3F2GA

Crystal structure of merb mutant c160s, the organomercurial lyase involved in a bacterial mercury resistance system
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
208
structure length
205
Chain Sequence
MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCSHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylmercury lyase
publication title Crystal Structures of the Organomercurial Lyase MerB in Its Free and Mercury-bound Forms: INSIGHTS INTO THE MECHANISM OF METHYLMERCURY DEGRADATION
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 57
structure length 205
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3f2gA00
3F0PA 3F2FA 5C0UA 3F2GA 3FN8A 5DSFA 5C0TA 5C17A 3F0OA 3F2HA
chains in the Genus database with same CATH superfamily
2B9LA 1OP8A 1HAYB 4K69A 2XTTB 1O37A 5E0HA 1GMCG 2GCTB 1A5GH 4B6FA 1O2KA 2SGAA 1J17T 3LGUA 1HGTH 1OP0A 1QJ6B 3U8OH 1T4VH 3RXDA 3VB6A 4YM9A 1G30B 1WTHD 1ZGVA 3PB1E 2ZDNA 1YPHC 3A87A 3UNQA 1TGCA 4I7YH 1C5PA 3E0PB 2UWLA 1YP9A 2SGQE 2XBVA 3SJ9A 1SR5C 4XFQA 2H5CA 3F6UH 1V2QT 1AB9C 2WUBA 1DWDH 1FNIA 1T8LA 4YZUA 2FYQA 3VG8A 1XKAC 1SPJA 1CT2E 4AN7A 1LKAA 3A88A 4IN2A 1D3PB 1IQMA 1QNJA 2PTNA 3KHVA 4ZHMU 4NA8A 1TGNA 2PKSB 3A84A 4MPXA 1GBMA 2FESH 1W7GH 4X1NU 4TY6A 2VIOA 4WMEA 4XOJA 3ZZ6A 6ESTA 1NRRH 1K1NA 1OSSA 1P05A 1C5TA 3UQOA 4ZKNU 3AW0A 4WXIA 1IHTH 1IQNA 3MO9A 1A46H 5JBAS 1MD7A 1FY3A 3VXEH 3U98H 5LGOA 3M37A 3RXIA 1PPEE 2LP6A 3EYDA 3BN9A 3SU4A 2EC9H 1MKXK 3RXGA 5KEDA 3RXBA 1O5GH 1H9IE 4KP0A 1PYTC 1EOLA 3HGNA 3F3BA 2HGTH 3TPIZ 3ZZ3A 1BMAA 1CHOF 1UCYK 1GCTB 1GI2A 1P8VC 2M5TA 1TRNA 1C2JA 4FUIA 1P09A 3MNCA 2BX4A 5EQRA 2QA9E 1HIAA 3KEEA 1GI8B 1PQ5A 2P94A 5FBEA 1C5NH 1MCVA 4MLFB 3TH3H 1FPHH 3D65E 4JYTA 4Q7YA 6LPRA 1OWJA 1W13U 3SGAE 5B6OA 3QTOH 1LHCH 3QUMP 1S0RA 3ITIA 1GHYH 3ESTA 1V3XA 1QBOA 2K1QA 4K1EA 3HKIB 3WWBA 5C2ZA 5CE1A 5A2MH 1GBBA 3SN8A 2F83A 2AFQB 2EA3A 3UY9A 1HAVB 1T8NA 1RJXB 2NU4E 1S82A 3A86A 4H42U 2BTCE 2VIDA 4BAOB 1A4WH 4H4FA 1GDUA 4HZHA 2WPJS 2JJ2D 1PPBH 1T8MA 1F0UA 1HXEH 3JZ2B 3SJIA 3FZZA 2FOEA 3RXPA 1FMGA 2HNTE 1W3CA 1C2DA 3V3MA 4FUHA 1NRSH 2Y82A 1WDIA 2ANKH 5EJLA 1EB2A 3G01A 2TIOA 3PV4A 1VJAU 1N1LA 1UTPA 3VGCB 1ZSKA 2P16A 2ZNKH 1C1PA 3GYMA 3UTUH 1DXWA 2BXTH 4X2WA 2D1JA 1TPAE 2IN2A 2UWPA 4U30A 1OHHD 2GMTC 3KNXA 3TIUA 2VWLA 2YNAA 1C5WB 4Y7AA 4TY7A 1O2LA 1O2WA 3GY2A 3RC6A 1YPMH 5LPRA 1GI9B 2A32A 3MOCA 4UD9H 3Q77A 3O8CA 3SJ8A 2AMPA 3O8DA 2CF8H 1QHRB 5HXFA 3TK6A 1XMNB 2F9NA 3BEIB 4JZIA 1B0FA 2O8TA 3F9EA 4ABAA 4Q7XA 5PTPA 1LO6A 1K22H 1ZPZA 4E7NA 1QR3E 1O0DH 1VCQA 2ZU3A 3GS9A 3PYHA 1D6WA 1P2JA 2VGCC 5L30H 3VB7A 4B2CA 5DPAA 4Q2KA 2O8LA 2FXRA 2VWMA 1L1GA 2BLOA 1DY8A 4Y8ZA 1QIXB 3RLWH 5DP9A 3FOAA 3UNRA 3S9BA 4DIHH 1W10U 3GY5A 1AUTC 3ZIAD 2GVFA 4IC6A 5HM2A 1GHXH 1QRXA 1BHXB 3U8TH 2XWBI 1EJMA 1BHXF 4RSPA 2BMGB 1DLKB 5BRRE 2P95A 2KR7A 1HAOH 5JYIA 3QZRA 1KY9A 1QB9A 1ZHMA 1TNIA 2OCVB 4FETA 3ZYEA 5HKKD 2G00A 1O3AA 4XBBA 2PTCE 2XNIA 2OQ5A 1C1VH 1ZPCA 3QK1A 4E05H 2C8WB 4NWKA 1IQLA 1FDPA 1ABIH 3NK8A 4NA7A 2OUAA 1A3BH 5C1XA 4B2BA 1HYLA 2SNWA 1WSSH 4BAQB 1C2IA 2OC0A 3LDXH 1O5CB 1CGHA 2CXVA 3P8NA 3D62A 1TIOA 3F0PA 3SU1A 5C94A 3QN7A 4I31A 4PROA 7GCHG 1UHBA 3TLOA 1G3DA 4AC9A 1V2VT 5I46H 3A8BA 3CNRA 1FXYA 1UK4A 2FODA 4CRGA 1Z71A 1WAYB 1KXEA 1MTNB 3R3GB 1CA0C 1SL3A 1CHGA 5EJZA 3ZVGA 1WYKA 2CK3D 1MTSA 3HATH 4FUCA 2PKAB 2GDDA 5TCCA 2OC7A 2ODYB 2J94A 1BCUH 3TITA 1TX6A 3BTHE 1P2OA 1NM6A 1THRH 1TQ0B 1MTVA 2R3UA 2B0FA 2AIQA 1QY6A 5JPMH 2QIQA 3DSPA 2SGPE 4BAHB 4CHAC 1LVYA 1YCPH 1NT1A 4RT0A 4ZKRU 1UTNA 2J98A 1FI8A 4YOJA 1E35B 1MUEB 2P3UB 1V6DA 3FAOA 1O2TA 2J5UA 3S69A 1MBQA 1LHEH 4NGAH 4A5TS 5ETXA 2FDAA 3SU0A 1G2LA 4KTSA 3VPKA 2A4GA 3SUDA 1W14U 2BY6X 4DW2U 1MAYA 4AFUA 2QN5T 3GCNA 1F0TA 1ZTKA 1O5DH 2YMSD 4DT4A 3TU7H 1C5MD 3FANA 3MO3A 3GY8A 1O2HA 5GPIB 3TJVA 1C2KA 1PFXC 2ZFSA 2SGFE 5DK1A 1QA7A 5F6MA 1K9OE 1YF4A 5F8TA 1UCYE 2Z3EA 5EODA 2H6MA 3VB5A 2DE9A 4F48B 3P92A 3F2GA 4LZ1H 1OWKA 3U9AH 5EQQA 1UW7A 1AFQC 2WSSD 2G52A 2AYWA 1C1WH 2PW8H 5A0CA 1G3BA 1GJCB 2ZI2H 5DP6A 1HV7A 5EQSA 1TWXB 4BNRA 4ABBA 4I86A 2DE8A 2FLRH 2ZF0H 1DSTA 2KCOA 2QYIA 1GDQA 1ELGA 1BMMH 4X8TH 6CHAC 5FBIA 1S0QA 1DLEA 1O32A 3QX5H 2V0BA 4AFSA 3GCHB 4X2XA 3MNXA 1CT4E 2WV9A 1SGEE 4Y76A 5GCHF 2BB4A 5HIYA 1GJBB 1OP2A 4I33A 1QCPA 1SMFE 1TNGA 4A1XA 1ZLRA 1TPSA 1GMDF 1L4ZA 2IPQX 1T31A 1Y8TA 1Z8JB 1U6QA 2G5VA 2ZQ2A 3L6PA 2SGDE 1A3EH 5IK2D 2I6SA 2RA3A 1YY3A 1G37A 4UFGH 1N6YA 3M7TA 2ODQA 3DCLA 1DDJA 4F4OC 1O38A 3BTKE 3MWIU 3RU4T 1TQ7B 1F92A 1O3JA 1HJ8A 2R3YA 3QGNB 3MO6A 3LH3A 1DFPA 3EA7A 5JBTA 1EZUC 1IQEA 1FIWA 3MYWA 1EAXA 1JMOH 2H9HA 3OTPA 4ISOA 1TBZH 2XOKD 3RMOH 1TE0A 2KZ4A 4B76A 2HNTC 1AD8H 1JBUH 1PPFE 3AASA 3GY6A 1J8AA 3FO8D 2WYGA 4AZ2B 5DP3A 1NESE 3RP2A 2ZG0H 4THNH 4BTTB 5EU8A 1GJ7B 3RXCA 1YLCA 1BTWA 3UAIC 5A0AE 5HIZA 1O2IA 1F2SE 3B8JA 2OP9A 2FX4A 3E90B 3ZVFA 1AB9B 1W0JD 1SSXA 4J2YB 1OOKB 2XBWA 4GAWA 3TVJB 1HAPH 2FOBA 3ODDA 2XWAA 1AZZA 1QGFA 2BOKA 3U1JB 1O34A 1KIGH 1GBJA 1N8OC 1TBQH 4X1SU 4XBCA 5TJXA 1D3DB 3AK5A 5AVDA 2FTMA 2PLXA 2Z9KA 2LNCA 3MFJA 3WY8A 1VITF 1QURH 2AMQA 4TPIZ 3UOUA 1IQFA 5C20A 4DT7B 3MMGA 4AYVB 1GMHF 1CA8B 2RG3A 5EXNA 1A0HB 4YLUA 3UWIA 1Z1JA 3S7KB 1LPZB 4X2VA 4A1VA 1P57B 1YKTA 3P8OA 3FN8A 1O2ZA 1WBGB 2BVSH 2H9TH 1C9PA 2BDGA 2ZFQH 1V2RT 2AS9A 3ZZ8A 1BTZA 2ZU2A 3ATKA 4D76A 1BBRK 4ACAA 1XVMA 2BLVA 3ZV8A 5KECA 4DIIH 5F8XA 5JBBS 3SNEA 5CHAC 2GDEH 1FZZA 3MU8A 2PP6A 5GDSH 2TBSA 3OTJE 1VKYA 5SGAE 1S6HA 1TLDA 1IQJA 1NTPA 3URCA 2ZHFH 1AGJA 4Q7ZA 1C5LH 1KDQB 1J16A 3M5LA 3NRLA 3K65B 1AO5A 1V2OT 2OTVA 2HOBA 2PHBA 1UVOA 4CRDA 2GP9B 1RRKA 2KFWA 4IW4E 1WUNH 1AZ8A 1K28D 3PO1C 3SQEE 3OEED 3S9CA 1BTPA 3SV9A 3A81A 1T32A 1P06A 1O5FH 4XBDA 1NFWA 5BPEA 4YO9A 1C5XB 5DP7A 2P3FH 8GCHF 2HVXA 2QE7D 4D9RA 1FONA 1O36A 1TMUH 1HLTH 4INLA 1AN1E 1OPHB 1G9IE 5T6DA 3RDZA 2QF3A 2BVXH 3D49H 3KF2A 5J4QA 1UTLM 2ULLA 2V35A 5A09A 1YYY1 4YXWD 1ARCA 1O39A 1NC6A 2GV7A 2TGTA 2GT7A 1ESTA 3RMNH 2C4FH 1JRSA 2A7JA 1GL0E 2IJD1 4LXBH 1GJAB 2A4OA 1IHSH 4GCHF 2FI5E 5EGMA 4CRBA 2ZECA 4FU7A 3PM3A 3ZVAA 4U01A 5FPTA 1C1TA 2F91A 4KGAA 1XX9A 3D23A 3SO3A 1GI5A 1CT0E 4OGXA 2ZO3H 2RCEA 3GYLB 1ELFA 5AFYH 3DT0H 3DFJA 3LU9B 3RLYH 2BVRH 3DHKH 1AWHB 1ETSH 3MH6A 4IS5A 2VNTA 1OX1A 1SOZA 4UONA 2VWOA 1Q2WA 1L2EA 2G4UA 1NPMA 2Q6GA 1DSUA 2O8WA 3BTQE 1N6XA 1PPZA 1FY4A 3JZ1B 3RXMA 1E36B 3KQEA 3NWUA 2F9VA 4NIYA 1RTFB 4BAMB 3E16B 2DUCA 1LVBA 3DD2H 1S81A 5DP8A 3KGPA 1KMHB 2F9OA 5EPYA 1PPGE 4BTIB 1P01A 2A2XH 3KQCA 1H8IH 4OS4A 1HPGA 1EAWA 3ZVCA 1B7XB 1ZMJA 1BZXE 4U2WA 1A5IA 3PMHB 2ZDMA 1EX3A 2BLQA 2EI6A 4LZ4B 1ZHRA 3PMAB 2WYJA 4Y8XA 4YLQH 4UFFH 2CGAA 3DUXH 1ZOMA 1TNLA 2G8TA 1UTJA 1T4UH 1HNEE 4GHTA 5C17A 4MNVA 1O3EA 1DVAH 1O3CA 2GJGA 1O2SA 1T8OA 2L74A 3DFLA 1O30A 2CMYA 1PPHE 2CF9H 3PMJA 5JBCS 2KAIB 2EQNA 2BLWA 1YCPM 2BDHA 1QQUA 1ZPBA 2XRCA 1ELEE 1GHBF 3M3SA 5DP5A 1VCPA 2VIQA 2ZU4A 1CU1A 2XC0A 3H7TA 2FI4E 2UWOA 2P8OC 1AE8H 1W12U 4NZLA 1QFKH 3NCLA 1FY5A 4HI3A 1ABJH 1TFXA 4D9QA 3NZIA 1J9CH 1JOUB 1TRMA 1GJ4H 1HCGA 4ESTE 2V6NA 1D3TB 3EE0B 4KTCA 1GJDB 2XC4A 1XVOA 2UUKB 3GCTF 1EQ9A 1Y3XA 2GT8A 4DCDA 3MHWU 4WMFA 1MZDA 2VU8E 1KLIH 3T5FH 1X7AC 3O8RA 1RTLA 1VGCB 2TGDA 5A0BA 2AIPA 2ANMH 4BAKB 5DGJA 3GDSA 1O2XA 3SHCH 1XUKA 4TYDA 5L2ZH 3T26A 1EFRD 4ZROA 3OY6U 3OYPA 4F55A 1HAZB 4Q63A 4JCNA 1SGNE 2ZFRH 2VIPA 1EJAA 5LH8A 2R0KA 2EI7A 1P2IA 3PRBA 1JXPA 3CS7A 1GBTA 1F7ZA 3A82A 4AYYB 1P0SH 3NUMA 3A7YA 3L33A 3RXVA 3TJOA 5K7RA 1YPEH 2UUFB 2ZHWH 1TNHA 2VIVA 2VJ1A 2F43B 2BDCA 1Z1IA 3SI3H 2GTBA 5A8YA 4F49A 3OFND 4ISHH 4GLYA 1COWD 1Y5BT 1TPOA 4CR9A 2ANYA 4BXWA 1K1MA 2QGRA 1O3LA 4IMZA 3SV7A 1MTWA 2XCFA 3PRDA 3BEFB 1O2MA 1GPZA 1CQQA 2A5KA 2R2MB 1C2LA 1TX7A 4JK5A 4JK6A 2KCYA 3KYFA 5FCKA 2A1DB 1ZJDA 3QO6A 1P2KA 5C1UA 1TOMH 9LPRA 3M5MA 1KXCA 2OBOA 3A89A 1TRYA 4UE7H 1XUFA 3EA9A 1GGDC 5JDUB 1ZRBA 3ZZAA 1CBWB 1HJ9A 1HFDA 2YOLA 1C5RA 1BBRE 1HAVA 2OBQA 1TMBH 5HM9A 3BTFE 4DJZB 1YM0A 3ATMA 4B71A 1H9LB 1O3IA 2ZA5A 3RXLA 1DICA 1GBDA 3BTWE 3UUZA 1OS8A 3MTYA 2BY7X 2AGIX 2C93B 1C5QA 2H5DA 1EPTA 2ZC9H 3SUFA 3A85A 1BJVA 1QL9A 2AMDA 1MH0A 2B8OH 1UTOA 3LIWA 2JETC 2A0QB 1AFQB 1UVPA 2QF4A 4K3JA 2V7QD 2FS9A 3C1KA 3SI4H 3UFAA 1NN6A 1SGFA 3RU4D 5GWZA 1FLEE 1V2WT 1C4Y2 1ESAA 1PJPA 3TJUA 1EAIA 1YLDA 1YPKH 4J1YA 3U8RH 2RDLA 3U1IB 2PR3A 3KN2A 2G51A 1FV9A 6CHAB 2WZQA 5KGOA 1QL8A 3SNBA 1H8ED 2FYRA 3F2HA 1TGTA 3GY7A 1OWEA 2IPHA 4CBNA 2V3MA 4K1TA 3OE7D 1FX0B 2KCAA 3SGQE 3PV2A 1E0FD 3PLPA 2ZCLP 4IMQA 2OQUA 3LJOA 1C1NA 2H1UA 1ZRKA 2D8WA 1M9UA 4Y0ZE 1FAXA 1BT7A 2BY9X 2Z3DA 4OS1A 1F0SA 1YBWA 1Q3XA 3SU6A 5DO4H 2BQ6B 1QBNA 1C5UA 4JZDH 1PPCE 2BD5A 1F5RA 4FUEA 4NSYA 1UMAH 2J38A 2ZCHP 4MQAA 4HGCA 1BMFD 1KXFA 3K2UA 1WQSA 4OGYA 2PKSC 3C27B 3FP7E 2BX3A 1FJSA 4YOIA 5DN6D 1OXGA 3BTGE 3E6PH 5C5NA 1GJ6A 4INKA 5E0JA 1O2NA 2BD2A 1SLWB 4NWLA 1AE5A 1YCPK 1KXAA 2BDIA 2XBXA 2YNBA 1PYTD 1BTYA 2Q6DA 5GNDA 3SZNA 2WPLS 1HBTH 3QWCH 3SUEA 2GCHG 1V2KT 3N7OA 1ZTJA 4CRFA 3K6ZA 3FVFB 2XNDD 2SGEE 6GCHG 3DA9B 1HJAC 3SQHE 3SNAA 3PWBA 1QB1A 1RIWC 2VH6A 1V2MT 4SGBE 1D4PB 1SB1H 3HKJB 4OS7A 4XRNA 4B75A 1QZ8A 4ABEA 1ZSJA 2SNVA 1Y5UT 1NU9A 4TWYA 4UEHH 1DT2A 1A0JA 2ILNA 1C9TA 1MKWH 1V2ST 2W3KA 1GCTC 3F9HA 1C2GA 5CHBA 1SGRE 3Q3XA 1HAIH 3F0OA 1CGJE 4NCYA 4X6PA 3A8DA 1VCWA 3FZDA 4RN6A 3TNSA 1OWHA 1OYTH 3S9AA 1E34B 3UR9A 1THSH 2GZ7A 3LGWA 2BZAA 1DM4B 1ORFA 5G4BA 3E0NB 2VVCA 1TNJA 5AF9H 3Q3KA 1OYQA 5CDFE 1EOJA 1V2TT 2KX4A 1TGSZ 1WV7H 5CHAB 2PKAA 3SU5A 3SZEA 1UK2A 3KQBA 2BZ6H 2R9PA 4GUXA 1GG6B 1XXDA 1IQIA 3MNSA 3FFGA 4CRCA 1A5HA 2ZDAH 2BDYA 4Z0KA 3UPEA 1W0ZU 2ALVA 1K21H 1W0YH 1EPTC 2LPRA 1K1PA 1SFIA 7GCHF 1B0EA 3BEUA 4FUDA 1LQDB 1YPHE 5ABWA 1ELTA 1ACBE 1GDNA 2QF0A 3BF6H 3P6ZB 1YC0A 4BTUB 1NROH 1ETTH 1VR1H 1C5VA 1YPGH 4WJG2 1EKBB 4HFPB 1O2QA 5LPEA 1Y3WA 1TYNA 4X8UH 1UK3A 1QRZA 2WPMS 3QDZB 2OLGA 1DUAA 1NO9H 1TX8A 1P3EA 4WF8A 4ZKOU 2O9QA 1RTKA 3SUGA 2VINA 1NRPH 2OC8A 5L2YH 4I8JA 3TGIE 2GZ8A 1HUTH 1G3CA 1HAGE 1RD3B 4Q4LA 3V0XA 3AVZA 3GDUA 3U69H 1BDAA 2WUCA 3EE7A 1IQKA 4JZ1A 2Q1JA 2Z3CA 4ISIH 3OSYA 1XM1A 3UB0A 1NBMD 2JH0D 2Z9GA 4UFDH 1ZR0A 4K2YA 3B9FH 3FP8E 4AB8A 1T7CA 1JWTA 3Q76A 3P8FA 4RKJB 3RM0H 2I6QA 4ZXYH 1GBFA 4AFZA 3TK9A 1AKSB 3ATWA 2VH0A 2O8MA 2ZZUH 4XDEA 1MU6B 1ZZZA 3ZVEA 1MQ6A 4IGDA 2PWXA 2ZPQA 1RS0A 4H6TA 1O2OA 4K8BA 5ESTE 5LPFA 1PQ7A 2PUQH 4DURA 2NWNA 2ZGJA 1YPLH 2B5TB 1QTFA 1C5SA 2BM2A 1NFUA 4GSOA 1E1QD 1VITG 1TALA 3LPRA 2VIWA 1NRNH 4B1TA 1GMHG 1C1QA 1C1SA 1O5AB 2C90B 1QJ1B 3BG4C 2HLDD 3CP7A 4WH6A 2BD7A 1GI3A 3ZZ7A 3HK6B 3BSQA 1GBIA 4MPUA 1ZTLA 2P59A 4NIWA 3ZVBA 1K0HA 1ARBA 1O3KA 4O03A 1BRUP 3BG8A 3DSGA 3I78A 1CE5A 1O3DA 4YTAA 5EW1H 2ZEBA 1O2JA 1W2KH 4FUFA 1GBKA 5C67A 2RA0A 5TCAA 3I29A 5F8ZA 1SLXB 1KSNA 4D7GA 5HYOA 3WW7A 1OWIA 1UTKA 2FLBH 1CO7E 1O3FA 2ANWA 1CSOE 3SV6A 1IOEA 3RXTA 4NG9H 1P04A 3LOXA 1UVUH 2PSYA 2XYAA 4FUGA 2Y5HA 4Y0YE 1ANBA 1DWCH 1GVLA 2J34A 3SU2A 5FX5A 2ZHQH 2XC5A 2ZU5A 3A7WA 4VGCC 2HWLB 4OS6A 2P8OB 3HGPA 1DX5M 3BTDE 5IDKA 2OC1A 1GVKB 1SHYA 5GJ4B 1KXBA 4OS2A 1XUIA 5C0TA 1WQVH 4DOQA 2F9PA 3H7OA 2ZTXA 1LVOA 2ZWLH 1V2PT 4A7IB 1Q31A 2QXJA 1O3MA 3M7UA 1AI8H 2BDAA 5FPYA 1TBRH 2ZCKP 5GIBA 3W94A 4P02A 1GJ8B 3H5CB 2ZDLA 4Q80A 4M7GA 2FOCA 4MPVA 1XUJA 1GHAG 1IQGA 3URDA 3STIA 1LHGH 4UFEH 1FPCH 2FOHA 1WXRA 5E2PA 1NFXA 4JMYA 1LPGB 1FN6A 1O3GA 4X6OA 3TH4H 3RMMH 7ESTE 2LELA 2TGPZ 2CHAC 2A5IA 2H9EH 4WXVA 3W1EA 3LGVA 1C5OH 4CRAA 4YOGA 2PV9B 4H6SB 1AIXH 3P95A 1KDQA 1C2HA 1TONA 1C2EA 1UJ1A 2PFEA 1BQYA 1HDTH 3ZZDA 1P11E 4O3UA 4TWWA 3PLBA 1HAHH 3T28A 1KTTB 1NBME 2HRVA 3S0NA 4NIXA 4ASUD 3QZQA 1DOJA 4IN1A 4ZHLU 5C3NA 3ENSB 2G55A 4I8GA 1TMTH 1Z8RA 2FOGA 4O97A 3T2NA 3UREA 2AGEX 4ASHA 2D26C 5T1VA 4X8VH 1MTUA 2W5EA 1KYNA 1ZMLA 1ANDA 3ELAH 1K1JA 5A8ZA 3KYGA 1Z8GA 4NZQA 1BRBE 2VVVA 1GGDB 4X2YA 5AFZH 3T62A 4YT6H 4X0WU 1BTXA 2TRMA 4AOQA 2STBE 4I8LA 1ANCA 1UVSH 1K1OA 2WV5A 5A8XA 5EIYA 5JB9S 2GD4B 2J97A 2J95A 3N7EA 3GCHC 2Y5FA 3H09A 1AUJA 3A7ZA 3ZYDA 1B5GH 4FVDA 2HPPH 1AWFH 1DY9A 4HG6A 2GMTB 1GJ9B 4FUJA 4I32A 3GICB 2ZFTA 3SW2B 2VVUA 1Y5AT 1BTUA 1E1RD 2JETB 3SV8A 3WWFA 1EJNA 2Z7FE 4U32A 2Z9LA 2CN0H 3K9XB 1DITH 3F68H 2TGAA 2F4LA 1H1BA 3PV5A 4TT3D 2A4RA 3MU5A 2BDBA 3VEQB 3NPSA 5FL7D 1KXDA 1A61H 2H2ZA 1JIMA 5IYTA 3P8GA 1VZQH 2CV3A 1O3BA 4R8TB 1FN8A 1J15A 3T29A 4CBOA 2VB0A 1SC8U 4FOUC 2FS8A 3GCTG 3M3TA 3E3TA 3Q00A 2V3HH 2Y81A 5F53A 5CMXH 2WV4A 4AGJA 5EW2H 2VGCB 2ZDKA 1C4V2 3M61U 3QLPH 1LVMA 1CHOG 4ZKSU 1Z6JH 2J92A 1AVXA 1EASA 1GBHA 1L1NA 1MZAA 1AVWA 3RXFA 1GBCA 4FXGH 1ZGIA 5T6GA 2A7HA 4XE4A 5C5OA 3MQKC 4E06H 2JH5D 4ZAEA 1C1OA 4Y79A 1GBAA 1EXFA 2Y7ZA 3A8CA 3E91A 1GMCF 1DWBH 1O3OA 1L4DA 2F9BH 1P2QA 3F9FA 3ZZBA 1SQTA 2NU1E 1XXFA 3B23B 3ZZ4A 4O3TA 4DGJA 2WPHS 2GZ9A 2HLCA 4CH2B 4Z1MD 1GJ5H 4ABFA 2KAIA 4IC5A 1FY1A 2QC2A 4X1QU 1XUHA 1P2NA 3UOPA 2BHGA 2FX6A 1SGDE 3M5NA 1V2LT 2F9UA 1HIAB 2ZGXH 3PROA 1HJAB 1Y3YA 2AGGX 4NSVA 1RIWB 4AG2A 2O8UA 3LGTA 1UTQA 2BY8X 4MVNA 2C8YB 3M5OA 4NFEA 1EAUA 1H4WA 3IWMA 2JH6D 1ETRH 2GX4A 3F9GA 1CA0B 1SGIB 2AH4X 2P93A 1LHDH 1SGFG 2BQWB 3LC5A 5E8EH 1P9UA 2ODPA 2PSXA 1ZMNA 3EQ0H 3PMBB 2EI8A 2BY5X 4GHQA 4ABDA 2XXLA 4M9FA 3N99A 4WMDA 1V2UT 1VJ9U 1IAUA 1FAKH 4MPWA 3E1XB 4CHAB 1SG8B 2AERH 3ZZCA 2Z9IA 2BOHB 2BD9A 3LJJA 2BD3A 1Y59T 3KL6A 3ZV9A 1ZSLA 3V7TA 3UIRA 1AFEH 2JKHA 1Y3VA 3UWJH 1CVWH 1A7SA 1G32B 5EOKA 4XSKU 1MKXH 2W3IA 8KME2 2NU3E 4RT1A 3R0FA 3OX7U 4X8SH 3VXFH 3EAJA 3S7HB 2QAAA 1DUEA 3RUOA 2FIRH 5FAHA 1O2GH 3BIVH 2THFB 1Z7KA 2ZU1A 4R0IA 4IBLH 4A1TA 4RI0A 1EPTB 1SLVB 1P03A 1UCYH 1DE7H 3RXQA 1C5YB 3PWCA 1EZSC 1AQ7A 1GI6A 1LMWB 3K6YA 3GCOA 1SFQB 1C4U2 2Z9JA 1W7XH 1BITA 2KCPA 1F5LA 3A80A 1H8DH 2KM0A 2ZP0H 4B73A 4NIVA 1FY8E 3FP6E 2YMSC 1RGQA 2WPIS 1TABE 2R0LA 1WU1A 1ID5H 4FUBA 4CH8B 1HAXB 1BRAA 5EXLA 1LQEA 1TA6A 2B7DH 4FU8A 4FU9A 3VB4A 3LH1A 4UDWH 5T3HA 1J14A 3PTBA 3TGJE 2RFKC 3SOSA 2GCTC 3MH7A 2ASUB 1BB0B 2GKVE 2ZPSA 4MDSA 1FUJA 1VITH 1C1UH 3M7QA 4BOHA 3RXSA 1DS2E 1GI7B 3KQ5A 4LOYH 1F0RA 2W7UA 1K1IA 1SGTA 4OS5A 1HB0B 3SJKA 1LTOA 3MU4A 4AORA 1YLNA 3UNSA 3EDXB 2FZZA 1O33A 1RFNA 1D9IA 5GXPA 3MH5A 4ZXXH 5DKMA 2L6OA 1Z8IB 2STAE 1GL1A 1DWEH 1Z6EA 4LK4A 4NFFA 3RXRA 3MH4A 4KTUA 2FM2A 2ZTYA 1QB6A 3HPTB 2BD8A 4AG1A 3PTNA 1O2VA 1BMLA 1MKWK 2FO9A 2A2QH 4QT8C 2AEIH 4WWYA 1L1JA 2BYAX 3CS0A 4BXSA 3A7VA 2W7SA 1DANH 3MU0A 3OY5U 3RXKA 1ESBA 2QV1A 4YT7H 1DXPA 1S6LA 2VWNA 2UUJB 1YWUA 3SYJA 1G3EA 1KLJH 4JZEH 2ZQ1A 3SJOA 4D8NA 2HNTF 4AGKA 1NZQH 2J9NA 4I8KA 2A7CA 3RXEA 4WH8A 3BG4B 1GWAA 1O3PB 3F2FA 4XD7D 2P3TB 5HMAA 4Y6DA 3SU3A 4A6LA 1FIZA 3AAUA 3RXJA 5EPNA 1O2RA 3P17H 1UHBB 4X1RU 5EJ1A 4WVPE 1LPKB 2W6JD 2FPZA 4CR5A 3T25A 4OM9A 1S83A 2QXHA 2ZFFH 3LONA 1SGCA 2Y6TA 4MNWA 4JYUH 1ELBA 3OAAD 4DVAU 1LDTT 7KMEH 1N8OB 2G4TA 1KLTA 1SOTA 3QGJA 1MAXA 3U28C 1VGCC 1WCZA 3M3VA 1SVPA 2ZGBH 4ZUHA 4K8YA 1C5ZB 2CJIA 2JJ1D 3KCGH 1QA0A 2JIZD 4Y10E 4AFQA 1SGYE 3Q3YA 1EB1H 2QCYA 3RMLH 2ZHDA 3A8AA 1BJUA 4X6MA 3TGKE 1O31A 3GY3A 1ZHPA 5FXLA 2J98B 2QF5A 4VGCB 2J2UA 2BXUH 4WY3A 1BIOA 1O3NA 1AHTH 1O3HA 3O8BA 3L3TA 2Q6FA 2XW9A 3TH2H 3RXHA 1QL7A 1A1RA 1AMHA 2FMJA 2ZGHA 3MNBA 3BTEE 3EGKH 1S84A 1UO6A 2OXSA 4KKDA 3UR6A 8LPRA 3LKWA 4ZHAA 1SGPE 4HTCH 5E0GA 4ABGA 1QJ7B 3RC5A 1CGIE 5FPSA 1P12E 2GCHF 1MD8A 5DG6A 1GBEA 2ZDVH 4SGAE 3OU0A 1GI4A 4INHA 3F1SB 6GCHF 1L0ZA 4MTBA 1E37B 3EA8A 3PO1B 1OKXA 3ODFA 3ATLA 5GCHG 5C0UA 1GVZA 4Y11E 3TNTA 1YGCH 3BTME 1ZYOA 3RU4E 4Y8YA 5L6NH 1GMDG 1THPB 4B2AA 4K60A 1CBWC 2CHAB 5I25A 3NKKA 2Y80A 7LPRA 2OK5A 3RXUA 3VGCC 1D3QB 3ATIA 3RC4A 3OEHD 1WTGH 1BMNH 2RDEA 2ZHEH 1HRTH 1EUFA 3A7TA 3VFEA 2BD4A 2FOFA 1IQHA 2A31A 2GGVB 5EXMA 3LGIA 5FHTA 2FWWA 1K2I1 1O35A 1NY22 4I8HA 1SGQE 2A5AA 1NS3A 1K1LA 1TOCB 3IG6B 1SHHB 1SQAA 1YPJH 1P9SA 1ELDE 2HALA 4YESB 3CENA 4Y7BA 2W26A 1A0LA 8ESTE 1TAWA 2ZFPH 3N7DA 4A92A 4P00A 1P2MA 3ZZ5A 2FOMB 1EZXC 1DPOA 1P3CA 1QQ4A 1SI5H 2PGBB 4GVUA 3RXAA 2XCNA 3QTVH 4RKOB 3W95A 1O2YA 4B74A 1A2CH 2Z94A 2Y5GA 1E38B 1QBVH 1MQ5A 2VBCA 3GISB 3NXPA 5B6LA 2TPIZ 2V3OH 3VB3A 1S5SA 1AU8A 2NU2E 3P70B 2FP7B 4NA9H 4GPGA 5DP4A 4JZFH 1GBLA 1O2PA 3BTTE 1E79D 3BV9B 3RXOA 5EG4A 5C1YA 4X1PU 2D2DA 5JB8S 4X6NA 2QXIA 3PLKA 4MNYA 1EATA 1XUGA 1AKSA 5J4SA 1P10A 1GI0A 2PGQB 1C1MA 1INCA 2SFAA 1SQOA 3SNDA 2M2AA 1RXPA 4ABIA 2OD3B 4D7FA 1MABB 1BRCE 1QRWA 1SKYE 2W6ID 3ZZ9A 4K5ZA 2ZGCA 2FTLE 1V2JT 2WINI 3SORA 1NRQH 1HXFH 1O5EH 5T6FA 2GV6A 5H4IB 5K0HA 2R2WU 4KELA 2JDID 3UQVA 2OINA 5FCRA 1UVTH 1GHVH 1PQ8A 1ANEA 1MU8B 1TA2A 1G36A 3SGBE 1W0KD 4DY7B 1ELAA 1GHZA 4MG3A 1D6RA 2HVYB 2FI3E 4MNXA 2F3CE 1TNKA 2HPQH 1MTNC 3FKSD 3HK3B 3M35A 4B6EA 8GCHG 1MMJN 5E2OA 2WPKS 2ZPRA 2A45B 2FEQH 3SHAH 3SNCA 1KTSB 2K0QA 1BUIA 4AB9A 1BOQA 3KQDA 4ABJA 4E7RG 3SV2H 2EEKA 3TK5A 1V2NT 4ISNA 4TPYA 4Y71A 1S6FA 4FVBA 1ELVA 1F5KU 1W8BH 1O2UA 3KIDU 2ZIQH 1JIRA 1WOFA 4CREA 4GCHG 3A83A 4ZMAH 1LKBA 4BANB 1C2MA 3MI4A 5ESBA 4Z6AH 4K1SA 1ZJKA 2A4QA 3GDVA 4ABHA 1SLUB 3STJA 1GG6C 3LT3A 5DSFA 3RM2H 1OWDA 2WPDD 2Z6BD 3BIUH 2XBYA 1C1RA 1LCYA 3GOVB 1MBMA 3M36A 5AHGH 5HGGA 4ZCNA 4ISLA 3SBKA 1P02A 2G81E 2ZKSA 3AW1A 3MU1A 2J4IA 2IJOB 1XKBC 1JRTA 1UTMA 3E8LA 4JYVH 3A7XA 1FQ3A 3I77A 3LC3A 1GHWH 1EP5A 1EZQA 3LGYA 4ACBA 2C8XB 2EY4C 2G5NA 3ZVDA 1Y3UA 2QY0B 2UUYA 1PQAA 2C8ZB 1BBRH 1GCDA 1EP6A 4ZH8A 3V12A 2IOTA 1NFYA 1AY6H 2BQ7B 1G2MA 3DSOA 1O5BB 1BTHH 1ELCA 5DJ7A 2ALPA 1W11U 1SQRA 2K8IA 1S85A 1H8HD 4DG4A 1H9HE 1NU7B 3GY4A 1AVGH 1GHAF 2Y7XA 3TJNA 1MCTA 1LHFH 4AX9H 3V13A 3AAVA 2FOAA 3T27A 2QXGA 2WHXA 4O9VA 1BA8B 2ZTZA 1TB6H 5F03A 1GI1A 2AHME 9ESTA 2NU0E 3IITA 2YMSB 5FX6A 4TSFD 1GHBG 2C3SA 1TGBA 2ESTE 1TPPA 2PUXB 1C2FA 1SBWA
chains in the Genus database with same CATH topology
2W6JD 2IJD1 1W0JD 4KTCA 2LELA 2YMSD 4DT4A 1DY8A 4U01A 4OM9A 4B6FA 5FPTA 3LONA 3W1EA 1E1QD 3N7DA 4A1TA 4RI0A 4A92A 2FOMB 3OAAD 5GPIB 3O8RA 1RTLA 2K1QA 3FOAA 5CDFE 3U1JB 3WWBA 3U1IB 3KN2A 2XCNA 3AK5A 2WZQA 3ZIAD 2KCPA 3F0OA 1H8ED 2KM0A 3F2HA 4B74A 2GVFA 1NBME 2HLDD 4TYDA 4WH6A 5ESBA 2JJ1D 4B73A 1EFRD 4K8BA 4ASUD 3SU5A 4F55A 2YMSC 2JIZD 1RGQA 3F2GA 3OYPA 2A4QA 2VBCA 3SZEA 5B6LA 5EQQA 2P59A 3OE7D 4Q63A 1FX0B 2KCAA 2KR7A 4JMYA 2WSSD 2FP7B 3PV2A 4FETA 5HKKD 4Z1MD 5T1VA 2JJ2D 2QF5A 5DSFA 3PRBA 1JXPA 2F9VA 2WPDD 2XNIA 4A1VA 3O8BA 5EQSA 3P8OA 1E79D 3VG8A 3FN8A 1W3CA 4NWKA 1BT7A 3SU6A 3M5NA 1A1RA 2F9UA 2KCOA 1KMHB 4ZCNA 3WW7A 2F43B 5EPYA 1BMFD 3OFND 1COWD 2OC0A 3SV6A 2M2AA 3LKWA 3P8NA 3F0PA 2IJOB 3SU1A 1N1LA 3RC5A 4I31A 5DN6D 3LOXA 3SV7A 3N7EA 1MABB 2WV9A 2XCFA 5FPSA 3H09A 3M5OA 1SKYE 3PRDA 2W6ID 4I33A 4A1XA 3SU2A 2KCYA 4WF8A 4NWLA 3SUGA 2L6OA 3M5LA 3L6PA 1DXWA 3NRLA 2OC8A 1DY9A 4I32A 5IK2D 2FM2A 1OHHD 3KNXA 2KFWA 1E1RD 2OC1A 3M5MA 2CK3D 5GNDA 5IDKA 2OBOA 5GJ4B 3DCLA 5C0UA 5H4IB 3SV8A 3WWFA 5C0TA 2OC7A 3OEED 3SUEA 5C17A 4Q4LA 3SV9A 2JDID 4M9FA 3N99A 3RC6A 3DSOA 2F4LA 2XNDD 3PV5A 2OINA 2YOLA 4TT3D 3EYDA 2A4RA 2OBQA 3SU4A 2K8IA 3UB0A 1H8HD 1W0KD 2QV1A 1NBMD 1DXPA 1S6LA 2QE7D 2OK5A 3DSPA 4B71A 3O8CA 5FL7D 3O8DA 3SYJA 3OTPA 4B75A 2XOKD 5FPYA 3F3BA 2KZ4A 4B76A 2WHXA 4R8TB 3RC4A 3OEHD 2J5UA 1CU1A 3FKSD 4B6EA 4WH8A 3FO8D 2AHME 3KF2A 3F2FA 3SUFA 4XD7D 2GGVB 5CHBA 2O8MA 2YMSB 4TSFD 5ETXA 5EQRA 3SU0A 4YXWD 3KEEA 2K0QA 5F53A 3SU3A 2A4GA 5EPNA 3GS9A 3SUDA 1NS3A 1WXRA 2QF4A 3E90B 2V7QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0P A;  3F2F A;  5C0U A;  3F2G A;  3FN8 A;  5DSF A;  5C0T A;  5C17 A;  3F0O A;  3F2H A; 
#chains in the Genus database with same CATH topology
 2B9L A;  1OP8 A;  1HAY B;  4K69 A;  2XTT B;  1O37 A;  5E0H A;  1GMC G;  2GCT B;  1A5G H;  4B6F A;  1O2K A;  2SGA A;  1J17 T;  3LGU A;  1HGT H;  1OP0 A;  1QJ6 B;  3U8O H;  1T4V H;  3RXD A;  3VB6 A;  4YM9 A;  1G30 B;  1WTH D;  1ZGV A;  3PB1 E;  2ZDN A;  1YPH C;  3A87 A;  3UNQ A;  1TGC A;  4I7Y H;  1C5P A;  3E0P B;  2UWL A;  1YP9 A;  2SGQ E;  2XBV A;  3SJ9 A;  1SR5 C;  4XFQ A;  2H5C A;  3F6U H;  1V2Q T;  1AB9 C;  2WUB A;  1DWD H;  1FNI A;  1T8L A;  4YZU A;  2FYQ A;  3VG8 A;  1XKA C;  1SPJ A;  1CT2 E;  4AN7 A;  1LKA A;  3A88 A;  4IN2 A;  1D3P B;  1IQM A;  1QNJ A;  2PTN A;  3KHV A;  4ZHM U;  4NA8 A;  1TGN A;  2PKS B;  3A84 A;  4MPX A;  1GBM A;  2FES H;  1W7G H;  4X1N U;  4TY6 A;  2VIO A;  4WME A;  4XOJ A;  3ZZ6 A;  6EST A;  1NRR H;  1K1N A;  1OSS A;  1P05 A;  1C5T A;  3UQO A;  4ZKN U;  3AW0 A;  4WXI A;  1IHT H;  1IQN A;  3MO9 A;  1A46 H;  5JBA S;  1MD7 A;  1FY3 A;  3VXE H;  3U98 H;  5LGO A;  3M37 A;  3RXI A;  1PPE E;  2LP6 A;  3EYD A;  3BN9 A;  3SU4 A;  2EC9 H;  1MKX K;  3RXG A;  5KED A;  3RXB A;  1O5G H;  1H9I E;  4KP0 A;  1PYT C;  1EOL A;  3HGN A;  3F3B A;  2HGT H;  3TPI Z;  3ZZ3 A;  1BMA A;  1CHO F;  1UCY K;  1GCT B;  1GI2 A;  1P8V C;  2M5T A;  1TRN A;  1C2J A;  4FUI A;  1P09 A;  3MNC A;  2BX4 A;  5EQR A;  2QA9 E;  1HIA A;  3KEE A;  1GI8 B;  1PQ5 A;  2P94 A;  5FBE A;  1C5N H;  1MCV A;  4MLF B;  3TH3 H;  1FPH H;  3D65 E;  4JYT A;  4Q7Y A;  6LPR A;  1OWJ A;  1W13 U;  3SGA E;  5B6O A;  3QTO H;  1LHC H;  3QUM P;  1S0R A;  3ITI A;  1GHY H;  3EST A;  1V3X A;  1QBO A;  2K1Q A;  4K1E A;  3HKI B;  3WWB A;  5C2Z A;  5CE1 A;  5A2M H;  1GBB A;  3SN8 A;  2F83 A;  2AFQ B;  2EA3 A;  3UY9 A;  1HAV B;  1T8N A;  1RJX B;  2NU4 E;  1S82 A;  3A86 A;  4H42 U;  2BTC E;  2VID A;  4BAO B;  1A4W H;  4H4F A;  1GDU A;  4HZH A;  2WPJ S;  2JJ2 D;  1PPB H;  1T8M A;  1F0U A;  1HXE H;  3JZ2 B;  3SJI A;  3FZZ A;  2FOE A;  3RXP A;  1FMG A;  2HNT E;  1W3C A;  1C2D A;  3V3M A;  4FUH A;  1NRS H;  2Y82 A;  1WDI A;  2ANK H;  5EJL A;  1EB2 A;  3G01 A;  2TIO A;  3PV4 A;  1VJA U;  1N1L A;  1UTP A;  3VGC B;  1ZSK A;  2P16 A;  2ZNK H;  1C1P A;  3GYM A;  3UTU H;  1DXW A;  2BXT H;  4X2W A;  2D1J A;  1TPA E;  2IN2 A;  2UWP A;  4U30 A;  1OHH D;  2GMT C;  3KNX A;  3TIU A;  2VWL A;  2YNA A;  1C5W B;  4Y7A A;  4TY7 A;  1O2L A;  1O2W A;  3GY2 A;  3RC6 A;  1YPM H;  5LPR A;  1GI9 B;  2A32 A;  3MOC A;  4UD9 H;  3Q77 A;  3O8C A;  3SJ8 A;  2AMP A;  3O8D A;  2CF8 H;  1QHR B;  5HXF A;  3TK6 A;  1XMN B;  2F9N A;  3BEI B;  4JZI A;  1B0F A;  2O8T A;  3F9E A;  4ABA A;  4Q7X A;  5PTP A;  1LO6 A;  1K22 H;  1ZPZ A;  4E7N A;  1QR3 E;  1O0D H;  1VCQ A;  2ZU3 A;  3GS9 A;  3PYH A;  1D6W A;  1P2J A;  2VGC C;  5L30 H;  3VB7 A;  4B2C A;  5DPA A;  4Q2K A;  2O8L A;  2FXR A;  2VWM A;  1L1G A;  2BLO A;  1DY8 A;  4Y8Z A;  1QIX B;  3RLW H;  5DP9 A;  3FOA A;  3UNR A;  3S9B A;  4DIH H;  1W10 U;  3GY5 A;  1AUT C;  3ZIA D;  2GVF A;  4IC6 A;  5HM2 A;  1GHX H;  1QRX A;  1BHX B;  3U8T H;  2XWB I;  1EJM A;  1BHX F;  4RSP A;  2BMG B;  1DLK B;  5BRR E;  2P95 A;  2KR7 A;  1HAO H;  5JYI A;  3QZR A;  1KY9 A;  1QB9 A;  1ZHM A;  1TNI A;  2OCV B;  4FET A;  3ZYE A;  5HKK D;  2G00 A;  1O3A A;  4XBB A;  2PTC E;  2XNI A;  2OQ5 A;  1C1V H;  1ZPC A;  3QK1 A;  4E05 H;  2C8W B;  4NWK A;  1IQL A;  1FDP A;  1ABI H;  3NK8 A;  4NA7 A;  2OUA A;  1A3B H;  5C1X A;  4B2B A;  1HYL A;  2SNW A;  1WSS H;  4BAQ B;  1C2I A;  2OC0 A;  3LDX H;  1O5C B;  1CGH A;  2CXV A;  3P8N A;  3D62 A;  1TIO A;  3F0P A;  3SU1 A;  5C94 A;  3QN7 A;  4I31 A;  4PRO A;  7GCH G;  1UHB A;  3TLO A;  1G3D A;  4AC9 A;  1V2V T;  5I46 H;  3A8B A;  3CNR A;  1FXY A;  1UK4 A;  2FOD A;  4CRG A;  1Z71 A;  1WAY B;  1KXE A;  1MTN B;  3R3G B;  1CA0 C;  1SL3 A;  1CHG A;  5EJZ A;  3ZVG A;  1WYK A;  2CK3 D;  1MTS A;  3HAT H;  4FUC A;  2PKA B;  2GDD A;  5TCC A;  2OC7 A;  2ODY B;  2J94 A;  1BCU H;  3TIT A;  1TX6 A;  3BTH E;  1P2O A;  1NM6 A;  1THR H;  1TQ0 B;  1MTV A;  2R3U A;  2B0F A;  2AIQ A;  1QY6 A;  5JPM H;  2QIQ A;  3DSP A;  2SGP E;  4BAH B;  4CHA C;  1LVY A;  1YCP H;  1NT1 A;  4RT0 A;  4ZKR U;  1UTN A;  2J98 A;  1FI8 A;  4YOJ A;  1E35 B;  1MUE B;  2P3U B;  1V6D A;  3FAO A;  1O2T A;  2J5U A;  3S69 A;  1MBQ A;  1LHE H;  4NGA H;  4A5T S;  5ETX A;  2FDA A;  3SU0 A;  1G2L A;  4KTS A;  3VPK A;  2A4G A;  3SUD A;  1W14 U;  2BY6 X;  4DW2 U;  1MAY A;  4AFU A;  2QN5 T;  3GCN A;  1F0T A;  1ZTK A;  1O5D H;  2YMS D;  4DT4 A;  3TU7 H;  1C5M D;  3FAN A;  3MO3 A;  3GY8 A;  1O2H A;  5GPI B;  3TJV A;  1C2K A;  1PFX C;  2ZFS A;  2SGF E;  5DK1 A;  1QA7 A;  5F6M A;  1K9O E;  1YF4 A;  5F8T A;  1UCY E;  2Z3E A;  5EOD A;  2H6M A;  3VB5 A;  2DE9 A;  4F48 B;  3P92 A;  3F2G A;  4LZ1 H;  1OWK A;  3U9A H;  5EQQ A;  1UW7 A;  1AFQ C;  2WSS D;  2G52 A;  2AYW A;  1C1W H;  2PW8 H;  5A0C A;  1G3B A;  1GJC B;  2ZI2 H;  5DP6 A;  1HV7 A;  5EQS A;  1TWX B;  4BNR A;  4ABB A;  4I86 A;  2DE8 A;  2FLR H;  2ZF0 H;  1DST A;  2KCO A;  2QYI A;  1GDQ A;  1ELG A;  1BMM H;  4X8T H;  6CHA C;  5FBI A;  1S0Q A;  1DLE A;  1O32 A;  3QX5 H;  2V0B A;  4AFS A;  3GCH B;  4X2X A;  3MNX A;  1CT4 E;  2WV9 A;  1SGE E;  4Y76 A;  5GCH F;  2BB4 A;  5HIY A;  1GJB B;  1OP2 A;  4I33 A;  1QCP A;  1SMF E;  1TNG A;  4A1X A;  1ZLR A;  1TPS A;  1GMD F;  1L4Z A;  2IPQ X;  1T31 A;  1Y8T A;  1Z8J B;  1U6Q A;  2G5V A;  2ZQ2 A;  3L6P A;  2SGD E;  1A3E H;  5IK2 D;  2I6S A;  2RA3 A;  1YY3 A;  1G37 A;  4UFG H;  1N6Y A;  3M7T A;  2ODQ A;  3DCL A;  1DDJ A;  4F4O C;  1O38 A;  3BTK E;  3MWI U;  3RU4 T;  1TQ7 B;  1F92 A;  1O3J A;  1HJ8 A;  2R3Y A;  3QGN B;  3MO6 A;  3LH3 A;  1DFP A;  3EA7 A;  5JBT A;  1EZU C;  1IQE A;  1FIW A;  3MYW A;  1EAX A;  1JMO H;  2H9H A;  3OTP A;  4ISO A;  1TBZ H;  2XOK D;  3RMO H;  1TE0 A;  2KZ4 A;  4B76 A;  2HNT C;  1AD8 H;  1JBU H;  1PPF E;  3AAS A;  3GY6 A;  1J8A A;  3FO8 D;  2WYG A;  4AZ2 B;  5DP3 A;  1NES E;  3RP2 A;  2ZG0 H;  4THN H;  4BTT B;  5EU8 A;  1GJ7 B;  3RXC A;  1YLC A;  1BTW A;  3UAI C;  5A0A E;  5HIZ A;  1O2I A;  1F2S E;  3B8J A;  2OP9 A;  2FX4 A;  3E90 B;  3ZVF A;  1AB9 B;  1W0J D;  1SSX A;  4J2Y B;  1OOK B;  2XBW A;  4GAW A;  3TVJ B;  1HAP H;  2FOB A;  3ODD A;  2XWA A;  1AZZ A;  1QGF A;  2BOK A;  3U1J B;  1O34 A;  1KIG H;  1GBJ A;  1N8O C;  1TBQ H;  4X1S U;  4XBC A;  5TJX A;  1D3D B;  3AK5 A;  5AVD A;  2FTM A;  2PLX A;  2Z9K A;  2LNC A;  3MFJ A;  3WY8 A;  1VIT F;  1QUR H;  2AMQ A;  4TPI Z;  3UOU A;  1IQF A;  5C20 A;  4DT7 B;  3MMG A;  4AYV B;  1GMH F;  1CA8 B;  2RG3 A;  5EXN A;  1A0H B;  4YLU A;  3UWI A;  1Z1J A;  3S7K B;  1LPZ B;  4X2V A;  4A1V A;  1P57 B;  1YKT A;  3P8O A;  3FN8 A;  1O2Z A;  1WBG B;  2BVS H;  2H9T H;  1C9P A;  2BDG A;  2ZFQ H;  1V2R T;  2AS9 A;  3ZZ8 A;  1BTZ A;  2ZU2 A;  3ATK A;  4D76 A;  1BBR K;  4ACA A;  1XVM A;  2BLV A;  3ZV8 A;  5KEC A;  4DII H;  5F8X A;  5JBB S;  3SNE A;  5CHA C;  2GDE H;  1FZZ A;  3MU8 A;  2PP6 A;  5GDS H;  2TBS A;  3OTJ E;  1VKY A;  5SGA E;  1S6H A;  1TLD A;  1IQJ A;  1NTP A;  3URC A;  2ZHF H;  1AGJ A;  4Q7Z A;  1C5L H;  1KDQ B;  1J16 A;  3M5L A;  3NRL A;  3K65 B;  1AO5 A;  1V2O T;  2OTV A;  2HOB A;  2PHB A;  1UVO A;  4CRD A;  2GP9 B;  1RRK A;  2KFW A;  4IW4 E;  1WUN H;  1AZ8 A;  1K28 D;  3PO1 C;  3SQE E;  3OEE D;  3S9C A;  1BTP A;  3SV9 A;  3A81 A;  1T32 A;  1P06 A;  1O5F H;  4XBD A;  1NFW A;  5BPE A;  4YO9 A;  1C5X B;  5DP7 A;  2P3F H;  8GCH F;  2HVX A;  2QE7 D;  4D9R A;  1FON A;  1O36 A;  1TMU H;  1HLT H;  4INL A;  1AN1 E;  1OPH B;  1G9I E;  5T6D A;  3RDZ A;  2QF3 A;  2BVX H;  3D49 H;  3KF2 A;  5J4Q A;  1UTL M;  2ULL A;  2V35 A;  5A09 A;  1YYY 1;  4YXW D;  1ARC A;  1O39 A;  1NC6 A;  2GV7 A;  2TGT A;  2GT7 A;  1EST A;  3RMN H;  2C4F H;  1JRS A;  2A7J A;  1GL0 E;  2IJD 1;  4LXB H;  1GJA B;  2A4O A;  1IHS H;  4GCH F;  2FI5 E;  5EGM A;  4CRB A;  2ZEC A;  4FU7 A;  3PM3 A;  3ZVA A;  4U01 A;  5FPT A;  1C1T A;  2F91 A;  4KGA A;  1XX9 A;  3D23 A;  3SO3 A;  1GI5 A;  1CT0 E;  4OGX A;  2ZO3 H;  2RCE A;  3GYL B;  1ELF A;  5AFY H;  3DT0 H;  3DFJ A;  3LU9 B;  3RLY H;  2BVR H;  3DHK H;  1AWH B;  1ETS H;  3MH6 A;  4IS5 A;  2VNT A;  1OX1 A;  1SOZ A;  4UON A;  2VWO A;  1Q2W A;  1L2E A;  2G4U A;  1NPM A;  2Q6G A;  1DSU A;  2O8W A;  3BTQ E;  1N6X A;  1PPZ A;  1FY4 A;  3JZ1 B;  3RXM A;  1E36 B;  3KQE A;  3NWU A;  2F9V A;  4NIY A;  1RTF B;  4BAM B;  3E16 B;  2DUC A;  1LVB A;  3DD2 H;  1S81 A;  5DP8 A;  3KGP A;  1KMH B;  2F9O A;  5EPY A;  1PPG E;  4BTI B;  1P01 A;  2A2X H;  3KQC A;  1H8I H;  4OS4 A;  1HPG A;  1EAW A;  3ZVC A;  1B7X B;  1ZMJ A;  1BZX E;  4U2W A;  1A5I A;  3PMH B;  2ZDM A;  1EX3 A;  2BLQ A;  2EI6 A;  4LZ4 B;  1ZHR A;  3PMA B;  2WYJ A;  4Y8X A;  4YLQ H;  4UFF H;  2CGA A;  3DUX H;  1ZOM A;  1TNL A;  2G8T A;  1UTJ A;  1T4U H;  1HNE E;  4GHT A;  5C17 A;  4MNV A;  1O3E A;  1DVA H;  1O3C A;  2GJG A;  1O2S A;  1T8O A;  2L74 A;  3DFL A;  1O30 A;  2CMY A;  1PPH E;  2CF9 H;  3PMJ A;  5JBC S;  2KAI B;  2EQN A;  2BLW A;  1YCP M;  2BDH A;  1QQU A;  1ZPB A;  2XRC A;  1ELE E;  1GHB F;  3M3S A;  5DP5 A;  1VCP A;  2VIQ A;  2ZU4 A;  1CU1 A;  2XC0 A;  3H7T A;  2FI4 E;  2UWO A;  2P8O C;  1AE8 H;  1W12 U;  4NZL A;  1QFK H;  3NCL A;  1FY5 A;  4HI3 A;  1ABJ H;  1TFX A;  4D9Q A;  3NZI A;  1J9C H;  1JOU B;  1TRM A;  1GJ4 H;  1HCG A;  4EST E;  2V6N A;  1D3T B;  3EE0 B;  4KTC A;  1GJD B;  2XC4 A;  1XVO A;  2UUK B;  3GCT F;  1EQ9 A;  1Y3X A;  2GT8 A;  4DCD A;  3MHW U;  4WMF A;  1MZD A;  2VU8 E;  1KLI H;  3T5F H;  1X7A C;  3O8R A;  1RTL A;  1VGC B;  2TGD A;  5A0B A;  2AIP A;  2ANM H;  4BAK B;  5DGJ A;  3GDS A;  1O2X A;  3SHC H;  1XUK A;  4TYD A;  5L2Z H;  3T26 A;  1EFR D;  4ZRO A;  3OY6 U;  3OYP A;  4F55 A;  1HAZ B;  4Q63 A;  4JCN A;  1SGN E;  2ZFR H;  2VIP A;  1EJA A;  5LH8 A;  2R0K A;  2EI7 A;  1P2I A;  3PRB A;  1JXP A;  3CS7 A;  1GBT A;  1F7Z A;  3A82 A;  4AYY B;  1P0S H;  3NUM A;  3A7Y A;  3L33 A;  3RXV A;  3TJO A;  5K7R A;  1YPE H;  2UUF B;  2ZHW H;  1TNH A;  2VIV A;  2VJ1 A;  2F43 B;  2BDC A;  1Z1I A;  3SI3 H;  2GTB A;  5A8Y A;  4F49 A;  3OFN D;  4ISH H;  4GLY A;  1COW D;  1Y5B T;  1TPO A;  4CR9 A;  2ANY A;  4BXW A;  1K1M A;  2QGR A;  1O3L A;  4IMZ A;  3SV7 A;  1MTW A;  2XCF A;  3PRD A;  3BEF B;  1O2M A;  1GPZ A;  1CQQ A;  2A5K A;  2R2M B;  1C2L A;  1TX7 A;  4JK5 A;  4JK6 A;  2KCY A;  3KYF A;  5FCK A;  2A1D B;  1ZJD A;  3QO6 A;  1P2K A;  5C1U A;  1TOM H;  9LPR A;  3M5M A;  1KXC A;  2OBO A;  3A89 A;  1TRY A;  4UE7 H;  1XUF A;  3EA9 A;  1GGD C;  5JDU B;  1ZRB A;  3ZZA A;  1CBW B;  1HJ9 A;  1HFD A;  2YOL A;  1C5R A;  1BBR E;  1HAV A;  2OBQ A;  1TMB H;  5HM9 A;  3BTF E;  4DJZ B;  1YM0 A;  3ATM A;  4B71 A;  1H9L B;  1O3I A;  2ZA5 A;  3RXL A;  1DIC A;  1GBD A;  3BTW E;  3UUZ A;  1OS8 A;  3MTY A;  2BY7 X;  2AGI X;  2C93 B;  1C5Q A;  2H5D A;  1EPT A;  2ZC9 H;  3SUF A;  3A85 A;  1BJV A;  1QL9 A;  2AMD A;  1MH0 A;  2B8O H;  1UTO A;  3LIW A;  2JET C;  2A0Q B;  1AFQ B;  1UVP A;  2QF4 A;  4K3J A;  2V7Q D;  2FS9 A;  3C1K A;  3SI4 H;  3UFA A;  1NN6 A;  1SGF A;  3RU4 D;  5GWZ A;  1FLE E;  1V2W T;  1C4Y 2;  1ESA A;  1PJP A;  3TJU A;  1EAI A;  1YLD A;  1YPK H;  4J1Y A;  3U8R H;  2RDL A;  3U1I B;  2PR3 A;  3KN2 A;  2G51 A;  1FV9 A;  6CHA B;  2WZQ A;  5KGO A;  1QL8 A;  3SNB A;  1H8E D;  2FYR A;  3F2H A;  1TGT A;  3GY7 A;  1OWE A;  2IPH A;  4CBN A;  2V3M A;  4K1T A;  3OE7 D;  1FX0 B;  2KCA A;  3SGQ E;  3PV2 A;  1E0F D;  3PLP A;  2ZCL P;  4IMQ A;  2OQU A;  3LJO A;  1C1N A;  2H1U A;  1ZRK A;  2D8W A;  1M9U A;  4Y0Z E;  1FAX A;  1BT7 A;  2BY9 X;  2Z3D A;  4OS1 A;  1F0S A;  1YBW A;  1Q3X A;  3SU6 A;  5DO4 H;  2BQ6 B;  1QBN A;  1C5U A;  4JZD H;  1PPC E;  2BD5 A;  1F5R A;  4FUE A;  4NSY A;  1UMA H;  2J38 A;  2ZCH P;  4MQA A;  4HGC A;  1BMF D;  1KXF A;  3K2U A;  1WQS A;  4OGY A;  2PKS C;  3C27 B;  3FP7 E;  2BX3 A;  1FJS A;  4YOI A;  5DN6 D;  1OXG A;  3BTG E;  3E6P H;  5C5N A;  1GJ6 A;  4INK A;  5E0J A;  1O2N A;  2BD2 A;  1SLW B;  4NWL A;  1AE5 A;  1YCP K;  1KXA A;  2BDI A;  2XBX A;  2YNB A;  1PYT D;  1BTY A;  2Q6D A;  5GND A;  3SZN A;  2WPL S;  1HBT H;  3QWC H;  3SUE A;  2GCH G;  1V2K T;  3N7O A;  1ZTJ A;  4CRF A;  3K6Z A;  3FVF B;  2XND D;  2SGE E;  6GCH G;  3DA9 B;  1HJA C;  3SQH E;  3SNA A;  3PWB A;  1QB1 A;  1RIW C;  2VH6 A;  1V2M T;  4SGB E;  1D4P B;  1SB1 H;  3HKJ B;  4OS7 A;  4XRN A;  4B75 A;  1QZ8 A;  4ABE A;  1ZSJ A;  2SNV A;  1Y5U T;  1NU9 A;  4TWY A;  4UEH H;  1DT2 A;  1A0J A;  2ILN A;  1C9T A;  1MKW H;  1V2S T;  2W3K A;  1GCT C;  3F9H A;  1C2G A;  5CHB A;  1SGR E;  3Q3X A;  1HAI H;  3F0O A;  1CGJ E;  4NCY A;  4X6P A;  3A8D A;  1VCW A;  3FZD A;  4RN6 A;  3TNS A;  1OWH A;  1OYT H;  3S9A A;  1E34 B;  3UR9 A;  1THS H;  2GZ7 A;  3LGW A;  2BZA A;  1DM4 B;  1ORF A;  5G4B A;  3E0N B;  2VVC A;  1TNJ A;  5AF9 H;  3Q3K A;  1OYQ A;  5CDF E;  1EOJ A;  1V2T T;  2KX4 A;  1TGS Z;  1WV7 H;  5CHA B;  2PKA A;  3SU5 A;  3SZE A;  1UK2 A;  3KQB A;  2BZ6 H;  2R9P A;  4GUX A;  1GG6 B;  1XXD A;  1IQI A;  3MNS A;  3FFG A;  4CRC A;  1A5H A;  2ZDA H;  2BDY A;  4Z0K A;  3UPE A;  1W0Z U;  2ALV A;  1K21 H;  1W0Y H;  1EPT C;  2LPR A;  1K1P A;  1SFI A;  7GCH F;  1B0E A;  3BEU A;  4FUD A;  1LQD B;  1YPH E;  5ABW A;  1ELT A;  1ACB E;  1GDN A;  2QF0 A;  3BF6 H;  3P6Z B;  1YC0 A;  4BTU B;  1NRO H;  1ETT H;  1VR1 H;  1C5V A;  1YPG H;  4WJG 2;  1EKB B;  4HFP B;  1O2Q A;  5LPE A;  1Y3W A;  1TYN A;  4X8U H;  1UK3 A;  1QRZ A;  2WPM S;  3QDZ B;  2OLG A;  1DUA A;  1NO9 H;  1TX8 A;  1P3E A;  4WF8 A;  4ZKO U;  2O9Q A;  1RTK A;  3SUG A;  2VIN A;  1NRP H;  2OC8 A;  5L2Y H;  4I8J A;  3TGI E;  2GZ8 A;  1HUT H;  1G3C A;  1HAG E;  1RD3 B;  4Q4L A;  3V0X A;  3AVZ A;  3GDU A;  3U69 H;  1BDA A;  2WUC A;  3EE7 A;  1IQK A;  4JZ1 A;  2Q1J A;  2Z3C A;  4ISI H;  3OSY A;  1XM1 A;  3UB0 A;  1NBM D;  2JH0 D;  2Z9G A;  4UFD H;  1ZR0 A;  4K2Y A;  3B9F H;  3FP8 E;  4AB8 A;  1T7C A;  1JWT A;  3Q76 A;  3P8F A;  4RKJ B;  3RM0 H;  2I6Q A;  4ZXY H;  1GBF A;  4AFZ A;  3TK9 A;  1AKS B;  3ATW A;  2VH0 A;  2O8M A;  2ZZU H;  4XDE A;  1MU6 B;  1ZZZ A;  3ZVE A;  1MQ6 A;  4IGD A;  2PWX A;  2ZPQ A;  1RS0 A;  4H6T A;  1O2O A;  4K8B A;  5EST E;  5LPF A;  1PQ7 A;  2PUQ H;  4DUR A;  2NWN A;  2ZGJ A;  1YPL H;  2B5T B;  1QTF A;  1C5S A;  2BM2 A;  1NFU A;  4GSO A;  1E1Q D;  1VIT G;  1TAL A;  3LPR A;  2VIW A;  1NRN H;  4B1T A;  1GMH G;  1C1Q A;  1C1S A;  1O5A B;  2C90 B;  1QJ1 B;  3BG4 C;  2HLD D;  3CP7 A;  4WH6 A;  2BD7 A;  1GI3 A;  3ZZ7 A;  3HK6 B;  3BSQ A;  1GBI A;  4MPU A;  1ZTL A;  2P59 A;  4NIW A;  3ZVB A;  1K0H A;  1ARB A;  1O3K A;  4O03 A;  1BRU P;  3BG8 A;  3DSG A;  3I78 A;  1CE5 A;  1O3D A;  4YTA A;  5EW1 H;  2ZEB A;  1O2J A;  1W2K H;  4FUF A;  1GBK A;  5C67 A;  2RA0 A;  5TCA A;  3I29 A;  5F8Z A;  1SLX B;  1KSN A;  4D7G A;  5HYO A;  3WW7 A;  1OWI A;  1UTK A;  2FLB H;  1CO7 E;  1O3F A;  2ANW A;  1CSO E;  3SV6 A;  1IOE A;  3RXT A;  4NG9 H;  1P04 A;  3LOX A;  1UVU H;  2PSY A;  2XYA A;  4FUG A;  2Y5H A;  4Y0Y E;  1ANB A;  1DWC H;  1GVL A;  2J34 A;  3SU2 A;  5FX5 A;  2ZHQ H;  2XC5 A;  2ZU5 A;  3A7W A;  4VGC C;  2HWL B;  4OS6 A;  2P8O B;  3HGP A;  1DX5 M;  3BTD E;  5IDK A;  2OC1 A;  1GVK B;  1SHY A;  5GJ4 B;  1KXB A;  4OS2 A;  1XUI A;  5C0T A;  1WQV H;  4DOQ A;  2F9P A;  3H7O A;  2ZTX A;  1LVO A;  2ZWL H;  1V2P T;  4A7I B;  1Q31 A;  2QXJ A;  1O3M A;  3M7U A;  1AI8 H;  2BDA A;  5FPY A;  1TBR H;  2ZCK P;  5GIB A;  3W94 A;  4P02 A;  1GJ8 B;  3H5C B;  2ZDL A;  4Q80 A;  4M7G A;  2FOC A;  4MPV A;  1XUJ A;  1GHA G;  1IQG A;  3URD A;  3STI A;  1LHG H;  4UFE H;  1FPC H;  2FOH A;  1WXR A;  5E2P A;  1NFX A;  4JMY A;  1LPG B;  1FN6 A;  1O3G A;  4X6O A;  3TH4 H;  3RMM H;  7EST E;  2LEL A;  2TGP Z;  2CHA C;  2A5I A;  2H9E H;  4WXV A;  3W1E A;  3LGV A;  1C5O H;  4CRA A;  4YOG A;  2PV9 B;  4H6S B;  1AIX H;  3P95 A;  1KDQ A;  1C2H A;  1TON A;  1C2E A;  1UJ1 A;  2PFE A;  1BQY A;  1HDT H;  3ZZD A;  1P11 E;  4O3U A;  4TWW A;  3PLB A;  1HAH H;  3T28 A;  1KTT B;  1NBM E;  2HRV A;  3S0N A;  4NIX A;  4ASU D;  3QZQ A;  1DOJ A;  4IN1 A;  4ZHL U;  5C3N A;  3ENS B;  2G55 A;  4I8G A;  1TMT H;  1Z8R A;  2FOG A;  4O97 A;  3T2N A;  3URE A;  2AGE X;  4ASH A;  2D26 C;  5T1V A;  4X8V H;  1MTU A;  2W5E A;  1KYN A;  1ZML A;  1AND A;  3ELA H;  1K1J A;  5A8Z A;  3KYG A;  1Z8G A;  4NZQ A;  1BRB E;  2VVV A;  1GGD B;  4X2Y A;  5AFZ H;  3T62 A;  4YT6 H;  4X0W U;  1BTX A;  2TRM A;  4AOQ A;  2STB E;  4I8L A;  1ANC A;  1UVS H;  1K1O A;  2WV5 A;  5A8X A;  5EIY A;  5JB9 S;  2GD4 B;  2J97 A;  2J95 A;  3N7E A;  3GCH C;  2Y5F A;  3H09 A;  1AUJ A;  3A7Z A;  3ZYD A;  1B5G H;  4FVD A;  2HPP H;  1AWF H;  1DY9 A;  4HG6 A;  2GMT B;  1GJ9 B;  4FUJ A;  4I32 A;  3GIC B;  2ZFT A;  3SW2 B;  2VVU A;  1Y5A T;  1BTU A;  1E1R D;  2JET B;  3SV8 A;  3WWF A;  1EJN A;  2Z7F E;  4U32 A;  2Z9L A;  2CN0 H;  3K9X B;  1DIT H;  3F68 H;  2TGA A;  2F4L A;  1H1B A;  3PV5 A;  4TT3 D;  2A4R A;  3MU5 A;  2BDB A;  3VEQ B;  3NPS A;  5FL7 D;  1KXD A;  1A61 H;  2H2Z A;  1JIM A;  5IYT A;  3P8G A;  1VZQ H;  2CV3 A;  1O3B A;  4R8T B;  1FN8 A;  1J15 A;  3T29 A;  4CBO A;  2VB0 A;  1SC8 U;  4FOU C;  2FS8 A;  3GCT G;  3M3T A;  3E3T A;  3Q00 A;  2V3H H;  2Y81 A;  5F53 A;  5CMX H;  2WV4 A;  4AGJ A;  5EW2 H;  2VGC B;  2ZDK A;  1C4V 2;  3M61 U;  3QLP H;  1LVM A;  1CHO G;  4ZKS U;  1Z6J H;  2J92 A;  1AVX A;  1EAS A;  1GBH A;  1L1N A;  1MZA A;  1AVW A;  3RXF A;  1GBC A;  4FXG H;  1ZGI A;  5T6G A;  2A7H A;  4XE4 A;  5C5O A;  3MQK C;  4E06 H;  2JH5 D;  4ZAE A;  1C1O A;  4Y79 A;  1GBA A;  1EXF A;  2Y7Z A;  3A8C A;  3E91 A;  1GMC F;  1DWB H;  1O3O A;  1L4D A;  2F9B H;  1P2Q A;  3F9F A;  3ZZB A;  1SQT A;  2NU1 E;  1XXF A;  3B23 B;  3ZZ4 A;  4O3T A;  4DGJ A;  2WPH S;  2GZ9 A;  2HLC A;  4CH2 B;  4Z1M D;  1GJ5 H;  4ABF A;  2KAI A;  4IC5 A;  1FY1 A;  2QC2 A;  4X1Q U;  1XUH A;  1P2N A;  3UOP A;  2BHG A;  2FX6 A;  1SGD E;  3M5N A;  1V2L T;  2F9U A;  1HIA B;  2ZGX H;  3PRO A;  1HJA B;  1Y3Y A;  2AGG X;  4NSV A;  1RIW B;  4AG2 A;  2O8U A;  3LGT A;  1UTQ A;  2BY8 X;  4MVN A;  2C8Y B;  3M5O A;  4NFE A;  1EAU A;  1H4W A;  3IWM A;  2JH6 D;  1ETR H;  2GX4 A;  3F9G A;  1CA0 B;  1SGI B;  2AH4 X;  2P93 A;  1LHD H;  1SGF G;  2BQW B;  3LC5 A;  5E8E H;  1P9U A;  2ODP A;  2PSX A;  1ZMN A;  3EQ0 H;  3PMB B;  2EI8 A;  2BY5 X;  4GHQ A;  4ABD A;  2XXL A;  4M9F A;  3N99 A;  4WMD A;  1V2U T;  1VJ9 U;  1IAU A;  1FAK H;  4MPW A;  3E1X B;  4CHA B;  1SG8 B;  2AER H;  3ZZC A;  2Z9I A;  2BOH B;  2BD9 A;  3LJJ A;  2BD3 A;  1Y59 T;  3KL6 A;  3ZV9 A;  1ZSL A;  3V7T A;  3UIR A;  1AFE H;  2JKH A;  1Y3V A;  3UWJ H;  1CVW H;  1A7S A;  1G32 B;  5EOK A;  4XSK U;  1MKX H;  2W3I A;  8KME 2;  2NU3 E;  4RT1 A;  3R0F A;  3OX7 U;  4X8S H;  3VXF H;  3EAJ A;  3S7H B;  2QAA A;  1DUE A;  3RUO A;  2FIR H;  5FAH A;  1O2G H;  3BIV H;  2THF B;  1Z7K A;  2ZU1 A;  4R0I A;  4IBL H;  4A1T A;  4RI0 A;  1EPT B;  1SLV B;  1P03 A;  1UCY H;  1DE7 H;  3RXQ A;  1C5Y B;  3PWC A;  1EZS C;  1AQ7 A;  1GI6 A;  1LMW B;  3K6Y A;  3GCO A;  1SFQ B;  1C4U 2;  2Z9J A;  1W7X H;  1BIT A;  2KCP A;  1F5L A;  3A80 A;  1H8D H;  2KM0 A;  2ZP0 H;  4B73 A;  4NIV A;  1FY8 E;  3FP6 E;  2YMS C;  1RGQ A;  2WPI S;  1TAB E;  2R0L A;  1WU1 A;  1ID5 H;  4FUB A;  4CH8 B;  1HAX B;  1BRA A;  5EXL A;  1LQE A;  1TA6 A;  2B7D H;  4FU8 A;  4FU9 A;  3VB4 A;  3LH1 A;  4UDW H;  5T3H A;  1J14 A;  3PTB A;  3TGJ E;  2RFK C;  3SOS A;  2GCT C;  3MH7 A;  2ASU B;  1BB0 B;  2GKV E;  2ZPS A;  4MDS A;  1FUJ A;  1VIT H;  1C1U H;  3M7Q A;  4BOH A;  3RXS A;  1DS2 E;  1GI7 B;  3KQ5 A;  4LOY H;  1F0R A;  2W7U A;  1K1I A;  1SGT A;  4OS5 A;  1HB0 B;  3SJK A;  1LTO A;  3MU4 A;  4AOR A;  1YLN A;  3UNS A;  3EDX B;  2FZZ A;  1O33 A;  1RFN A;  1D9I A;  5GXP A;  3MH5 A;  4ZXX H;  5DKM A;  2L6O A;  1Z8I B;  2STA E;  1GL1 A;  1DWE H;  1Z6E A;  4LK4 A;  4NFF A;  3RXR A;  3MH4 A;  4KTU A;  2FM2 A;  2ZTY A;  1QB6 A;  3HPT B;  2BD8 A;  4AG1 A;  3PTN A;  1O2V A;  1BML A;  1MKW K;  2FO9 A;  2A2Q H;  4QT8 C;  2AEI H;  4WWY A;  1L1J A;  2BYA X;  3CS0 A;  4BXS A;  3A7V A;  2W7S A;  1DAN H;  3MU0 A;  3OY5 U;  3RXK A;  1ESB A;  2QV1 A;  4YT7 H;  1DXP A;  1S6L A;  2VWN A;  2UUJ B;  1YWU A;  3SYJ A;  1G3E A;  1KLJ H;  4JZE H;  2ZQ1 A;  3SJO A;  4D8N A;  2HNT F;  4AGK A;  1NZQ H;  2J9N A;  4I8K A;  2A7C A;  3RXE A;  4WH8 A;  3BG4 B;  1GWA A;  1O3P B;  3F2F A;  4XD7 D;  2P3T B;  5HMA A;  4Y6D A;  3SU3 A;  4A6L A;  1FIZ A;  3AAU A;  3RXJ A;  5EPN A;  1O2R A;  3P17 H;  1UHB B;  4X1R U;  5EJ1 A;  4WVP E;  1LPK B;  2W6J D;  2FPZ A;  4CR5 A;  3T25 A;  4OM9 A;  1S83 A;  2QXH A;  2ZFF H;  3LON A;  1SGC A;  2Y6T A;  4MNW A;  4JYU H;  1ELB A;  3OAA D;  4DVA U;  1LDT T;  7KME H;  1N8O B;  2G4T A;  1KLT A;  1SOT A;  3QGJ A;  1MAX A;  3U28 C;  1VGC C;  1WCZ A;  3M3V A;  1SVP A;  2ZGB H;  4ZUH A;  4K8Y A;  1C5Z B;  2CJI A;  2JJ1 D;  3KCG H;  1QA0 A;  2JIZ D;  4Y10 E;  4AFQ A;  1SGY E;  3Q3Y A;  1EB1 H;  2QCY A;  3RML H;  2ZHD A;  3A8A A;  1BJU A;  4X6M A;  3TGK E;  1O31 A;  3GY3 A;  1ZHP A;  5FXL A;  2J98 B;  2QF5 A;  4VGC B;  2J2U A;  2BXU H;  4WY3 A;  1BIO A;  1O3N A;  1AHT H;  1O3H A;  3O8B A;  3L3T A;  2Q6F A;  2XW9 A;  3TH2 H;  3RXH A;  1QL7 A;  1A1R A;  1AMH A;  2FMJ A;  2ZGH A;  3MNB A;  3BTE E;  3EGK H;  1S84 A;  1UO6 A;  2OXS A;  4KKD A;  3UR6 A;  8LPR A;  3LKW A;  4ZHA A;  1SGP E;  4HTC H;  5E0G A;  4ABG A;  1QJ7 B;  3RC5 A;  1CGI E;  5FPS A;  1P12 E;  2GCH F;  1MD8 A;  5DG6 A;  1GBE A;  2ZDV H;  4SGA E;  3OU0 A;  1GI4 A;  4INH A;  3F1S B;  6GCH F;  1L0Z A;  4MTB A;  1E37 B;  3EA8 A;  3PO1 B;  1OKX A;  3ODF A;  3ATL A;  5GCH G;  5C0U A;  1GVZ A;  4Y11 E;  3TNT A;  1YGC H;  3BTM E;  1ZYO A;  3RU4 E;  4Y8Y A;  5L6N H;  1GMD G;  1THP B;  4B2A A;  4K60 A;  1CBW C;  2CHA B;  5I25 A;  3NKK A;  2Y80 A;  7LPR A;  2OK5 A;  3RXU A;  3VGC C;  1D3Q B;  3ATI A;  3RC4 A;  3OEH D;  1WTG H;  1BMN H;  2RDE A;  2ZHE H;  1HRT H;  1EUF A;  3A7T A;  3VFE A;  2BD4 A;  2FOF A;  1IQH A;  2A31 A;  2GGV B;  5EXM A;  3LGI A;  5FHT A;  2FWW A;  1K2I 1;  1O35 A;  1NY2 2;  4I8H A;  1SGQ E;  2A5A A;  1NS3 A;  1K1L A;  1TOC B;  3IG6 B;  1SHH B;  1SQA A;  1YPJ H;  1P9S A;  1ELD E;  2HAL A;  4YES B;  3CEN A;  4Y7B A;  2W26 A;  1A0L A;  8EST E;  1TAW A;  2ZFP H;  3N7D A;  4A92 A;  4P00 A;  1P2M A;  3ZZ5 A;  2FOM B;  1EZX C;  1DPO A;  1P3C A;  1QQ4 A;  1SI5 H;  2PGB B;  4GVU A;  3RXA A;  2XCN A;  3QTV H;  4RKO B;  3W95 A;  1O2Y A;  4B74 A;  1A2C H;  2Z94 A;  2Y5G A;  1E38 B;  1QBV H;  1MQ5 A;  2VBC A;  3GIS B;  3NXP A;  5B6L A;  2TPI Z;  2V3O H;  3VB3 A;  1S5S A;  1AU8 A;  2NU2 E;  3P70 B;  2FP7 B;  4NA9 H;  4GPG A;  5DP4 A;  4JZF H;  1GBL A;  1O2P A;  3BTT E;  1E79 D;  3BV9 B;  3RXO A;  5EG4 A;  5C1Y A;  4X1P U;  2D2D A;  5JB8 S;  4X6N A;  2QXI A;  3PLK A;  4MNY A;  1EAT A;  1XUG A;  1AKS A;  5J4S A;  1P10 A;  1GI0 A;  2PGQ B;  1C1M A;  1INC A;  2SFA A;  1SQO A;  3SND A;  2M2A A;  1RXP A;  4ABI A;  2OD3 B;  4D7F A;  1MAB B;  1BRC E;  1QRW A;  1SKY E;  2W6I D;  3ZZ9 A;  4K5Z A;  2ZGC A;  2FTL E;  1V2J T;  2WIN I;  3SOR A;  1NRQ H;  1HXF H;  1O5E H;  5T6F A;  2GV6 A;  5H4I B;  5K0H A;  2R2W U;  4KEL A;  2JDI D;  3UQV A;  2OIN A;  5FCR A;  1UVT H;  1GHV H;  1PQ8 A;  1ANE A;  1MU8 B;  1TA2 A;  1G36 A;  3SGB E;  1W0K D;  4DY7 B;  1ELA A;  1GHZ A;  4MG3 A;  1D6R A;  2HVY B;  2FI3 E;  4MNX A;  2F3C E;  1TNK A;  2HPQ H;  1MTN C;  3FKS D;  3HK3 B;  3M35 A;  4B6E A;  8GCH G;  1MMJ N;  5E2O A;  2WPK S;  2ZPR A;  2A45 B;  2FEQ H;  3SHA H;  3SNC A;  1KTS B;  2K0Q A;  1BUI A;  4AB9 A;  1BOQ A;  3KQD A;  4ABJ A;  4E7R G;  3SV2 H;  2EEK A;  3TK5 A;  1V2N T;  4ISN A;  4TPY A;  4Y71 A;  1S6F A;  4FVB A;  1ELV A;  1F5K U;  1W8B H;  1O2U A;  3KID U;  2ZIQ H;  1JIR A;  1WOF A;  4CRE A;  4GCH G;  3A83 A;  4ZMA H;  1LKB A;  4BAN B;  1C2M A;  3MI4 A;  5ESB A;  4Z6A H;  4K1S A;  1ZJK A;  2A4Q A;  3GDV A;  4ABH A;  1SLU B;  3STJ A;  1GG6 C;  3LT3 A;  5DSF A;  3RM2 H;  1OWD A;  2WPD D;  2Z6B D;  3BIU H;  2XBY A;  1C1R A;  1LCY A;  3GOV B;  1MBM A;  3M36 A;  5AHG H;  5HGG A;  4ZCN A;  4ISL A;  3SBK A;  1P02 A;  2G81 E;  2ZKS A;  3AW1 A;  3MU1 A;  2J4I A;  2IJO B;  1XKB C;  1JRT A;  1UTM A;  3E8L A;  4JYV H;  3A7X A;  1FQ3 A;  3I77 A;  3LC3 A;  1GHW H;  1EP5 A;  1EZQ A;  3LGY A;  4ACB A;  2C8X B;  2EY4 C;  2G5N A;  3ZVD A;  1Y3U A;  2QY0 B;  2UUY A;  1PQA A;  2C8Z B;  1BBR H;  1GCD A;  1EP6 A;  4ZH8 A;  3V12 A;  2IOT A;  1NFY A;  1AY6 H;  2BQ7 B;  1G2M A;  3DSO A;  1O5B B;  1BTH H;  1ELC A;  5DJ7 A;  2ALP A;  1W11 U;  1SQR A;  2K8I A;  1S85 A;  1H8H D;  4DG4 A;  1H9H E;  1NU7 B;  3GY4 A;  1AVG H;  1GHA F;  2Y7X A;  3TJN A;  1MCT A;  1LHF H;  4AX9 H;  3V13 A;  3AAV A;  2FOA A;  3T27 A;  2QXG A;  2WHX A;  4O9V A;  1BA8 B;  2ZTZ A;  1TB6 H;  5F03 A;  1GI1 A;  2AHM E;  9EST A;  2NU0 E;  3IIT A;  2YMS B;  5FX6 A;  4TSF D;  1GHB G;  2C3S A;  1TGB A;  2EST E;  1TPP A;  2PUX B;  1C2F A;  1SBW A; 
#chains in the Genus database with same CATH homology
 2W6J D;  2IJD 1;  1W0J D;  4KTC A;  2LEL A;  2YMS D;  4DT4 A;  1DY8 A;  4U01 A;  4OM9 A;  4B6F A;  5FPT A;  3LON A;  3W1E A;  1E1Q D;  3N7D A;  4A1T A;  4RI0 A;  4A92 A;  2FOM B;  3OAA D;  5GPI B;  3O8R A;  1RTL A;  2K1Q A;  3FOA A;  5CDF E;  3U1J B;  3WWB A;  3U1I B;  3KN2 A;  2XCN A;  3AK5 A;  2WZQ A;  3ZIA D;  2KCP A;  3F0O A;  1H8E D;  2KM0 A;  3F2H A;  4B74 A;  2GVF A;  1NBM E;  2HLD D;  4TYD A;  4WH6 A;  5ESB A;  2JJ1 D;  4B73 A;  1EFR D;  4K8B A;  4ASU D;  3SU5 A;  4F55 A;  2YMS C;  2JIZ D;  1RGQ A;  3F2G A;  3OYP A;  2A4Q A;  2VBC A;  3SZE A;  5B6L A;  5EQQ A;  2P59 A;  3OE7 D;  4Q63 A;  1FX0 B;  2KCA A;  2KR7 A;  4JMY A;  2WSS D;  2FP7 B;  3PV2 A;  4FET A;  5HKK D;  4Z1M D;  5T1V A;  2JJ2 D;  2QF5 A;  5DSF A;  3PRB A;  1JXP A;  2F9V A;  2WPD D;  2XNI A;  4A1V A;  3O8B A;  5EQS A;  3P8O A;  1E79 D;  3VG8 A;  3FN8 A;  1W3C A;  4NWK A;  1BT7 A;  3SU6 A;  3M5N A;  1A1R A;  2F9U A;  2KCO A;  1KMH B;  4ZCN A;  3WW7 A;  2F43 B;  5EPY A;  1BMF D;  3OFN D;  1COW D;  2OC0 A;  3SV6 A;  2M2A A;  3LKW A;  3P8N A;  3F0P A;  2IJO B;  3SU1 A;  1N1L A;  3RC5 A;  4I31 A;  5DN6 D;  3LOX A;  3SV7 A;  3N7E A;  1MAB B;  2WV9 A;  2XCF A;  5FPS A;  3H09 A;  3M5O A;  1SKY E;  3PRD A;  2W6I D;  4I33 A;  4A1X A;  3SU2 A;  2KCY A;  4WF8 A;  4NWL A;  3SUG A;  2L6O A;  3M5L A;  3L6P A;  1DXW A;  3NRL A;  2OC8 A;  1DY9 A;  4I32 A;  5IK2 D;  2FM2 A;  1OHH D;  3KNX A;  2KFW A;  1E1R D;  2OC1 A;  3M5M A;  2CK3 D;  5GND A;  5IDK A;  2OBO A;  5GJ4 B;  3DCL A;  5C0U A;  5H4I B;  3SV8 A;  3WWF A;  5C0T A;  2OC7 A;  3OEE D;  3SUE A;  5C17 A;  4Q4L A;  3SV9 A;  2JDI D;  4M9F A;  3N99 A;  3RC6 A;  3DSO A;  2F4L A;  2XND D;  3PV5 A;  2OIN A;  2YOL A;  4TT3 D;  3EYD A;  2A4R A;  2OBQ A;  3SU4 A;  2K8I A;  3UB0 A;  1H8H D;  1W0K D;  2QV1 A;  1NBM D;  1DXP A;  1S6L A;  2QE7 D;  2OK5 A;  3DSP A;  4B71 A;  3O8C A;  5FL7 D;  3O8D A;  3SYJ A;  3OTP A;  4B75 A;  2XOK D;  5FPY A;  3F3B A;  2KZ4 A;  4B76 A;  2WHX A;  4R8T B;  3RC4 A;  3OEH D;  2J5U A;  1CU1 A;  3FKS D;  4B6E A;  4WH8 A;  3FO8 D;  2AHM E;  3KF2 A;  3F2F A;  3SUF A;  4XD7 D;  2GGV B;  5CHB A;  2O8M A;  2YMS B;  4TSF D;  5ETX A;  5EQR A;  3SU0 A;  4YXW D;  3KEE A;  2K0Q A;  5F53 A;  3SU3 A;  2A4G A;  5EPN A;  3GS9 A;  3SUD A;  1NS3 A;  1WXR A;  2QF4 A;  3E90 B;  2V7Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...