3F2ZA

Crystal structure of the c-terminal domain of a chitobiase (bf3579) from bacteroides fragilis, northeast structural genomics consortium target bfr260b
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
DKLSKTDWKIVSFTTEEASGEGSNNGHAKHLIDGNIETFWHSRWQGGSDPLPYEIIIDMNHRVKIAQIELLPRGRGSNNPIKVVRFEASEDGTNWESIGQFGFTNQDAALKYYVKSSTARYIKLVIPDGVGNGTVAAIRELDVRGTVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the C-terminal domain of a chitobiase (BF3579) from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR260B
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein BF3579
total genus 35
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3f2zA00
3WQBA 1W8NA 3SKVA 3HNMA 2VM9A 1JZ8A 2VZTA 5JXGA 3J7HA 2RJ2A 4M4PA 1W8OA 5LA0A 4JKKA 4QDRA 4OUEA 3CQOA 4FI9A 4M4RA 4P02B 5JXHA 3NRUA 3ETPA 2BBAA 4ZZ5A 2C4XA 2CDOA 4TTGA 4QB1A 5EJ1B 4XUOA 1JZ5A 3CZUA 3WNPA 1UY0A 4PQQA 1ULPA 3T0DA 2YFUA 2BZDA 3T2QA 1O8SA 2VMFA 3C7OA 2VL4A 4LPLA 2JKXA 1TVGA 3K4DA 3HNYM 1K42A 2J1AA 2J1VA 3FHQA 4KI5M 4P5YA 5DN2A 5CZKA 1TG7A 1OH4A 2VO5A 1F4HA 1W9SA 3ACHA 1NUKA 3THCA 2C9KA 1W0NA 1XNAA 4W8JA 2W87A 4DXRA 3WNLA 2J22A 5LCWL 3W5NA 3HN3A 4BK4A 2J1TA 1GQPA 1SHWB 4A45A 1CZTA 2W95A 3K4ZA 3I3BA 4QX2A 4UOJA 1O8PA 1DP0A 4D0QA 1UXXX 2V5DA 2QQJA 1JZ4A 1F4AA 4QPWA 4GWJA 2Y8KA 3OGSA 1W9TA 4XURA 1OT5A 4XUTA 4L0PA 3WSOA 2QQOA 4GZ9A 2DDUA 2WUHA 2VZQA 3NJXA 4ZXEA 1JZ3A 4MADA 3OEBA 1MPXA 2LW8A 4RYDA 3ACFA 3UESA 4A42A 3THDA 3VDAA 3SEPA 3VDBA 1XPWA 4DUXA 3A21A 5IFTA 2L9LA 3SKJE 2DCJA 2J7MA 2RV9A 2WO3A 3OB8A 4A41A 4CU6A 3EYPA 1GOFA 3WF2A 3C7HA 1UMHA 3BGAA 4QX3A 3T2PA 2J1UA 2JD9A 3E1F1 3MO4A 3K4AA 3CMGA 1H6XA 2XHNA 2XQXA 1L7RA 3GGLA 1I5PA 1YQ2A 3P6BA 2WYSA 3K77A 1JU4A 3CZJA 3BN6A 5LA1A 4BJ0A 4DUWA 4QDQA 1R64A 3I2HA 1DLCA 3CIHA 4OMDA 1D7PM 2WABA 3HNBM 2QQKA 4RN5A 2VCBA 3UETA 3WF0A 1UXZA 4KMQA 2JDAA 2R7EB 2WAOA 3DYPA 2X09A 1JZ2A 2WQ8A 4QB2A 1UZ0A 2KD7A 3IAQA 3NJVA 4ARXA 1UWWA 3FHAA 2W91A 2ZEWA 4XVHA 3A7QA 3GM8A 1UX7A 3I2IA 3I3EA 3DYOA 2W92A 3LEKA 2B4KA 3EB7A 1J83A 3K75B 2VMEA 3IDAA 4CU8A 4YPJA 2VR4A 2W46A 2W1QA 5B4XA 3LEIA 1KGYA 4XZUG 2ID4A 4DXSA 4AAXA 1RYYA 1W9WA 3OEAA 4JHZA 2C26A 5CYYA 5J1XA 2Y6LA 3OGVA 1UYXA 1UMIA 1K12A 4QAWA 2VZ1A 2X10A 3I2FA 4JKMA 3D3AA 1WCQA 1LNSA 2VJXA 3FL7A 4TXWA 5IHRA 2DCKA 4QX1A 4D8MA 3MBWA 4IUGA 2VC9A 3LEGA 4GWIA 1WKYA 4OMCA 4JX0A 1SDDB 2X05A 4DUVA 2YC2A 4HG6B 2ZEYA 1UY2A 4XUQA 1K3IA 5FUIA 2W5FA 5G05L 3OGRA 4DEQA 2VMDA 3CDZB 1GMMA 3T2OA 5EJZB 1JHJA 1EUUA 4P00B 2E33A 2WN2A 2XOMA 3P1IA 3MV11 2W1UA 3WEZA 2QQLA 3WNMA 5LA2A 3T08A 2W94A 3K46A 2ZXQA 4QDSA 2Y64A 4CVUA 2YC4A 2QQMA 2WO1A 5G04L 3DECA 3W5MA 2ORZA 2WN3A 1GNYA 2W47A 2VZOA 3VD3A 2E32A 2E26A 4LKSA 1CIYA 4A44A 2WO2A 1SG3A 1NAEA 3ACGA 4ET7A 3IAPA 4E8CA 3DYMA 3PUHA 1OF3A 2EIEA 3I2GA 4ZZ8A 3PUIA 5I0DA 5A1AA 4DXTA 1CX1A 1PX4A 2VZVA 2EICA 2WZEA 4PF1A 3VD9A 1K45A 2QQIA 2BGPA 1UYZA 3UNPA 1IQDC 2W1WA 4PT6A 4CU7A 4A3ZA 1GOHA 3ABZA 4QX0A 2VCAA 4OYUA 1ULOA 3A23A 5IJRA 2WBKA 5C70A 3HOBA 5DMYA 1GUIA 3C7FA 2PQSA 4E8DA 3A22A 2HLEA 5IFPA 2Z4FA 3I3DA 3C8XA 3I97A 5DQ0A 2HYXA 3WNNA 5C7GA 1W99A 3JXSA 3WF4A 2VZSA 1UYYA 1UY4A 4A4AA 4LQRA 2ZEZA 1GU3A 2W1SA 2OKXA 1JYNA 4MGQA 3LPFA 4UAPA 3ECQA 2QBXA 1XC6A 4MOAA 1US2A 3AC0A 2RVAA 3U37A 1JZ7A 4BDVB 2YFZA 3T09A 2WZ8A 3HJRA 3MUY1 4DEVA 4UI9L 1P8JA 1BHGA 3OG2A 5JMOA 3OBAA 1CZSA 1JU3A 3VD7A 5JR2A 4XUPA 5EIYB 4CUAA 3T0AA 3T0BA 3NNGA 2QQNA 2CDPA 3VD4A 2ZEXA 4CU9A 4MO3M 1OF4A 5IYYA 1NX9A 2VZ3A 2VMCA 3LE0A 4OZOA 3SEEA 3WNOA 1PX3A 3VD5A 3ACIA 3LPGA 2BGOA 5JUVA 2VCCA 5HXMA 4LHSA 3WF3A 5JXIA 2V72A 2W9XA 1UY3A 1OD3A 4CUBA 2YB7A 3WF1A 4QB6A 3HPNA 3VDCA 1KEXA 1EUTA 4AG4A 1JZ6A 3GXUA 3HEIA 2V4VA 4JKLA 2VQUA 4Z2AA 3FN9A 2VZRA 4W50A 4ZY9A 3NQHA 4KWUA 3MV01 1JI6A 2J1SA 2VZUA 3WNKA 3C7GA 2VTFA 1CZVA 1PMHX 3F2ZA 5C71A 2W3JA 1T2XA 3I2JA 4BXSV 1JYVA 1GOGA 1H6YA 2Y6HA 2VQTA 4ARYA 1US3A 1PMJX 1O59A 3C7EA 3CKHA 2EIBA 5DPNA 3IB3A 5HPOA 2LS6A 2XONA 4CUCA 1J84A 4P08A 2Y6KA 1L7QA 2Y6GA 3LQCA 5F7UA 1HN1A 2J1RA 1UY1A 2J1EA 2ORXA 2WDBA 4W4ZA 2EIDA 4XUNA 4BK5A 5B4NA 1XNTA 5JXJA 3IIIA 4MGSA 4A6OA 1JYXA 2B9VA 2BERA 2E31A 3MUZ1 2VZPA 2Y6JA 3GDBA 1JYWA 3ZM8A 3I2KA 1NKGA 1DYOA 2VOTA 2YG0A 2WAAA 2JE8A
chains in the Genus database with same CATH superfamily
5APAA 3UJOA 4QPGC 2GP3A 1JZ8A 5IK8A 3VV1A 2RJ2A 1CESA 2R061 1OOPC 2QVSB 2HWC1 4QDRA 4ATEA 4M0NA 4XILA 2BUKA 4KNCA 3RI9A 4HFSA 3WDUA 4FI9A 1WMXA 2NLRA 4I01A 4P02B 5JXHA 4LLFA 1N1SA 4JTOA 2ADEA 5L7OC 3EBRA 2BNMA 2LROA 3POEA 4IV1A 4GAZA 3RI8A 3M4FA 3KB5A 3UKVA 3UYJA 4CEYB 1QHDA 4QB1A 4RR3A 3DXTA 1VB2A 3LSDA 2VQAA 4B1LA 5GZGA 4HLTA 1PIV3 5A3MA 2Y6FA 1UU4A 1HQNA 2RE9A 3WNPA 1AYM2 1ULPA 3Q8BA 5FKBA 1RMU3 1HW5A 3CF6E 2BZDA 2P34A 4LKEA 1G8WA 3RGBA 3U11A 1W2UA 1F35A 4MG2A 4I02A 2WKKA 1U0AA 2BTVC 3VKNA 1PGW1 4XFCA 2DVDA 5FZDA 4CCKA 5FYMA 2WR9A 1TVGA 4DIQA 4HMZA 4N43B 2J1AA 3IN9A 2ZKLA 4YRDA 2SBAA 4P5YA 2VNVA 1G9CA 4Y1XA 2VVFA 1R091 1BXHA 3R05A 4LJHA 2VO5A 2R0HA 1N3QA 5FZOA 3ACHA 1JXNA 3JD73 4AFCA 3THCA 2WZPP 4Y33A 1W0NA 2W87A 1PK6A 3VBFA 3HR9A 4DXRA 1O5UA 2WWJA 5F1RA 2RJKA 2J1TA 2ZGRA 2Q1ZB 5CFCB 4UFIA 2W95A 3K4ZA 4D6QA 3AP6A 1JN2P 1WLDA 3U1XA 4CCNA 1RUJ1 4IE4A 4JGYC 4UOJA 2GMPA 5BUVA 4D0QA 5CADA 4AR2A 2WZR3 2RR11 4KWKA 4WVMB 1F4AA 1ONAA 2D6KA 3MW2A 4KWJA 2XJPA 2P4EA 4QPWA 4UFHA 3RMXA 3VLBB 3WDYA 2VPVA 2WQ4A 3CJIC 4AWDA 5DUVA 5C9AC 3KCYA 1POV1 3BOWA 3N36A 1GANA 1WGPA 5EYYA 1R083 1BJQA 5C3PA 1PO23 1UCXA 3KT4A 3ZFFB 1COV1 4WM8C 1W2TA 3NKTA 1Q8OA 2DU0A 1PZ9A 4HSJA 4K8RB 2ERFA 2MEV1 1I3HA 4A42A 2ETEA 1VALA 3RZZA 4NIHA 3SEPA 1Y9GA 3OYWA 4XZPA 5L9RA 5C5UA 3VDBA 1XPWA 5KR7A 3AZVA 3A21A 5IFTA 1DQ5A 4QKNA 5CG9A 2A70A 4AGGA 1TQ5A 2DFBA 1AR62 2DCJA 3ZKYA 5ERLA 2WO3A 4BIOA 5IK7A 2ZMNA 1NA1A 4A41A 1Y9QA 4P9XA 1WW7A 1Y9MA 1RHI3 1HRI3 3EYPA 4FPFA 1AR63 4I0BA 1OHFA 4JGZC 4LEJA 4QQPA 3T4HB 4C8DA 5FDBA 3ZR5A 3RZKA 4HXCA 4OHZA 5J36A 5IVJA 2ZHKA 3T2PA 2J1UA 2P3KA 5C6CA 2D7FA 5FZ3A 1UU5A 3CMGA 3AVSA 3K4AA 5T54A 1W8ZA 1M4WA 3V56A 1XQNA 2XQXA 5FZ9A 1BEV3 1L7RA 2A6YA 2HWE2 1HKDA 3KVAA 3N7MA 4Y3OA 5L73A 5J98B 1WW6A 3HMYA 1HXS1 4Q0PA 5C9AB 4AVBA 1VBA3 4XJWA 4AFAA 5D2AA 3GALA 2HWE1 2WYSA 4QPGB 5I0TA 5CFDB 3K77A 1JU4A 1QY4A 4XTPA 3BN6A 4AVCA 1ULGA 4DUWA 4Z8BA 1YFWA 3WHUA 1N1TA 2FHRA 2R1DA 2YGMA 3I2HA 3KQ4B 5BXXA 2WZR2 5FZLA 3ZO0B 4EROA 4HSLA 1NQDA 5HCHA 4CCOA 4FFIA 3PJQA 1VBE2 1D7PM 1PZ7A 4CEWC 1REDA 4JQRA 4M00A 4NMIA 3ZMOA 4IV1C 4OHWA 5JIUA 1QOOA 4PDWA 4PIZA 1FI2A 2GNDA 2JDYA 2Y60A 4WVWA 3RWNA 5JR7B 3DYPA 3NJZA 1JYCA 4OZXA 4CP0A 3U4SA 4LO7A 1XSQA 4QB2A 1VBB3 1D4M2 3IAQA 1ND3C 4UF0B 4COYA 4YM3A 4CEYC 4HN0A 3OD4A 3FHAA 1FV3A 2ZEWA 5LZ6A 1YIFA 1ULCA 4FXKB 3B93A 5FO8B 5EXOA 1RXFA 2G9GA 3FFZA 4EN6B 1HRI1 1I6XA 3LZZA 2JG9C 3W21A 3DYOA 5FY9A 3SLIA 2B4KA 3B94A 1RVF3 5A7WA 4CU8A 4MUVA 4D7YA 4YPJA 1S2BA 3PIGA 2OYZA 4EN7B 3LF7A 4LBQD 1DQ6A 3MZHA 1LESA 4LA3A 3KQRA 5BNOC 1FX5A 3KGZA 5E89A 1NZIA 1JYIA 3AFGA 5ACA1 1PVXA 5FYZA 3LA3A 1RYYA 3OEAA 4JHZA 5J1XA 5CYYA 1WMDA 4COVA 5C3RA 3OGVA 1UYXA 2AENA 2CSGA 2JKBA 2RS33 5FK8A 4ASKA 4GB33 2X10A 5IVCA 4DO0A 3AVRA 4ASMB 2WO7A 1LNSA 3Q8AA 5SV8A 2JG9B 2QE3A 1GICA 1PNFA 3I49A 1JOJA 1W6QB 2WWUA 2DFCA 1C8M2 3I4IA 1EPZA 4NRPA 3SH4A 3JZVA 2B5HA 1YNAA 1XYNA 4IUGA 1E5HA 5BNNB 3J8F1 4E4ZA 1WKYA 4QXCA 2AUYA 2VW1A 4YW1A 3GCXA 4N9IA 1MACA 4NAOA 4BOWA 1AF9A 1VBE1 4Y24A 5FUIA 5IK5A 1GBGA 5G05L 2VMDA 2YROA 4AQ2A 5F9TA 1PGL1 1ST8A 1LOGA 3K3OA 4IEZA 1NCRB 2NPIA 1IG3A 1W6NB 3O5SA 1OOPA 5DAQA 5DUXA 2EAAA 3NSTA 3T2OA 1W8WA 1PO11 5FR3A 3PNAA 1UL9A 3V65A 1JYTA 3KHBA 3VBUB 4URTA 1HXS3 4XCBA 3NNJA 3H0OA 4QGLA 2FDGA 2LALA 5J96B 3SCGA 1G86A 1O3QA 4FPKA 1JOPA 4HKWA 1CAWB 4BQWA 3R4UA 4Q26A 1RUNA 5HCAA 3WNMA 1OMIA 2RS13 3ILNA 2XHKA 1ZX5A 2GALA 2DUOA 3KZ4C 3BU0A 4QPIA 2IVIB 5K4LA 4CVUA 4JCKA 4AFMA 1BQPA 1NY71 2YXSA 3VL8A 3MIDA 4PBOA 5G04L 2Q30A 2R041 3DECA 1J3RA 5IUQA 3VZMA 2WN3A 3H8OA 2W47A 2VZOA 5FYIA 3ATGA 5LBCA 3VD3A 4B29A 4LKSA 4Y26A 1LEDA 5A32B 1DYPA 1B09A 3R4SA 3VZLA 1NAEA 4FFHA 5CU1A 2RS52 4AHYA 5FK7A 1OA2A 2EIEA 4HL0A 4IEXA 1OI6A 2EVXA 1KS4A 2ZCWA 1VBD1 3HT1A 4LR4A 5K7PA 2BU9A 4ZZ8A 2E6VA 3BB6A 1DGRA 3K3NA 5A1AA 4E4HA 2A71A 2OUJA 1CAWA 1ZRFA 2FDKA 4LBLA 2D93A 4PF1A 1EYBA 1W2AX 3DN7A 3HQUA 2PLV1 4J1XA 2BGPA 3DXUA 4K1ZA 4PLNA 2UWCA 4YGCA 5FY0A 3UNPA 1NYWA 1Q5OA 4FOQA 5HV0A 1QJZA 4RGKA 2E7QA 2A6ZA 3G6JB 4LHNA 4YZ5A 2A3WA 3ABZA 1C8M1 5FMCA 2VCAA 2VMGA 2RG4A 1BBT1 1PO13 2W68A 1NE4A 3A23A 3HOBA 5IJRA 1U5ZA 1GUIA 5E6HA 4QU2A 2Q8CA 1CAUB 1CIWA 3ZVXA 3A22A 4E8DA 4NHLA 5LK7B 5JPMB 5DAVA 2PQQA 2WNEA 5IFPA 1J59A 1TME3 2Z4FA 1N1YA 1OKQA 2PHWA 1HRI2 2QTWB 3I3DA 4LITA 2XBO2 5AC92 4Q4V1 1KXGA 5AFEA 3ZSJA 2C5DA 1JUHA 1B35C 3W9AA 2VOVA 4NE9A 1BYHA 4CP9B 5C8CA 5CFCC 3WF4A 2PMWB 5DG1A 3N9MA 5T5LA 3D0JA 3R6SA 3QD6A 4NHMA 2HH9A 1DGLA 5F6LB 4Q8LA 4CDQA 3KF5A 2ZAHA 3H3UA 1SBDA 4WVVA 3ECQA 1AR72 1VAKA 3VBFC 3KM5A 2E9QA 1RUE1 2QZ3A 5FZ4A 3D5OA 4MOAA 4LKDA 4ZXKA 4I0WB 2JDNA 3FE5A 5L7OA 5FY1A 5JI7A 2K46A 3ZFFC 4NRQA 4LBNA 1UKRA 5BNPB 2JD4A 1UZVA 5HCFA 3QCWA 1X7NA 4AVAA 3ACLA 1FATA 2IC1A 3NW4A 3VUOA 3S7EA 1LHNA 1S0JA 3T09A 2OS2A 3HJRA 3GZTB 4UI9L 2OZ6A 2AR6A 2P6CA 3M3EA 5GZEA 5IWFA 3ZFEC 3NVCA 1BHGA 4LE3A 5CEHA 4OHYA 1GZWA 2XXZA 3JD71 4DRVA 3NAPB 4YSFA 5KXBA 5F5CA 2BBVA 1PGSA 4BQYA 3KGLA 3BALA 3PVOA 3OBAA 3VBHC 1V6OA 3OYWB 1OBNA 4RS5B 3L2YA 4J25A 4O65A 5JR2A 2NP0A 3AMNA 4DOUA 4LT5A 4YW6A 4XUPA 3POIA 3VBSC 1W2OA 2R062 4AI9A 4CU9A 3PDQA 1Y3TA 4CDUC 2OA2A 1UOJA 4XF3A 1NX9A 3Q8FA 5T5PA 1FOD1 2VMCA 4YWAA 4XQ4A 4CPBA 4CDUA 4XF4A 2YYOA 2ZABA 4YM0A 2ZGPA 1R1A1 5CKMA 5JXIA 3WF3A 1XRUA 1RUG1 1RMU1 2EF6A 2Y38A 4B1MA 1YYNA 2AYHA 2XKPA 3LSEA 5E16A 1LCLA 1SFYA 4CUBA 2F6BA 1MVQA 2ADDA 1E5IA 1RMU2 2H6CA 5DAPA 3H7YA 3HPNA 4L97A 1KEXA 4X8NA 4QKDA 1EV13 1EUTA 2I45A 3GXUA 4Q0SA 4LHLA 4BIFA 1PK6C 4EWEA 3FN9A 3ZFGB 2VZRA 4WZCA 4W50A 2R042 3VKFC 4Z1VA 5KHJA 1KFUL 2VNGA 4QM8A 4QX8A 2YMZA 1R093 3N35A 1KJLA 3C7GA 1RUI1 4F83A 4BA6A 3WG4A 2BW8A 1IS5A 1RUOA 2O8QA 5FZ0A 1PMHX 1C57A 4YVSC 5A33A 3I54A 5C71A 1A34A 2W3JA 4UF0A 2O14A 3KT7A 5FFOC 5F37A 3V0BA 3AP9A 2ZGSA 4M0HA 5FLHA 3ZN6A 5A7PA 4AOCA 3GCWA 5A3TA 4CCEA 1DBNA 4DXZA 5A3LA 2HBTA 3GZUC 1KITA 5DUWA 3N3HA 3PTRB 1VBA1 4Y5TA 5C3SA 3N9LA 2EIBA 1SBFA 4RFT0 5DPNA 3IB3A 2YBKA 5FTTC 2XONA 1KDMA 4XW3A 3AX4A 2G4IA 1PM7A 1MS3A 1PO21 1L7QA 3N7KA 1KJRA 1MQTC 4HPKB 3WOGA 2Y6GA 3IMNA 4RGGA 4D3WA 5C5TA 1ALYA 3V0AA 3PTYA 2A1XA 3BU7A 2IXJA 2XMLA 1UY1A 2IWGB 3O1SA 5FLIA 2OQ7A 1XNCA 1H8TB 1W6MA 1HB2A 3S5QA 3NV1A 5B4NA 2MEV3 4HOOA 2PN5A 1Z78A 3EQEA 4M3CA 2KM2A 1CD3G 3IIIA 3VHOA 1XE0A 2JDKA 1GP6A 1W0PA 2A3YA 1LAJA 5JPNB 3I8TA 3JB4C 4MGSA 4CDWA 1ND2C 4KL1A 3SQOA 3BPZA 5FXVA 1QH7A 4IESA 4XF9A 3J7NA 1J1LA 1W05A 3BOPA 1NKGA 2Z69A 3EO6A 1F5FA 2VAUA 4YFZA 5JOYA 2VOTA 2ZGQA 1F31A 3U10A 5JZGA 2VG9A 1XJAA 2DYCA 1RUE2 1FPN2 2WAAA 4TWTA 3WX5A 1LOFA 3GJAA 1W8NA 3OPTA 3SKVA 1H30A 5JI9A 2VM9A 1D2QA 5JXGA 2XVLA 3FC0A 1W8OA 5I0RA 2WT1A 3OPZA 3RVHA 5LA0A 3CQOA 3GZEA 4IEQA 3M1HA 4AW7A 2PAMA 1VMJA 4FQ4A 2HWB2 1JW6A 2YGLA 3NRUA 4RQPB 3ETPA 4R9DA 1QMJA 1FMD1 5FZ7A 4RD7A 2ZX4A 3CJXA 4L92A 2CY6A 2PA7A 3VB9A 5GZCA 3WDXA 2K2SA 1OOPB 4XUOA 3VHRA 1RUH3 3OUIA 3E6CC 3M3IA 5ABJA 3ZN6B 4S2GA 4MGIE 5CKQA 5FZMA 2WLQA 1UY0A 1O4TA 3QLQA 1FXZA 4LBKA 4YG3A 2ZX3A 3LAGA 4F3JA 4CDXB 4BWOA 1HX6A 3ME2A 4KBBA 2Q1MA 5FZGA 5T5JA 3P3NA 4WBBA 3C7OA 3O1PA 3POSA 2JKXA 3AL6A 2Y0IA 2E53A 1W9FA 1DCSA 1AR73 3DCQA 3LDBA 4QHOA 3MW3A 4X6QB 4XC9A 3T3YA 3Q8EA 1VBD2 1OH4A 3USUA 3B9IA 1KD7A 3OPWA 1UF2C 1UKGA 4XJUA 5FPZA 4B4QA 5IAXA 1DU3D 3CNAA 1BMV1 3FWEA 3PJYA 5I8TA 1H1AA 2CL2A 2C9KA 1V70A 4QHZA 4BXFA 3WNLA 2J22A 1LB2A 2QZ2A 3Q9OA 3W5NA 4BK4A 1GQPA 1ZBA3 3BI3A 4R4XA 1SHWB 4A45A 3SISA 3NV3A 4E2SA 4CP1A 3I3BA 1RB8G 1UQXA 5CISA 2GU9A 3WNXA 1ND2A 2R49A 4O7XA 3LOIA 4XF0A 2QQJA 2WFF3 1Y43B 4Q4W1 1QXPA 3CLPA 2JG8C 4ZU4A 5BNPA 3D82A 2DVGA 2XJTA 3MGUA 2VBDA 3I59A 4UT5A 4L0PA 1PHMA 3PVNA 4GZ9A 3TNPB 2VZQA 3THPA 4MADA 1CAUA 4XE9A 2QKDA 2VBBA 5FPLA 3BPSA 3UESA 2AC1A 4KH9A 4QD2A 4Y1ZA 3VDAA 4XBNA 3RYPA 5IW0A 4QKBA 2B9UA 1VBB1 2UWAA 3FLPA 1QJY3 4BPZA 1NZCA 4DUXA 2JG8B 2DTWA 1RUC3 4HONA 2EXHA 4RHV2 1OLRA 3VBOA 3IT8A 1LGNA 2J7MA 4BQ4A 2DTYA 3J8F3 1HDKA 1MQTB 5FP9A 3BYWA 1GOFA 2OQ6A 3TAYA 4GMP3 4AI8A 3C7HA 3ORJA 5FZFA 1OUXA 1SLLA 1UMHA 1ASJ3 1QJFA 3U4XA 5FP3A 3E1F1 4LBQA 3POWA 1DDLA 1AXYA 4LA2A 2XHNA 3D8CA 5JOZA 2VNOA 3B69A 3LKJA 4AQTA 1WMFA 4MHRA 5A6ZA 1W8HA 5A7QA 1YQ2A 2R063 1H2NA 1S0BA 5L9VA 1LECA 1RUG2 2D6NA 3GHNA 5FYUA 3ZX7A 4BQXA 1CGPA 2D44A 3W58A 5LA1A 1GZWB 2WFF1 5T5OA 3EJKA 2ZZQA 1NCQC 1QEXA 2VXJA 4QDQA 3POGA 3EMRA 1DLCA 3MIGA 4FOWA 3CIHA 3U75A 3ZPYA 1UIKA 4CSWA 2BEOA 4OMDA 5K9YA 3THTA 3QH7A 2OT7A 1VBC1 4AZZA 2QQPA 2CWSA 1ZZBA 2QQKA 2VCBA 3UETA 3WF0A 1ND2B 5KC5A 1QDOA 4JDMA 4AI3A 5LWBA 3KD4A 2A6XA 2B46X 2R7EB 4W6YA 4XEZA 3DUIA 2X09A 3DL3A 2WQ8A 4HT1T 2R16A 4X6RB 4XMAA 3ZSEA 1UZ0A 1LTEA 1ZZ9A 2ARBA 3NJVA 3L9JT 5BPXA 4ARXA 1UWWA 1J58A 2WLPA 1HRV2 1S2EA 3EXUA 3LA2A 5EV7A 3R4DB 5LASA 1K5MB 3E5QA 1LR5A 4E9KA 3SITA 1BK0A 2GMEA 4KGGA 2XR4A 4FP2A 3OSDA 4CDXC 1DGWX 1ULFA 1F2NA 1D4M1 1TMF1 2RS32 2CYFA 3EB7A 1GKBA 2WNUB 3KCCA 2VMEA 4J1WA 3IDAA 2P6HA 1AHSA 2VR4A 1O6UA 2XBO3 3MLLA 2W46A 4CPBD 5AC93 1HV0A 4NHXA 1ZBA1 2RM23 4CDWC 1MS1A 1SEFA 2GMMA 1KGYA 3LEIA 2IXHA 1G9DA 2RMU2 4NJ4A 1O4YA 3VBOC 5A6QA 3LGRA 5CBLA 3AZWA 1MVEA 1WZXA 3ZFGA 4M3CB 1Y4WA 1C5HA 4AAXA 4DXSA 3TN91 4PQ9A 3WP4A 4Q4W3 3VKLA 5A33B 1JHNA 2VW2A 2XPJA 1VAMA 4AVSA 2CU5A 2BVVA 4P14A 2NMNA 2XJVA 4CDQC 1UMIA 4JDNA 4QAWA 1OPOA 3MPPG 1O3RA 3I2FA 4JKMA 3D3AA 2PHUA 5C9AA 1G6NA 1U5IA 5FCCA 3TRSB 5A6YA 5C8CC 4FOVA 2D3SA 1RJ7A 2VJXA 3OUJA 3BTZA 3ENRA 2P3JA 1ULEA 1QKQA 2DCKA 1S0GA 3CO2A 4QX1A 1F8VA 2VC9A 4M3CE 3AMMA 5KHHA 4DZGA 1W0OA 4DS0A 2RDRA 4GWIA 4YW7A 4EN9B 2B42B 5ANQA 3TBDA 1RUD1 5F39A 4C91A 5DABA 1SDDB 1AR61 2I2SA 5FO7B 2A6VA 1ZBE1 2Q8DA 2BYVE 3ZYPA 5KXCA 2ZEYA 1UY2A 4AQ6A 3SCFA 3LCPA 3K48A 4DEQA 3OGRA 3CDZB 1X82A 1GMMA 4RFRB 1OVPA 1QWRA 4AI1A 4AGVA 2RS12 3BIWE 2Y34A 3WW3A 2D98A 1QH6A 1H1IA 3BUCA 3AXDA 2BOJA 4P00B 5CB7A 3NKGA 3MV11 5FPBA 2XVKA 1KQRA 3ZXAC 3AYDA 3D0SA 1HXS2 2YBSA 3MIBA 5A3OA 1J3QA 3VBSB 3D4KA 3ST7A 3GZAA 3P5BA 4S2HA 3LOBA 1AX1A 1XU1A 4Q5OA 1G9FA 3K46A 1IZ3A 3PUSA 4H3WA 1X8MA 5A7OA 2GNMA 2YC4A 2RMU3 1SCRA 2WO1A 4KWLA 5FYSA 1GP4A 1C1LA 1AJKA 3NNMA 2AEYA 4BM8A 5I91A 1GNYA 2C6SA 4BH9A 2E32A 3HWJA 1CIYA 4ORFA 5C4WC 4DQAA 4XF1A 3ZN5A 5D8AC 2PHFA 4FSJA 1YHFA 3H8XA 3O1VA 4QQOA 4E8CA 4E4SA 1OPMA 1YFXA 3AZXA 3PUHA 4AHXA 3Q8CA 4IV1B 2DCYA 3V0AB 2NYYA 5EP9A 2X53S 1E57A 3WHTA 5FMBA 4Q4Y1 5BV6A 2XJRA 3ZLIA 1DZRA 3X29B 4FTSA 2XL9A 2UY8A 1CJDA 1VMHA 5ABJB 4XJAA 5FOBB 2X5IB 1CX1A 2XB6C 2EICA 4IDZA 3WCRA 3S5AA 4Q1PA 5LW9A 1QGLA 1SLAA 3N4MA 1GLHA 4YW4A 1R082 1IQDC 1MZFA 1W8TA 4LMFA 4PT6A 4IGOA 5J09A 1UYPA 4EZ4A 5C8WA 3WW2A 2HWF1 2ZGMA 2PAEA 1HQWA 2V5YA 3OY8B 4I09A 4MXWB 4QX0A 1VMFA 4S2DA 1UOGA 4CCDA 4OYUA 3AJYA 3S30A 5C70A 4AYUA 2GN3A 3B3QE 4GQ7A 3JBG3 2WSVA 3DPRC 1S0CA 4AXOA 4IW3A 5LY2A 2C24A 3ASIA 4FPEA 5FZOB 2WT0A 1AYN3 5F5QA 1OQEA 2HLEA 3JBG2 2BGCA 5FZAA 2ZGNA 1YQ8A 3I97A 3AM2A 1D2SA 1AUYA 1UZWA 3MFAA 1DZTA 3VKOA 1BCXA 1RVF2 3WNNA 5IK4A 2W52A 2Z2SB 5FYYA 3JXSA 4GB31 1W8UA 5J3UA 3ZIXA 2BVBA 4N8MA 1O91A 4YYOA 2VZSA 1UYYA 2QNKA 2HWB1 2X5IC 4A4AA 5ABJC 1B35A 1BBT2 1GU3A 1RUF1 3ZYRA 4GH4B 3OGJA 4COUA 5T50A 5FY5A 3LPFA 2HWC2 4UAPA 4XJZA 3S0MA 1LHVA 5K0UC 5KHKA 5EWSA 2GAUA 3ZDVA 1NT0A 2ZJCA 5F5AA 2D40A 2QBXA 2JB4A 3SXWA 4Q1RA 1XC6A 3P3PA 5JSPA 1L7LA 3AC0A 1GWKA 2VE1A 3OJBA 4BU2A 4Y22A 2YBPA 3RZHA 4FTBA 2YU1A 1LULA 2LTNA 5F8PA 1YIPA 4BDVB 2F17A 2WS91 2ZACA 4D7SA 4HZFA 3ZXGA 4PLOA 4AEDC 2WZ8A 4ONUA 4UFKA 3W20A 1AYM1 1HV1A 1ULDA 3L2HA 3LIHA 4FPHA 4M01A 1CVNA 2GSYA 1AR82 4EV0A 2TUNA 5E88A 5A7NA 2ZBJA 3VD7A 3UGGA 3T1LA 5J48A 3A0KA 1WBFA 5I0UA 3HBKA 1OURA 2VULA 4CDQB 2MPFA 5JVVA 3T0AA 4CUAA 3KCXA 4G3YC 4JV4A 4BQ3A 2CDPA 4HVRA 2H0VA 2ZEXA 4MO3M 5FYTA 5CA6A 1OF4A 1W39A 2BP6A 3LFIA 3UV9A 4W6WA 3WP5A 4QX7A 4EWAA 2VZ3A 3WT3A 4M3CF 1YI7A 3SEEA 2WFF2 3WNOA 3FUOA 4J6GA 4LBQB 1RITA 5D8AB 1H0BA 1POV3 4MH0E 4CDWB 3OOXA 2VCCA 4LHSA 4N7UA 2A73B 2BPA2 1UY3A 4K6BA 2QQWA 1X33A 1VE0A 3VDDC 1ENXA 2YY1A 4OCTA 3JQWA 3PMEA 4K8FA 3VDCA 5DZFA 4R9BA 1JZ6A 2ZHMA 1H4HA 4JKLA 3RZGA 4NPRA 2W39A 2XQRA 4BLIA 2HJIA 3HBZA 4DPNA 1VBD3 2HYKA 3O12A 2Q8EA 3NQHA 2FBEA 3QOPA 3WNKA 1JI6A 2G1MA 5HCBA 1S55A 1U12A 1GYKA 2EXIA 3FBMA 5A7SA 4ITCA 1WWYA 1QDCA 1EP0A 4DY5A 5JAXA 1J1TA 4UW4A 2CHHA 5FLJA 5JIAA 1RIRA 3UT0A 3F95A 1T2XA 1MS4A 4JRAA 3DF0A 2EXKA 3RPQA 3ROUA 1QIQA 1JYVA 4AVVA 4CZSA 4GIQA 3PLQA 3LIGA 4LO5B 1AYN2 1JUIA 3UKNA 2UURA 2Y6HA 4D7TA 1US3A 5GZFA 4I30A 3RRDA 1OH3A 5FBJA 1H2MA 1AYN1 2WS92 4BYYA 1W6QA 2HEYF 2JE9A 1RL3A 2WA4A 4LULA 5A3PA 5HPOA 4YZ2A 3IPVB 2ZMLA 5H9QA 1IS6A 1V9U1 1J84A 2DV9A 4JVAA 2GDFA 3UGFA 1YQ6A 2AREA 1VR3A 2PAKA 3WINE 1H9PA 4AHWA 5CFDC 1HN1A 5F7UA 4FQZA 4COZA 4CXWA 2ZMKA 4IEVA 4YZ4A 2WFPA 1OLMA 3RG0A 3TWIA 4LK7A 1G7YA 5DAWA 3K2OA 1UMZA 4WZFA 1XNTA 5JXJA 3VBRC 4C0BA 3FX3A 4LUMA 4RQPA 4Y4RA 1HRV3 3TNQA 1F9KA 3T30A 3VBUA 2WNVB 2XG3A 3ILRA 2ARCA 2CV6A 4GB32 3DKQA 2ES3A 1BVP1 5IT6A 4JTNA 2ET1A 3N7LA 4RR3B 5CAZA 3MF6A 1WA6X 4FOYA 4IGQA 3BTAA 4PI2A 4XHXA 4C90A 2HWD1 1MS8A 4MZUA 5FZCA 5C33A 1E5SA 1AYM3 3AP5A 1W28A 3O1RA 2C0ZA 4K20A 1LHUA 4XXPA 2D6OX 3I2OA 2Q5TA 4PF5A 1XNDA 3AKRA 3DV8A 4MLOA 3ZYBA 4AI2A 4P9IA 2JIGA 3FHIB 4QXKA 2WNVC 3O0WA 3WQBA 4Q8KA 3HNMA 2VZTA 4X8PA 1LU2A 2FZ2A 2RM21 3H3LA 1ND3A 4LUKA 5T55A 2PLV2 2W2IA 4Q0VA 2IXIA 5J7MA 2WZR1 1ZZCA 2VMIA 4HN1A 5C3QA 1XYOA 4JHTA 4UFMA 4ZZ5A 2C4XA 1WW4A 5BYNA 2CGPA 4I3GA 4R4ZA 3ELNA 3NMBA 3N9PA 1TNRA 4LHKA 2QDRA 3SC7X 5EJ1B 1XSRA 1I1EA 1PVC3 4XAEA 4SBVA 3CL1A 5IVYA 2GC2A 2TNFA 4BLJA 1Q8SA 3C2UA 4P5HA 3PMSA 1IG0A 4YG0A 4A2UA 4FAGA 1JZ5A 3RZLA 1QJX3 5EJ3A 4O9GA 3CZUA 4PQQA 1DLLA 4JAAA 2XJQA 4H55A 1U5YA 3MF9A 4R8HA 3A4UA 4R9CA 3TEWA 2P1BA 3DKWA 4XACA 4FTEA 3T2QA 2R30A 5DDJ2 1O8SA 3RJRA 3IDBB 1C3HA 4LOTA 4OI2A 3H1WA 2GH2A 2PYTA 4LPLA 3H7JA 3TEYA 3RQ0A 1UOFA 3K4DA 3HNYM 1K42A 1NXD1 1NY72 1XB9A 2P3IA 4FXGB 3FHQA 4TZDA 4F8AA 4QGNA 2BQPA 5DN2A 4IEYA 5CZKA 1NOVA 4TLFA 1TEIA 2ZA9A 4QPIB 3POFA 3FLTA 1H2KA 4COWA 2Q4SA 1F4HA 1OFNA 1AL23 1H8TA 1W6MB 1WW5A 1NUKA 2R071 3AK0A 4NWVA 3WG1A 1ZRRA 4ZS3A 1EV12 1KDKA 1VBA2 3V64A 3W59A 2RS51 1RVF1 3PUAA 5LCWL 3SMHA 3HN3A 1BEV2 1PZ8A 1XNBA 2P17A 5I93A 5AVPA 1CZTA 2Q1FA 2YPDA 1W9YA 2NN8A 4ASLA 1YEWA 1EAH1 3KV4A 4N7IA 4OI1A 3VBHB 1IGOA 1Q56A 1DP0A 1QJU1 1UXXX 2O8OA 2V5DA 2VTXJ 3AP4A 2W08A 5I8YA 1W90A 4IEUA 5FMOS 2WNUC 1JZ4A 2IXKA 2IXCA 1V00A 2X29A 3MIEA 4N43A 3ZFEB 2RR12 1YC61 3OD0A 1ZBA2 4EJRA 3OGSA 1W9TA 1GWMA 4XURA 4IE5A 1CPNA 1OT5A 3WSOA 3VBRB 4EE2A 1VBC3 2QQOA 4K9SA 2WUHA 4QPIC 3ZXDA 2PTMA 4EQVA 1O3SA 5T52A 4Y5SA 3ILFA 4RQPC 1UAIA 2GC1A 4XETA 3HT2A 5FZ8A 2JDPA 4WM7A 1MPXA 2LW8A 4RYDA 1U5XA 2F4PA 3ACFA 5F5IA 5GLUA 2XUMA 2VD7A 5F3GA 4XIOA 2BFUL 1SMVA 5CFDA 5FXZA 5FY7A 2ARXA 1AR93 2L9LA 2WSUA 3NAPC 3LDRA 5A6XA 1CJPA 2R6QA 1V0AA 1HB3A 1SQ4A 2AACA 2KR2A 4NRMA 3VDDB 4O9EA 5ANNA 3B00A 3BGAA 2Q0AA 2P3YA 1OUSA 2IFWA 2OPWA 1H4GA 3D6EA 4YG6A 3MO4A 4LIVA 4Y4YA 4KG8A 1ZREA 1H6XA 1S0FA 1WLWA 4CDUB 1OD5A 4G4FA 2G9ZA 3O1TA 5D8AA 3GGLA 1I5ZA 2BWAA 1I5PA 2VW0A 4Z07A 2ENRA 3P6BA 1S4CA 1C5IA 3ETQA 1AVBA 3TEZA 2Q8OA 4I3PA 4OFGA 2UYBA 1LRHA 2R0FA 2VGDA 3JD72 3KS7A 5ACA3 2DBNA 3CZJA 2RS11 2RR13 1ZRIA 3KWVA 3APBA 4N43C 1WCKA 1R64A 1UOBA 1MQTA 3B01A 4RS5A 3NAPA 1MS9A 1DGWA 5T3NA 2WABA 1VPHA 4IL7A 4UW3A 1ENRA 1N47A 4UXAA 4DRRA 4RR3C 1MZ6A 2DWRA 4AL9A 2XLGA 4CXYA 2JDAA 4Q27A 2PHRA 2ZAAA 4OHVA 1YQ5A 1JZ2A 1DQ4A 1BMV2 5LEJA 2VXRA 1W6NA 2KXLA 2PXJA 2HEVF 3I59B 1AL22 1H8TC 3H8UA 4TLGA 5CNAA 2B45X 1AR91 2W91A 4L8QA 3RJ2X 3TEXA 4AFDA 3M70A 1C8NA 2EA7A 4L2NA 2MEV2 4BQ1A 4XVHA 1ZM1A 4Y20B 4E4DX 1REFA 2A75A 3KHCA 1AL21 2MNGA 3J7LA 2ZGKA 1CN1A 2DBIA 3GM8A 3I3QA 4XIKA 4B7KA 5CVRA 2D6MA 1ZA4A 2RS53 1VRBA 3I2IA 3PIJA 3KF3A 2W92A 3LEKA 4QX5A 3WP6A 1J3PA 5F6KA 3ZXEA 3K75B 5FYHA 1QJEA 4LE4A 3ZSLA 1IKPA 3BKZA 2W1QA 1S1AA 4XDPA 5B4XA 4H7LA 2IUWA 4TYSA 5FYBA 4BHPA 4CTEA 1KFXL 2HWF2 5LEKA 4FPGA 3S6PA 4CYDA 4AI0A 5L36A 2CGNA 3VKMA 2VCMA 5IVBA 5JDBA 5DZGA 1ZNPA 3OGGA 2GNTA 4XYXA 2OVUA 5HI0A 3TB0A 1W9WA 4PLMA 4V2WA 4YVSB 4DINB 3BTXA 5GKAC 2NQYA 3T1MA 4CE8A 3I3MA 1LOBA 3H1YA 1WBLA 4ZHNA 2WIIB 1LENA 1K12A 5EZWA 3ZIWA 1VRH3 5FJKA 1OKOA 4XJ8A 2VZ1A 1COV3 3ZXJA 1YI9A 2QJVA 5EHDA 3V0BB 3ZFGC 2XJSA 1F15A 2WQZC 4HANA 1RUF3 4DB5A 4H2AA 2OX0A 1FNYA 1MEC1 1UW8A 3ES1A 4HBNA 3RZJA 1V6KA 4C1WA 3MFCA 4IV3B 4KG0A 1GP5A 1NLQA 1WUVA 5FPXA 5IHRA 4IQPA 3MBWA 3WLUA 1QJY1 5D21A 4LBMA 1VRH2 2EIGA 4QQLA 4R52A 3LEGA 3N9QA 1IPJA 1FOD2 1LGCA 1IKQA 4ZS2A 4OMCA 4OULA 3ZSMA 4DUVA 4LIUA 3VGIA 1MEC2 2YC2A 2R073 1SPPB 5C4WB 5FZ1A 1TE1B 2OIIA 2ZZJA 4XFIA 3POYA 2WWSA 5FP7A 4S2FA 1SZBA 2B39A 3AYCA 2HWF3 1DQ1A 4JGZA 4O61A 5LY1A 4FCAA 1NA1C 4CEWB 5BNOB 1SFNA 3WDVA 3QH6A 1D0GA 4Q4V2 1JHJA 2WNVA 2WN2A 3TOJA 4ATFA 2XOMA 1B35B 3P1IA 4UBHA 3OCPA 4GH4A 2A3XA 3MEPA 4XMIA 5A1FA 3JB8A 2GP5A 1XXNA 4RS5C 4JC1A 3WEZA 2PHTA 3ZKUA 1RINA 4RSUA 4XBQA 1NCRC 5BNNA 4QQ2A 5LA2A 2Z79A 2FCUA 3B5LB 1I9RA 2RHPA 5EFUA 3G7DA 1R081 2Y64A 3HN1A 5FQ0B 1QU0A 2Y33A 5K8SA 2TBVA 4Y22B 1PGW2 3M3OA 4MHUA 1NLRA 3HAGA 1R1A3 2XLFA 3RZMA 3AKSA 4P9JA 2ORZA 4BQ5A 3WZ1A 3JU9A 4AK3A 4GKXA 2GN7A 4GD4A 4Q4Y2 4A44A 5FOJB 3JQXA 3MLJA 1EV11 1GNZA 2ZX1A 3GHMA 3ACGA 1RJ8A 4IERA 4XHBA 4Y5Z0 1YCIA 2JE7A 4FT8A 1CX4A 1YLLA 3I2GA 4NUBA 3NWKA 4CCLA 1OQDA 3PURA 3ZDSA 4N90A 4FP3A 5HV4A 5H9SA 4DFSA 1XOYA 2VZVA 2IVJA 2ILMA 2WZEA 2VUAA 3FFQA 1UPSA 3VD9A 3H42B 5ACA2 3AMPA 4WVMA 1D4M3 2QCSB 2W1WA 1Q8QA 1Q3EA 4IGPA 4CU7A 2VY0A 1DZQA 4FO9A 4IEOA 1GWLA 3AYAA 3VBRA 2DVAA 2CTVA 3FZ3A 4LBJA 3BIEA 4QT6A 1HJFA 4RA0A 2D6LX 1TME2 2D3RA 3C7FA 2PQSA 4MGZE 3WG2A 4UW6A 3ZXKA 3ZYGA 2E51A 3TN93 1EAH2 3GBGA 1H2LA 2R32A 4HVOA 3C8XA 1PO12 1ENQA 3MI8A 4KBZA 5DQ0A 1IS4A 4CCMA 1NCRA 1LEMA 3AFKA 2HYXA 3E6DA 4ISQA 5BNNC 1FV2A 4LORA 1V9U3 1JBCA 4H14A 1SDWA 1X9PA 1YFUA 4KU8A 1T6BX 1APNA 5FPVA 5M0TA 1UY4A 4LQRA 2CAVA 1WCUA 3WXPA 2DU1A 4XQDA 4G9SB 1H1MA 2R043 4B4PA 4WM7C 4YFWA 3VHNA 2VUJA 1AR83 1POQA 2ZGTA 1UNBA 4AGRA 1CAXB 1VBC2 3VZJA 4JRLA 4WM8B 5A3UA 5FWJA 4GJYA 4K1YA 4XABA 4CRQA 1JZ7A 2BWCA 1C1FA 1RUD3 1LOCA 3IDCB 1C28A 1RUI3 1AX2A 1OC1A 4HK9A 2HWD3 5JLVA 1JS9A 3MUY1 4OUSA 4DEVA 1P8JA 5A32A 3CJIB 1V6NA 5FV3A 1AJOA 1URXA 3WV6A 1SCSA 4DNYA 4KQ7A 4JGYB 4NIIA 1JU3A 1FMD2 1Z7S3 2HWC3 4V1PA 4AFBA 3FBYA 2UYAA 4YW5A 1BBT3 4NOTA 4OVEA 3NNGA 1PO22 3KV9A 3WQ1A 5JMCA 2OZJA 4B3NA 1MS5A 2KA3A 2P5BA 3ZXLA 3AL5A 2LM3A 3I7DA 3N9NA 4N53B 1CAXA 4Q0QA 3AZZA 4LO6B 3MYXA 1HB1A 3H8RA 1HJGA 2PHXA 1HN0A 2YZ4A 3K51A 4LO4B 1KRIA 3E97A 4LK6A 1QJX1 4W65A 3OBZA 5FP4A 3LPGA 1DF0A 1K5MA 2FZ1A 3ITQA 5HXMA 5JUVA 1Y7BA 1EY2A 1QQP2 2LRPA 1OD3A 1N1VA 1OSGA 3N9OA 2OW4A 2YB7A 1V6JA 4AAPA 3WF1A 4UYBA 2DUQA 4QB6A 5HBAA 2VTXA 1QQP1 1Q43A 4YARA 1YJLA 2WT2A 2X8KA 1W04A 2G19A 1QJX2 2WNUA 5DG2A 3SNMA 2VECA 3NO8A 5C8CB 5GM0A 2V4VA 2RDNA 2VQUA 1PVC2 4GH4C 4Q29A 2I07B 1TZOA 2MHFA 3BODA 5C3OA 2VMHA 1DHKB 5DDJ1 2ZOEB 3UL2A 1NQJA 1UN1A 2PFWA 1RHI1 4Q4X2 5JOXA 3RYRA 2FCVA 2VTFA 4LTAA 3O1UA 5FJHA 5FXWA 4YM2A 1CZVA 1A6CA 2P2KA 5LBEA 1JH5A 2PLV3 3F2ZA 1VAVA 2GH8A 3JCIA 4XPVA 3WR0A 2XKOA 3ALQA 3J26N 1MZEA 2D3PA 3SCHA 4AE2A 1PMIA 4FPCA 1UX6A 1GOGA 2FDFA 1TMF2 4AEKA 4OUMA 1BEV1 3ZXFA 2JWPA 3O14A 4EN8B 3FLRA 3JBG1 4Q0UA 2VQTA 1T6GC 4MX3A 5BY5A 4CP2A 4P9LA 4XFHA 1PMJX 1MS0A 1REEA 3VZNA 1O59A 3C7EA 3CKHA 3VHPA 4K3UA 5GZDA 2B7YA 1WCSA 2FDJA 4NIGA 5FYVA 3ZR6A 1PIV1 5JZGB 3H1MA 3KV5A 4P08A 4ES8A 2RMU1 1XE7A 4QGMA 3LQCA 4WVZA 1LHOA 1GZ9A 2GC0A 2DF7A 1K5MC 2J1RA 5FZHA 3UGHA 3OF1A 4GKYA 2J1EA 1QNWA 1JODA 1SPPA 1YXWA 2EIDA 4IEPA 4MV2A 4PIYA 4W4ZA 5C4WA 4D69A 1UZZA 2ZX0A 3U07A 2C9AA 5FXXA 4D94A 2C1FA 3VZOA 2UY9A 2PELA 1LODA 3KT1A 3WVJA 4E2GA 4E2QA 3M2MA 4BCUA 2BERA 3WUDA 2E31A 3JUUA 3MUZ1 2Y6JA 1MR5A 4PI0A 1UD1A 3GDBA 5IVVA 1JYWA 3VBHA 3ZM8A 2WS93 3KVBA 4ZU7A 1A3KA 2DVFA 2WNOA 1DYOA 4LKFA 2DUPA 2YG0A 5FWEA 1DYKA 2GC3A 5IAVA 5LRRA 3VBSA 1ASJ1 2JG9A 5FQ0A 3IMMA 1D4VB 3RNSA 3ZOIA 3ZPOA 4YNIA 3J7HA 1QXRA 4M4PA 5H9RA 5IVFA 3R0RA 4JKKA 2AGSA 4OUEA 3WW4A 5IVEA 5E8AA 1N3PA 2SLIA 4M4RA 5FPUA 5LATA 3CEWA 3IKWA 3GNEA 2BBAA 2GZWA 4LLOA 4XJ9A 1UZYA 4IE0A 2HWE3 2CDOA 2IXLA 4W6XA 4TTGA 1CQ9A 1CWPA 1HLCA 1Z7S2 2I74A 1V6LA 3AKPA 5F2WA 4PDWC 2CGOA 2YPJA 4K40A 4YVWB 2XUEA 1POV0 4YGBA 2A7AA 4NO4A 4ZKTB 2RM22 1RUI2 3T0DA 2YFUA 1NG0A 3ZYHA 2WINB 2VMFA 3MIHA 1G9BA 2VL4A 1EPWA 5A70A 4Y1YA 1QOTA 1IHMA 1NCQB 2O1QA 3QBQA 4GALA 2J1VA 2DCTA 4KI5M 3NJYA 1OLQA 2QQUA 2D43A 5I8SA 4YVWC 1TG7A 4ZU5A 4K21A 2H6BA 2PHLA 5LA9A 1W9SA 5FP8A 2ZHLA 4QWNA 1XNAA 4W8JA 3RWKX 4CP9A 4EYUA 4MGTA 2V73A 1CR7A 2FD8A 1UU6A 3ZYJB 1D0HA 2ZKNA 4GWMA 2XBO1 4HKOA 5AC91 2F4LA 4QX2A 3RDIA 3TN92 5A80A 2JIJA 2X5IA 5KHGA 1IS3A 1O8PA 1SBEA 3ES4A 1CONA 1A8MA 4IEWA 1ODMA 5CG8A 2XWBB 2G9FA 3AB0A 4B7EA 4XFBA 3EHKA 1VIWB 1RXGA 1PM4A 4Q4X1 1NCQA 3AZYA 4GWJA 5KHIA 4FPLA 1DIWA 2Y8KA 2RS31 3WCSA 2HBUA 1BLZA 4XUTA 1YJKA 4WM8A 1JTZX 1RC6A 2RJLA 5FZEA 5LB6A 1RUG3 2DDUA 4PBPA 3NJXA 3BVCA 5BNPC 5D1IA 1VRH1 1PNGA 3IIAA 2JXAA 4ZXEA 1JZ3A 1HQLA 3OEBA 4OQ8A 1PK6B 2ZX2A 2JEMA 3THDA 4FAHA 1W3XA 3CJIA 1GZCA 3E5UA 4D6SA 1Z0HA 2FQPA 3CBNA 4XFGA 1Q8PA 2BFUS 2WA3A 1VBB2 4MYEA 3SKJE 1WLCA 1ZBE2 4B8EA 2OPKA 2RV9A 3U0ZA 2UWBA 2XL7A 1GQHA 5DAXA 4Q4Y3 3J8F2 3OB8A 4CU6A 1W6PB 4N53A 1O4ZA 5KWRA 1YRZA 1OLME 3WF2A 1FT9A 3M3CA 3MHZA 2NM1A 1VBE3 2VBPA 4QX3A 5JSRA 1QJY2 2JD9A 2NZ9A 3B02A 3KSCA 3S57A 1OXCA 3VL9A 1W2NA 3LB9A 1RTVA 3PVEA 4OQ9A 3FUQA 4A7KA 1S0IA 3ZFFA 3LDKA 5F2SA 4FBFA 3VN4A 3LD8A 2TEPA 1FPN1 1SLIA 3UKTA 3OBTA 4DMIA 1WD3A 4FFGA 4IETA 5L7OB 4F7ZA 4NIDA 5AFBA 4ZPIA 4Y20A 2BOIA 5KXEA 1JMUB 4UFJA 4AHZA 2BNOA 5FY8A 2HEWF 1S0EA 4BB3A 3PU3A 4EN0A 1FMD3 4BJ0A 2FDIA 5FAXA 3TYJA 3E6BA 1WA4A 4XCAA 4OI0A 4MVTA 2R1BA 1QXJA 4JDOA 4XBLA 3NV4A 3O0XA 1C4RA 5CFCA 3U78A 3PL0A 3T2TA 3HNBM 4JZRA 2VNRA 3VDDA 4RN5A 3WQ0A 1AX0A 1RHI2 1UXZA 2BDRA 3GYDA 4UFLA 4I0AA 1RUD2 1MEC3 4KMQA 5KC6A 5LRSA 1A8DA 1GR3A 1E5RA 2EXJA 1SLCA 2WAOA 2ZTNA 3AMHA 1V6MA 4AEDB 2NMOA 1LHWA 3INAA 4IE7A 3AXEA 2XH6A 1QF3A 2B8MA 2KD7A 2XJUA 2Z5WA 5GLTA 4AQSA 1IOAA 3LA7A 1WLTA 2H0BA 3A7QA 4GJZA 2E63A 4ES9A 4CA9A 4NVPA 4LOSA 3O1MA 4H7MA 3M3QA 4WM7B 5LK5A 1BZWA 2CAUA 4Z92B 1AZDA 1UX7A 1SFPA 2OUHA 1ACCA 3LEMA 3I3EA 5KXDA 5I0SA 5GJ6A 4L99A 4DY3A 4Y1VA 1W06A 4CCCA 3U14A 1J83A 3CHXA 1F5JA 1NXMA 3RFRA 4D6RA 4YM1A 4YW3A 4XOGA 4BMBA 1EAH3 2HKXA 1K5JA 1LU1A 2JJ6A 5F3CA 1QJU3 1VJ2A 4XZUG 2ID4A 5GLVA 4I2OA 2Z42A 4NPLA 2VQ0A 4FVVA 2ZS6B 2JENA 4MXVA 4NWWA 4YGEA 2WC2A 1RUH2 2XVGA 3OTFA 5FBZA 4YW2A 1CAVB 3MDPA 1VP6A 1L3JA 2WRAA 3SH5A 3MLKA 1FNZA 4NAMA 2C26A 1PVC1 2Y6LA 4AEMA 1S2KA 1WCDJ 2JB8A 2HWB3 4C0HA 1OA3A 4UBGA 5EPAA 5DZEA 3IDEA 5K0UB 4UW5A 4CEWA 1Q8VA 2UU8A 1WCQA 1BVVA 2VH9A 2XDVA 3WD5A 4MSVA 4KU7A 2FCTA 3RMYA 1M06G 1RUE3 2D5HA 2JDMA 3FL7A 4TXWA 4HK8A 1ZZ8A 5JZGC 5FPAA 4D8MA 3RS6A 1AR71 2VU9A 4A6SA 1ZRCA 4HPKA 4OLLA 5FZIA 1STMA 2RDQA 3J9SA 1BKZA 2W0XA 2VUDA 4JX0A 2AH2A 3M7AA 2X05A 2V4AA 4Q4W2 5CKNA 4HG6B 2RDSA 1HIXA 1VLNA 4XUQA 3HD8B 1K3IA 3J4UH 4AF9A 2W5FA 3NL1A 4N9HA 4NR1A 1ODNA 1PIV2 4XDOA 1G9AA 3KLSA 3MPBA 2J42A 4N53C 3LFMA 1Z7S1 4LBOA 5EJZB 1TMF3 2EALA 4FPYA 4XTMA 4QHBA 1VB4A 2ATFA 4UWDA 1EUUA 2VOKA 3WW1A 5FYCA 2E33A 4YLZA 4YVWA 3SH3A 4BISA 2JX9A 1GZTA 5GLZA 3PUQA 2W1UA 3UK9A 2JDZA 3C3VA 2ZGOA 4PIXA 4Q4X3 2DVBA 4AEJA 5B2GB 4Q4V3 1FYUA 2QQLA 4B4RA 3AMQA 3HQXA 5A1LA 3T08A 1H9WA 4GXLA 2QFEA 2W94A 1MZ5A 2WYFA 2ZXQA 4QDSA 3WQ7A 4NPMA 1ZA7A 2VUCA 4NN0A 4OI4A 3IBMA 1QJU2 1WD4A 2QQMA 3T4VA 2DURA 3USUB 4CXXA 5F3IA 4BE3A 3W5MA 3KMHA 3BTYA 3DEMA 3WDTA 5JWPA 2E26A 4META 1CAVA 4KGQA 1ZYBA 5F32A 2VVEA 2WO2A 3CU7A 1SG3A 4A7ZA 4ET7A 1QQP3 2D5FA 5BNOA 2FDHA 3HIFA 3IAPA 1ZZ7A 5KBFA 1AR92 3DYMA 3HVDA 4ZONA 1OF3A 5FIXA 4IE6A 4QMAA 5LBBA 3ZMNA 4NHKA 4XAAA 1R092 2Y26A 2ZPXA 3PUIA 4L11A 3B9CA 3BCWA 4BMEA 5I0DA 2QDNA 5FMOL 1AL0G 2JICA 3QACA 4DXTA 1PX4A 5F3EA 4RL7A 4XQWA 5FY4A 1ZZ6A 3POBA 3ZFEA 1K45A 2QQIA 1COV2 1SLBA 1UYZA 3O0VA 5J37A 2A5ZA 5FKCA 4QM9A 5FZ6A 4A7YA 4A3ZA 2FMYA 4GMP0 1GOHA 2E7AA 3IM0A 1X8EA 4RGAA 3IWZA 1ULOA 5DMYA 5JSOA 2D97A 1R1ZA 2WBKA 1RGSA 4IXLA 1RUJ2 4QKFA 1DGRN 4JQTA 5FREA 4WV8A 2CWMA 3OUHA 1ASJ2 1N3OA 4FFFA 2HWD2 2JG8A 3E5XA 4U36A 5GLWA 4EZHA 5FZBA 4QU1A 3VBOB 5SV5A 3H50A 4XDQA 1O7FA 5C7GA 4GULA 2V09A 3ZYFA 1W99A 3HQRA 2QUOA 3VBFB 3AP7A 1OVSA 2JDHA 2YUEA 4RHV3 4BZ4A 1RUC2 4LO8A 3WG3A 2A6WA 2ZEZA 3MW4A 2W1SA 1WMEA 2OKXA 3WUCA 1JYNA 2PHDA 4MGQA 2ARAA 2FMDA 3RYKA 4CCJA 3O7OA 4GWNA 2GNBA 4P9GA 3GF6A 5IATA 2XWJB 1GV9A 3OY8A 4MXWA 2K9ZA 5FUNA 1GNHA 5FUPA 3POJA 1US2A 1V9U2 5TSWA 3M8LA 1CPMA 4LNVA 4A3XA 1XE8A 4R9AA 2RVAA 4NHYA 1GQGA 5DDJ3 3DPRA 3U37A 1NLSA 1OQ1A 1W3VA 3NV2A 3AYEA 4NROA 2VVDA 4E27A 5AVAA 2YFZA 3PHMA 1ZBE3 1XU2A 3PU8A 2YC0A 1LOEA 3AKTA 3B7MA 3OG2A 4QQHA 3FJSA 4GA9A 4PCRA 4NIAA 5JMOA 4SLIA 2AEZA 1DQ0A 1CZSA 2YV8A 4BQ2A 3LWCA 4MGYE 1W8FA 3ON7A 4PJYA 4PDWB 3N7JA 1HB4A 4Z2WA 5EIYB 3T0BA 2BRTA 2EAKA 1W6PA 2OXBA 2QQNA 2YDEA 3H9AA 4AEDA 3ZYIB 4P9WA 3VD4A 3VZKA 3GBWA 1NA1B 4ISRA 1QOSA 5EYXA 3VBUC 2XGXA 2IZWA 2D6PA 3GBFA 4Y1UA 2XLAA 5IYYA 1AXZA 1X9TA 3LE0A 4OZOA 5L19A 2WJSA 4PHZA 3DPRB 1OFSA 1PX3A 3WP3A 2AZ5A 4U2AA 3VD5A 3ACIA 1QNYA 3A0NA 1ZRDA 2ZGLA 2BGOA 2K0GA 3NNFA 1YO8A 1SACA 4RHV1 2V72A 5A3WA 2W9XA 2BV4A 4URAA 5H9PA 4MGKE 3J7MA 1JOBA 5A7WB 2JECA 5A3NA 1LOFC 2JDUA 1HRV1 4JGYA 2LUWA 1R1A2 4XFAA 4QPGA 5FZKA 4AG4A 4V2VA 4L9BA 3GJBA 5EQUA 3UJQA 4K7JA 3IZOA 1IPKA 4CUGA 2BNNA 3HEIA 4HVQA 2YU2A 3IPVA 4FPOB 1UO9A 2ZGUA 4Z2AA 4YZ1A 1ENSA 4ZY9A 5JCTA 4KWUA 3MV01 2J1SA 2VZUA 5E1RA 1DFQA 2P37A 1YWKA 5L9BA 3AJZA 3DGTA 5CIRA 5LBFA 2Y0OA 3FMGA 5FO9B 4YGDA 3MIFA 1UPIA 5FRAA 3URFA 4LXLA 1NE6A 2DCZA 1A78A 4CEYA 5ISLA 3WDWA 1OA4A 3I2JA 5DUUA 5DXDA 5K0UA 4BXSV 3MICA 4OHXA 1W6OA 1IQAA 1YFYA 2E7TA 4HETA 4TSVA 1H6YA 1YUDA 1O3TA 1FPN3 1W03A 4TN7A 1KS5A 4ARYA 1TME1 1FAYA 2CNAA 1TNFA 1RUJ3 1UIJA 3ZN4A 3I2DA 5BNQA 2R072 4HKLA 4FPJA 5FMDA 4IV3A 1RUH1 2O0OA 2LS6A 2ZHNA 2QQVA 2YHJA 4INDA 2ET7A 4CUCA 4XXAA 1FOD3 3WY6A 1PGL2 1AXKA 1DG6A 2Y6KA 3NNLA 4IV3C 3KV6A 2N7GA 1S0DA 4Q2FA 5HXVA 1LKNA 1O5LA 2WL1A 3AKQA 5GALA 1H8VA 2ORXA 2WDBA 4XUNA 4BK5A 4EWDA 3S7IA 3SHRA 1ND3B 4QXBA 3ZSKA 1XYPA 1AR81 3OBRA 5JOWA 1RUF2 1SLTA 1DQ2A 4YVSA 1W6OB 2VOXA 3USSA 4JGZB 1V6IA 3O1OA 4AVTA 1X50A 1RUC1 4A6OA 1GFF2 1LJ7A 1JYXA 1LGBA 1XBFA 2B9VA 1X36A 1ZVFA 3H3ZA 4C1XA 2IFRA 2VZPA 4GMP1 4QXHA 4XFFA 4YZ3A 1BK1A 1GSLA 4P9YA 1IPSA 3I2KA 3RSJA 2BJSA 1LOAA 4Z82A 1YQCA 4QPYA 1XNKA 2VOWA 3PVBB 4CDXA 1C8M3 2JE8A
chains in the Genus database with same CATH topology
3WQBA 1W8NA 3SKVA 3HNMA 2VM9A 1JZ8A 2VZTA 5JXGA 3J7HA 2RJ2A 4M4PA 1W8OA 5LA0A 4JKKA 4QDRA 4OUEA 3CQOA 4FI9A 4M4RA 4P02B 5JXHA 3NRUA 3ETPA 2BBAA 4ZZ5A 2C4XA 2CDOA 4TTGA 4QB1A 5EJ1B 4XUOA 1JZ5A 3CZUA 3WNPA 1UY0A 4PQQA 1ULPA 3T0DA 2YFUA 2BZDA 3T2QA 1O8SA 2VMFA 3C7OA 2VL4A 4LPLA 2JKXA 1TVGA 3K4DA 3HNYM 1K42A 2J1AA 2J1VA 3FHQA 4KI5M 4P5YA 5DN2A 5CZKA 1TG7A 1OH4A 2VO5A 1F4HA 1W9SA 3ACHA 1NUKA 3THCA 2C9KA 1W0NA 1XNAA 4W8JA 2W87A 4DXRA 3WNLA 2J22A 5LCWL 3W5NA 3HN3A 4BK4A 2J1TA 1GQPA 1SHWB 4A45A 1CZTA 2W95A 3K4ZA 3I3BA 4QX2A 4UOJA 1O8PA 1DP0A 4D0QA 1UXXX 2V5DA 2QQJA 1JZ4A 1F4AA 4QPWA 4GWJA 2Y8KA 3OGSA 1W9TA 4XURA 1OT5A 4XUTA 4L0PA 3WSOA 2QQOA 4GZ9A 2DDUA 2WUHA 2VZQA 3NJXA 4ZXEA 1JZ3A 4MADA 3OEBA 1MPXA 2LW8A 4RYDA 3ACFA 3UESA 4A42A 3THDA 3VDAA 3SEPA 3VDBA 1XPWA 4DUXA 3A21A 5IFTA 2L9LA 3SKJE 2DCJA 2J7MA 2RV9A 2WO3A 3OB8A 4A41A 4CU6A 3EYPA 1GOFA 3WF2A 3C7HA 1UMHA 3BGAA 4QX3A 3T2PA 2J1UA 2JD9A 3E1F1 3MO4A 3K4AA 3CMGA 1H6XA 2XHNA 2XQXA 1L7RA 3GGLA 1I5PA 1YQ2A 3P6BA 2WYSA 3K77A 1JU4A 3CZJA 3BN6A 5LA1A 4BJ0A 4DUWA 4QDQA 1R64A 3I2HA 1DLCA 3CIHA 4OMDA 1D7PM 2WABA 3HNBM 2QQKA 4RN5A 2VCBA 3UETA 3WF0A 1UXZA 4KMQA 2JDAA 2R7EB 2WAOA 3DYPA 2X09A 1JZ2A 2WQ8A 4QB2A 1UZ0A 2KD7A 3IAQA 3NJVA 4ARXA 1UWWA 3FHAA 2W91A 2ZEWA 4XVHA 3A7QA 3GM8A 1UX7A 3I2IA 3I3EA 3DYOA 2W92A 3LEKA 2B4KA 3EB7A 1J83A 3K75B 2VMEA 3IDAA 4CU8A 4YPJA 2VR4A 2W46A 2W1QA 5B4XA 3LEIA 1KGYA 4XZUG 2ID4A 4DXSA 4AAXA 1RYYA 1W9WA 3OEAA 4JHZA 2C26A 5CYYA 5J1XA 2Y6LA 3OGVA 1UYXA 1UMIA 1K12A 4QAWA 2VZ1A 2X10A 3I2FA 4JKMA 3D3AA 1WCQA 1LNSA 2VJXA 3FL7A 4TXWA 5IHRA 2DCKA 4QX1A 4D8MA 3MBWA 4IUGA 2VC9A 3LEGA 4GWIA 1WKYA 4OMCA 4JX0A 1SDDB 2X05A 4DUVA 2YC2A 4HG6B 2ZEYA 1UY2A 4XUQA 1K3IA 5FUIA 2W5FA 5G05L 3OGRA 4DEQA 2VMDA 3CDZB 1GMMA 3T2OA 5EJZB 1JHJA 1EUUA 4P00B 2E33A 2WN2A 2XOMA 3P1IA 3MV11 2W1UA 3WEZA 2QQLA 3WNMA 5LA2A 3T08A 2W94A 3K46A 2ZXQA 4QDSA 2Y64A 4CVUA 2YC4A 2QQMA 2WO1A 5G04L 3DECA 3W5MA 2ORZA 2WN3A 1GNYA 2W47A 2VZOA 3VD3A 2E32A 2E26A 4LKSA 1CIYA 4A44A 2WO2A 1SG3A 1NAEA 3ACGA 4ET7A 3IAPA 4E8CA 3DYMA 3PUHA 1OF3A 2EIEA 3I2GA 4ZZ8A 3PUIA 5I0DA 5A1AA 4DXTA 1CX1A 1PX4A 2VZVA 2EICA 2WZEA 4PF1A 3VD9A 1K45A 2QQIA 2BGPA 1UYZA 3UNPA 1IQDC 2W1WA 4PT6A 4CU7A 4A3ZA 1GOHA 3ABZA 4QX0A 2VCAA 4OYUA 1ULOA 3A23A 5IJRA 2WBKA 5C70A 3HOBA 5DMYA 1GUIA 3C7FA 2PQSA 4E8DA 3A22A 2HLEA 5IFPA 2Z4FA 3I3DA 3C8XA 3I97A 5DQ0A 2HYXA 3WNNA 5C7GA 1W99A 3JXSA 3WF4A 2VZSA 1UYYA 1UY4A 4A4AA 4LQRA 2ZEZA 1GU3A 2W1SA 2OKXA 1JYNA 4MGQA 3LPFA 4UAPA 3ECQA 2QBXA 1XC6A 4MOAA 1US2A 3AC0A 2RVAA 3U37A 1JZ7A 4BDVB 2YFZA 3T09A 2WZ8A 3HJRA 3MUY1 4DEVA 4UI9L 1P8JA 1BHGA 3OG2A 5JMOA 3OBAA 1CZSA 1JU3A 3VD7A 5JR2A 4XUPA 5EIYB 4CUAA 3T0AA 3T0BA 3NNGA 2QQNA 2CDPA 3VD4A 2ZEXA 4CU9A 4MO3M 1OF4A 5IYYA 1NX9A 2VZ3A 2VMCA 3LE0A 4OZOA 3SEEA 3WNOA 1PX3A 3VD5A 3ACIA 3LPGA 2BGOA 5JUVA 2VCCA 5HXMA 4LHSA 3WF3A 5JXIA 2V72A 2W9XA 1UY3A 1OD3A 4CUBA 2YB7A 3WF1A 4QB6A 3HPNA 3VDCA 1KEXA 1EUTA 4AG4A 1JZ6A 3GXUA 3HEIA 2V4VA 4JKLA 2VQUA 4Z2AA 3FN9A 2VZRA 4W50A 4ZY9A 3NQHA 4KWUA 3MV01 1JI6A 2J1SA 2VZUA 3WNKA 3C7GA 2VTFA 1CZVA 1PMHX 3F2ZA 5C71A 2W3JA 1T2XA 3I2JA 4BXSV 1JYVA 1GOGA 1H6YA 2Y6HA 2VQTA 4ARYA 1US3A 1PMJX 1O59A 3C7EA 3CKHA 2EIBA 5DPNA 3IB3A 5HPOA 2LS6A 2XONA 4CUCA 1J84A 4P08A 2Y6KA 1L7QA 2Y6GA 3LQCA 5F7UA 1HN1A 2J1RA 1UY1A 2J1EA 2ORXA 2WDBA 4W4ZA 2EIDA 4XUNA 4BK5A 5B4NA 1XNTA 5JXJA 3IIIA 4MGSA 4A6OA 1JYXA 2B9VA 2BERA 2E31A 3MUZ1 2VZPA 2Y6JA 3GDBA 1JYWA 3ZM8A 3I2KA 1NKGA 1DYOA 2VOTA 2YG0A 2WAAA 2JE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WQB A;  1W8N A;  3SKV A;  3HNM A;  2VM9 A;  1JZ8 A;  2VZT A;  5JXG A;  3J7H A;  2RJ2 A;  4M4P A;  1W8O A;  5LA0 A;  4JKK A;  4QDR A;  4OUE A;  3CQO A;  4FI9 A;  4M4R A;  4P02 B;  5JXH A;  3NRU A;  3ETP A;  2BBA A;  4ZZ5 A;  2C4X A;  2CDO A;  4TTG A;  4QB1 A;  5EJ1 B;  4XUO A;  1JZ5 A;  3CZU A;  3WNP A;  1UY0 A;  4PQQ A;  1ULP A;  3T0D A;  2YFU A;  2BZD A;  3T2Q A;  1O8S A;  2VMF A;  3C7O A;  2VL4 A;  4LPL A;  2JKX A;  1TVG A;  3K4D A;  3HNY M;  1K42 A;  2J1A A;  2J1V A;  3FHQ A;  4KI5 M;  4P5Y A;  5DN2 A;  5CZK A;  1TG7 A;  1OH4 A;  2VO5 A;  1F4H A;  1W9S A;  3ACH A;  1NUK A;  3THC A;  2C9K A;  1W0N A;  1XNA A;  4W8J A;  2W87 A;  4DXR A;  3WNL A;  2J22 A;  5LCW L;  3W5N A;  3HN3 A;  4BK4 A;  2J1T A;  1GQP A;  1SHW B;  4A45 A;  1CZT A;  2W95 A;  3K4Z A;  3I3B A;  4QX2 A;  4UOJ A;  1O8P A;  1DP0 A;  4D0Q A;  1UXX X;  2V5D A;  2QQJ A;  1JZ4 A;  1F4A A;  4QPW A;  4GWJ A;  2Y8K A;  3OGS A;  1W9T A;  4XUR A;  1OT5 A;  4XUT A;  4L0P A;  3WSO A;  2QQO A;  4GZ9 A;  2DDU A;  2WUH A;  2VZQ A;  3NJX A;  4ZXE A;  1JZ3 A;  4MAD A;  3OEB A;  1MPX A;  2LW8 A;  4RYD A;  3ACF A;  3UES A;  4A42 A;  3THD A;  3VDA A;  3SEP A;  3VDB A;  1XPW A;  4DUX A;  3A21 A;  5IFT A;  2L9L A;  3SKJ E;  2DCJ A;  2J7M A;  2RV9 A;  2WO3 A;  3OB8 A;  4A41 A;  4CU6 A;  3EYP A;  1GOF A;  3WF2 A;  3C7H A;  1UMH A;  3BGA A;  4QX3 A;  3T2P A;  2J1U A;  2JD9 A;  3E1F 1;  3MO4 A;  3K4A A;  3CMG A;  1H6X A;  2XHN A;  2XQX A;  1L7R A;  3GGL A;  1I5P A;  1YQ2 A;  3P6B A;  2WYS A;  3K77 A;  1JU4 A;  3CZJ A;  3BN6 A;  5LA1 A;  4BJ0 A;  4DUW A;  4QDQ A;  1R64 A;  3I2H A;  1DLC A;  3CIH A;  4OMD A;  1D7P M;  2WAB A;  3HNB M;  2QQK A;  4RN5 A;  2VCB A;  3UET A;  3WF0 A;  1UXZ A;  4KMQ A;  2JDA A;  2R7E B;  2WAO A;  3DYP A;  2X09 A;  1JZ2 A;  2WQ8 A;  4QB2 A;  1UZ0 A;  2KD7 A;  3IAQ A;  3NJV A;  4ARX A;  1UWW A;  3FHA A;  2W91 A;  2ZEW A;  4XVH A;  3A7Q A;  3GM8 A;  1UX7 A;  3I2I A;  3I3E A;  3DYO A;  2W92 A;  3LEK A;  2B4K A;  3EB7 A;  1J83 A;  3K75 B;  2VME A;  3IDA A;  4CU8 A;  4YPJ A;  2VR4 A;  2W46 A;  2W1Q A;  5B4X A;  3LEI A;  1KGY A;  4XZU G;  2ID4 A;  4DXS A;  4AAX A;  1RYY A;  1W9W A;  3OEA A;  4JHZ A;  2C26 A;  5CYY A;  5J1X A;  2Y6L A;  3OGV A;  1UYX A;  1UMI A;  1K12 A;  4QAW A;  2VZ1 A;  2X10 A;  3I2F A;  4JKM A;  3D3A A;  1WCQ A;  1LNS A;  2VJX A;  3FL7 A;  4TXW A;  5IHR A;  2DCK A;  4QX1 A;  4D8M A;  3MBW A;  4IUG A;  2VC9 A;  3LEG A;  4GWI A;  1WKY A;  4OMC A;  4JX0 A;  1SDD B;  2X05 A;  4DUV A;  2YC2 A;  4HG6 B;  2ZEY A;  1UY2 A;  4XUQ A;  1K3I A;  5FUI A;  2W5F A;  5G05 L;  3OGR A;  4DEQ A;  2VMD A;  3CDZ B;  1GMM A;  3T2O A;  5EJZ B;  1JHJ A;  1EUU A;  4P00 B;  2E33 A;  2WN2 A;  2XOM A;  3P1I A;  3MV1 1;  2W1U A;  3WEZ A;  2QQL A;  3WNM A;  5LA2 A;  3T08 A;  2W94 A;  3K46 A;  2ZXQ A;  4QDS A;  2Y64 A;  4CVU A;  2YC4 A;  2QQM A;  2WO1 A;  5G04 L;  3DEC A;  3W5M A;  2ORZ A;  2WN3 A;  1GNY A;  2W47 A;  2VZO A;  3VD3 A;  2E32 A;  2E26 A;  4LKS A;  1CIY A;  4A44 A;  2WO2 A;  1SG3 A;  1NAE A;  3ACG A;  4ET7 A;  3IAP A;  4E8C A;  3DYM A;  3PUH A;  1OF3 A;  2EIE A;  3I2G A;  4ZZ8 A;  3PUI A;  5I0D A;  5A1A A;  4DXT A;  1CX1 A;  1PX4 A;  2VZV A;  2EIC A;  2WZE A;  4PF1 A;  3VD9 A;  1K45 A;  2QQI A;  2BGP A;  1UYZ A;  3UNP A;  1IQD C;  2W1W A;  4PT6 A;  4CU7 A;  4A3Z A;  1GOH A;  3ABZ A;  4QX0 A;  2VCA A;  4OYU A;  1ULO A;  3A23 A;  5IJR A;  2WBK A;  5C70 A;  3HOB A;  5DMY A;  1GUI A;  3C7F A;  2PQS A;  4E8D A;  3A22 A;  2HLE A;  5IFP A;  2Z4F A;  3I3D A;  3C8X A;  3I97 A;  5DQ0 A;  2HYX A;  3WNN A;  5C7G A;  1W99 A;  3JXS A;  3WF4 A;  2VZS A;  1UYY A;  1UY4 A;  4A4A A;  4LQR A;  2ZEZ A;  1GU3 A;  2W1S A;  2OKX A;  1JYN A;  4MGQ A;  3LPF A;  4UAP A;  3ECQ A;  2QBX A;  1XC6 A;  4MOA A;  1US2 A;  3AC0 A;  2RVA A;  3U37 A;  1JZ7 A;  4BDV B;  2YFZ A;  3T09 A;  2WZ8 A;  3HJR A;  3MUY 1;  4DEV A;  4UI9 L;  1P8J A;  1BHG A;  3OG2 A;  5JMO A;  3OBA A;  1CZS A;  1JU3 A;  3VD7 A;  5JR2 A;  4XUP A;  5EIY B;  4CUA A;  3T0A A;  3T0B A;  3NNG A;  2QQN A;  2CDP A;  3VD4 A;  2ZEX A;  4CU9 A;  4MO3 M;  1OF4 A;  5IYY A;  1NX9 A;  2VZ3 A;  2VMC A;  3LE0 A;  4OZO A;  3SEE A;  3WNO A;  1PX3 A;  3VD5 A;  3ACI A;  3LPG A;  2BGO A;  5JUV A;  2VCC A;  5HXM A;  4LHS A;  3WF3 A;  5JXI A;  2V72 A;  2W9X A;  1UY3 A;  1OD3 A;  4CUB A;  2YB7 A;  3WF1 A;  4QB6 A;  3HPN A;  3VDC A;  1KEX A;  1EUT A;  4AG4 A;  1JZ6 A;  3GXU A;  3HEI A;  2V4V A;  4JKL A;  2VQU A;  4Z2A A;  3FN9 A;  2VZR A;  4W50 A;  4ZY9 A;  3NQH A;  4KWU A;  3MV0 1;  1JI6 A;  2J1S A;  2VZU A;  3WNK A;  3C7G A;  2VTF A;  1CZV A;  1PMH X;  3F2Z A;  5C71 A;  2W3J A;  1T2X A;  3I2J A;  4BXS V;  1JYV A;  1GOG A;  1H6Y A;  2Y6H A;  2VQT A;  4ARY A;  1US3 A;  1PMJ X;  1O59 A;  3C7E A;  3CKH A;  2EIB A;  5DPN A;  3IB3 A;  5HPO A;  2LS6 A;  2XON A;  4CUC A;  1J84 A;  4P08 A;  2Y6K A;  1L7Q A;  2Y6G A;  3LQC A;  5F7U A;  1HN1 A;  2J1R A;  1UY1 A;  2J1E A;  2ORX A;  2WDB A;  4W4Z A;  2EID A;  4XUN A;  4BK5 A;  5B4N A;  1XNT A;  5JXJ A;  3III A;  4MGS A;  4A6O A;  1JYX A;  2B9V A;  2BER A;  2E31 A;  3MUZ 1;  2VZP A;  2Y6J A;  3GDB A;  1JYW A;  3ZM8 A;  3I2K A;  1NKG A;  1DYO A;  2VOT A;  2YG0 A;  2WAA A;  2JE8 A; 
#chains in the Genus database with same CATH topology
 5APA A;  3UJO A;  4QPG C;  2GP3 A;  1JZ8 A;  5IK8 A;  3VV1 A;  2RJ2 A;  1CES A;  2R06 1;  1OOP C;  2QVS B;  2HWC 1;  4QDR A;  4ATE A;  4M0N A;  4XIL A;  2BUK A;  4KNC A;  3RI9 A;  4HFS A;  3WDU A;  4FI9 A;  1WMX A;  2NLR A;  4I01 A;  4P02 B;  5JXH A;  4LLF A;  1N1S A;  4JTO A;  2ADE A;  5L7O C;  3EBR A;  2BNM A;  2LRO A;  3POE A;  4IV1 A;  4GAZ A;  3RI8 A;  3M4F A;  3KB5 A;  3UKV A;  3UYJ A;  4CEY B;  1QHD A;  4QB1 A;  4RR3 A;  3DXT A;  1VB2 A;  3LSD A;  2VQA A;  4B1L A;  5GZG A;  4HLT A;  1PIV 3;  5A3M A;  2Y6F A;  1UU4 A;  1HQN A;  2RE9 A;  3WNP A;  1AYM 2;  1ULP A;  3Q8B A;  5FKB A;  1RMU 3;  1HW5 A;  3CF6 E;  2BZD A;  2P34 A;  4LKE A;  1G8W A;  3RGB A;  3U11 A;  1W2U A;  1F35 A;  4MG2 A;  4I02 A;  2WKK A;  1U0A A;  2BTV C;  3VKN A;  1PGW 1;  4XFC A;  2DVD A;  5FZD A;  4CCK A;  5FYM A;  2WR9 A;  1TVG A;  4DIQ A;  4HMZ A;  4N43 B;  2J1A A;  3IN9 A;  2ZKL A;  4YRD A;  2SBA A;  4P5Y A;  2VNV A;  1G9C A;  4Y1X A;  2VVF A;  1R09 1;  1BXH A;  3R05 A;  4LJH A;  2VO5 A;  2R0H A;  1N3Q A;  5FZO A;  3ACH A;  1JXN A;  3JD7 3;  4AFC A;  3THC A;  2WZP P;  4Y33 A;  1W0N A;  2W87 A;  1PK6 A;  3VBF A;  3HR9 A;  4DXR A;  1O5U A;  2WWJ A;  5F1R A;  2RJK A;  2J1T A;  2ZGR A;  2Q1Z B;  5CFC B;  4UFI A;  2W95 A;  3K4Z A;  4D6Q A;  3AP6 A;  1JN2 P;  1WLD A;  3U1X A;  4CCN A;  1RUJ 1;  4IE4 A;  4JGY C;  4UOJ A;  2GMP A;  5BUV A;  4D0Q A;  5CAD A;  4AR2 A;  2WZR 3;  2RR1 1;  4KWK A;  4WVM B;  1F4A A;  1ONA A;  2D6K A;  3MW2 A;  4KWJ A;  2XJP A;  2P4E A;  4QPW A;  4UFH A;  3RMX A;  3VLB B;  3WDY A;  2VPV A;  2WQ4 A;  3CJI C;  4AWD A;  5DUV A;  5C9A C;  3KCY A;  1POV 1;  3BOW A;  3N36 A;  1GAN A;  1WGP A;  5EYY A;  1R08 3;  1BJQ A;  5C3P A;  1PO2 3;  1UCX A;  3KT4 A;  3ZFF B;  1COV 1;  4WM8 C;  1W2T A;  3NKT A;  1Q8O A;  2DU0 A;  1PZ9 A;  4HSJ A;  4K8R B;  2ERF A;  2MEV 1;  1I3H A;  4A42 A;  2ETE A;  1VAL A;  3RZZ A;  4NIH A;  3SEP A;  1Y9G A;  3OYW A;  4XZP A;  5L9R A;  5C5U A;  3VDB A;  1XPW A;  5KR7 A;  3AZV A;  3A21 A;  5IFT A;  1DQ5 A;  4QKN A;  5CG9 A;  2A70 A;  4AGG A;  1TQ5 A;  2DFB A;  1AR6 2;  2DCJ A;  3ZKY A;  5ERL A;  2WO3 A;  4BIO A;  5IK7 A;  2ZMN A;  1NA1 A;  4A41 A;  1Y9Q A;  4P9X A;  1WW7 A;  1Y9M A;  1RHI 3;  1HRI 3;  3EYP A;  4FPF A;  1AR6 3;  4I0B A;  1OHF A;  4JGZ C;  4LEJ A;  4QQP A;  3T4H B;  4C8D A;  5FDB A;  3ZR5 A;  3RZK A;  4HXC A;  4OHZ A;  5J36 A;  5IVJ A;  2ZHK A;  3T2P A;  2J1U A;  2P3K A;  5C6C A;  2D7F A;  5FZ3 A;  1UU5 A;  3CMG A;  3AVS A;  3K4A A;  5T54 A;  1W8Z A;  1M4W A;  3V56 A;  1XQN A;  2XQX A;  5FZ9 A;  1BEV 3;  1L7R A;  2A6Y A;  2HWE 2;  1HKD A;  3KVA A;  3N7M A;  4Y3O A;  5L73 A;  5J98 B;  1WW6 A;  3HMY A;  1HXS 1;  4Q0P A;  5C9A B;  4AVB A;  1VBA 3;  4XJW A;  4AFA A;  5D2A A;  3GAL A;  2HWE 1;  2WYS A;  4QPG B;  5I0T A;  5CFD B;  3K77 A;  1JU4 A;  1QY4 A;  4XTP A;  3BN6 A;  4AVC A;  1ULG A;  4DUW A;  4Z8B A;  1YFW A;  3WHU A;  1N1T A;  2FHR A;  2R1D A;  2YGM A;  3I2H A;  3KQ4 B;  5BXX A;  2WZR 2;  5FZL A;  3ZO0 B;  4ERO A;  4HSL A;  1NQD A;  5HCH A;  4CCO A;  4FFI A;  3PJQ A;  1VBE 2;  1D7P M;  1PZ7 A;  4CEW C;  1RED A;  4JQR A;  4M00 A;  4NMI A;  3ZMO A;  4IV1 C;  4OHW A;  5JIU A;  1QOO A;  4PDW A;  4PIZ A;  1FI2 A;  2GND A;  2JDY A;  2Y60 A;  4WVW A;  3RWN A;  5JR7 B;  3DYP A;  3NJZ A;  1JYC A;  4OZX A;  4CP0 A;  3U4S A;  4LO7 A;  1XSQ A;  4QB2 A;  1VBB 3;  1D4M 2;  3IAQ A;  1ND3 C;  4UF0 B;  4COY A;  4YM3 A;  4CEY C;  4HN0 A;  3OD4 A;  3FHA A;  1FV3 A;  2ZEW A;  5LZ6 A;  1YIF A;  1ULC A;  4FXK B;  3B93 A;  5FO8 B;  5EXO A;  1RXF A;  2G9G A;  3FFZ A;  4EN6 B;  1HRI 1;  1I6X A;  3LZZ A;  2JG9 C;  3W21 A;  3DYO A;  5FY9 A;  3SLI A;  2B4K A;  3B94 A;  1RVF 3;  5A7W A;  4CU8 A;  4MUV A;  4D7Y A;  4YPJ A;  1S2B A;  3PIG A;  2OYZ A;  4EN7 B;  3LF7 A;  4LBQ D;  1DQ6 A;  3MZH A;  1LES A;  4LA3 A;  3KQR A;  5BNO C;  1FX5 A;  3KGZ A;  5E89 A;  1NZI A;  1JYI A;  3AFG A;  5ACA 1;  1PVX A;  5FYZ A;  3LA3 A;  1RYY A;  3OEA A;  4JHZ A;  5J1X A;  5CYY A;  1WMD A;  4COV A;  5C3R A;  3OGV A;  1UYX A;  2AEN A;  2CSG A;  2JKB A;  2RS3 3;  5FK8 A;  4ASK A;  4GB3 3;  2X10 A;  5IVC A;  4DO0 A;  3AVR A;  4ASM B;  2WO7 A;  1LNS A;  3Q8A A;  5SV8 A;  2JG9 B;  2QE3 A;  1GIC A;  1PNF A;  3I49 A;  1JOJ A;  1W6Q B;  2WWU A;  2DFC A;  1C8M 2;  3I4I A;  1EPZ A;  4NRP A;  3SH4 A;  3JZV A;  2B5H A;  1YNA A;  1XYN A;  4IUG A;  1E5H A;  5BNN B;  3J8F 1;  4E4Z A;  1WKY A;  4QXC A;  2AUY A;  2VW1 A;  4YW1 A;  3GCX A;  4N9I A;  1MAC A;  4NAO A;  4BOW A;  1AF9 A;  1VBE 1;  4Y24 A;  5FUI A;  5IK5 A;  1GBG A;  5G05 L;  2VMD A;  2YRO A;  4AQ2 A;  5F9T A;  1PGL 1;  1ST8 A;  1LOG A;  3K3O A;  4IEZ A;  1NCR B;  2NPI A;  1IG3 A;  1W6N B;  3O5S A;  1OOP A;  5DAQ A;  5DUX A;  2EAA A;  3NST A;  3T2O A;  1W8W A;  1PO1 1;  5FR3 A;  3PNA A;  1UL9 A;  3V65 A;  1JYT A;  3KHB A;  3VBU B;  4URT A;  1HXS 3;  4XCB A;  3NNJ A;  3H0O A;  4QGL A;  2FDG A;  2LAL A;  5J96 B;  3SCG A;  1G86 A;  1O3Q A;  4FPK A;  1JOP A;  4HKW A;  1CAW B;  4BQW A;  3R4U A;  4Q26 A;  1RUN A;  5HCA A;  3WNM A;  1OMI A;  2RS1 3;  3ILN A;  2XHK A;  1ZX5 A;  2GAL A;  2DUO A;  3KZ4 C;  3BU0 A;  4QPI A;  2IVI B;  5K4L A;  4CVU A;  4JCK A;  4AFM A;  1BQP A;  1NY7 1;  2YXS A;  3VL8 A;  3MID A;  4PBO A;  5G04 L;  2Q30 A;  2R04 1;  3DEC A;  1J3R A;  5IUQ A;  3VZM A;  2WN3 A;  3H8O A;  2W47 A;  2VZO A;  5FYI A;  3ATG A;  5LBC A;  3VD3 A;  4B29 A;  4LKS A;  4Y26 A;  1LED A;  5A32 B;  1DYP A;  1B09 A;  3R4S A;  3VZL A;  1NAE A;  4FFH A;  5CU1 A;  2RS5 2;  4AHY A;  5FK7 A;  1OA2 A;  2EIE A;  4HL0 A;  4IEX A;  1OI6 A;  2EVX A;  1KS4 A;  2ZCW A;  1VBD 1;  3HT1 A;  4LR4 A;  5K7P A;  2BU9 A;  4ZZ8 A;  2E6V A;  3BB6 A;  1DGR A;  3K3N A;  5A1A A;  4E4H A;  2A71 A;  2OUJ A;  1CAW A;  1ZRF A;  2FDK A;  4LBL A;  2D93 A;  4PF1 A;  1EYB A;  1W2A X;  3DN7 A;  3HQU A;  2PLV 1;  4J1X A;  2BGP A;  3DXU A;  4K1Z A;  4PLN A;  2UWC A;  4YGC A;  5FY0 A;  3UNP A;  1NYW A;  1Q5O A;  4FOQ A;  5HV0 A;  1QJZ A;  4RGK A;  2E7Q A;  2A6Z A;  3G6J B;  4LHN A;  4YZ5 A;  2A3W A;  3ABZ A;  1C8M 1;  5FMC A;  2VCA A;  2VMG A;  2RG4 A;  1BBT 1;  1PO1 3;  2W68 A;  1NE4 A;  3A23 A;  3HOB A;  5IJR A;  1U5Z A;  1GUI A;  5E6H A;  4QU2 A;  2Q8C A;  1CAU B;  1CIW A;  3ZVX A;  3A22 A;  4E8D A;  4NHL A;  5LK7 B;  5JPM B;  5DAV A;  2PQQ A;  2WNE A;  5IFP A;  1J59 A;  1TME 3;  2Z4F A;  1N1Y A;  1OKQ A;  2PHW A;  1HRI 2;  2QTW B;  3I3D A;  4LIT A;  2XBO 2;  5AC9 2;  4Q4V 1;  1KXG A;  5AFE A;  3ZSJ A;  2C5D A;  1JUH A;  1B35 C;  3W9A A;  2VOV A;  4NE9 A;  1BYH A;  4CP9 B;  5C8C A;  5CFC C;  3WF4 A;  2PMW B;  5DG1 A;  3N9M A;  5T5L A;  3D0J A;  3R6S A;  3QD6 A;  4NHM A;  2HH9 A;  1DGL A;  5F6L B;  4Q8L A;  4CDQ A;  3KF5 A;  2ZAH A;  3H3U A;  1SBD A;  4WVV A;  3ECQ A;  1AR7 2;  1VAK A;  3VBF C;  3KM5 A;  2E9Q A;  1RUE 1;  2QZ3 A;  5FZ4 A;  3D5O A;  4MOA A;  4LKD A;  4ZXK A;  4I0W B;  2JDN A;  3FE5 A;  5L7O A;  5FY1 A;  5JI7 A;  2K46 A;  3ZFF C;  4NRQ A;  4LBN A;  1UKR A;  5BNP B;  2JD4 A;  1UZV A;  5HCF A;  3QCW A;  1X7N A;  4AVA A;  3ACL A;  1FAT A;  2IC1 A;  3NW4 A;  3VUO A;  3S7E A;  1LHN A;  1S0J A;  3T09 A;  2OS2 A;  3HJR A;  3GZT B;  4UI9 L;  2OZ6 A;  2AR6 A;  2P6C A;  3M3E A;  5GZE A;  5IWF A;  3ZFE C;  3NVC A;  1BHG A;  4LE3 A;  5CEH A;  4OHY A;  1GZW A;  2XXZ A;  3JD7 1;  4DRV A;  3NAP B;  4YSF A;  5KXB A;  5F5C A;  2BBV A;  1PGS A;  4BQY A;  3KGL A;  3BAL A;  3PVO A;  3OBA A;  3VBH C;  1V6O A;  3OYW B;  1OBN A;  4RS5 B;  3L2Y A;  4J25 A;  4O65 A;  5JR2 A;  2NP0 A;  3AMN A;  4DOU A;  4LT5 A;  4YW6 A;  4XUP A;  3POI A;  3VBS C;  1W2O A;  2R06 2;  4AI9 A;  4CU9 A;  3PDQ A;  1Y3T A;  4CDU C;  2OA2 A;  1UOJ A;  4XF3 A;  1NX9 A;  3Q8F A;  5T5P A;  1FOD 1;  2VMC A;  4YWA A;  4XQ4 A;  4CPB A;  4CDU A;  4XF4 A;  2YYO A;  2ZAB A;  4YM0 A;  2ZGP A;  1R1A 1;  5CKM A;  5JXI A;  3WF3 A;  1XRU A;  1RUG 1;  1RMU 1;  2EF6 A;  2Y38 A;  4B1M A;  1YYN A;  2AYH A;  2XKP A;  3LSE A;  5E16 A;  1LCL A;  1SFY A;  4CUB A;  2F6B A;  1MVQ A;  2ADD A;  1E5I A;  1RMU 2;  2H6C A;  5DAP A;  3H7Y A;  3HPN A;  4L97 A;  1KEX A;  4X8N A;  4QKD A;  1EV1 3;  1EUT A;  2I45 A;  3GXU A;  4Q0S A;  4LHL A;  4BIF A;  1PK6 C;  4EWE A;  3FN9 A;  3ZFG B;  2VZR A;  4WZC A;  4W50 A;  2R04 2;  3VKF C;  4Z1V A;  5KHJ A;  1KFU L;  2VNG A;  4QM8 A;  4QX8 A;  2YMZ A;  1R09 3;  3N35 A;  1KJL A;  3C7G A;  1RUI 1;  4F83 A;  4BA6 A;  3WG4 A;  2BW8 A;  1IS5 A;  1RUO A;  2O8Q A;  5FZ0 A;  1PMH X;  1C57 A;  4YVS C;  5A33 A;  3I54 A;  5C71 A;  1A34 A;  2W3J A;  4UF0 A;  2O14 A;  3KT7 A;  5FFO C;  5F37 A;  3V0B A;  3AP9 A;  2ZGS A;  4M0H A;  5FLH A;  3ZN6 A;  5A7P A;  4AOC A;  3GCW A;  5A3T A;  4CCE A;  1DBN A;  4DXZ A;  5A3L A;  2HBT A;  3GZU C;  1KIT A;  5DUW A;  3N3H A;  3PTR B;  1VBA 1;  4Y5T A;  5C3S A;  3N9L A;  2EIB A;  1SBF A;  4RFT 0;  5DPN A;  3IB3 A;  2YBK A;  5FTT C;  2XON A;  1KDM A;  4XW3 A;  3AX4 A;  2G4I A;  1PM7 A;  1MS3 A;  1PO2 1;  1L7Q A;  3N7K A;  1KJR A;  1MQT C;  4HPK B;  3WOG A;  2Y6G A;  3IMN A;  4RGG A;  4D3W A;  5C5T A;  1ALY A;  3V0A A;  3PTY A;  2A1X A;  3BU7 A;  2IXJ A;  2XML A;  1UY1 A;  2IWG B;  3O1S A;  5FLI A;  2OQ7 A;  1XNC A;  1H8T B;  1W6M A;  1HB2 A;  3S5Q A;  3NV1 A;  5B4N A;  2MEV 3;  4HOO A;  2PN5 A;  1Z78 A;  3EQE A;  4M3C A;  2KM2 A;  1CD3 G;  3III A;  3VHO A;  1XE0 A;  2JDK A;  1GP6 A;  1W0P A;  2A3Y A;  1LAJ A;  5JPN B;  3I8T A;  3JB4 C;  4MGS A;  4CDW A;  1ND2 C;  4KL1 A;  3SQO A;  3BPZ A;  5FXV A;  1QH7 A;  4IES A;  4XF9 A;  3J7N A;  1J1L A;  1W05 A;  3BOP A;  1NKG A;  2Z69 A;  3EO6 A;  1F5F A;  2VAU A;  4YFZ A;  5JOY A;  2VOT A;  2ZGQ A;  1F31 A;  3U10 A;  5JZG A;  2VG9 A;  1XJA A;  2DYC A;  1RUE 2;  1FPN 2;  2WAA A;  4TWT A;  3WX5 A;  1LOF A;  3GJA A;  1W8N A;  3OPT A;  3SKV A;  1H30 A;  5JI9 A;  2VM9 A;  1D2Q A;  5JXG A;  2XVL A;  3FC0 A;  1W8O A;  5I0R A;  2WT1 A;  3OPZ A;  3RVH A;  5LA0 A;  3CQO A;  3GZE A;  4IEQ A;  3M1H A;  4AW7 A;  2PAM A;  1VMJ A;  4FQ4 A;  2HWB 2;  1JW6 A;  2YGL A;  3NRU A;  4RQP B;  3ETP A;  4R9D A;  1QMJ A;  1FMD 1;  5FZ7 A;  4RD7 A;  2ZX4 A;  3CJX A;  4L92 A;  2CY6 A;  2PA7 A;  3VB9 A;  5GZC A;  3WDX A;  2K2S A;  1OOP B;  4XUO A;  3VHR A;  1RUH 3;  3OUI A;  3E6C C;  3M3I A;  5ABJ A;  3ZN6 B;  4S2G A;  4MGI E;  5CKQ A;  5FZM A;  2WLQ A;  1UY0 A;  1O4T A;  3QLQ A;  1FXZ A;  4LBK A;  4YG3 A;  2ZX3 A;  3LAG A;  4F3J A;  4CDX B;  4BWO A;  1HX6 A;  3ME2 A;  4KBB A;  2Q1M A;  5FZG A;  5T5J A;  3P3N A;  4WBB A;  3C7O A;  3O1P A;  3POS A;  2JKX A;  3AL6 A;  2Y0I A;  2E53 A;  1W9F A;  1DCS A;  1AR7 3;  3DCQ A;  3LDB A;  4QHO A;  3MW3 A;  4X6Q B;  4XC9 A;  3T3Y A;  3Q8E A;  1VBD 2;  1OH4 A;  3USU A;  3B9I A;  1KD7 A;  3OPW A;  1UF2 C;  1UKG A;  4XJU A;  5FPZ A;  4B4Q A;  5IAX A;  1DU3 D;  3CNA A;  1BMV 1;  3FWE A;  3PJY A;  5I8T A;  1H1A A;  2CL2 A;  2C9K A;  1V70 A;  4QHZ A;  4BXF A;  3WNL A;  2J22 A;  1LB2 A;  2QZ2 A;  3Q9O A;  3W5N A;  4BK4 A;  1GQP A;  1ZBA 3;  3BI3 A;  4R4X A;  1SHW B;  4A45 A;  3SIS A;  3NV3 A;  4E2S A;  4CP1 A;  3I3B A;  1RB8 G;  1UQX A;  5CIS A;  2GU9 A;  3WNX A;  1ND2 A;  2R49 A;  4O7X A;  3LOI A;  4XF0 A;  2QQJ A;  2WFF 3;  1Y43 B;  4Q4W 1;  1QXP A;  3CLP A;  2JG8 C;  4ZU4 A;  5BNP A;  3D82 A;  2DVG A;  2XJT A;  3MGU A;  2VBD A;  3I59 A;  4UT5 A;  4L0P A;  1PHM A;  3PVN A;  4GZ9 A;  3TNP B;  2VZQ A;  3THP A;  4MAD A;  1CAU A;  4XE9 A;  2QKD A;  2VBB A;  5FPL A;  3BPS A;  3UES A;  2AC1 A;  4KH9 A;  4QD2 A;  4Y1Z A;  3VDA A;  4XBN A;  3RYP A;  5IW0 A;  4QKB A;  2B9U A;  1VBB 1;  2UWA A;  3FLP A;  1QJY 3;  4BPZ A;  1NZC A;  4DUX A;  2JG8 B;  2DTW A;  1RUC 3;  4HON A;  2EXH A;  4RHV 2;  1OLR A;  3VBO A;  3IT8 A;  1LGN A;  2J7M A;  4BQ4 A;  2DTY A;  3J8F 3;  1HDK A;  1MQT B;  5FP9 A;  3BYW A;  1GOF A;  2OQ6 A;  3TAY A;  4GMP 3;  4AI8 A;  3C7H A;  3ORJ A;  5FZF A;  1OUX A;  1SLL A;  1UMH A;  1ASJ 3;  1QJF A;  3U4X A;  5FP3 A;  3E1F 1;  4LBQ A;  3POW A;  1DDL A;  1AXY A;  4LA2 A;  2XHN A;  3D8C A;  5JOZ A;  2VNO A;  3B69 A;  3LKJ A;  4AQT A;  1WMF A;  4MHR A;  5A6Z A;  1W8H A;  5A7Q A;  1YQ2 A;  2R06 3;  1H2N A;  1S0B A;  5L9V A;  1LEC A;  1RUG 2;  2D6N A;  3GHN A;  5FYU A;  3ZX7 A;  4BQX A;  1CGP A;  2D44 A;  3W58 A;  5LA1 A;  1GZW B;  2WFF 1;  5T5O A;  3EJK A;  2ZZQ A;  1NCQ C;  1QEX A;  2VXJ A;  4QDQ A;  3POG A;  3EMR A;  1DLC A;  3MIG A;  4FOW A;  3CIH A;  3U75 A;  3ZPY A;  1UIK A;  4CSW A;  2BEO A;  4OMD A;  5K9Y A;  3THT A;  3QH7 A;  2OT7 A;  1VBC 1;  4AZZ A;  2QQP A;  2CWS A;  1ZZB A;  2QQK A;  2VCB A;  3UET A;  3WF0 A;  1ND2 B;  5KC5 A;  1QDO A;  4JDM A;  4AI3 A;  5LWB A;  3KD4 A;  2A6X A;  2B46 X;  2R7E B;  4W6Y A;  4XEZ A;  3DUI A;  2X09 A;  3DL3 A;  2WQ8 A;  4HT1 T;  2R16 A;  4X6R B;  4XMA A;  3ZSE A;  1UZ0 A;  1LTE A;  1ZZ9 A;  2ARB A;  3NJV A;  3L9J T;  5BPX A;  4ARX A;  1UWW A;  1J58 A;  2WLP A;  1HRV 2;  1S2E A;  3EXU A;  3LA2 A;  5EV7 A;  3R4D B;  5LAS A;  1K5M B;  3E5Q A;  1LR5 A;  4E9K A;  3SIT A;  1BK0 A;  2GME A;  4KGG A;  2XR4 A;  4FP2 A;  3OSD A;  4CDX C;  1DGW X;  1ULF A;  1F2N A;  1D4M 1;  1TMF 1;  2RS3 2;  2CYF A;  3EB7 A;  1GKB A;  2WNU B;  3KCC A;  2VME A;  4J1W A;  3IDA A;  2P6H A;  1AHS A;  2VR4 A;  1O6U A;  2XBO 3;  3MLL A;  2W46 A;  4CPB D;  5AC9 3;  1HV0 A;  4NHX A;  1ZBA 1;  2RM2 3;  4CDW C;  1MS1 A;  1SEF A;  2GMM A;  1KGY A;  3LEI A;  2IXH A;  1G9D A;  2RMU 2;  4NJ4 A;  1O4Y A;  3VBO C;  5A6Q A;  3LGR A;  5CBL A;  3AZW A;  1MVE A;  1WZX A;  3ZFG A;  4M3C B;  1Y4W A;  1C5H A;  4AAX A;  4DXS A;  3TN9 1;  4PQ9 A;  3WP4 A;  4Q4W 3;  3VKL A;  5A33 B;  1JHN A;  2VW2 A;  2XPJ A;  1VAM A;  4AVS A;  2CU5 A;  2BVV A;  4P14 A;  2NMN A;  2XJV A;  4CDQ C;  1UMI A;  4JDN A;  4QAW A;  1OPO A;  3MPP G;  1O3R A;  3I2F A;  4JKM A;  3D3A A;  2PHU A;  5C9A A;  1G6N A;  1U5I A;  5FCC A;  3TRS B;  5A6Y A;  5C8C C;  4FOV A;  2D3S A;  1RJ7 A;  2VJX A;  3OUJ A;  3BTZ A;  3ENR A;  2P3J A;  1ULE A;  1QKQ A;  2DCK A;  1S0G A;  3CO2 A;  4QX1 A;  1F8V A;  2VC9 A;  4M3C E;  3AMM A;  5KHH A;  4DZG A;  1W0O A;  4DS0 A;  2RDR A;  4GWI A;  4YW7 A;  4EN9 B;  2B42 B;  5ANQ A;  3TBD A;  1RUD 1;  5F39 A;  4C91 A;  5DAB A;  1SDD B;  1AR6 1;  2I2S A;  5FO7 B;  2A6V A;  1ZBE 1;  2Q8D A;  2BYV E;  3ZYP A;  5KXC A;  2ZEY A;  1UY2 A;  4AQ6 A;  3SCF A;  3LCP A;  3K48 A;  4DEQ A;  3OGR A;  3CDZ B;  1X82 A;  1GMM A;  4RFR B;  1OVP A;  1QWR A;  4AI1 A;  4AGV A;  2RS1 2;  3BIW E;  2Y34 A;  3WW3 A;  2D98 A;  1QH6 A;  1H1I A;  3BUC A;  3AXD A;  2BOJ A;  4P00 B;  5CB7 A;  3NKG A;  3MV1 1;  5FPB A;  2XVK A;  1KQR A;  3ZXA C;  3AYD A;  3D0S A;  1HXS 2;  2YBS A;  3MIB A;  5A3O A;  1J3Q A;  3VBS B;  3D4K A;  3ST7 A;  3GZA A;  3P5B A;  4S2H A;  3LOB A;  1AX1 A;  1XU1 A;  4Q5O A;  1G9F A;  3K46 A;  1IZ3 A;  3PUS A;  4H3W A;  1X8M A;  5A7O A;  2GNM A;  2YC4 A;  2RMU 3;  1SCR A;  2WO1 A;  4KWL A;  5FYS A;  1GP4 A;  1C1L A;  1AJK A;  3NNM A;  2AEY A;  4BM8 A;  5I91 A;  1GNY A;  2C6S A;  4BH9 A;  2E32 A;  3HWJ A;  1CIY A;  4ORF A;  5C4W C;  4DQA A;  4XF1 A;  3ZN5 A;  5D8A C;  2PHF A;  4FSJ A;  1YHF A;  3H8X A;  3O1V A;  4QQO A;  4E8C A;  4E4S A;  1OPM A;  1YFX A;  3AZX A;  3PUH A;  4AHX A;  3Q8C A;  4IV1 B;  2DCY A;  3V0A B;  2NYY A;  5EP9 A;  2X53 S;  1E57 A;  3WHT A;  5FMB A;  4Q4Y 1;  5BV6 A;  2XJR A;  3ZLI A;  1DZR A;  3X29 B;  4FTS A;  2XL9 A;  2UY8 A;  1CJD A;  1VMH A;  5ABJ B;  4XJA A;  5FOB B;  2X5I B;  1CX1 A;  2XB6 C;  2EIC A;  4IDZ A;  3WCR A;  3S5A A;  4Q1P A;  5LW9 A;  1QGL A;  1SLA A;  3N4M A;  1GLH A;  4YW4 A;  1R08 2;  1IQD C;  1MZF A;  1W8T A;  4LMF A;  4PT6 A;  4IGO A;  5J09 A;  1UYP A;  4EZ4 A;  5C8W A;  3WW2 A;  2HWF 1;  2ZGM A;  2PAE A;  1HQW A;  2V5Y A;  3OY8 B;  4I09 A;  4MXW B;  4QX0 A;  1VMF A;  4S2D A;  1UOG A;  4CCD A;  4OYU A;  3AJY A;  3S30 A;  5C70 A;  4AYU A;  2GN3 A;  3B3Q E;  4GQ7 A;  3JBG 3;  2WSV A;  3DPR C;  1S0C A;  4AXO A;  4IW3 A;  5LY2 A;  2C24 A;  3ASI A;  4FPE A;  5FZO B;  2WT0 A;  1AYN 3;  5F5Q A;  1OQE A;  2HLE A;  3JBG 2;  2BGC A;  5FZA A;  2ZGN A;  1YQ8 A;  3I97 A;  3AM2 A;  1D2S A;  1AUY A;  1UZW A;  3MFA A;  1DZT A;  3VKO A;  1BCX A;  1RVF 2;  3WNN A;  5IK4 A;  2W52 A;  2Z2S B;  5FYY A;  3JXS A;  4GB3 1;  1W8U A;  5J3U A;  3ZIX A;  2BVB A;  4N8M A;  1O91 A;  4YYO A;  2VZS A;  1UYY A;  2QNK A;  2HWB 1;  2X5I C;  4A4A A;  5ABJ C;  1B35 A;  1BBT 2;  1GU3 A;  1RUF 1;  3ZYR A;  4GH4 B;  3OGJ A;  4COU A;  5T50 A;  5FY5 A;  3LPF A;  2HWC 2;  4UAP A;  4XJZ A;  3S0M A;  1LHV A;  5K0U C;  5KHK A;  5EWS A;  2GAU A;  3ZDV A;  1NT0 A;  2ZJC A;  5F5A A;  2D40 A;  2QBX A;  2JB4 A;  3SXW A;  4Q1R A;  1XC6 A;  3P3P A;  5JSP A;  1L7L A;  3AC0 A;  1GWK A;  2VE1 A;  3OJB A;  4BU2 A;  4Y22 A;  2YBP A;  3RZH A;  4FTB A;  2YU1 A;  1LUL A;  2LTN A;  5F8P A;  1YIP A;  4BDV B;  2F17 A;  2WS9 1;  2ZAC A;  4D7S A;  4HZF A;  3ZXG A;  4PLO A;  4AED C;  2WZ8 A;  4ONU A;  4UFK A;  3W20 A;  1AYM 1;  1HV1 A;  1ULD A;  3L2H A;  3LIH A;  4FPH A;  4M01 A;  1CVN A;  2GSY A;  1AR8 2;  4EV0 A;  2TUN A;  5E88 A;  5A7N A;  2ZBJ A;  3VD7 A;  3UGG A;  3T1L A;  5J48 A;  3A0K A;  1WBF A;  5I0U A;  3HBK A;  1OUR A;  2VUL A;  4CDQ B;  2MPF A;  5JVV A;  3T0A A;  4CUA A;  3KCX A;  4G3Y C;  4JV4 A;  4BQ3 A;  2CDP A;  4HVR A;  2H0V A;  2ZEX A;  4MO3 M;  5FYT A;  5CA6 A;  1OF4 A;  1W39 A;  2BP6 A;  3LFI A;  3UV9 A;  4W6W A;  3WP5 A;  4QX7 A;  4EWA A;  2VZ3 A;  3WT3 A;  4M3C F;  1YI7 A;  3SEE A;  2WFF 2;  3WNO A;  3FUO A;  4J6G A;  4LBQ B;  1RIT A;  5D8A B;  1H0B A;  1POV 3;  4MH0 E;  4CDW B;  3OOX A;  2VCC A;  4LHS A;  4N7U A;  2A73 B;  2BPA 2;  1UY3 A;  4K6B A;  2QQW A;  1X33 A;  1VE0 A;  3VDD C;  1ENX A;  2YY1 A;  4OCT A;  3JQW A;  3PME A;  4K8F A;  3VDC A;  5DZF A;  4R9B A;  1JZ6 A;  2ZHM A;  1H4H A;  4JKL A;  3RZG A;  4NPR A;  2W39 A;  2XQR A;  4BLI A;  2HJI A;  3HBZ A;  4DPN A;  1VBD 3;  2HYK A;  3O12 A;  2Q8E A;  3NQH A;  2FBE A;  3QOP A;  3WNK A;  1JI6 A;  2G1M A;  5HCB A;  1S55 A;  1U12 A;  1GYK A;  2EXI A;  3FBM A;  5A7S A;  4ITC A;  1WWY A;  1QDC A;  1EP0 A;  4DY5 A;  5JAX A;  1J1T A;  4UW4 A;  2CHH A;  5FLJ A;  5JIA A;  1RIR A;  3UT0 A;  3F95 A;  1T2X A;  1MS4 A;  4JRA A;  3DF0 A;  2EXK A;  3RPQ A;  3ROU A;  1QIQ A;  1JYV A;  4AVV A;  4CZS A;  4GIQ A;  3PLQ A;  3LIG A;  4LO5 B;  1AYN 2;  1JUI A;  3UKN A;  2UUR A;  2Y6H A;  4D7T A;  1US3 A;  5GZF A;  4I30 A;  3RRD A;  1OH3 A;  5FBJ A;  1H2M A;  1AYN 1;  2WS9 2;  4BYY A;  1W6Q A;  2HEY F;  2JE9 A;  1RL3 A;  2WA4 A;  4LUL A;  5A3P A;  5HPO A;  4YZ2 A;  3IPV B;  2ZML A;  5H9Q A;  1IS6 A;  1V9U 1;  1J84 A;  2DV9 A;  4JVA A;  2GDF A;  3UGF A;  1YQ6 A;  2ARE A;  1VR3 A;  2PAK A;  3WIN E;  1H9P A;  4AHW A;  5CFD C;  1HN1 A;  5F7U A;  4FQZ A;  4COZ A;  4CXW A;  2ZMK A;  4IEV A;  4YZ4 A;  2WFP A;  1OLM A;  3RG0 A;  3TWI A;  4LK7 A;  1G7Y A;  5DAW A;  3K2O A;  1UMZ A;  4WZF A;  1XNT A;  5JXJ A;  3VBR C;  4C0B A;  3FX3 A;  4LUM A;  4RQP A;  4Y4R A;  1HRV 3;  3TNQ A;  1F9K A;  3T30 A;  3VBU A;  2WNV B;  2XG3 A;  3ILR A;  2ARC A;  2CV6 A;  4GB3 2;  3DKQ A;  2ES3 A;  1BVP 1;  5IT6 A;  4JTN A;  2ET1 A;  3N7L A;  4RR3 B;  5CAZ A;  3MF6 A;  1WA6 X;  4FOY A;  4IGQ A;  3BTA A;  4PI2 A;  4XHX A;  4C90 A;  2HWD 1;  1MS8 A;  4MZU A;  5FZC A;  5C33 A;  1E5S A;  1AYM 3;  3AP5 A;  1W28 A;  3O1R A;  2C0Z A;  4K20 A;  1LHU A;  4XXP A;  2D6O X;  3I2O A;  2Q5T A;  4PF5 A;  1XND A;  3AKR A;  3DV8 A;  4MLO A;  3ZYB A;  4AI2 A;  4P9I A;  2JIG A;  3FHI B;  4QXK A;  2WNV C;  3O0W A;  3WQB A;  4Q8K A;  3HNM A;  2VZT A;  4X8P A;  1LU2 A;  2FZ2 A;  2RM2 1;  3H3L A;  1ND3 A;  4LUK A;  5T55 A;  2PLV 2;  2W2I A;  4Q0V A;  2IXI A;  5J7M A;  2WZR 1;  1ZZC A;  2VMI A;  4HN1 A;  5C3Q A;  1XYO A;  4JHT A;  4UFM A;  4ZZ5 A;  2C4X A;  1WW4 A;  5BYN A;  2CGP A;  4I3G A;  4R4Z A;  3ELN A;  3NMB A;  3N9P A;  1TNR A;  4LHK A;  2QDR A;  3SC7 X;  5EJ1 B;  1XSR A;  1I1E A;  1PVC 3;  4XAE A;  4SBV A;  3CL1 A;  5IVY A;  2GC2 A;  2TNF A;  4BLJ A;  1Q8S A;  3C2U A;  4P5H A;  3PMS A;  1IG0 A;  4YG0 A;  4A2U A;  4FAG A;  1JZ5 A;  3RZL A;  1QJX 3;  5EJ3 A;  4O9G A;  3CZU A;  4PQQ A;  1DLL A;  4JAA A;  2XJQ A;  4H55 A;  1U5Y A;  3MF9 A;  4R8H A;  3A4U A;  4R9C A;  3TEW A;  2P1B A;  3DKW A;  4XAC A;  4FTE A;  3T2Q A;  2R30 A;  5DDJ 2;  1O8S A;  3RJR A;  3IDB B;  1C3H A;  4LOT A;  4OI2 A;  3H1W A;  2GH2 A;  2PYT A;  4LPL A;  3H7J A;  3TEY A;  3RQ0 A;  1UOF A;  3K4D A;  3HNY M;  1K42 A;  1NXD 1;  1NY7 2;  1XB9 A;  2P3I A;  4FXG B;  3FHQ A;  4TZD A;  4F8A A;  4QGN A;  2BQP A;  5DN2 A;  4IEY A;  5CZK A;  1NOV A;  4TLF A;  1TEI A;  2ZA9 A;  4QPI B;  3POF A;  3FLT A;  1H2K A;  4COW A;  2Q4S A;  1F4H A;  1OFN A;  1AL2 3;  1H8T A;  1W6M B;  1WW5 A;  1NUK A;  2R07 1;  3AK0 A;  4NWV A;  3WG1 A;  1ZRR A;  4ZS3 A;  1EV1 2;  1KDK A;  1VBA 2;  3V64 A;  3W59 A;  2RS5 1;  1RVF 1;  3PUA A;  5LCW L;  3SMH A;  3HN3 A;  1BEV 2;  1PZ8 A;  1XNB A;  2P17 A;  5I93 A;  5AVP A;  1CZT A;  2Q1F A;  2YPD A;  1W9Y A;  2NN8 A;  4ASL A;  1YEW A;  1EAH 1;  3KV4 A;  4N7I A;  4OI1 A;  3VBH B;  1IGO A;  1Q56 A;  1DP0 A;  1QJU 1;  1UXX X;  2O8O A;  2V5D A;  2VTX J;  3AP4 A;  2W08 A;  5I8Y A;  1W90 A;  4IEU A;  5FMO S;  2WNU C;  1JZ4 A;  2IXK A;  2IXC A;  1V00 A;  2X29 A;  3MIE A;  4N43 A;  3ZFE B;  2RR1 2;  1YC6 1;  3OD0 A;  1ZBA 2;  4EJR A;  3OGS A;  1W9T A;  1GWM A;  4XUR A;  4IE5 A;  1CPN A;  1OT5 A;  3WSO A;  3VBR B;  4EE2 A;  1VBC 3;  2QQO A;  4K9S A;  2WUH A;  4QPI C;  3ZXD A;  2PTM A;  4EQV A;  1O3S A;  5T52 A;  4Y5S A;  3ILF A;  4RQP C;  1UAI A;  2GC1 A;  4XET A;  3HT2 A;  5FZ8 A;  2JDP A;  4WM7 A;  1MPX A;  2LW8 A;  4RYD A;  1U5X A;  2F4P A;  3ACF A;  5F5I A;  5GLU A;  2XUM A;  2VD7 A;  5F3G A;  4XIO A;  2BFU L;  1SMV A;  5CFD A;  5FXZ A;  5FY7 A;  2ARX A;  1AR9 3;  2L9L A;  2WSU A;  3NAP C;  3LDR A;  5A6X A;  1CJP A;  2R6Q A;  1V0A A;  1HB3 A;  1SQ4 A;  2AAC A;  2KR2 A;  4NRM A;  3VDD B;  4O9E A;  5ANN A;  3B00 A;  3BGA A;  2Q0A A;  2P3Y A;  1OUS A;  2IFW A;  2OPW A;  1H4G A;  3D6E A;  4YG6 A;  3MO4 A;  4LIV A;  4Y4Y A;  4KG8 A;  1ZRE A;  1H6X A;  1S0F A;  1WLW A;  4CDU B;  1OD5 A;  4G4F A;  2G9Z A;  3O1T A;  5D8A A;  3GGL A;  1I5Z A;  2BWA A;  1I5P A;  2VW0 A;  4Z07 A;  2ENR A;  3P6B A;  1S4C A;  1C5I A;  3ETQ A;  1AVB A;  3TEZ A;  2Q8O A;  4I3P A;  4OFG A;  2UYB A;  1LRH A;  2R0F A;  2VGD A;  3JD7 2;  3KS7 A;  5ACA 3;  2DBN A;  3CZJ A;  2RS1 1;  2RR1 3;  1ZRI A;  3KWV A;  3APB A;  4N43 C;  1WCK A;  1R64 A;  1UOB A;  1MQT A;  3B01 A;  4RS5 A;  3NAP A;  1MS9 A;  1DGW A;  5T3N A;  2WAB A;  1VPH A;  4IL7 A;  4UW3 A;  1ENR A;  1N47 A;  4UXA A;  4DRR A;  4RR3 C;  1MZ6 A;  2DWR A;  4AL9 A;  2XLG A;  4CXY A;  2JDA A;  4Q27 A;  2PHR A;  2ZAA A;  4OHV A;  1YQ5 A;  1JZ2 A;  1DQ4 A;  1BMV 2;  5LEJ A;  2VXR A;  1W6N A;  2KXL A;  2PXJ A;  2HEV F;  3I59 B;  1AL2 2;  1H8T C;  3H8U A;  4TLG A;  5CNA A;  2B45 X;  1AR9 1;  2W91 A;  4L8Q A;  3RJ2 X;  3TEX A;  4AFD A;  3M70 A;  1C8N A;  2EA7 A;  4L2N A;  2MEV 2;  4BQ1 A;  4XVH A;  1ZM1 A;  4Y20 B;  4E4D X;  1REF A;  2A75 A;  3KHC A;  1AL2 1;  2MNG A;  3J7L A;  2ZGK A;  1CN1 A;  2DBI A;  3GM8 A;  3I3Q A;  4XIK A;  4B7K A;  5CVR A;  2D6M A;  1ZA4 A;  2RS5 3;  1VRB A;  3I2I A;  3PIJ A;  3KF3 A;  2W92 A;  3LEK A;  4QX5 A;  3WP6 A;  1J3P A;  5F6K A;  3ZXE A;  3K75 B;  5FYH A;  1QJE A;  4LE4 A;  3ZSL A;  1IKP A;  3BKZ A;  2W1Q A;  1S1A A;  4XDP A;  5B4X A;  4H7L A;  2IUW A;  4TYS A;  5FYB A;  4BHP A;  4CTE A;  1KFX L;  2HWF 2;  5LEK A;  4FPG A;  3S6P A;  4CYD A;  4AI0 A;  5L36 A;  2CGN A;  3VKM A;  2VCM A;  5IVB A;  5JDB A;  5DZG A;  1ZNP A;  3OGG A;  2GNT A;  4XYX A;  2OVU A;  5HI0 A;  3TB0 A;  1W9W A;  4PLM A;  4V2W A;  4YVS B;  4DIN B;  3BTX A;  5GKA C;  2NQY A;  3T1M A;  4CE8 A;  3I3M A;  1LOB A;  3H1Y A;  1WBL A;  4ZHN A;  2WII B;  1LEN A;  1K12 A;  5EZW A;  3ZIW A;  1VRH 3;  5FJK A;  1OKO A;  4XJ8 A;  2VZ1 A;  1COV 3;  3ZXJ A;  1YI9 A;  2QJV A;  5EHD A;  3V0B B;  3ZFG C;  2XJS A;  1F15 A;  2WQZ C;  4HAN A;  1RUF 3;  4DB5 A;  4H2A A;  2OX0 A;  1FNY A;  1MEC 1;  1UW8 A;  3ES1 A;  4HBN A;  3RZJ A;  1V6K A;  4C1W A;  3MFC A;  4IV3 B;  4KG0 A;  1GP5 A;  1NLQ A;  1WUV A;  5FPX A;  5IHR A;  4IQP A;  3MBW A;  3WLU A;  1QJY 1;  5D21 A;  4LBM A;  1VRH 2;  2EIG A;  4QQL A;  4R52 A;  3LEG A;  3N9Q A;  1IPJ A;  1FOD 2;  1LGC A;  1IKQ A;  4ZS2 A;  4OMC A;  4OUL A;  3ZSM A;  4DUV A;  4LIU A;  3VGI A;  1MEC 2;  2YC2 A;  2R07 3;  1SPP B;  5C4W B;  5FZ1 A;  1TE1 B;  2OII A;  2ZZJ A;  4XFI A;  3POY A;  2WWS A;  5FP7 A;  4S2F A;  1SZB A;  2B39 A;  3AYC A;  2HWF 3;  1DQ1 A;  4JGZ A;  4O61 A;  5LY1 A;  4FCA A;  1NA1 C;  4CEW B;  5BNO B;  1SFN A;  3WDV A;  3QH6 A;  1D0G A;  4Q4V 2;  1JHJ A;  2WNV A;  2WN2 A;  3TOJ A;  4ATF A;  2XOM A;  1B35 B;  3P1I A;  4UBH A;  3OCP A;  4GH4 A;  2A3X A;  3MEP A;  4XMI A;  5A1F A;  3JB8 A;  2GP5 A;  1XXN A;  4RS5 C;  4JC1 A;  3WEZ A;  2PHT A;  3ZKU A;  1RIN A;  4RSU A;  4XBQ A;  1NCR C;  5BNN A;  4QQ2 A;  5LA2 A;  2Z79 A;  2FCU A;  3B5L B;  1I9R A;  2RHP A;  5EFU A;  3G7D A;  1R08 1;  2Y64 A;  3HN1 A;  5FQ0 B;  1QU0 A;  2Y33 A;  5K8S A;  2TBV A;  4Y22 B;  1PGW 2;  3M3O A;  4MHU A;  1NLR A;  3HAG A;  1R1A 3;  2XLF A;  3RZM A;  3AKS A;  4P9J A;  2ORZ A;  4BQ5 A;  3WZ1 A;  3JU9 A;  4AK3 A;  4GKX A;  2GN7 A;  4GD4 A;  4Q4Y 2;  4A44 A;  5FOJ B;  3JQX A;  3MLJ A;  1EV1 1;  1GNZ A;  2ZX1 A;  3GHM A;  3ACG A;  1RJ8 A;  4IER A;  4XHB A;  4Y5Z 0;  1YCI A;  2JE7 A;  4FT8 A;  1CX4 A;  1YLL A;  3I2G A;  4NUB A;  3NWK A;  4CCL A;  1OQD A;  3PUR A;  3ZDS A;  4N90 A;  4FP3 A;  5HV4 A;  5H9S A;  4DFS A;  1XOY A;  2VZV A;  2IVJ A;  2ILM A;  2WZE A;  2VUA A;  3FFQ A;  1UPS A;  3VD9 A;  3H42 B;  5ACA 2;  3AMP A;  4WVM A;  1D4M 3;  2QCS B;  2W1W A;  1Q8Q A;  1Q3E A;  4IGP A;  4CU7 A;  2VY0 A;  1DZQ A;  4FO9 A;  4IEO A;  1GWL A;  3AYA A;  3VBR A;  2DVA A;  2CTV A;  3FZ3 A;  4LBJ A;  3BIE A;  4QT6 A;  1HJF A;  4RA0 A;  2D6L X;  1TME 2;  2D3R A;  3C7F A;  2PQS A;  4MGZ E;  3WG2 A;  4UW6 A;  3ZXK A;  3ZYG A;  2E51 A;  3TN9 3;  1EAH 2;  3GBG A;  1H2L A;  2R32 A;  4HVO A;  3C8X A;  1PO1 2;  1ENQ A;  3MI8 A;  4KBZ A;  5DQ0 A;  1IS4 A;  4CCM A;  1NCR A;  1LEM A;  3AFK A;  2HYX A;  3E6D A;  4ISQ A;  5BNN C;  1FV2 A;  4LOR A;  1V9U 3;  1JBC A;  4H14 A;  1SDW A;  1X9P A;  1YFU A;  4KU8 A;  1T6B X;  1APN A;  5FPV A;  5M0T A;  1UY4 A;  4LQR A;  2CAV A;  1WCU A;  3WXP A;  2DU1 A;  4XQD A;  4G9S B;  1H1M A;  2R04 3;  4B4P A;  4WM7 C;  4YFW A;  3VHN A;  2VUJ A;  1AR8 3;  1POQ A;  2ZGT A;  1UNB A;  4AGR A;  1CAX B;  1VBC 2;  3VZJ A;  4JRL A;  4WM8 B;  5A3U A;  5FWJ A;  4GJY A;  4K1Y A;  4XAB A;  4CRQ A;  1JZ7 A;  2BWC A;  1C1F A;  1RUD 3;  1LOC A;  3IDC B;  1C28 A;  1RUI 3;  1AX2 A;  1OC1 A;  4HK9 A;  2HWD 3;  5JLV A;  1JS9 A;  3MUY 1;  4OUS A;  4DEV A;  1P8J A;  5A32 A;  3CJI B;  1V6N A;  5FV3 A;  1AJO A;  1URX A;  3WV6 A;  1SCS A;  4DNY A;  4KQ7 A;  4JGY B;  4NII A;  1JU3 A;  1FMD 2;  1Z7S 3;  2HWC 3;  4V1P A;  4AFB A;  3FBY A;  2UYA A;  4YW5 A;  1BBT 3;  4NOT A;  4OVE A;  3NNG A;  1PO2 2;  3KV9 A;  3WQ1 A;  5JMC A;  2OZJ A;  4B3N A;  1MS5 A;  2KA3 A;  2P5B A;  3ZXL A;  3AL5 A;  2LM3 A;  3I7D A;  3N9N A;  4N53 B;  1CAX A;  4Q0Q A;  3AZZ A;  4LO6 B;  3MYX A;  1HB1 A;  3H8R A;  1HJG A;  2PHX A;  1HN0 A;  2YZ4 A;  3K51 A;  4LO4 B;  1KRI A;  3E97 A;  4LK6 A;  1QJX 1;  4W65 A;  3OBZ A;  5FP4 A;  3LPG A;  1DF0 A;  1K5M A;  2FZ1 A;  3ITQ A;  5HXM A;  5JUV A;  1Y7B A;  1EY2 A;  1QQP 2;  2LRP A;  1OD3 A;  1N1V A;  1OSG A;  3N9O A;  2OW4 A;  2YB7 A;  1V6J A;  4AAP A;  3WF1 A;  4UYB A;  2DUQ A;  4QB6 A;  5HBA A;  2VTX A;  1QQP 1;  1Q43 A;  4YAR A;  1YJL A;  2WT2 A;  2X8K A;  1W04 A;  2G19 A;  1QJX 2;  2WNU A;  5DG2 A;  3SNM A;  2VEC A;  3NO8 A;  5C8C B;  5GM0 A;  2V4V A;  2RDN A;  2VQU A;  1PVC 2;  4GH4 C;  4Q29 A;  2I07 B;  1TZO A;  2MHF A;  3BOD A;  5C3O A;  2VMH A;  1DHK B;  5DDJ 1;  2ZOE B;  3UL2 A;  1NQJ A;  1UN1 A;  2PFW A;  1RHI 1;  4Q4X 2;  5JOX A;  3RYR A;  2FCV A;  2VTF A;  4LTA A;  3O1U A;  5FJH A;  5FXW A;  4YM2 A;  1CZV A;  1A6C A;  2P2K A;  5LBE A;  1JH5 A;  2PLV 3;  3F2Z A;  1VAV A;  2GH8 A;  3JCI A;  4XPV A;  3WR0 A;  2XKO A;  3ALQ A;  3J26 N;  1MZE A;  2D3P A;  3SCH A;  4AE2 A;  1PMI A;  4FPC A;  1UX6 A;  1GOG A;  2FDF A;  1TMF 2;  4AEK A;  4OUM A;  1BEV 1;  3ZXF A;  2JWP A;  3O14 A;  4EN8 B;  3FLR A;  3JBG 1;  4Q0U A;  2VQT A;  1T6G C;  4MX3 A;  5BY5 A;  4CP2 A;  4P9L A;  4XFH A;  1PMJ X;  1MS0 A;  1REE A;  3VZN A;  1O59 A;  3C7E A;  3CKH A;  3VHP A;  4K3U A;  5GZD A;  2B7Y A;  1WCS A;  2FDJ A;  4NIG A;  5FYV A;  3ZR6 A;  1PIV 1;  5JZG B;  3H1M A;  3KV5 A;  4P08 A;  4ES8 A;  2RMU 1;  1XE7 A;  4QGM A;  3LQC A;  4WVZ A;  1LHO A;  1GZ9 A;  2GC0 A;  2DF7 A;  1K5M C;  2J1R A;  5FZH A;  3UGH A;  3OF1 A;  4GKY A;  2J1E A;  1QNW A;  1JOD A;  1SPP A;  1YXW A;  2EID A;  4IEP A;  4MV2 A;  4PIY A;  4W4Z A;  5C4W A;  4D69 A;  1UZZ A;  2ZX0 A;  3U07 A;  2C9A A;  5FXX A;  4D94 A;  2C1F A;  3VZO A;  2UY9 A;  2PEL A;  1LOD A;  3KT1 A;  3WVJ A;  4E2G A;  4E2Q A;  3M2M A;  4BCU A;  2BER A;  3WUD A;  2E31 A;  3JUU A;  3MUZ 1;  2Y6J A;  1MR5 A;  4PI0 A;  1UD1 A;  3GDB A;  5IVV A;  1JYW A;  3VBH A;  3ZM8 A;  2WS9 3;  3KVB A;  4ZU7 A;  1A3K A;  2DVF A;  2WNO A;  1DYO A;  4LKF A;  2DUP A;  2YG0 A;  5FWE A;  1DYK A;  2GC3 A;  5IAV A;  5LRR A;  3VBS A;  1ASJ 1;  2JG9 A;  5FQ0 A;  3IMM A;  1D4V B;  3RNS A;  3ZOI A;  3ZPO A;  4YNI A;  3J7H A;  1QXR A;  4M4P A;  5H9R A;  5IVF A;  3R0R A;  4JKK A;  2AGS A;  4OUE A;  3WW4 A;  5IVE A;  5E8A A;  1N3P A;  2SLI A;  4M4R A;  5FPU A;  5LAT A;  3CEW A;  3IKW A;  3GNE A;  2BBA A;  2GZW A;  4LLO A;  4XJ9 A;  1UZY A;  4IE0 A;  2HWE 3;  2CDO A;  2IXL A;  4W6X A;  4TTG A;  1CQ9 A;  1CWP A;  1HLC A;  1Z7S 2;  2I74 A;  1V6L A;  3AKP A;  5F2W A;  4PDW C;  2CGO A;  2YPJ A;  4K40 A;  4YVW B;  2XUE A;  1POV 0;  4YGB A;  2A7A A;  4NO4 A;  4ZKT B;  2RM2 2;  1RUI 2;  3T0D A;  2YFU A;  1NG0 A;  3ZYH A;  2WIN B;  2VMF A;  3MIH A;  1G9B A;  2VL4 A;  1EPW A;  5A70 A;  4Y1Y A;  1QOT A;  1IHM A;  1NCQ B;  2O1Q A;  3QBQ A;  4GAL A;  2J1V A;  2DCT A;  4KI5 M;  3NJY A;  1OLQ A;  2QQU A;  2D43 A;  5I8S A;  4YVW C;  1TG7 A;  4ZU5 A;  4K21 A;  2H6B A;  2PHL A;  5LA9 A;  1W9S A;  5FP8 A;  2ZHL A;  4QWN A;  1XNA A;  4W8J A;  3RWK X;  4CP9 A;  4EYU A;  4MGT A;  2V73 A;  1CR7 A;  2FD8 A;  1UU6 A;  3ZYJ B;  1D0H A;  2ZKN A;  4GWM A;  2XBO 1;  4HKO A;  5AC9 1;  2F4L A;  4QX2 A;  3RDI A;  3TN9 2;  5A80 A;  2JIJ A;  2X5I A;  5KHG A;  1IS3 A;  1O8P A;  1SBE A;  3ES4 A;  1CON A;  1A8M A;  4IEW A;  1ODM A;  5CG8 A;  2XWB B;  2G9F A;  3AB0 A;  4B7E A;  4XFB A;  3EHK A;  1VIW B;  1RXG A;  1PM4 A;  4Q4X 1;  1NCQ A;  3AZY A;  4GWJ A;  5KHI A;  4FPL A;  1DIW A;  2Y8K A;  2RS3 1;  3WCS A;  2HBU A;  1BLZ A;  4XUT A;  1YJK A;  4WM8 A;  1JTZ X;  1RC6 A;  2RJL A;  5FZE A;  5LB6 A;  1RUG 3;  2DDU A;  4PBP A;  3NJX A;  3BVC A;  5BNP C;  5D1I A;  1VRH 1;  1PNG A;  3IIA A;  2JXA A;  4ZXE A;  1JZ3 A;  1HQL A;  3OEB A;  4OQ8 A;  1PK6 B;  2ZX2 A;  2JEM A;  3THD A;  4FAH A;  1W3X A;  3CJI A;  1GZC A;  3E5U A;  4D6S A;  1Z0H A;  2FQP A;  3CBN A;  4XFG A;  1Q8P A;  2BFU S;  2WA3 A;  1VBB 2;  4MYE A;  3SKJ E;  1WLC A;  1ZBE 2;  4B8E A;  2OPK A;  2RV9 A;  3U0Z A;  2UWB A;  2XL7 A;  1GQH A;  5DAX A;  4Q4Y 3;  3J8F 2;  3OB8 A;  4CU6 A;  1W6P B;  4N53 A;  1O4Z A;  5KWR A;  1YRZ A;  1OLM E;  3WF2 A;  1FT9 A;  3M3C A;  3MHZ A;  2NM1 A;  1VBE 3;  2VBP A;  4QX3 A;  5JSR A;  1QJY 2;  2JD9 A;  2NZ9 A;  3B02 A;  3KSC A;  3S57 A;  1OXC A;  3VL9 A;  1W2N A;  3LB9 A;  1RTV A;  3PVE A;  4OQ9 A;  3FUQ A;  4A7K A;  1S0I A;  3ZFF A;  3LDK A;  5F2S A;  4FBF A;  3VN4 A;  3LD8 A;  2TEP A;  1FPN 1;  1SLI A;  3UKT A;  3OBT A;  4DMI A;  1WD3 A;  4FFG A;  4IET A;  5L7O B;  4F7Z A;  4NID A;  5AFB A;  4ZPI A;  4Y20 A;  2BOI A;  5KXE A;  1JMU B;  4UFJ A;  4AHZ A;  2BNO A;  5FY8 A;  2HEW F;  1S0E A;  4BB3 A;  3PU3 A;  4EN0 A;  1FMD 3;  4BJ0 A;  2FDI A;  5FAX A;  3TYJ A;  3E6B A;  1WA4 A;  4XCA A;  4OI0 A;  4MVT A;  2R1B A;  1QXJ A;  4JDO A;  4XBL A;  3NV4 A;  3O0X A;  1C4R A;  5CFC A;  3U78 A;  3PL0 A;  3T2T A;  3HNB M;  4JZR A;  2VNR A;  3VDD A;  4RN5 A;  3WQ0 A;  1AX0 A;  1RHI 2;  1UXZ A;  2BDR A;  3GYD A;  4UFL A;  4I0A A;  1RUD 2;  1MEC 3;  4KMQ A;  5KC6 A;  5LRS A;  1A8D A;  1GR3 A;  1E5R A;  2EXJ A;  1SLC A;  2WAO A;  2ZTN A;  3AMH A;  1V6M A;  4AED B;  2NMO A;  1LHW A;  3INA A;  4IE7 A;  3AXE A;  2XH6 A;  1QF3 A;  2B8M A;  2KD7 A;  2XJU A;  2Z5W A;  5GLT A;  4AQS A;  1IOA A;  3LA7 A;  1WLT A;  2H0B A;  3A7Q A;  4GJZ A;  2E63 A;  4ES9 A;  4CA9 A;  4NVP A;  4LOS A;  3O1M A;  4H7M A;  3M3Q A;  4WM7 B;  5LK5 A;  1BZW A;  2CAU A;  4Z92 B;  1AZD A;  1UX7 A;  1SFP A;  2OUH A;  1ACC A;  3LEM A;  3I3E A;  5KXD A;  5I0S A;  5GJ6 A;  4L99 A;  4DY3 A;  4Y1V A;  1W06 A;  4CCC A;  3U14 A;  1J83 A;  3CHX A;  1F5J A;  1NXM A;  3RFR A;  4D6R A;  4YM1 A;  4YW3 A;  4XOG A;  4BMB A;  1EAH 3;  2HKX A;  1K5J A;  1LU1 A;  2JJ6 A;  5F3C A;  1QJU 3;  1VJ2 A;  4XZU G;  2ID4 A;  5GLV A;  4I2O A;  2Z42 A;  4NPL A;  2VQ0 A;  4FVV A;  2ZS6 B;  2JEN A;  4MXV A;  4NWW A;  4YGE A;  2WC2 A;  1RUH 2;  2XVG A;  3OTF A;  5FBZ A;  4YW2 A;  1CAV B;  3MDP A;  1VP6 A;  1L3J A;  2WRA A;  3SH5 A;  3MLK A;  1FNZ A;  4NAM A;  2C26 A;  1PVC 1;  2Y6L A;  4AEM A;  1S2K A;  1WCD J;  2JB8 A;  2HWB 3;  4C0H A;  1OA3 A;  4UBG A;  5EPA A;  5DZE A;  3IDE A;  5K0U B;  4UW5 A;  4CEW A;  1Q8V A;  2UU8 A;  1WCQ A;  1BVV A;  2VH9 A;  2XDV A;  3WD5 A;  4MSV A;  4KU7 A;  2FCT A;  3RMY A;  1M06 G;  1RUE 3;  2D5H A;  2JDM A;  3FL7 A;  4TXW A;  4HK8 A;  1ZZ8 A;  5JZG C;  5FPA A;  4D8M A;  3RS6 A;  1AR7 1;  2VU9 A;  4A6S A;  1ZRC A;  4HPK A;  4OLL A;  5FZI A;  1STM A;  2RDQ A;  3J9S A;  1BKZ A;  2W0X A;  2VUD A;  4JX0 A;  2AH2 A;  3M7A A;  2X05 A;  2V4A A;  4Q4W 2;  5CKN A;  4HG6 B;  2RDS A;  1HIX A;  1VLN A;  4XUQ A;  3HD8 B;  1K3I A;  3J4U H;  4AF9 A;  2W5F A;  3NL1 A;  4N9H A;  4NR1 A;  1ODN A;  1PIV 2;  4XDO A;  1G9A A;  3KLS A;  3MPB A;  2J42 A;  4N53 C;  3LFM A;  1Z7S 1;  4LBO A;  5EJZ B;  1TMF 3;  2EAL A;  4FPY A;  4XTM A;  4QHB A;  1VB4 A;  2ATF A;  4UWD A;  1EUU A;  2VOK A;  3WW1 A;  5FYC A;  2E33 A;  4YLZ A;  4YVW A;  3SH3 A;  4BIS A;  2JX9 A;  1GZT A;  5GLZ A;  3PUQ A;  2W1U A;  3UK9 A;  2JDZ A;  3C3V A;  2ZGO A;  4PIX A;  4Q4X 3;  2DVB A;  4AEJ A;  5B2G B;  4Q4V 3;  1FYU A;  2QQL A;  4B4R A;  3AMQ A;  3HQX A;  5A1L A;  3T08 A;  1H9W A;  4GXL A;  2QFE A;  2W94 A;  1MZ5 A;  2WYF A;  2ZXQ A;  4QDS A;  3WQ7 A;  4NPM A;  1ZA7 A;  2VUC A;  4NN0 A;  4OI4 A;  3IBM A;  1QJU 2;  1WD4 A;  2QQM A;  3T4V A;  2DUR A;  3USU B;  4CXX A;  5F3I A;  4BE3 A;  3W5M A;  3KMH A;  3BTY A;  3DEM A;  3WDT A;  5JWP A;  2E26 A;  4MET A;  1CAV A;  4KGQ A;  1ZYB A;  5F32 A;  2VVE A;  2WO2 A;  3CU7 A;  1SG3 A;  4A7Z A;  4ET7 A;  1QQP 3;  2D5F A;  5BNO A;  2FDH A;  3HIF A;  3IAP A;  1ZZ7 A;  5KBF A;  1AR9 2;  3DYM A;  3HVD A;  4ZON A;  1OF3 A;  5FIX A;  4IE6 A;  4QMA A;  5LBB A;  3ZMN A;  4NHK A;  4XAA A;  1R09 2;  2Y26 A;  2ZPX A;  3PUI A;  4L11 A;  3B9C A;  3BCW A;  4BME A;  5I0D A;  2QDN A;  5FMO L;  1AL0 G;  2JIC A;  3QAC A;  4DXT A;  1PX4 A;  5F3E A;  4RL7 A;  4XQW A;  5FY4 A;  1ZZ6 A;  3POB A;  3ZFE A;  1K45 A;  2QQI A;  1COV 2;  1SLB A;  1UYZ A;  3O0V A;  5J37 A;  2A5Z A;  5FKC A;  4QM9 A;  5FZ6 A;  4A7Y A;  4A3Z A;  2FMY A;  4GMP 0;  1GOH A;  2E7A A;  3IM0 A;  1X8E A;  4RGA A;  3IWZ A;  1ULO A;  5DMY A;  5JSO A;  2D97 A;  1R1Z A;  2WBK A;  1RGS A;  4IXL A;  1RUJ 2;  4QKF A;  1DGR N;  4JQT A;  5FRE A;  4WV8 A;  2CWM A;  3OUH A;  1ASJ 2;  1N3O A;  4FFF A;  2HWD 2;  2JG8 A;  3E5X A;  4U36 A;  5GLW A;  4EZH A;  5FZB A;  4QU1 A;  3VBO B;  5SV5 A;  3H50 A;  4XDQ A;  1O7F A;  5C7G A;  4GUL A;  2V09 A;  3ZYF A;  1W99 A;  3HQR A;  2QUO A;  3VBF B;  3AP7 A;  1OVS A;  2JDH A;  2YUE A;  4RHV 3;  4BZ4 A;  1RUC 2;  4LO8 A;  3WG3 A;  2A6W A;  2ZEZ A;  3MW4 A;  2W1S A;  1WME A;  2OKX A;  3WUC A;  1JYN A;  2PHD A;  4MGQ A;  2ARA A;  2FMD A;  3RYK A;  4CCJ A;  3O7O A;  4GWN A;  2GNB A;  4P9G A;  3GF6 A;  5IAT A;  2XWJ B;  1GV9 A;  3OY8 A;  4MXW A;  2K9Z A;  5FUN A;  1GNH A;  5FUP A;  3POJ A;  1US2 A;  1V9U 2;  5TSW A;  3M8L A;  1CPM A;  4LNV A;  4A3X A;  1XE8 A;  4R9A A;  2RVA A;  4NHY A;  1GQG A;  5DDJ 3;  3DPR A;  3U37 A;  1NLS A;  1OQ1 A;  1W3V A;  3NV2 A;  3AYE A;  4NRO A;  2VVD A;  4E27 A;  5AVA A;  2YFZ A;  3PHM A;  1ZBE 3;  1XU2 A;  3PU8 A;  2YC0 A;  1LOE A;  3AKT A;  3B7M A;  3OG2 A;  4QQH A;  3FJS A;  4GA9 A;  4PCR A;  4NIA A;  5JMO A;  4SLI A;  2AEZ A;  1DQ0 A;  1CZS A;  2YV8 A;  4BQ2 A;  3LWC A;  4MGY E;  1W8F A;  3ON7 A;  4PJY A;  4PDW B;  3N7J A;  1HB4 A;  4Z2W A;  5EIY B;  3T0B A;  2BRT A;  2EAK A;  1W6P A;  2OXB A;  2QQN A;  2YDE A;  3H9A A;  4AED A;  3ZYI B;  4P9W A;  3VD4 A;  3VZK A;  3GBW A;  1NA1 B;  4ISR A;  1QOS A;  5EYX A;  3VBU C;  2XGX A;  2IZW A;  2D6P A;  3GBF A;  4Y1U A;  2XLA A;  5IYY A;  1AXZ A;  1X9T A;  3LE0 A;  4OZO A;  5L19 A;  2WJS A;  4PHZ A;  3DPR B;  1OFS A;  1PX3 A;  3WP3 A;  2AZ5 A;  4U2A A;  3VD5 A;  3ACI A;  1QNY A;  3A0N A;  1ZRD A;  2ZGL A;  2BGO A;  2K0G A;  3NNF A;  1YO8 A;  1SAC A;  4RHV 1;  2V72 A;  5A3W A;  2W9X A;  2BV4 A;  4URA A;  5H9P A;  4MGK E;  3J7M A;  1JOB A;  5A7W B;  2JEC A;  5A3N A;  1LOF C;  2JDU A;  1HRV 1;  4JGY A;  2LUW A;  1R1A 2;  4XFA A;  4QPG A;  5FZK A;  4AG4 A;  4V2V A;  4L9B A;  3GJB A;  5EQU A;  3UJQ A;  4K7J A;  3IZO A;  1IPK A;  4CUG A;  2BNN A;  3HEI A;  4HVQ A;  2YU2 A;  3IPV A;  4FPO B;  1UO9 A;  2ZGU A;  4Z2A A;  4YZ1 A;  1ENS A;  4ZY9 A;  5JCT A;  4KWU A;  3MV0 1;  2J1S A;  2VZU A;  5E1R A;  1DFQ A;  2P37 A;  1YWK A;  5L9B A;  3AJZ A;  3DGT A;  5CIR A;  5LBF A;  2Y0O A;  3FMG A;  5FO9 B;  4YGD A;  3MIF A;  1UPI A;  5FRA A;  3URF A;  4LXL A;  1NE6 A;  2DCZ A;  1A78 A;  4CEY A;  5ISL A;  3WDW A;  1OA4 A;  3I2J A;  5DUU A;  5DXD A;  5K0U A;  4BXS V;  3MIC A;  4OHX A;  1W6O A;  1IQA A;  1YFY A;  2E7T A;  4HET A;  4TSV A;  1H6Y A;  1YUD A;  1O3T A;  1FPN 3;  1W03 A;  4TN7 A;  1KS5 A;  4ARY A;  1TME 1;  1FAY A;  2CNA A;  1TNF A;  1RUJ 3;  1UIJ A;  3ZN4 A;  3I2D A;  5BNQ A;  2R07 2;  4HKL A;  4FPJ A;  5FMD A;  4IV3 A;  1RUH 1;  2O0O A;  2LS6 A;  2ZHN A;  2QQV A;  2YHJ A;  4IND A;  2ET7 A;  4CUC A;  4XXA A;  1FOD 3;  3WY6 A;  1PGL 2;  1AXK A;  1DG6 A;  2Y6K A;  3NNL A;  4IV3 C;  3KV6 A;  2N7G A;  1S0D A;  4Q2F A;  5HXV A;  1LKN A;  1O5L A;  2WL1 A;  3AKQ A;  5GAL A;  1H8V A;  2ORX A;  2WDB A;  4XUN A;  4BK5 A;  4EWD A;  3S7I A;  3SHR A;  1ND3 B;  4QXB A;  3ZSK A;  1XYP A;  1AR8 1;  3OBR A;  5JOW A;  1RUF 2;  1SLT A;  1DQ2 A;  4YVS A;  1W6O B;  2VOX A;  3USS A;  4JGZ B;  1V6I A;  3O1O A;  4AVT A;  1X50 A;  1RUC 1;  4A6O A;  1GFF 2;  1LJ7 A;  1JYX A;  1LGB A;  1XBF A;  2B9V A;  1X36 A;  1ZVF A;  3H3Z A;  4C1X A;  2IFR A;  2VZP A;  4GMP 1;  4QXH A;  4XFF A;  4YZ3 A;  1BK1 A;  1GSL A;  4P9Y A;  1IPS A;  3I2K A;  3RSJ A;  2BJS A;  1LOA A;  4Z82 A;  1YQC A;  4QPY A;  1XNK A;  2VOW A;  3PVB B;  4CDX A;  1C8M 3;  2JE8 A; 
#chains in the Genus database with same CATH homology
 3WQB A;  1W8N A;  3SKV A;  3HNM A;  2VM9 A;  1JZ8 A;  2VZT A;  5JXG A;  3J7H A;  2RJ2 A;  4M4P A;  1W8O A;  5LA0 A;  4JKK A;  4QDR A;  4OUE A;  3CQO A;  4FI9 A;  4M4R A;  4P02 B;  5JXH A;  3NRU A;  3ETP A;  2BBA A;  4ZZ5 A;  2C4X A;  2CDO A;  4TTG A;  4QB1 A;  5EJ1 B;  4XUO A;  1JZ5 A;  3CZU A;  3WNP A;  1UY0 A;  4PQQ A;  1ULP A;  3T0D A;  2YFU A;  2BZD A;  3T2Q A;  1O8S A;  2VMF A;  3C7O A;  2VL4 A;  4LPL A;  2JKX A;  1TVG A;  3K4D A;  3HNY M;  1K42 A;  2J1A A;  2J1V A;  3FHQ A;  4KI5 M;  4P5Y A;  5DN2 A;  5CZK A;  1TG7 A;  1OH4 A;  2VO5 A;  1F4H A;  1W9S A;  3ACH A;  1NUK A;  3THC A;  2C9K A;  1W0N A;  1XNA A;  4W8J A;  2W87 A;  4DXR A;  3WNL A;  2J22 A;  5LCW L;  3W5N A;  3HN3 A;  4BK4 A;  2J1T A;  1GQP A;  1SHW B;  4A45 A;  1CZT A;  2W95 A;  3K4Z A;  3I3B A;  4QX2 A;  4UOJ A;  1O8P A;  1DP0 A;  4D0Q A;  1UXX X;  2V5D A;  2QQJ A;  1JZ4 A;  1F4A A;  4QPW A;  4GWJ A;  2Y8K A;  3OGS A;  1W9T A;  4XUR A;  1OT5 A;  4XUT A;  4L0P A;  3WSO A;  2QQO A;  4GZ9 A;  2DDU A;  2WUH A;  2VZQ A;  3NJX A;  4ZXE A;  1JZ3 A;  4MAD A;  3OEB A;  1MPX A;  2LW8 A;  4RYD A;  3ACF A;  3UES A;  4A42 A;  3THD A;  3VDA A;  3SEP A;  3VDB A;  1XPW A;  4DUX A;  3A21 A;  5IFT A;  2L9L A;  3SKJ E;  2DCJ A;  2J7M A;  2RV9 A;  2WO3 A;  3OB8 A;  4A41 A;  4CU6 A;  3EYP A;  1GOF A;  3WF2 A;  3C7H A;  1UMH A;  3BGA A;  4QX3 A;  3T2P A;  2J1U A;  2JD9 A;  3E1F 1;  3MO4 A;  3K4A A;  3CMG A;  1H6X A;  2XHN A;  2XQX A;  1L7R A;  3GGL A;  1I5P A;  1YQ2 A;  3P6B A;  2WYS A;  3K77 A;  1JU4 A;  3CZJ A;  3BN6 A;  5LA1 A;  4BJ0 A;  4DUW A;  4QDQ A;  1R64 A;  3I2H A;  1DLC A;  3CIH A;  4OMD A;  1D7P M;  2WAB A;  3HNB M;  2QQK A;  4RN5 A;  2VCB A;  3UET A;  3WF0 A;  1UXZ A;  4KMQ A;  2JDA A;  2R7E B;  2WAO A;  3DYP A;  2X09 A;  1JZ2 A;  2WQ8 A;  4QB2 A;  1UZ0 A;  2KD7 A;  3IAQ A;  3NJV A;  4ARX A;  1UWW A;  3FHA A;  2W91 A;  2ZEW A;  4XVH A;  3A7Q A;  3GM8 A;  1UX7 A;  3I2I A;  3I3E A;  3DYO A;  2W92 A;  3LEK A;  2B4K A;  3EB7 A;  1J83 A;  3K75 B;  2VME A;  3IDA A;  4CU8 A;  4YPJ A;  2VR4 A;  2W46 A;  2W1Q A;  5B4X A;  3LEI A;  1KGY A;  4XZU G;  2ID4 A;  4DXS A;  4AAX A;  1RYY A;  1W9W A;  3OEA A;  4JHZ A;  2C26 A;  5CYY A;  5J1X A;  2Y6L A;  3OGV A;  1UYX A;  1UMI A;  1K12 A;  4QAW A;  2VZ1 A;  2X10 A;  3I2F A;  4JKM A;  3D3A A;  1WCQ A;  1LNS A;  2VJX A;  3FL7 A;  4TXW A;  5IHR A;  2DCK A;  4QX1 A;  4D8M A;  3MBW A;  4IUG A;  2VC9 A;  3LEG A;  4GWI A;  1WKY A;  4OMC A;  4JX0 A;  1SDD B;  2X05 A;  4DUV A;  2YC2 A;  4HG6 B;  2ZEY A;  1UY2 A;  4XUQ A;  1K3I A;  5FUI A;  2W5F A;  5G05 L;  3OGR A;  4DEQ A;  2VMD A;  3CDZ B;  1GMM A;  3T2O A;  5EJZ B;  1JHJ A;  1EUU A;  4P00 B;  2E33 A;  2WN2 A;  2XOM A;  3P1I A;  3MV1 1;  2W1U A;  3WEZ A;  2QQL A;  3WNM A;  5LA2 A;  3T08 A;  2W94 A;  3K46 A;  2ZXQ A;  4QDS A;  2Y64 A;  4CVU A;  2YC4 A;  2QQM A;  2WO1 A;  5G04 L;  3DEC A;  3W5M A;  2ORZ A;  2WN3 A;  1GNY A;  2W47 A;  2VZO A;  3VD3 A;  2E32 A;  2E26 A;  4LKS A;  1CIY A;  4A44 A;  2WO2 A;  1SG3 A;  1NAE A;  3ACG A;  4ET7 A;  3IAP A;  4E8C A;  3DYM A;  3PUH A;  1OF3 A;  2EIE A;  3I2G A;  4ZZ8 A;  3PUI A;  5I0D A;  5A1A A;  4DXT A;  1CX1 A;  1PX4 A;  2VZV A;  2EIC A;  2WZE A;  4PF1 A;  3VD9 A;  1K45 A;  2QQI A;  2BGP A;  1UYZ A;  3UNP A;  1IQD C;  2W1W A;  4PT6 A;  4CU7 A;  4A3Z A;  1GOH A;  3ABZ A;  4QX0 A;  2VCA A;  4OYU A;  1ULO A;  3A23 A;  5IJR A;  2WBK A;  5C70 A;  3HOB A;  5DMY A;  1GUI A;  3C7F A;  2PQS A;  4E8D A;  3A22 A;  2HLE A;  5IFP A;  2Z4F A;  3I3D A;  3C8X A;  3I97 A;  5DQ0 A;  2HYX A;  3WNN A;  5C7G A;  1W99 A;  3JXS A;  3WF4 A;  2VZS A;  1UYY A;  1UY4 A;  4A4A A;  4LQR A;  2ZEZ A;  1GU3 A;  2W1S A;  2OKX A;  1JYN A;  4MGQ A;  3LPF A;  4UAP A;  3ECQ A;  2QBX A;  1XC6 A;  4MOA A;  1US2 A;  3AC0 A;  2RVA A;  3U37 A;  1JZ7 A;  4BDV B;  2YFZ A;  3T09 A;  2WZ8 A;  3HJR A;  3MUY 1;  4DEV A;  4UI9 L;  1P8J A;  1BHG A;  3OG2 A;  5JMO A;  3OBA A;  1CZS A;  1JU3 A;  3VD7 A;  5JR2 A;  4XUP A;  5EIY B;  4CUA A;  3T0A A;  3T0B A;  3NNG A;  2QQN A;  2CDP A;  3VD4 A;  2ZEX A;  4CU9 A;  4MO3 M;  1OF4 A;  5IYY A;  1NX9 A;  2VZ3 A;  2VMC A;  3LE0 A;  4OZO A;  3SEE A;  3WNO A;  1PX3 A;  3VD5 A;  3ACI A;  3LPG A;  2BGO A;  5JUV A;  2VCC A;  5HXM A;  4LHS A;  3WF3 A;  5JXI A;  2V72 A;  2W9X A;  1UY3 A;  1OD3 A;  4CUB A;  2YB7 A;  3WF1 A;  4QB6 A;  3HPN A;  3VDC A;  1KEX A;  1EUT A;  4AG4 A;  1JZ6 A;  3GXU A;  3HEI A;  2V4V A;  4JKL A;  2VQU A;  4Z2A A;  3FN9 A;  2VZR A;  4W50 A;  4ZY9 A;  3NQH A;  4KWU A;  3MV0 1;  1JI6 A;  2J1S A;  2VZU A;  3WNK A;  3C7G A;  2VTF A;  1CZV A;  1PMH X;  3F2Z A;  5C71 A;  2W3J A;  1T2X A;  3I2J A;  4BXS V;  1JYV A;  1GOG A;  1H6Y A;  2Y6H A;  2VQT A;  4ARY A;  1US3 A;  1PMJ X;  1O59 A;  3C7E A;  3CKH A;  2EIB A;  5DPN A;  3IB3 A;  5HPO A;  2LS6 A;  2XON A;  4CUC A;  1J84 A;  4P08 A;  2Y6K A;  1L7Q A;  2Y6G A;  3LQC A;  5F7U A;  1HN1 A;  2J1R A;  1UY1 A;  2J1E A;  2ORX A;  2WDB A;  4W4Z A;  2EID A;  4XUN A;  4BK5 A;  5B4N A;  1XNT A;  5JXJ A;  3III A;  4MGS A;  4A6O A;  1JYX A;  2B9V A;  2BER A;  2E31 A;  3MUZ 1;  2VZP A;  2Y6J A;  3GDB A;  1JYW A;  3ZM8 A;  3I2K A;  1NKG A;  1DYO A;  2VOT A;  2YG0 A;  2WAA A;  2JE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...