y48B 5JR9C 4ZS2A 1L0VA 2XAFB 2M6IA 1D1BA 2EHOA 4AQFA 2XQYA 4JEHB 5ABGA 1X79A 3NKZA 5F8PA 3DTOA 4EYUA 5HXRA 2CWOA 1US7B 4TNWA 1W9RA 2UXXB 3RX6A 2XY8B 2J1DG 1W0AA 4P0BA 4AKLA 3SOLA 1GQEA 1WR6A 3VR8A 1WCRA 3TLSA 3K3NA 4B3RT 1CUNA 2IUBA 5HXCA 2BVMA 1ZV4X 4P0AA 2HPJA 1OEDB 2WBLA 4TX5A 1XMQT 4DV7T 2D9DA 3HI2A 3AVSA 4X1YE 1ZEEA 3OVUA 4HFBA 4GYRA 4HWCA 2DI4A 3B57A 5E0OA 3N2KE 3VR9A 4TWFA 2DHRA 2VKJA 3NZQA 4H9RC 4HFHA 2E9XD 3AECA 2YDRA 3ETVA 1J5WA 5KDMC 3QB5A 1W09A 3LBXA 3ZT7A 1N34T 2L8KA 1EZ3A 3ZN1B 3KVBA 3ZLIA 1HX8A 5JTGA 4YSXA 4UF0B 5CGMA 1YQ4A 2LKGA 2E9XC 2CXLA 2KZ7B 4TUYE 3CQCB 3KFWX 3KV5A 4FI5A 4F8HA 1S94A 1M7KA 2QVAA 4DUZT 2C5IT 4IE6A 2C0SA 4LF7T 2M6BA 4PAGA 3F2EA 3AE9A 3N9LA 3PUYF 4DNDA 3CX8B 2WY2A 5FXZA 1LKXA 4H9NC 1N32T 2UUAT 5J0ZA 4P1NA 4JBWF 5TAOA 5JRCB 2WZHA 4N78D 1YW0A 2LOPA 4MHCA 2JRKA 4IHJE 2B1EA 3QC9A 2XSBA 4TV9E 2N2NA 4HFDA 3ZMSB 3AE6A 3HA4A 4UVCB 2WB5A 4DBQA 4ERRA 1LRZA 1HNWT 3H3MA 4LF5T 4WBOA 4ZI3D 5FXWA 2NW9A 1QUUA 5LHGB 5F3JA 3HKBE 3I0QA 2J4GA 5LG4A 2YKSA 2V1DB 1OEDA 3E0ZA 3I1AA 2YU2A 3PJAJ 5AQSB 3FHNA 5L3FB 1ZKEA 4LF8T 5F5WA 2B76A 1LVFA 2C5JA 2X0HA 3FBZA 2ACZA 1QLBA 2FJAA 5ABFB 3N9PA 3QK6A 2V7MA 1E7PA 2BZBA 3RIAA 4ZI3C 3PTRB 5ADXL 4CI3B 3AEAA 2NWBA 4ZXLA 4JLEA 5HEGA 2NOXA 3U3IA 1UCUA 3SFEA 4PJNA 4OFZA 2XSAA 1G8XA 4A56A 1UGOA 3EDUA 2RA1A 5C2TA 2A2FX 3HR0A 5LCYA 3TLUA 3EHZA 2QA7A 4KX6A 4DR4T 2N1GA 2XM1A 5HCMA 3L3PA 4PJLA 4DR5T 3L8RA 5L3CB 5KXJA 3EI0A 3ANWB 3GA8A 5EK3A 1BR2A 2WQYA 2YU1A 3I9YA 5FP3A 2HH7A 3JAEA 1FJGT 3C64A 2WAUA 4IDNA 1IZNB 3V5UA 4BJMA 2LSKA 2DNXA 3EUHA 3C50A 4DUYT 2FBWA 4O2AE 4L9IA 1NEKA 2NR4A 4DR1T 3O9XA 2WWUA 4UV8B 3MJXA 2VKHA 2QRXA 4EEBA 3PJAA 4AKIA 1AJ3A 4AKHA 5L4EA 3MA9A 1B7TA 3KBTA 5JRCA 2BS2A 3O1IA 2JQ9A 3AAAB 3N9MA 5J1GA 2CA5A 4UVAB 3CQGB 2VVNA 2W67A 2CBIA 4HWHA 2VB6A 1JNRA 4CQIA 2PJQA 4KP3C 4MLKA 4C90A 4Z8XA 3HKEE 5LGNB 2WSSV 2XQ8A 5AQLB 1BR4A 2CRBA 4TWDA 3FB2A 3I9WA 2VKDA 3PV0F 3O4XE 1IAPA 3UQ4A 4NPPA 2JPFA 4TNVA 1IBLT 4PK5A 3J9X1 4JI3T 1S35A 3AE5A 3EVYA 2WU5A 3ZT6A 3A7MA 3F31A 3ZCJA 1XNRT 3RQWA 4UEMA 5ETWA 2E9XB 5HEOA 2LOSA 2LHNA 2H3RA 2AE9A 2H88A 4WYVA 1YQ3A 3S4UA 3C4WA 5AQFB 4EEDA 5JVDE 4MBQA 4B3ST 4QXHB 4AISA 2BDEA 3WAKA 3N2GE 5AQKB 4DR3T 4H9PC 5HAXA 3GMIA 3JC6D 3ETUA 4DV5T 4HFIA 3ONXA 3OYXA 3P7IA 4HFEA 4U7YA 5JR9A 2V5DA 1XWMA 2Q9QC 3N5LA 3FBLA 4CN6A 4YFSA 1YXRA 3QB5K 3KBUA 2W63A 4LFCT 2P9BA 5KX5E 2UXBT 1HG2A 5HXEA 2YEVC 2NTYA 4QX7B 4UIGA 1YD8G 3FXDB 2CHOA 2PTFA 3HKCE 4FJOA 4IE0A 3JC6C 1UURA 3UUXB 2XUEA 2XAHB 5IUXA 4EV6A 1D0XA 5CJ5A 3RRWA 2ZM6T 5AQPB 3ZCIA 4LFBT 2SPCA 4JI0T 3OKQA 3AE2A 3RF1A 4ILBA 4JEUB 2V7LA 4ZOLE 3ZC0A 4OK0A 3RH3A 3VRBA 3D0TA 3Q2MA 5EZYE 4J2CA 1HX1B 1WFDA 4IDOA 4QH5A 4ZZCA 4DVDA 3UUBA 4QKNA 4AIUA 4EXTA 2H7VC 3T8OA 4M1PA 1NENA 2I0MA 3B13A 2E5LT 1WYBA 3A8YC 5FYMA 5AQNB 4DMVA 2XAQB 2BS4A 3RYCE 4ILUA 2WU2A 3PUXF 5KMGP 1X9BA 4CXWA 1NWMX 3C4XA 2WDVA 2PFVA 5FL1A 4I4TE 3RRCA 5LYJE 2CMRA 3UFGA 4WNKA 1HS7A 1N36T 4DR6T 2E9XA 3IF8B 2I59A 3FZMB 2XZEA 4EYYR 5AQHB 3AE7A 4H9OC 4YTMA 4F6RC 4HE8A 1W0BA 2CHNA 3CKDA 3RIUC 4U7IA 2BBHA 2XQ6A 1XMOT 3GWHA 3RYHE 2JQKA 1BR1A 2W0GA 1UUSA 4HWFA 1HTJF 4NUUA 4KBMB 4XZCA 2D0UA 3KV4A 4GK0E 2ZMAA 3BK9A 5H6RB 1FEWA 3BQKA 3RPUA 4U2YA 3U78A 2UXNB 1KNRA 3QOFA 5LB7B 4AQGA 4XAXB 2HHHT 2V6YA 4QH4A 4E7SA 1Z8UA 5JH7E 2UUBT 4DR7T 2OA5A 2BKNA 2LJLA 4O4HE 4CXXA 1MIYA 1J5ET 3TLTA 3L39A 4EZHA 3KV9A 4DV3T 5FNVE 3M65A 2BBJA 4JI6T 5LMUT 4LMLA 3ZEFB 2A72A 3L09A 2RP4A 4ADZA 4GOUA 1D0YA 1KFYA 4X1KE 2W2UA 3AE1A 2VVSA 2JJ9A 5L3GB 3N9QA 2Z6EA 2DWKA 4BA9A 1E2AA 3K8PC 2F4VT 4K0UA 4KHZF 3PUWF 4IE7A 3RC3A 2UXCT 3O1JA 3LK42 1NAFA 5L4HA 3ZT5A 2KWHA 2G0UA 1IJ5A 2ZM2A 5LP6E 3PUQA 4QXCB 1YKHB 3NRYA 1ZP0A 2X51A 2X67A 1ZOYA 2LE8A 2X9WA 2IC9A 3CWZB 2MOZA 4ILCA 3SS1A 3M3ZB 4DV4T 5AQGB 4MALA 3P50A 2WZIA 3LK2B 4E7ZA 2X0YA 4YHHT 4PNIA 2V7KA 3ZPOA 4X1IE 2YDQA 4ZI7E 1IBKT 4KHPT 1IJ6A 4JI4T 4UVBB 3PUAA 2LSYA 3MK7C 5FY7A 3UT5E 4GIWA 1MMGA 4IDQA 1ZHCA 5L3DB 4LF6T 4KI0F 4YSYA 5BR8T 3PU8A 5FMNA 2WS3A 3SFDA 4DIDB 3Q5XA 5JDMA 2MBGA 2XJ7A 2VQFT 3H37A 5IYZE 3CK6A 4JI1T 3H3AA 1Z0PA 4I55E 2K9AA 4BJNA 3T1HT 3OYZA 1UX4A 5AQOB 1WLXA 3AEFA 3PUSA 2DL1A 4P09A 3G06A 3E22E 2LLYA 4ZHQE 5JR9B 1XDOA 2WWVA 3RI5A 2M67A 3ZMTB 3VHLA 2V26A 1OWAA 1WR0A 1T72A 1U5PA 4PK4A 4YY3T 1KEYA 3FZFB 3EABA 5AQQB 3AA1B 4YHJA 2E5VA 1HF8A 3ZJ2A 4NXNT 5L47A 4YJ2E 4Z91A 2YK0A 2RPAA 2W61A 3ZMUB 1HNZT 1MIWA 3IBPA 1HG5A 3AE4A 3NVOA 2JMKA 4GYSA 4ZZBA 4EOZB 4U2ZA 5LA6E 3P4RA 5LHHB 3RGLA 1J1JA 2CCQA 1IBMT 2LRLA 5LBMA 3ZJ1A 5FXVA 2MTQA 3PUVF 3MXZA 4MFRA 1M62A 4HTEA 3FZKB 4U3CA 2WCAA 2XQ5A 4U31A 1MIVA 4NUVA 2JQHA 3UU5A 2LT3A 2IMLA 3CQXC 4NXMT 1QSDA 3R6NA 4PFOA 5LJMA 2YDSA 5LJNA 2HN2A 2XASB 5DJQC 5LGTB 2XQ7A 2W00A 5JDGA 4DV0T 3SRZA 2VQET 2WMNA 3ONLC 4X64T 1I94T 3PUGA 1XZYA 2BG9E 2V6XA 3NBXX 5AQTB 1D0ZA 1T98A 2XQ4A 1VOMA 2Q9QD 4UV9B 4HFCA 2I6HA 3W15B 1T8BA 5AQMB 1E1HB 3P4SA 5J2UE 1VRBA 4HGAA 2KMFA 3FZLB 4X65T 2HPLA 2CPTA 2LRKA 3GN5B 3UUMA 3P8CD 4B3TT 2BS3A 3RHWA 3PUZF 4DO0A 4WBNE 2WM9A 3E08A 2W62A 5LNKA 2KLQA 3NRXA 4UXNB 3ZYMA 5CA1E 3AEGA 2XM2A 2VASA 3SWHA
chains in the Genus database with same CATH topology
4H9OC 4I43B 2ACXA 2KNDA 2NW9A 1FMWA 1QUUA 4F6RC 4HE8A 5LHGB 5F3JA 3AA0B 3CKDA 3HKBE 5JDFA 3I0QA 4CI2B 4ISTA 5LG4A 2XHEB 2KT9A 3DJBA 2V1DB 2IW5B 3E0ZA 3I1AA 3HL6A 2YU2A 3GWHA 3IEEA 3RYHE 1BR1A 2IC6A 2W0GA 3ZMZB 3FHNA 1LVKA 5L3FB 1HTJF 1ZKEA 4KBMB 4NUUA 2YINA 4XZCA 3OJAA 1SHZC 1WRDA 2D0UA 2EHOB 3KV4A 4GK0E 2ZMAA 3BK9A 5H6RB 3HKDE 2X68A 2X0LB 5LBQB 5LXTE 2XTLA 4H9QC 1FEWA 1LVFA 1O3XA 3BQKA 4X20E 3RPUA 2CLYB 4WW0A 3RYFE 2CXDA 4H9SE 2C5JA 3U78A 2UXNB 3RKOA 3FBZA 3N9PA 3QK6A 4AQGA 2MYSA 3N9OA 2V7MA 4DBRA 3AA6B 2PG8A 4XAXB 4CI1B 2BZBA 3N9NA 2KINB 4O8SA 5HXHA 4ZI3C 3PTRB 5ADXL 4CI3B 3AAIA 3MACA 5DABA 3TKLB 4E7SA 5JH7E 5EK2A 2NWBA 3SWHA 4JLEA 2GK9A 2OA5A 3LK3B 2NOXA 2LJLA 4PW8A 3BQLA 4O4HE 3U3IA 1UCUA 2NW7A 3AB3B 3C98B 4PJNA 4AKRB 4OFZA 4CXXA 1MIYA 3WI3A 1G8XA 4A56A 2H7OA 3EDUA 4I50E 4V1Av 4EZHA 2RA1A 4AI6A 3KV9A 2A2FX 3HR0A 5LCYA 5FNVE 5IHYA 2QA7A 2N1GA 3M65A 3UUNA 2LHRA 3PE0A 4YJ3E 3L3PA 4PJLA 2Q9QA 1MMDA 5L3CB 4EAHA 1D1CA 3ZEFB 2A72A 1MMAA 3L09A 3CX6B 2RP4A 2EHOD 4ADZA 1FMVA 3ANWB 4GOUA 1D0YA 3GA8A 5EK3A 3CVRA 5JDQA 5M4YA 4DMWA 4X1KE 5CA0E 4ZI2D 1BR2A 2YU1A 3AAEB 2JJ9A 3I9YA 4TV8E 5FP3A 2HH7A 3OBVE 5HXSA 5L3GB 2LEHA 3N9QA 2Z6EA 2DWKA 4BA9A 3C64A 1Y64B 4ANJA 5JDLA 3K8PC 2X9YA 2Y8DA 4TN7B 2WAUA 1IZNB 5DQVA 3V5UA 4BJMA 4K0UA 3RC3A 4IE7A 4EIWA 3V5SA 2CM0A 4OHFA 2LSKA 2DNXA 3O1JA 3EUHA 3LK42 4B6XA 4EZ4A 3C50A 4QHOA 1HFAA 2C5KT 1NAFA 3EDVA 2LSGA 3ZMVB 3VKHA 4CXYA 3PDYA 4O2AE 3R84B 5A1LA 2KWHA 2G0UA 5FY1A 1FIOA 4L9IA 1IJ5A 2NW8A 2XAGB 3VKGA 2X9XA 2D2SA 2EHOC 3K3OA 2ZM2A 5LHIB 2A3DA 2DCFA 5HWYA 5LP6E 3BQIA 3LBXB 3PUQA 2CE7A 2WWUA 3O9XA 4AQFC 4UV8B 3ANWA 3MJXA 4CZZB 2D0TA 4QXCB 1YKHB 3NRYA 2VKHA 1HCIA 4KMCA 2X51A 2CLYC 2X67A 4TZ4C 4ZI2C 1H7CA 2LE8A 2X9HA 2X9WA 4XBFB 5HWXA 2CXFA 2IC9A 2WMOA 4AKIA 3CWZB 2MOZA 3SS1A 1AJ3A 4AKHA 2ODUA 4MALA 3MA9A 4QXBB 1B7TA 3LK2B 3O1HA 3KBTA 5AFUL 5JRCA 1D1AA 4O4JE 3ESLA 4ISSA 4E7ZA 2VK9A 4PNIA 3I0OA 3GN5A 2V7KA 3O1IA 4IGUA 3ZPOA 3DP7A 3CX7B 2D5UA 3NZPA 4X1IE 3AAAB 3N9MA 3KDSE 3ZC1A 2K24A 3C51A 5J1GA 2CA5A 5LOVE 2KWIB 4ZI7E 4UVAB 3CQGB 1IJ6A 1UX5A 5H6QB 4UVBB 3PUAA 3UFEA 5DQWA 2LSYA 3MK7C 2VB6A 3ZYKA 5FY7A 4CQIA 3UT5E 3KVAA 4C91A 2PJQA 4GIWA 2Y6XA 4KP3C 4U72A 1MMGA 4G63A 4QWNB 1ZHCA 2N9DA 5L3DB 4MLKA 4C90A 3KINB 4Z8XA 3HKEE 5LGNB 2VWAA 2WSSV 3MKDA 5LGUB 3RC8A 2LSJA 4PFPA 3PU8A 4HKAA 3KV6A 2IAKA 1BR4A 4H63H 5FMNA 3FB2A 5BMVE 3I9WA 2VKDA 3Q5XA 4YLHA 3O4XE 3QUJA 5JDMA 1IAPA 2MBGA 2Y48B 5JR9C 3A5XA 4ZS2A 4G2AA 5L2LA 2XAFB 1D1BA 2EHOA 3H37A 4EB6E 5IYZE 4AQFA 2XQYA 4JEHB 1X79A 3Q9DA 3LG7A 3H3AA 5F8PA 4KUMB 1OXZA 1Z0PA 3DTOA 4I55E 2JPFA 4EYUA 2K9AA 4BJNA 5HXRA 2JQQA 3OYZA 4OYJA 4PK5A 3J9X1 2CWOA 5JDHA 1US7B 1UX4A 1S35A 3EVYA 2UXXB 4AKGA 1WLXA 2ZM0A 5JDNA 3RX6A 3PUSA 5L3EB 2J1DG 1BR0A 3F31A 4P09A 4P0BA 3ZCJA 4AKLA 3E22E 3SOLA 4UEMA 2K5BB 4ZHQE 5JR9B 5ETWA 2E9XB 1WR6A 2LOSA 2H3RA 2LHNA 3K3NA 4IE4A 1MMNA 4OYKA 5C8YE 2M67A 3S4UA 2JMHA 3ZMTB 1CUNA 3C4WA 1SA0E 3VHLA 2V26A 5JVDE 5HXCA 4MBQA 3FXEB 1OWAA 2CWYA 2BVMA 1ZV4X 4QXHB 4P0AA 2HPJA 2LSIA 3CMLA 2BDEA 2ES0A 4PJMA 4JUYA 3WAKA 1U5PA 3N2GE 4PK4A 2WBLA 3ZN0B 1MNEA 5EK4A 3AA1B 3LFMA 4YHJA 3CPZA 2ODVA 1HF8A 4IDZA 3HI2A 3Q5WA 3ZJ2A 3AVSA 4UELA 4X1YE 1ZEEA 4H9PC 2E8IA 5HAXA 4YJ2E 4GYRA 3GMIA 3JC6D 3ZYLA 2DI4A 3B57A 5E0OA 5JREA 4QX8B 3ETUA 3N2KE 3ONXA 2YK0A 3OYXA 3P7IA 4L0RA 2NP9A 2W61A 5JR9A 2BVLA 3IHRA 2DHRA 1YKEB 1MNDA 2Q9QC 3N5LA 3ZMUB 2VL8A 3UULA 2VKJA 1MIWA 5FY0A 3FBLA 3IBPA 3NZQA 4H9RC 2E9XD 1HG5A 4YFSA 2JMKA 3ETVA 4GYSA 4EOZB 3KBUA 5KDMC 4L5GA 2VKOA 5LA6E 2W63A 4O4LE 2P9BA 5LHHB 2CCQA 5KX5E 1HG2A 5HXEA 3LBXA 2YEVC 2NTYA 4AXPA 5LBMA 3ZJ1A 4QX7B 4UIGA 5FXVA 1YD8G 4IE5A 2MTQA 3FXDB 3MXZA 4MFRA 2L9QA 3HKCE 3PU3A 4FJOA 1WYCA 2NTXA 4IE0A 3C4ZA 3JC6C 4HTEA 5L3BB 2Q9QB 2KXPB 2K48A 2L8KA 2V7IA 1EZ3A 4ZS3A 3UUXB 3ZN1B 3KVBA 2XUEA 3ZLIA 1MIVA 2XAHB 1HX8A 4NUVA 1D0XA 2LT3A 4UF0B 3RRWA 3ZCIA 2SPCA 2E9XC 3CQXC 3OKQA 2CXLA 2XAJB 1QSDA 2KZ7B 4TUYE 3R6NA 3CQCB 3KFWX 4PFOA 4JEUB 2V7LA 4ZOLE 2ZM8A 4OK0A 3KV5A 4PJJA 2L3LA 3ZC0A 5LJMA 4FI5A 3RH3A 3J7Yq 1S94A 3PURA 3D0TA 3Q2MA 5EZYE 5LJNA 4J2CA 2XASB 5DJQC 5LGTB 3K3QC 5HYAA 2ZLYA 2CEAA 2C5IT 2W00A 5JDGA 3SRZA 1KK7A 4IE6A 2WMNA 3AA7B 4DVDA 3PUGA 4H63V 4HEAA 4QKNA 2C0SA 4GK5E 3AVRA 4EXTA 2H7VC 3T8OA 3NBXX 4PAGA 3F2EA 4U74A 1D0ZA 2V7JA 3LJCA 4BAYB 4M1PA 1U4QA 3N9LA 4DNDA 1T98A 3UTKA 1VOMA 2Q9QD 3CX8B 3B13A 3N2OA 4UF0A 4UV9B 3W15B 1WYBA 5FYMA 5FXZA 1E1HB 4IIJE 4DMVA 1KNZA 5J2UE 1LKXA 1VRBA 4H9NC 4HGAA 2DWGA 2XAQB 2KMFA 3F57A 4PK6A 3RYCE 5TAOA 2PBIA 5JRCB 4ILUA 2HPLA 4N78D 1YW0A 4ASKA 5KMGP 4HFVA 3GN5B 2LOPA 4CXWA 3RYIE 2DLRA 4MHCA 2JRKA 3P8CD 3UUMA 4O4IE 4IHJE 1NWMX 3C4XA 4DO0A 2B1EA 4WBNE 2WM9A 3QC9A 2PFVA 3E08A 4TV9E 4I4TE 2N2NA 2W62A 5LNKA 3RRCA 2KLQA 5LYJE 2CMRA 3NRXA 5GONE 2X66A 4WNKA 4UXNB 1HS7A 5CB4E 4HN9A 3ZYMA 3ZMSB 5CA1E 1V9DA 3MZKB 3VU7H 3HA4A 2E9XA 4UVCB 3IF8B 4DBQA 2I59A 5JQGE 2LM9A 5J2TE 4ERRA 4O2BE 1G73A 2QGSA 5FXXA 4EYYR 1LRZA 3WAJA 2VASA 4WBOA 4TX5A 4ZI3D 5FXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBZ A;  3F2E A;  3J9X 1;  3FBL A; 
#chains in the Genus database with same CATH topology
 2V6Y B;  2ACX A;  1FMW A;  3AA0 B;  5JDF A;  4CI2 B;  2XQ9 A;  4IST A;  2XHE B;  4B3M T;  3HL6 A;  3TLV A;  1LVK A;  3UU6 A;  2YIN A;  3OJA A;  1WRD A;  3OTO T;  1T7S A;  2X68 A;  2X0L B;  2J47 A;  4H9Q C;  1O3X A;  4WW0 A;  2CXD A;  4H9S E;  5C3J A;  3RKO A;  3EAM A;  3RIF A;  4DBR A;  2MYS A;  3N9O A;  3AA6 B;  3K1S A;  3N9N A;  2KIN B;  4O8S A;  5HXH A;  3MAC A;  5DAB A;  5IWA T;  5EK2 A;  2A9U A;  2GK9 A;  4U33 A;  2QYW A;  2BG9 C;  4PW8 A;  3BQL A;  1KF6 A;  3C98 B;  4AKR B;  2BKP A;  1CHU A;  2H7O A;  3AE3 A;  4I50 E;  4V1A v;  4YXD A;  2HN1 A;  4AI6 A;  5IHY A;  2WP9 A;  3PE0 A;  4YTN A;  2XPK A;  1MMD A;  4EAH A;  4COF A;  1MMA A;  1SUM B;  2EHO D;  3CVR A;  4DMW A;  5CA0 E;  3RIU A;  5FL0 A;  4TV8 E;  5HXS A;  2LEH A;  3ZSS A;  1DU2 A;  4CN4 A;  1Y64 B;  4ANJ A;  2X9Y A;  2V8S V;  4TN7 B;  3P4W A;  3UU4 A;  2CM0 A;  4IL9 A;  4OHF A;  2XQ3 A;  4B6X A;  4EZ4 A;  3AEE A;  1XDP A;  2LSG A;  3ZMV B;  3VKH A;  5AQJ B;  1FIO A;  3Q5D A;  2NW8 A;  2XAG B;  4YTP A;  3VKG A;  4LMJ A;  2D2S A;  2EHO C;  2V5C A;  3BQI A;  2CE7 A;  4AQF C;  4CZZ B;  2D0T A;  4KMC A;  2CLY C;  4TZ4 C;  1H7C A;  2X9H A;  5HWX A;  2CXF A;  2WMO A;  3JAF A;  1XNQ T;  4QXB B;  3O1H A;  5AFU L;  2IHR 1;  2VK9 A;  3UQ7 A;  3GN5 A;  3NZP A;  4GKJ T;  5HEJ A;  3AXJ B;  3AED A;  2KWI B;  5CFB A;  1UX5 A;  5H6Q B;  3UFE A;  5DQW A;  3ZYK A;  3UU3 A;  4C91 A;  2Y6X A;  3TLW A;  4QWN B;  4DR2 T;  2VWA A;  5LGU B;  3RC8 A;  2LSJ A;  4PFP A;  3KV6 A;  3AE8 A;  3ONJ A;  3LSV A;  4H63 H;  2W4X A;  5BMV E;  5LMN T;  4X62 T;  3A5X A;  4G2A A;  5L2L A;  4IL4 A;  4LMK A;  4EB6 E;  3IA3 A;  3Q9D A;  3LG7 A;  4KUM B;  1OXZ A;  4GKK T;  2JQQ A;  4OYJ A;  5JDH A;  2WDR A;  3CIR A;  4AKG A;  2WDQ A;  2ZM0 A;  1SE7 A;  2LM2 A;  5JDN A;  1BR0 A;  5L3E B;  2KSR A;  4X66 T;  1HNX T;  2K5B B;  3AEB A;  4IE4 A;  1MMN A;  4OYK A;  5C8Y E;  1OED E;  4A97 A;  2JMH A;  3RLF F;  1SA0 E;  3FXE B;  2CWY A;  2FJE A;  4JI7 T;  2LSI A;  3CML A;  2ES0 A;  4PJM A;  4JUY A;  3ZN0 B;  3FZH B;  1MNE A;  1KNP A;  2VUR A;  5EK4 A;  2E2A A;  3JAD A;  3LFM A;  3CPZ A;  2ODV A;  5FVK A;  4IDZ A;  3Q5W A;  4UEL A;  2E8I A;  3ZYL A;  5JRE A;  4QX8 B;  4WZX A;  4L0R A;  2NP9 A;  3OPC A;  2BVL A;  3IHR A;  2K3W A;  1YKE B;  1MND A;  2VL8 A;  3UUL A;  5FKY A;  5FY0 A;  4OX9 T;  4L5G A;  2VKO A;  4O4L E;  1N33 T;  4DV2 T;  4X5T A;  4AXP A;  3ZKR A;  4IE5 A;  2L9Q A;  2FUP A;  3PU3 A;  4ILA A;  5AQU B;  1WYC A;  2NTX A;  3UU8 A;  3C4Z A;  3LDQ B;  1JNZ A;  5L3B B;  2Q9Q B;  2KXP B;  2K48 A;  2V7I A;  4ZS3 A;  4JV5 T;  3T1Y T;  2OLT A;  2XAJ B;  3AXJ A;  4YSZ A;  2ZM8 A;  4PJJ A;  2L3L A;  4EGW A;  3J7Y q;  3RKG A;  3PUR A;  3K3Q C;  5HYA A;  2ZLY A;  2CEA A;  1KK7 A;  3AA7 B;  1OED C;  4H63 V;  4HEA A;  2OV9 A;  4AQY T;  3NWI A;  4GK5 E;  3AVR A;  2CBJ A;  4U74 A;  2V7J A;  3LJC A;  4BAY B;  1U4Q A;  3P4Q A;  5ABH A;  4IT4 A;  4QH1 A;  3UTK A;  3N2O A;  4UF0 A;  2BG9 B;  4IIJ E;  1KNZ A;  2DWG A;  3F57 A;  4Z90 A;  4Q25 A;  4PK6 A;  2PBI A;  2UXD T;  4ASK A;  4HFV A;  3VRA A;  3RYI E;  2DLR A;  4O4I E;  3RQU A;  4JI8 T;  3JCF A;  2J62 A;  5GON E;  2X66 A;  5CB4 E;  4HN9 A;  1V9D A;  3MZK B;  3VU7 H;  3ABV A;  5JQG E;  2LM9 A;  5J2T E;  4O2B E;  4A98 A;  1G73 A;  2QGS A;  5FXX A;  3WAJ A;  4CXY A;  4I43 B;  2AXD S;  2KND A;  2W66 A;  2BKO A;  2KT9 A;  3DJB A;  5FVL A;  2IW5 B;  3IEE A;  2IC6 A;  3ZMZ B;  1R8I A;  4JI5 T;  1SHZ C;  2LKH A;  2EHO B;  1VCS A;  3HKD E;  5HCJ A;  5LBQ B;  5LXT E;  2XTL A;  4JYA T;  4X20 E;  2CLY B;  3RYF E;  4ZEY A;  2H89 A;  2MPK A;  3P4P A;  2UUC T;  4CI1 B;  2IIU A;  2PG8 A;  4IRE A;  2FJB A;  3AAI A;  3TKL B;  4LFA T;  3LK3 B;  4YT0 A;  2NW7 A;  2YN6 A;  3AB3 B;  4HWD A;  3WI3 A;  4NIQ A;  5LG3 A;  2IDO B;  4UR9 A;  5AQR B;  4IDP A;  5ABE A;  2UU9 T;  3UUN A;  2LHR A;  4YJ3 E;  2Q9Q A;  2XQA A;  1D1C A;  3CX6 B;  1FMV A;  3Q5E A;  4LF4 T;  5JDQ A;  5ABF A;  5M4Y A;  2YOE A;  4ZI2 D;  3AAE B;  3OBV E;  1HR0 T;  5JDL A;  2Y8D A;  3X1D A;  5DQV A;  2JIW A;  4EIW A;  3V5S A;  3ZST A;  2R6G F;  4QHO A;  1HFA A;  2C5K T;  4DV6 T;  4K0K T;  3EDV A;  4A5X A;  1I6Z A;  3PDY A;  3R84 B;  5AQV B;  5A1L A;  5FY1 A;  2X9X A;  3K3O A;  5LHI B;  2A3D A;  2DCF A;  5HWY A;  3LBX B;  4CN1 A;  3ANW A;  1HCI A;  1Y01 A;  4ZI2 C;  4XBF B;  2BG9 A;  2ODU A;  4I0U A;  5AQI B;  1D1A A;  4O4J E;  3ESL A;  4ISS A;  3I0O A;  4IGU A;  3DP7 A;  3CX7 B;  2D5U A;  3B5M A;  4HWI B;  3KDS E;  4DV1 T;  3ZC1 A;  2K24 A;  3C51 A;  5HEH A;  5LOV E;  2FJD A;  2MAW A;  4JI2 T;  2VL0 A;  3KVA A;  4U72 A;  4G63 A;  2N9D A;  3QNU A;  1VCT A;  3KIN B;  1UK5 A;  3MKD A;  4HKA A;  4TWH A;  2IAK A;  5HEU A;  4YLH A;  3QUJ A;  4LF9 T;  2Y48 B;  5JR9 C;  4ZS2 A;  1L0V A;  2XAF B;  2M6I A;  1D1B A;  2EHO A;  4AQF A;  2XQY A;  4JEH B;  5ABG A;  1X79 A;  3NKZ A;  5F8P A;  3DTO A;  4EYU A;  5HXR A;  2CWO A;  1US7 B;  4TNW A;  1W9R A;  2UXX B;  3RX6 A;  2XY8 B;  2J1D G;  1W0A A;  4P0B A;  4AKL A;  3SOL A;  1GQE A;  1WR6 A;  3VR8 A;  1WCR A;  3TLS A;  3K3N A;  4B3R T;  1CUN A;  2IUB A;  5HXC A;  2BVM A;  1ZV4 X;  4P0A A;  2HPJ A;  1OED B;  2WBL A;  4TX5 A;  1XMQ T;  4DV7 T;  2D9D A;  3HI2 A;  3AVS A;  4X1Y E;  1ZEE A;  3OVU A;  4HFB A;  4GYR A;  4HWC A;  2DI4 A;  3B57 A;  5E0O A;  3N2K E;  3VR9 A;  4TWF A;  2DHR A;  2VKJ A;  3NZQ A;  4H9R C;  4HFH A;  2E9X D;  3AEC A;  2YDR A;  3ETV A;  1J5W A;  5KDM C;  3QB5 A;  1W09 A;  3LBX A;  3ZT7 A;  1N34 T;  2L8K A;  1EZ3 A;  3ZN1 B;  3KVB A;  3ZLI A;  1HX8 A;  5JTG A;  4YSX A;  4UF0 B;  5CGM A;  1YQ4 A;  2LKG A;  2E9X C;  2CXL A;  2KZ7 B;  4TUY E;  3CQC B;  3KFW X;  3KV5 A;  4FI5 A;  4F8H A;  1S94 A;  1M7K A;  2QVA A;  4DUZ T;  2C5I T;  4IE6 A;  2C0S A;  4LF7 T;  2M6B A;  4PAG A;  3F2E A;  3AE9 A;  3N9L A;  3PUY F;  4DND A;  3CX8 B;  2WY2 A;  5FXZ A;  1LKX A;  4H9N C;  1N32 T;  2UUA T;  5J0Z A;  4P1N A;  4JBW F;  5TAO A;  5JRC B;  2WZH A;  4N78 D;  1YW0 A;  2LOP A;  4MHC A;  2JRK A;  4IHJ E;  2B1E A;  3QC9 A;  2XSB A;  4TV9 E;  2N2N A;  4HFD A;  3ZMS B;  3AE6 A;  3HA4 A;  4UVC B;  2WB5 A;  4DBQ A;  4ERR A;  1LRZ A;  1HNW T;  3H3M A;  4LF5 T;  4WBO A;  4ZI3 D;  5FXW A;  2NW9 A;  1QUU A;  5LHG B;  5F3J A;  3HKB E;  3I0Q A;  2J4G A;  5LG4 A;  2YKS A;  2V1D B;  1OED A;  3E0Z A;  3I1A A;  2YU2 A;  3PJA J;  5AQS B;  3FHN A;  5L3F B;  1ZKE A;  4LF8 T;  5F5W A;  2B76 A;  1LVF A;  2C5J A;  2X0H A;  3FBZ A;  2ACZ A;  1QLB A;  2FJA A;  5ABF B;  3N9P A;  3QK6 A;  2V7M A;  1E7P A;  2BZB A;  3RIA A;  4ZI3 C;  3PTR B;  5ADX L;  4CI3 B;  3AEA A;  2NWB A;  4ZXL A;  4JLE A;  5HEG A;  2NOX A;  3U3I A;  1UCU A;  3SFE A;  4PJN A;  4OFZ A;  2XSA A;  1G8X A;  4A56 A;  1UGO A;  3EDU A;  2RA1 A;  5C2T A;  2A2F X;  3HR0 A;  5LCY A;  3TLU A;  3EHZ A;  2QA7 A;  4KX6 A;  4DR4 T;  2N1G A;  2XM1 A;  5HCM A;  3L3P A;  4PJL A;  4DR5 T;  3L8R A;  5L3C B;  5KXJ A;  3EI0 A;  3ANW B;  3GA8 A;  5EK3 A;  1BR2 A;  2WQY A;  2YU1 A;  3I9Y A;  5FP3 A;  2HH7 A;  3JAE A;  1FJG T;  3C64 A;  2WAU A;  4IDN A;  1IZN B;  3V5U A;  4BJM A;  2LSK A;  2DNX A;  3EUH A;  3C50 A;  4DUY T;  2FBW A;  4O2A E;  4L9I A;  1NEK A;  2NR4 A;  4DR1 T;  3O9X A;  2WWU A;  4UV8 B;  3MJX A;  2VKH A;  2QRX A;  4EEB A;  3PJA A;  4AKI A;  1AJ3 A;  4AKH A;  5L4E A;  3MA9 A;  1B7T A;  3KBT A;  5JRC A;  2BS2 A;  3O1I A;  2JQ9 A;  3AAA B;  3N9M A;  5J1G A;  2CA5 A;  4UVA B;  3CQG B;  2VVN A;  2W67 A;  2CBI A;  4HWH A;  2VB6 A;  1JNR A;  4CQI A;  2PJQ A;  4KP3 C;  4MLK A;  4C90 A;  4Z8X A;  3HKE E;  5LGN B;  2WSS V;  2XQ8 A;  5AQL B;  1BR4 A;  2CRB A;  4TWD A;  3FB2 A;  3I9W A;  2VKD A;  3PV0 F;  3O4X E;  1IAP A;  3UQ4 A;  4NPP A;  2JPF A;  4TNV A;  1IBL T;  4PK5 A;  3J9X 1;  4JI3 T;  1S35 A;  3AE5 A;  3EVY A;  2WU5 A;  3ZT6 A;  3A7M A;  3F31 A;  3ZCJ A;  1XNR T;  3RQW A;  4UEM A;  5ETW A;  2E9X B;  5HEO A;  2LOS A;  2LHN A;  2H3R A;  2AE9 A;  2H88 A;  4WYV A;  1YQ3 A;  3S4U A;  3C4W A;  5AQF B;  4EED A;  5JVD E;  4MBQ A;  4B3S T;  4QXH B;  4AIS A;  2BDE A;  3WAK A;  3N2G E;  5AQK B;  4DR3 T;  4H9P C;  5HAX A;  3GMI A;  3JC6 D;  3ETU A;  4DV5 T;  4HFI A;  3ONX A;  3OYX A;  3P7I A;  4HFE A;  4U7Y A;  5JR9 A;  2V5D A;  1XWM A;  2Q9Q C;  3N5L A;  3FBL A;  4CN6 A;  4YFS A;  1YXR A;  3QB5 K;  3KBU A;  2W63 A;  4LFC T;  2P9B A;  5KX5 E;  2UXB T;  1HG2 A;  5HXE A;  2YEV C;  2NTY A;  4QX7 B;  4UIG A;  1YD8 G;  3FXD B;  2CHO A;  2PTF A;  3HKC E;  4FJO A;  4IE0 A;  3JC6 C;  1UUR A;  3UUX B;  2XUE A;  2XAH B;  5IUX A;  4EV6 A;  1D0X A;  5CJ5 A;  3RRW A;  2ZM6 T;  5AQP B;  3ZCI A;  4LFB T;  2SPC A;  4JI0 T;  3OKQ A;  3AE2 A;  3RF1 A;  4ILB A;  4JEU B;  2V7L A;  4ZOL E;  3ZC0 A;  4OK0 A;  3RH3 A;  3VRB A;  3D0T A;  3Q2M A;  5EZY E;  4J2C A;  1HX1 B;  1WFD A;  4IDO A;  4QH5 A;  4ZZC A;  4DVD A;  3UUB A;  4QKN A;  4AIU A;  4EXT A;  2H7V C;  3T8O A;  4M1P A;  1NEN A;  2I0M A;  3B13 A;  2E5L T;  1WYB A;  3A8Y C;  5FYM A;  5AQN B;  4DMV A;  2XAQ B;  2BS4 A;  3RYC E;  4ILU A;  2WU2 A;  3PUX F;  5KMG P;  1X9B A;  4CXW A;  1NWM X;  3C4X A;  2WDV A;  2PFV A;  5FL1 A;  4I4T E;  3RRC A;  5LYJ E;  2CMR A;  3UFG A;  4WNK A;  1HS7 A;  1N36 T;  4DR6 T;  2E9X A;  3IF8 B;  2I59 A;  3FZM B;  2XZE A;  4EYY R;  5AQH B;  3AE7 A;  4H9O C;  4YTM A;  4F6R C;  4HE8 A;  1W0B A;  2CHN A;  3CKD A;  3RIU C;  4U7I A;  2BBH A;  2XQ6 A;  1XMO T;  3GWH A;  3RYH E;  2JQK A;  1BR1 A;  2W0G A;  1UUS A;  4HWF A;  1HTJ F;  4NUU A;  4KBM B;  4XZC A;  2D0U A;  3KV4 A;  4GK0 E;  2ZMA A;  3BK9 A;  5H6R B;  1FEW A;  3BQK A;  3RPU A;  4U2Y A;  3U78 A;  2UXN B;  1KNR A;  3QOF A;  5LB7 B;  4AQG A;  4XAX B;  2HHH T;  2V6Y A;  4QH4 A;  4E7S A;  1Z8U A;  5JH7 E;  2UUB T;  4DR7 T;  2OA5 A;  2BKN A;  2LJL A;  4O4H E;  4CXX A;  1MIY A;  1J5E T;  3TLT A;  3L39 A;  4EZH A;  3KV9 A;  4DV3 T;  5FNV E;  3M65 A;  2BBJ A;  4JI6 T;  5LMU T;  4LML A;  3ZEF B;  2A72 A;  3L09 A;  2RP4 A;  4ADZ A;  4GOU A;  1D0Y A;  1KFY A;  4X1K E;  2W2U A;  3AE1 A;  2VVS A;  2JJ9 A;  5L3G B;  3N9Q A;  2Z6E A;  2DWK A;  4BA9 A;  1E2A A;  3K8P C;  2F4V T;  4K0U A;  4KHZ F;  3PUW F;  4IE7 A;  3RC3 A;  2UXC T;  3O1J A;  3LK4 2;  1NAF A;  5L4H A;  3ZT5 A;  2KWH A;  2G0U A;  1IJ5 A;  2ZM2 A;  5LP6 E;  3PUQ A;  4QXC B;  1YKH B;  3NRY A;  1ZP0 A;  2X51 A;  2X67 A;  1ZOY A;  2LE8 A;  2X9W A;  2IC9 A;  3CWZ B;  2MOZ A;  4ILC A;  3SS1 A;  3M3Z B;  4DV4 T;  5AQG B;  4MAL A;  3P50 A;  2WZI A;  3LK2 B;  4E7Z A;  2X0Y A;  4YHH T;  4PNI A;  2V7K A;  3ZPO A;  4X1I E;  2YDQ A;  4ZI7 E;  1IBK T;  4KHP T;  1IJ6 A;  4JI4 T;  4UVB B;  3PUA A;  2LSY A;  3MK7 C;  5FY7 A;  3UT5 E;  4GIW A;  1MMG A;  4IDQ A;  1ZHC A;  5L3D B;  4LF6 T;  4KI0 F;  4YSY A;  5BR8 T;  3PU8 A;  5FMN A;  2WS3 A;  3SFD A;  4DID B;  3Q5X A;  5JDM A;  2MBG A;  2XJ7 A;  2VQF T;  3H37 A;  5IYZ E;  3CK6 A;  4JI1 T;  3H3A A;  1Z0P A;  4I55 E;  2K9A A;  4BJN A;  3T1H T;  3OYZ A;  1UX4 A;  5AQO B;  1WLX A;  3AEF A;  3PUS A;  2DL1 A;  4P09 A;  3G06 A;  3E22 E;  2LLY A;  4ZHQ E;  5JR9 B;  1XDO A;  2WWV A;  3RI5 A;  2M67 A;  3ZMT B;  3VHL A;  2V26 A;  1OWA A;  1WR0 A;  1T72 A;  1U5P A;  4PK4 A;  4YY3 T;  1KEY A;  3FZF B;  3EAB A;  5AQQ B;  3AA1 B;  4YHJ A;  2E5V A;  1HF8 A;  3ZJ2 A;  4NXN T;  5L47 A;  4YJ2 E;  4Z91 A;  2YK0 A;  2RPA A;  2W61 A;  3ZMU B;  1HNZ T;  1MIW A;  3IBP A;  1HG5 A;  3AE4 A;  3NVO A;  2JMK A;  4GYS A;  4ZZB A;  4EOZ B;  4U2Z A;  5LA6 E;  3P4R A;  5LHH B;  3RGL A;  1J1J A;  2CCQ A;  1IBM T;  2LRL A;  5LBM A;  3ZJ1 A;  5FXV A;  2MTQ A;  3PUV F;  3MXZ A;  4MFR A;  1M62 A;  4HTE A;  3FZK B;  4U3C A;  2WCA A;  2XQ5 A;  4U31 A;  1MIV A;  4NUV A;  2JQH A;  3UU5 A;  2LT3 A;  2IML A;  3CQX C;  4NXM T;  1QSD A;  3R6N A;  4PFO A;  5LJM A;  2YDS A;  5LJN A;  2HN2 A;  2XAS B;  5DJQ C;  5LGT B;  2XQ7 A;  2W00 A;  5JDG A;  4DV0 T;  3SRZ A;  2VQE T;  2WMN A;  3ONL C;  4X64 T;  1I94 T;  3PUG A;  1XZY A;  2BG9 E;  2V6X A;  3NBX X;  5AQT B;  1D0Z A;  1T98 A;  2XQ4 A;  1VOM A;  2Q9Q D;  4UV9 B;  4HFC A;  2I6H A;  3W15 B;  1T8B A;  5AQM B;  1E1H B;  3P4S A;  5J2U E;  1VRB A;  4HGA A;  2KMF A;  3FZL B;  4X65 T;  2HPL A;  2CPT A;  2LRK A;  3GN5 B;  3UUM A;  3P8C D;  4B3T T;  2BS3 A;  3RHW A;  3PUZ F;  4DO0 A;  4WBN E;  2WM9 A;  3E08 A;  2W62 A;  5LNK A;  2KLQ A;  3NRX A;  4UXN B;  3ZYM A;  5CA1 E;  3AEG A;  2XM2 A;  2VAS A;  3SWH A; 
#chains in the Genus database with same CATH homology
 4H9O C;  4I43 B;  2ACX A;  2KND A;  2NW9 A;  1FMW A;  1QUU A;  4F6R C;  4HE8 A;  5LHG B;  5F3J A;  3AA0 B;  3CKD A;  3HKB E;  5JDF A;  3I0Q A;  4CI2 B;  4IST A;  5LG4 A;  2XHE B;  2KT9 A;  3DJB A;  2V1D B;  2IW5 B;  3E0Z A;  3I1A A;  3HL6 A;  2YU2 A;  3GWH A;  3IEE A;  3RYH E;  1BR1 A;  2IC6 A;  2W0G A;  3ZMZ B;  3FHN A;  1LVK A;  5L3F B;  1HTJ F;  1ZKE A;  4KBM B;  4NUU A;  2YIN A;  4XZC A;  3OJA A;  1SHZ C;  1WRD A;  2D0U A;  2EHO B;  3KV4 A;  4GK0 E;  2ZMA A;  3BK9 A;  5H6R B;  3HKD E;  2X68 A;  2X0L B;  5LBQ B;  5LXT E;  2XTL A;  4H9Q C;  1FEW A;  1LVF A;  1O3X A;  3BQK A;  4X20 E;  3RPU A;  2CLY B;  4WW0 A;  3RYF E;  2CXD A;  4H9S E;  2C5J A;  3U78 A;  2UXN B;  3RKO A;  3FBZ A;  3N9P A;  3QK6 A;  4AQG A;  2MYS A;  3N9O A;  2V7M A;  4DBR A;  3AA6 B;  2PG8 A;  4XAX B;  4CI1 B;  2BZB A;  3N9N A;  2KIN B;  4O8S A;  5HXH A;  4ZI3 C;  3PTR B;  5ADX L;  4CI3 B;  3AAI A;  3MAC A;  5DAB A;  3TKL B;  4E7S A;  5JH7 E;  5EK2 A;  2NWB A;  3SWH A;  4JLE A;  2GK9 A;  2OA5 A;  3LK3 B;  2NOX A;  2LJL A;  4PW8 A;  3BQL A;  4O4H E;  3U3I A;  1UCU A;  2NW7 A;  3AB3 B;  3C98 B;  4PJN A;  4AKR B;  4OFZ A;  4CXX A;  1MIY A;  3WI3 A;  1G8X A;  4A56 A;  2H7O A;  3EDU A;  4I50 E;  4V1A v;  4EZH A;  2RA1 A;  4AI6 A;  3KV9 A;  2A2F X;  3HR0 A;  5LCY A;  5FNV E;  5IHY A;  2QA7 A;  2N1G A;  3M65 A;  3UUN A;  2LHR A;  3PE0 A;  4YJ3 E;  3L3P A;  4PJL A;  2Q9Q A;  1MMD A;  5L3C B;  4EAH A;  1D1C A;  3ZEF B;  2A72 A;  1MMA A;  3L09 A;  3CX6 B;  2RP4 A;  2EHO D;  4ADZ A;  1FMV A;  3ANW B;  4GOU A;  1D0Y A;  3GA8 A;  5EK3 A;  3CVR A;  5JDQ A;  5M4Y A;  4DMW A;  4X1K E;  5CA0 E;  4ZI2 D;  1BR2 A;  2YU1 A;  3AAE B;  2JJ9 A;  3I9Y A;  4TV8 E;  5FP3 A;  2HH7 A;  3OBV E;  5HXS A;  5L3G B;  2LEH A;  3N9Q A;  2Z6E A;  2DWK A;  4BA9 A;  3C64 A;  1Y64 B;  4ANJ A;  5JDL A;  3K8P C;  2X9Y A;  2Y8D A;  4TN7 B;  2WAU A;  1IZN B;  5DQV A;  3V5U A;  4BJM A;  4K0U A;  3RC3 A;  4IE7 A;  4EIW A;  3V5S A;  2CM0 A;  4OHF A;  2LSK A;  2DNX A;  3O1J A;  3EUH A;  3LK4 2;  4B6X A;  4EZ4 A;  3C50 A;  4QHO A;  1HFA A;  2C5K T;  1NAF A;  3EDV A;  2LSG A;  3ZMV B;  3VKH A;  4CXY A;  3PDY A;  4O2A E;  3R84 B;  5A1L A;  2KWH A;  2G0U A;  5FY1 A;  1FIO A;  4L9I A;  1IJ5 A;  2NW8 A;  2XAG B;  3VKG A;  2X9X A;  2D2S A;  2EHO C;  3K3O A;  2ZM2 A;  5LHI B;  2A3D A;  2DCF A;  5HWY A;  5LP6 E;  3BQI A;  3LBX B;  3PUQ A;  2CE7 A;  2WWU A;  3O9X A;  4AQF C;  4UV8 B;  3ANW A;  3MJX A;  4CZZ B;  2D0T A;  4QXC B;  1YKH B;  3NRY A;  2VKH A;  1HCI A;  4KMC A;  2X51 A;  2CLY C;  2X67 A;  4TZ4 C;  4ZI2 C;  1H7C A;  2LE8 A;  2X9H A;  2X9W A;  4XBF B;  5HWX A;  2CXF A;  2IC9 A;  2WMO A;  4AKI A;  3CWZ B;  2MOZ A;  3SS1 A;  1AJ3 A;  4AKH A;  2ODU A;  4MAL A;  3MA9 A;  4QXB B;  1B7T A;  3LK2 B;  3O1H A;  3KBT A;  5AFU L;  5JRC A;  1D1A A;  4O4J E;  3ESL A;  4ISS A;  4E7Z A;  2VK9 A;  4PNI A;  3I0O A;  3GN5 A;  2V7K A;  3O1I A;  4IGU A;  3ZPO A;  3DP7 A;  3CX7 B;  2D5U A;  3NZP A;  4X1I E;  3AAA B;  3N9M A;  3KDS E;  3ZC1 A;  2K24 A;  3C51 A;  5J1G A;  2CA5 A;  5LOV E;  2KWI B;  4ZI7 E;  4UVA B;  3CQG B;  1IJ6 A;  1UX5 A;  5H6Q B;  4UVB B;  3PUA A;  3UFE A;  5DQW A;  2LSY A;  3MK7 C;  2VB6 A;  3ZYK A;  5FY7 A;  4CQI A;  3UT5 E;  3KVA A;  4C91 A;  2PJQ A;  4GIW A;  2Y6X A;  4KP3 C;  4U72 A;  1MMG A;  4G63 A;  4QWN B;  1ZHC A;  2N9D A;  5L3D B;  4MLK A;  4C90 A;  3KIN B;  4Z8X A;  3HKE E;  5LGN B;  2VWA A;  2WSS V;  3MKD A;  5LGU B;  3RC8 A;  2LSJ A;  4PFP A;  3PU8 A;  4HKA A;  3KV6 A;  2IAK A;  1BR4 A;  4H63 H;  5FMN A;  3FB2 A;  5BMV E;  3I9W A;  2VKD A;  3Q5X A;  4YLH A;  3O4X E;  3QUJ A;  5JDM A;  1IAP A;  2MBG A;  2Y48 B;  5JR9 C;  3A5X A;  4ZS2 A;  4G2A A;  5L2L A;  2XAF B;  1D1B A;  2EHO A;  3H37 A;  4EB6 E;  5IYZ E;  4AQF A;  2XQY A;  4JEH B;  1X79 A;  3Q9D A;  3LG7 A;  3H3A A;  5F8P A;  4KUM B;  1OXZ A;  1Z0P A;  3DTO A;  4I55 E;  2JPF A;  4EYU A;  2K9A A;  4BJN A;  5HXR A;  2JQQ A;  3OYZ A;  4OYJ A;  4PK5 A;  3J9X 1;  2CWO A;  5JDH A;  1US7 B;  1UX4 A;  1S35 A;  3EVY A;  2UXX B;  4AKG A;  1WLX A;  2ZM0 A;  5JDN A;  3RX6 A;  3PUS A;  5L3E B;  2J1D G;  1BR0 A;  3F31 A;  4P09 A;  4P0B A;  3ZCJ A;  4AKL A;  3E22 E;  3SOL A;  4UEM A;  2K5B B;  4ZHQ E;  5JR9 B;  5ETW A;  2E9X B;  1WR6 A;  2LOS A;  2H3R A;  2LHN A;  3K3N A;  4IE4 A;  1MMN A;  4OYK A;  5C8Y E;  2M67 A;  3S4U A;  2JMH A;  3ZMT B;  1CUN A;  3C4W A;  1SA0 E;  3VHL A;  2V26 A;  5JVD E;  5HXC A;  4MBQ A;  3FXE B;  1OWA A;  2CWY A;  2BVM A;  1ZV4 X;  4QXH B;  4P0A A;  2HPJ A;  2LSI A;  3CML A;  2BDE A;  2ES0 A;  4PJM A;  4JUY A;  3WAK A;  1U5P A;  3N2G E;  4PK4 A;  2WBL A;  3ZN0 B;  1MNE A;  5EK4 A;  3AA1 B;  3LFM A;  4YHJ A;  3CPZ A;  2ODV A;  1HF8 A;  4IDZ A;  3HI2 A;  3Q5W A;  3ZJ2 A;  3AVS A;  4UEL A;  4X1Y E;  1ZEE A;  4H9P C;  2E8I A;  5HAX A;  4YJ2 E;  4GYR A;  3GMI A;  3JC6 D;  3ZYL A;  2DI4 A;  3B57 A;  5E0O A;  5JRE A;  4QX8 B;  3ETU A;  3N2K E;  3ONX A;  2YK0 A;  3OYX A;  3P7I A;  4L0R A;  2NP9 A;  2W61 A;  5JR9 A;  2BVL A;  3IHR A;  2DHR A;  1YKE B;  1MND A;  2Q9Q C;  3N5L A;  3ZMU B;  2VL8 A;  3UUL A;  2VKJ A;  1MIW A;  5FY0 A;  3FBL A;  3IBP A;  3NZQ A;  4H9R C;  2E9X D;  1HG5 A;  4YFS A;  2JMK A;  3ETV A;  4GYS A;  4EOZ B;  3KBU A;  5KDM C;  4L5G A;  2VKO A;  5LA6 E;  2W63 A;  4O4L E;  2P9B A;  5LHH B;  2CCQ A;  5KX5 E;  1HG2 A;  5HXE A;  3LBX A;  2YEV C;  2NTY A;  4AXP A;  5LBM A;  3ZJ1 A;  4QX7 B;  4UIG A;  5FXV A;  1YD8 G;  4IE5 A;  2MTQ A;  3FXD B;  3MXZ A;  4MFR A;  2L9Q A;  3HKC E;  3PU3 A;  4FJO A;  1WYC A;  2NTX A;  4IE0 A;  3C4Z A;  3JC6 C;  4HTE A;  5L3B B;  2Q9Q B;  2KXP B;  2K48 A;  2L8K A;  2V7I A;  1EZ3 A;  4ZS3 A;  3UUX B;  3ZN1 B;  3KVB A;  2XUE A;  3ZLI A;  1MIV A;  2XAH B;  1HX8 A;  4NUV A;  1D0X A;  2LT3 A;  4UF0 B;  3RRW A;  3ZCI A;  2SPC A;  2E9X C;  3CQX C;  3OKQ A;  2CXL A;  2XAJ B;  1QSD A;  2KZ7 B;  4TUY E;  3R6N A;  3CQC B;  3KFW X;  4PFO A;  4JEU B;  2V7L A;  4ZOL E;  2ZM8 A;  4OK0 A;  3KV5 A;  4PJJ A;  2L3L A;  3ZC0 A;  5LJM A;  4FI5 A;  3RH3 A;  3J7Y q;  1S94 A;  3PUR A;  3D0T A;  3Q2M A;  5EZY E;  5LJN A;  4J2C A;  2XAS B;  5DJQ C;  5LGT B;  3K3Q C;  5HYA A;  2ZLY A;  2CEA A;  2C5I T;  2W00 A;  5JDG A;  3SRZ A;  1KK7 A;  4IE6 A;  2WMN A;  3AA7 B;  4DVD A;  3PUG A;  4H63 V;  4HEA A;  4QKN A;  2C0S A;  4GK5 E;  3AVR A;  4EXT A;  2H7V C;  3T8O A;  3NBX X;  4PAG A;  3F2E A;  4U74 A;  1D0Z A;  2V7J A;  3LJC A;  4BAY B;  4M1P A;  1U4Q A;  3N9L A;  4DND A;  1T98 A;  3UTK A;  1VOM A;  2Q9Q D;  3CX8 B;  3B13 A;  3N2O A;  4UF0 A;  4UV9 B;  3W15 B;  1WYB A;  5FYM A;  5FXZ A;  1E1H B;  4IIJ E;  4DMV A;  1KNZ A;  5J2U E;  1LKX A;  1VRB A;  4H9N C;  4HGA A;  2DWG A;  2XAQ B;  2KMF A;  3F57 A;  4PK6 A;  3RYC E;  5TAO A;  2PBI A;  5JRC B;  4ILU A;  2HPL A;  4N78 D;  1YW0 A;  4ASK A;  5KMG P;  4HFV A;  3GN5 B;  2LOP A;  4CXW A;  3RYI E;  2DLR A;  4MHC A;  2JRK A;  3P8C D;  3UUM A;  4O4I E;  4IHJ E;  1NWM X;  3C4X A;  4DO0 A;  2B1E A;  4WBN E;  2WM9 A;  3QC9 A;  2PFV A;  3E08 A;  4TV9 E;  4I4T E;  2N2N A;  2W62 A;  5LNK A;  3RRC A;  2KLQ A;  5LYJ E;  2CMR A;  3NRX A;  5GON E;  2X66 A;  4WNK A;  4UXN B;  1HS7 A;  5CB4 E;  4HN9 A;  3ZYM A;  3ZMS B;  5CA1 E;  1V9D A;  3MZK B;  3VU7 H;  3HA4 A;  2E9X A;  4UVC B;  3IF8 B;  4DBQ A;  2I59 A;  5JQG E;  2LM9 A;  5J2T E;  4ERR A;  4O2B E;  1G73 A;  2QGS A;  5FXX A;  4EYY R;  1LRZ A;  3WAJ A;  2VAS A;  4WBO A;  4TX5 A;  4ZI3 D;  5FXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...