3F3BA

Structure of the phage-like element pbsx protein xkdh from bacillus subtilus. northeast structural genomics consortium target sr352.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
RQMLIHRCDIYHEAAQAPSAGRFGIPADRLQPVISYPDTPDEQDVPCYFTEKTQQLIQEEPDQTVYHSFLVHFPLSADIRVNDKIIWENHKYILKLPKRIRHHHWEVVAVRDESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phage-like element PBSX protein xkdH
publication title Structure of the phage-like element PBSX protein xkdH from Bacillus Subtilus. Northeast Structural Genomics Consortium target SR352.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12206 DUF3599 Domain of unknown function (DUF3599)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.370 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3f3bA00
3F3BA
chains in the Genus database with same CATH superfamily
2IJD1 1FLEE 1EQ9A 3SNBA 3U28C 1AWFH 4BXWA 5KEDA 1TGCA 1GBEA 5JPMH 1IQLA 1P12E 1S85A 4H4FA 3RXVA 1SHYA 2IJOB 2ZU4A 2EI7A 4LXBH 4JK6A 3RXKA 4BAHB 1OP0A 1C5ZB 3H7OA 5I25A 3KHVA 1O5AB 5AFYH 2STBE 2XWAA 3UR9A 5FCKA 1TALA 2RDEA 5LGOA 3U8TH 1A0LA 2C8WB 1JWTA 3MH4A 1TNHA 4INHA 2FX4A 1PYTC 1RTKA 3GCNA 2FPZA 1O2XA 3OU0A 1SBWA 1S5SA 1WQVH 4K2YA 1A61H 1SGIB 1HNEE 3LU9B 5IK2D 2KR7A 5B6LA 2H9HA 1O2SA 1DWEH 2W3IA 4HFPB 1C2HA 4H6TA 2AGGX 2WPDD 3GYMA 5DGJA 2F3CE 2QXGA 2UWLA 3DFLA 8LPRA 1O3IA 3M7TA 1C5QA 1K1NA 3QTVH 5TJXA 1YPGH 2BYAX 3W1EA 2A4GA 2V3OH 2V6NA 5C17A 1Y3WA 1QR3E 1SLWB 2GCTC 1NFYA 3EGKH 1FPHH 2VIWA 4M7GA 1CGIE 3QUMP 3BEIB 2ZU3A 3F2GA 3RMNH 4ABIA 1G3CA 5K7RA 3NPSA 1LHFH 1QHRB 2ZPQA 2WPLS 1PPZA 1X7AC 1SGPE 4WY3A 5F6MA 2SGDE 3P6ZB 1HUTH 2R0KA 1C5RA 3KNXA 2F9VA 1A0HB 2QA9E 4X2XA 5L6NH 1UHBB 1AI8H 1LCYA 4IGDA 1TPAE 1A5HA 1F5RA 1ZMJA 1SLXB 1EX3A 2ALPA 1C1VH 2ZDAH 1C2JA 4ABHA 2FOEA 1DFPA 1HAXB 3FFGA 4ISIH 2H9TH 2XC0A 1GI8B 3LC5A 3SHAH 3PLPA 2QN5T 1GHAG 1WU1A 4Y8YA 1NRSH 1ELEE 1SGTA 1E79D 2ANWA 2J34A 1TABE 4ISNA 4ZAEA 1GBAA 4ASHA 4X6MA 1CU1A 1O5FH 1D4PB 3RXSA 4DOQA 3SO3A 3ZZDA 3M5NA 3RDZA 4DURA 2BY5X 1QGFA 2P93A 2VGCC 5CHBA 1P2JA 2CHAC 3Q00A 3SNEA 2A32A 1O38A 1GI6A 3ZIAD 4YM9A 3F0PA 1YCPM 1C1PA 5JYIA 1C5OH 4MPVA 3IITA 1C2FA 5C2ZA 2SGQE 5C3NA 2K0QA 2VINA 5EGMA 4KKDA 5TCCA 1O3DA 4J2YB 1TE0A 4NCYA 2ZPRA 4Z1MD 4Q63A 1BTWA 2SGFE 1G37A 2PUQH 2BDGA 2O8TA 3P17H 3TH3H 4GHQA 1GHAF 1XKBC 4ZCNA 2EY4C 3FKSD 5LPRA 1P01A 3KEEA 4F55A 4RT0A 5DJ7A 2B8OH 3UIRA 1W11U 2EC9H 1CGHA 1V2MT 1EFRD 1DXPA 1QTFA 1VKYA 1VJ9U 3QTOH 1BHXF 1GBCA 4X1PU 2XOKD 4KP0A 1H1BA 2VJ1A 3B9FH 3ATKA 3VB5A 4ABBA 1EB1H 3ZZBA 2ZU1A 2O8MA 1MQ5A 4AX9H 1MTNC 3ATLA 1SGFA 1MBMA 4B2BA 1GDQA 3M5MA 4NWLA 5C20A 1IAUA 1CA0B 1K1OA 1EATA 2NU4E 5DSFA 1OYTH 3UR6A 4IC5A 4M9FA 1HAYB 1IQIA 1Z8IB 1ESBA 3TITA 5B6OA 2Y81A 1E37B 4FUFA 4FUIA 2PSXA 2PWXA 4UFFH 1DPOA 3QO6A 5A0CA 4X1SU 3BTEE 4ABJA 3A7TA 1P3CA 3PO1B 1C5WB 4ACBA 4YXWD 3TH4H 1BTXA 2TGAA 3KQBA 4GPGA 1KXBA 1FQ3A 2KX4A 2Z6BD 4X8UH 5T3HA 1QBVH 4MG3A 4E7NA 3SUEA 1EAWA 4TY6A 4NWKA 1MZDA 1C2LA 2P94A 3TU7H 3U8RH 2HVXA 3AAUA 4Y7BA 1HRTH 4ZROA 3D49H 4KTUA 3SGAE 1GDUA 3FN8A 3PMHB 1EAUA 5FPSA 4U30A 1ZHRA 4XOJA 1P03A 3A81A 4UEHH 5A09A 1BTYA 2OK5A 2TRMA 2BVSH 1O2OA 1OHHD 5PTPA 2PHBA 2XRCA 3FAOA 1B7XB 3S7HB 5C5NA 1H9HE 2F43B 3P8NA 4XRNA 5H4IB 1AN1E 3F2HA 2ZC9H 1TYNA 2Y5GA 3STIA 1MKWH 4TWWA 4HZHA 4A1XA 1ZHMA 2XWBI 3BG4B 3TK6A 4Y79A 1AZZA 3S9BA 1IQEA 2TPIZ 1GBJA 1GBFA 2Z9JA 3TK9A 1EJMA 1LHDH 1QY6A 3HK6B 1A1RA 1NO9H 1JBUH 3A7WA 2KCOA 1T4VH 2FTMA 4NSVA 3UNRA 5EJLA 1PQ8A 5HXFA 2JH6D 2OC7A 3MU5A 3SU2A 1KXFA 4CH8B 1AZ8A 1D9IA 1GI7B 6LPRA 1WDIA 1TX6A 2J92A 1GMCG 5EU8A 4DG4A 2BD3A 2QF4A 2ZGJA 2OUAA 1OXGA 5GIBA 1OPHB 4ZHMU 3BG8A 4B2AA 1O2HA 3LGIA 1AWHB 2TGTA 3OFND 4MPXA 4X1QU 1PQ5A 2P3TB 2A7HA 2GGVB 3CENA 4DIHH 1C5YB 1GG6B 4TYDA 1F2SE 2BY9X 1TPOA 1ZRBA 4NA7A 5F53A 1C5UA 1NT1A 1HAVA 2ODQA 1TONA 1EZSC 2EQNA 3GY2A 5DP6A 2FMJA 2G4TA 2IPQX 4JZ1A 4P02A 1ELCA 5E8EH 3S9AA 2V0BA 3EDXB 1RS0A 1TMBH 1O3HA 1QA7A 4ABGA 2ZECA 1VITG 4X8VH 2H5DA 4B75A 1Y3VA 1MQ6A 4FUBA 4OS5A 2BDYA 1MKXH 1P8VC 1GMCF 2R3UA 1HIAB 1ANDA 1P3EA 2BHGA 2ZHFH 3DSPA 4AYVB 3KF2A 1LVOA 1QRXA 2I6SA 4UFDH 2FS8A 3SORA 5TCAA 3SN8A 4YZUA 4Q7ZA 1KXAA 1DSTA 2BDBA 1OOKB 2FI4E 3C1KA 5FBEA 3ATIA 1TBQH 2HGTH 2KCYA 3ESTA 2VB0A 2V3MA 4X6PA 1EP5A 3MU0A 1Y3UA 7KMEH 4AGJA 1DM4B 4A1TA 4JZFH 1HAGE 1PFXC 3UFAA 1D3PB 3R0FA 3LH3A 1FMGA 2W5EA 1NPMA 2FOFA 1QRWA 1UTJA 2ANMH 3PM3A 4AFQA 1D3DB 3SZEA 3MU8A 3F9GA 2FS9A 1VITF 4O97A 3TJOA 5SGAE 2PKAB 5DP4A 4ZUHA 4FVDA 3OEED 3RXRA 1DDJA 3KQ5A 1DOJA 3JZ2B 1AU8A 3EA7A 3SI3H 2SGPE 2A45B 1O5CB 2ZDKA 3LJJA 3ZZ4A 2GZ7A 3FVFB 2A5KA 4CHAC 1TOCB 1MU8B 5C94A 1G9IE 4DIIH 2A31A 4UDWH 2VIDA 1TRMA 2R0LA 3M5LA 1JOUB 3ZZ9A 4Y76A 4BTTB 1ETTH 1AVWA 1O35A 4IN1A 5CHAC 2I6QA 3CNRA 2VVCA 1QQ4A 3RMLH 3BTME 5AHGH 4DT4A 2SFAA 4NA9H 3SJKA 1H9LB 1BMNH 3O8CA 2ZPSA 3W94A 3MO6A 4AOQA 1HCGA 1UJ1A 1YLNA 2P95A 2DE9A 2H1UA 1UK4A 3OTJE 3LOXA 2B9LA 3VEQB 1BTUA 1O2UA 1MABB 1AFQC 3RXJA 1D6RA 1W0JD 1V2QT 2K1QA 3ZVGA 2BQ7B 4B74A 3AK5A 1LPKB 3RM2H 1BB0B 1JIMA 4ACAA 5A0AE 3MH7A 1EXFA 1ZMLA 1TMUH 1HB0B 2PLXA 1ELFA 3QK1A 2C8XB 5EQRA 5FBIA 1ZPCA 4NIVA 1UVTH 3NKKA 2BD7A 4K1SA 3ZV8A 4B1TA 4XBBA 4CREA 1WSSH 1UW7A 2GT7A 2CV3A 3F1SB 3MMGA 1HIAA 1C4Y2 1HJ8A 1HFDA 1K1IA 3FP7E 3OX7U 4ISLA 4XD7D 1NRRH 1GHBG 1ZRKA 1M9UA 1QL9A 4GSOA 4TPYA 1OP2A 3PWCA 5HYOA 2JETB 2AEIH 1O37A 1SMFE 3UOUA 1HJAB 5GNDA 5GPIB 3I78A 4K1EA 2AIPA 2Z9GA 1GBBA 8GCHG 1CHGA 2ZDMA 3A8AA 2FDAA 4LK4A 5T6GA 4OS4A 2VIOA 3P70B 3TVJB 1GMHG 2HPPH 2BOKA 2VBCA 4ZMAH 1A46H 2F83A 4E7RG 1W3CA 2TIOA 4O3UA 4Q80A 1G3DA 1FY1A 1QB9A 3A7VA 4PROA 4ZKNU 2J98B 2OTVA 1K2I1 3E90B 3LGWA 1LO6A 3LT3A 2ZU2A 1GCTB 1YBWA 2P16A 2C93B 5ABWA 1Y5AT 1P04A 2M2AA 2YOLA 1P2OA 1QNJA 1AGJA 2W3KA 2FLBH 4A5TS 3TGIE 1KXEA 4MDSA 1EJNA 2J5UA 4AG2A 3KQDA 3RXLA 2PKAA 1ZGVA 5EQSA 4D7GA 5LPEA 5EW2H 3PWBA 1GI0A 3GYLB 1W10U 2PW8H 3GY3A 1Z71A 3IWMA 1GHBF 4ISOA 4A6LA 1KIGH 1C5XB 2SNVA 1C1QA 2C8ZB 3FANA 1NY22 2WYJA 3K2UA 3ZYDA 1FDPA 1MZAA 1NROH 1HGTH 3BEUA 5F03A 3WW7A 2A7JA 3ITIA 3LGVA 8GCHF 5HIYA 1UK3A 5JBBS 3LONA 1TA2A 3HKIB 5DP3A 2HALA 5HM2A 1GMHF 1N1LA 2FOBA 3GCTG 1LVMA 1O34A 4X1NU 1C4V2 1G30B 3LC3A 1ANBA 2A4RA 2Z3CA 4Y8ZA 1RTFB 5E0GA 3NXPA 2OINA 3FP6E 1B5GH 1FY8E 1XUGA 3M7QA 1C9TA 1PPGE 3KIDU 3PMJA 3ZZ3A 1DITH 2ZTXA 1ELVA 2O8LA 2YNAA 1OSSA 1O3GA 3EYDA 2HRVA 4H42U 2AFQB 3HGPA 3SV2H 4GVUA 3RXIA 3SU0A 2XCNA 1EUFA 2EI8A 2GD4B 4YT6H 3RU4E 1BA8B 2ESTE 4BTIB 1TNLA 1C2IA 3T25A 2ZF0H 2VIQA 1F5KU 1GL1A 2J2UA 2VVVA 2G00A 2BLQA 1FONA 1TOMH 2D1JA 3UQOA 2JIZD 1ANCA 2Y7XA 3UNSA 1NRPH 2PKSC 2ODYB 1Y5UT 3GCTF 4AG1A 1ELDE 3RXMA 3BIVH 5DG6A 5DK1A 1GBMA 1BBRE 1T4UH 2O8UA 1UCYE 4K3JA 1EAIA 2FOGA 1BUIA 2R3YA 3GCHB 1IQGA 1DY9A 2O8WA 2FIRH 3ZVDA 1KXCA 3D23A 1SQRA 1SSXA 4YLQH 5FAHA 4FU8A 2Z9IA 1FY4A 5BRRE 4MNVA 3VB3A 1ID5H 1GHXH 2WV4A 2GVFA 1D3TB 1E1QD 2HVYB 2FEQH 1O2GH 1GI2A 3U69H 1CA8B 1ELBA 1MAXA 2BVXH 1O2MA 4NZLA 1XMNB 1YY3A 2KFWA 4BAMB 2B5TB 4Y0YE 3F9FA 3H5CB 5G4BA 2J98A 2XTTB 2HOBA 1SB1H 2PUXB 6ESTA 1MCVA 1J17T 1PPFE 3OAAD 4B76A 1C9PA 1EPTC 3F0OA 1HDTH 4NG9H 1C4U2 3E0PB 1P10A 1RIWC 1TNIA 4CRAA 3QWCH 2QAAA 1V3XA 4YO9A 2H2ZA 5LH8A 1PPHE 4WH8A 3PTNA 2BD9A 1BZXE 2R2WU 1F0RA 1Q2WA 3O8BA 2XBWA 3C27B 2QC2A 1NTPA 1PQAA 4AGKA 1C5VA 3PV2A 1SQOA 3M3VA 3E8LA 2Q1JA 4K8YA 4TT3D 4I32A 3E3TA 1UTKA 3SUGA 5E2PA 4WXVA 2BTCE 4BAOB 2VGCB 1GBTA 4THNH 2CHAB 1DT2A 3Q77A 1LQEA 5FXLA 4U2WA 3ZZCA 1EOLA 4WF8A 1OWKA 1AE8H 4DJZB 4Y0ZE 4FOUC 1ZSJA 1EKBB 3T27A 2FOAA 3LGYA 5ESTE 4HG6A 3A84A 1DICA 1NU7B 2QXIA 2BD4A 3FOAA 3UUZA 3MNXA 3A8CA 2J38A 3T62A 1E38B 1BHXB 1GI4A 1P9UA 1DWDH 4YTAA 1C5LH 1O3JA 1K1PA 3S69A 1O30A 1BBRK 1GDNA 1UCYK 1GJCB 1TPSA 2H5CA 3GISB 1WUNH 1DLKB 2FXRA 2GMTC 1CT4E 2Y6TA 3AASA 1TQ7B 2F9OA 2GV7A 1LQDB 3RXGA 1ARCA 3N7OA 4TY7A 1BTHH 3MQKC 2C8YB 2UUKB 4O03A 1C1SA 1KXDA 4Y10E 2QF0A 4AC9A 1RJXB 2FX6A 2PTNA 2SGAA 1O31A 3U1JB 5DKMA 2WPJS 1GCDA 1Q31A 4IMQA 1GJ9B 9LPRA 1ZYOA 1FJSA 4UFGH 2WPMS 4FU7A 2BY8X 3LGTA 1D3QB 3N7EA 4MPUA 3SJ9A 1ZJDA 3NWUA 1MTNB 3DT0H 3RM0H 3M7UA 1XX9A 3RMOH 2ZTZA 1TX7A 4OGYA 1LHEH 4P00A 1HAHH 3UNQA 3ZYEA 1K0HA 1C1RA 4WVPE 3NRLA 2H6MA 2EA3A 1ESAA 2CK3D 4AORA 1BRUP 4INKA 3M3TA 1HPGA 3R3GB 3SNAA 4ABFA 5EIYA 1O3LA 5C0TA 1H8ED 2VH0A 1P2KA 1QBOA 1T8NA 1TBRH 1ZMNA 1IOEA 4OM9A 1ZPZA 4FXGH 2KM0A 1GJ4H 1SLUB 2OP9A 1TAWA 3ELAH 1DWBH 3GY6A 2RA0A 2AGIX 1AKSB 5EQQA 1BJVA 2A2QH 1UVSH 2HNTC 1QZ8A 3MH5A 1AMHA 1Q3XA 2A2XH 3BIUH 1UHBA 2ZCKP 3RXQA 1SC8U 5JB8S 1XXFA 2H9EH 1O2ZA 2Z3EA 1EJAA 1QFKH 5C1XA 3GY4A 4CRFA 8ESTE 2ZQ2A 4D76A 3KYGA 1BMLA 3PRBA 1SVPA 1BITA 1RFNA 1O2VA 2RG3A 3RXEA 2FI5E 2VIPA 2HNTF 1PJPA 3QLPH 4ASUD 1JXPA 3MH6A 2EEKA 1C1UH 2PR3A 1C1TA 2WV5A 3ZVFA 1CA0C 2XCFA 4Q7YA 3ZZ7A 2WHXA 1K22H 1MTUA 3PROA 1O3EA 1IQHA 1OWIA 1OP8A 3MU4A 1SPJA 3TNTA 1QBNA 1YPKH 3BTQE 1MTSA 3DA9B 2C4FH 2RCEA 4A7IB 4Y6DA 4GHTA 1XUIA 2FOCA 3RXTA 1O5EH 4B6FA 1HAOH 1O3FA 3MNCA 1SOZA 2QV1A 2WSSD 1EB2A 3WWBA 1MTWA 2ZGHA 2JJ2D 2OQUA 5FX5A 2R2MB 3O8DA 1L2EA 4MNXA 1FZZA 4NSYA 2G4UA 1V2WT 4B6EA 1G3EA 1QQUA 2ALVA 3N7DA 1HYLA 2VWMA 1SQAA 2ZO3H 1BIOA 1PPEE 2XNDD 4K60A 3SYJA 3LJOA 1VCWA 1O36A 2IN2A 4XBDA 3TIUA 1SG8B 1VGCC 2A5IA 1N6XA 1LDTT 2GV6A 1K1JA 3ZVBA 2HPQH 1FN6A 1FAXA 3V13A 4E05H 2GZ9A 4NZQA 3MYWA 1OYQA 4WWYA 1HAZB 1XKAC 3NZIA 1H9IE 2YMSC 3TK5A 1V2VT 3FZDA 1AE5A 1TFXA 3LPRA 3GDUA 4Y11E 3F9HA 1W2KH 3BG4C 4IMZA 1TGNA 4OS2A 4X0WU 1BDAA 1Z6EA 3BEFB 1K9OE 4JYTA 2BX4A 4X6NA 5JDUB 1SGDE 4OS1A 5HIZA 3BTHE 1P09A 3F6UH 3RUOA 2C3SA 1T8LA 4CRBA 1C2DA 3SNCA 2ULLA 1C1NA 1RRKA 3TJUA 3RXDA 2J97A 1COWD 1P2MA 1THRH 5J4SA 1W8BH 1ZPBA 8KME2 2WPHS 1XVMA 1W13U 1O33A 3EAJA 1YPLH 1H8IH 5FCRA 3LIWA 5DPAA 4FUDA 4U01A 2BD2A 1GVLA 4DY7B 1AD8H 2R9PA 2AMQA 4VGCB 1QJ7B 1DS2E 2W7SA 1V2LT 1YPHC 1GG6C 4UE7H 2XYAA 4RN6A 1O3BA 2AH4X 4XE4A 2Z7FE 4AYYB 2XNIA 3CS7A 1K21H 1P2IA 1V2PT 3PV4A 1GHYH 1O3NA 3URDA 2FM2A 4XBCA 2XXLA 2ZHWH 4E06H 4OS7A 2BLVA 1EOJA 1EZUC 1RXPA 4JYVH 4BAKB 3PV5A 2A0QB 1LPGB 5J4QA 1RD3B 2Y7ZA 3FO8D 2ANYA 1H8DH 3VXEH 1GMDF 2QF5A 5IYTA 3VGCC 2FYRA 4Q7XA 3MI4A 2QCYA 1JMOH 4CHAB 1N8OC 5AVDA 4MTBA 5F8ZA 1AHTH 4KELA 1A3BH 3T26A 2W6JD 2Q6FA 5EOKA 4ESTE 2ZNKH 3SJIA 1GI5A 3A82A 3NUMA 1AQ7A 3SQHE 5CHAB 1MMJN 4BANB 2ZFPH 1S6FA 4YLUA 3ZZAA 1MD7A 1O32A 2NU0E 5C0UA 1HAPH 1AFEH 1EASA 3VG8A 1NU9A 1VR1H 3BTKE 3OY6U 1AO5A 1UTNA 3A87A 1YPEH 2AS9A 2P8OC 5BPEA 2BLWA 2AMDA 1O2WA 2BD5A 1MCTA 4X8TH 3RXOA 1T8MA 2L6OA 2TBSA 2PGQB 3ZZ5A 1ESTA 2XBYA 3V12A 1KTSB 2QXJA 7LPRA 1AFQB 2ZDVH 5T6DA 3UB0A 1QJ1B 4ABEA 2PSYA 3MU1A 3KN2A 1DANH 1XUKA 2FOMB 2G52A 2RA3A 1WYKA 3GOVB 3A80A 1Z8RA 4MPWA 5DP5A 3UREA 3UY9A 1A3EH 1OWJA 4ZKRU 2TGPZ 2CJIA 2ZU5A 1GBDA 1W0ZU 1ELGA 3SUFA 4WMFA 6GCHG 2Z3DA 2HWLB 2GZ8A 1GHWH 4SGAE 5FX6A 1HLTH 1LHGH 2THFB 1TRYA 6CHAB 5DO4H 1YC0A 1GBKA 1MH0A 3AW1A 4X2YA 4YT7H 1WBGB 3A7YA 2BX3A 3STJA 3VB6A 5K0HA 1VCQA 1G32B 1S83A 1IQNA 1P9SA 2ZZUH 3K6YA 1WAYB 4ZHLU 1XVOA 2ZGXH 1FIZA 1AVXA 1P0SH 4JYUH 3SBKA 4XSKU 1S0QA 2BM2A 1RGQA 1BBRH 1ELTA 1Z7KA 2VNTA 2ZWLH 1SGCA 2GKVE 5KGOA 4NA8A 4BXSA 3P8GA 3DD2H 5ESBA 1PQ7A 1NFUA 5E2OA 3IG6B 3AAVA 3S7KB 2FYQA 2ZFTA 4JCNA 1TLDA 1E1RD 3SU6A 1YKTA 2P3UB 5FPYA 4AFZA 1TB6H 6GCHF 4KTSA 3UWIA 1QA0A 1CBWC 3MNBA 4FUCA 3MHWU 1V2KT 4IW4E 3M3SA 4LOYH 1FXYA 3OSYA 4B73A 3SI4H 4YOJA 7ESTE 1O5DH 5HKKD 1ZZZA 3RLYH 5FHTA 3T28A 1YGCH 2Z9KA 3ATMA 4NIXA 1ETRH 3GCOA 3MTYA 1O5BB 1SHHB 1O2IA 1GGDC 1UVUH 1GI9B 3M61U 4WXIA 1ZTJA 3A7XA 1C2GA 3A86A 3BTTE 1T31A 1AB9B 3RU4D 1G36A 1W0KD 1L1NA 1WQSA 4ZXXH 2FODA 2XBXA 3T2NA 2FO9A 2ZGBH 4MVNA 1YP9A 4BOHA 4K8BA 2GT8A 1GCTC 1CE5A 1NRQH 3GY5A 4JZDH 2ZFFH 3D65E 3LH1A 4IN2A 1UTMA 5GCHF 2XC4A 4JZIA 1INCA 1QJ6B 5AFZH 1J16A 2OXSA 1C1MA 2ZGCA 1KLIH 4UD9H 3A83A 5JBAS 2XW9A 1DY8A 1ABJH 1GJ5H 2AHME 2GP9B 2WPKS 3SV6A 4JZEH 1KMHB 3SU1A 1QIXB 2ZHDA 4I33A 1KTTB 2CGAA 4HI3A 1KLTA 3SJ8A 1XM1A 1NFWA 2QGRA 1PYTD 2ZCHP 2PKSB 2BY6X 2ZKSA 1C5TA 2ZP0H 1QRZA 1YF4A 2JJ1D 2NU1E 1NN6A 1W0YH 3DSOA 3T5FH 1CQQA 1GBLA 1HXEH 4DGJA 1C5NH 1UMAH 3OY5U 5HM9A 4O3TA 3VPKA 1E34B 1BRBE 2J4IA 4WMEA 4GUXA 5DP7A 1KDQB 1ZSKA 1TIOA 1O3PB 5L2YH 1GBHA 3A7ZA 2QY0B 3HK3B 1O39A 1O2YA 3N99A 3DHKH 1EAXA 1JRTA 4BNRA 4I8KA 1EZQA 3M37A 2RFKC 1ZTLA 3HATH 3EE7A 1GPZA 1Y59T 2L74A 2SGEE 2STAE 1EP6A 2F9UA 1FUJA 1E0FD 2BZ6H 2GCTB 1A7SA 4Z0KA 3ZVAA 3SJOA 1O5GH 2P59A 1GI1A 1YLCA 4TWYA 1UK2A 2AMPA 2QIQA 1EPTB 2PP6A 1S0RA 2JKHA 1RIWB 3CS0A 1P11E 1W7GH 1O3AA 1DLEA 1GVZA 1NESE 1WXRA 2KZ4A 4JK5A 2DUCA 2SNWA 5JBTA 3SW2B 1P2NA 3RC5A 3WWFA 1SR5C 2XBVA 1W12U 2QF3A 1GVKB 2VU8E 4GCHG 2ZIQH 5E0JA 4LZ4B 1FIWA 2G5VA 2GDDA 2FZZA 2WUCA 1TA6A 5EJ1A 3BF6H 2F91A 3PMAB 1LVBA 1GJ7B 3E6PH 1A2CH 3M35A 1HAIH 1P2QA 2ZG0H 3GCHC 2D26C 1SGFG 1CSOE 5AF9H 1MBQA 1S6LA 1S6HA 4MQAA 3SUDA 2XC5A 3L3TA 4WH6A 1Z6JH 5CDFE 4U32A 1Y3XA 4RSPA 1QCPA 2BVRH 2ASUB 2BXUH 3QZRA 1NFXA 2NWNA 3D62A 5ETXA 2WZQA 5EPYA 2UUJB 1VCPA 5EJZA 4Z6AH 2V7QD 4B71A 1YCPK 1LVYA 3LGUA 4RI0A 4I7YH 1C5SA 1SQTA 1BMMH 4NIWA 1B0EA 3H09A 5GXPA 1BTZA 1TPPA 2A4QA 1QL7A 4B2CA 4GCHF 4RKOB 4WJG2 4CR5A 3SQEE 4CBOA 3BTFE 5KECA 5DN6D 2FESH 1THPB 3ODFA 4K69A 5DP8A 1GBIA 2GMTB 2V3HH 1K1LA 4INLA 2OBQA 4AFSA 3U8OH 1TNJA 1WV7H 1ETSH 2UWPA 1F92A 4AB8A 2CF8H 1HV7A 1V2OT 2A4OA 2A5AA 3S0NA 1PPBH 3SV8A 3TNSA 3O8RA 2BZAA 1BJUA 1AUTC 1LTOA 4Y71A 2W6ID 1NM6A 1HXFH 1SGNE 2OC8A 1GJDB 1G2MA 4RT1A 3RMMH 4X2WA 3A88A 1G2LA 1KDQA 1DX5M 4KGAA 2BDHA 3F9EA 2KAIB 1S84A 1A4WH 3V0XA 3BTWE 3F3BA 1OS8A 1GJBB 4KTCA 3LDXH 4D9QA 1BT7A 2IPHA 4FUEA 2Y5HA 5JB9S 4BTUB 1AUJA 3QDZB 1XUJA 4NFEA 4RKJB 3E1XB 1IHTH 3Q3YA 1S82A 3A89A 1ZTKA 2KCPA 3BSQA 4ZKSU 1EPTA 3ZZ6A 1MU6B 2LPRA 4YOGA 3SGBE 4F48B 2PFEA 1LMWB 3MO3A 1BRCE 5T6FA 2QXHA 9ESTA 3ZV9A 4FETA 1A0JA 2NU2E 2OBOA 1UTOA 1SGQE 1W14U 2BLOA 2F9BH 3AW0A 1DSUA 2BQWB 1O3MA 5A2MH 1ZGIA 3URCA 4ZH8A 3TLOA 2WPIS 4Y7AA 1AIXH 3PB1E 3HGNA 1V6DA 5JBCS 2LELA 4X6OA 1XXDA 1VJAU 3HPTB 3T29A 3MNSA 1GJ8B 1JIRA 5GJ4B 1HAVB 1FY5A 2ZCLP 3QGNB 4YESB 5C67A 2FI3E 1DUAA 3ODDA 3UQVA 2G8TA 3UPEA 2OC0A 2FTLE 4O9VA 4ZKOU 2Y80A 4GAWA 1TX8A 2HNTE 1SL3A 1O2PA 4TSFD 4ZHAA 3SGQE 1Y8TA 1Z1IA 4OGXA 1CVWH 1FY3A 1QURH 4D9RA 1ZLRA 5A0BA 5T1VA 3E16B 2BQ6B 3PYHA 3BN9A 1T7CA 1SGEE 1BMFD 2VWOA 3EA9A 2IOTA 3KQEA 3L33A 1THSH 1UO6A 4K5ZA 3ZVCA 4F4OC 5A8ZA 1F0TA 1Z8GA 2AERH 1GWAA 1N6YA 5EXMA 4HTCH 2G51A 5HGGA 3BTGE 3FZZA 1MD8A 4I8GA 3RXCA 1FI8A 1WCZA 3QGJA 2ZHQH 5C1YA 3PO1C 1H4WA 3DFJA 2OCVB 2Q6DA 3VB7A 1A5GH 3A8BA 3S9CA 1L4ZA 2A1DB 4ABDA 2ILNA 3QZQA 1YPMH 3Q3XA 1EZXC 1Y3YA 3DUXH 1HBTH 2BDIA 1TGTA 1BRAA 1CT2E 2NU3E 1VGCB 5EXLA 2BDAA 3ZVEA 1ZSLA 2UUYA 1VITH 3UWJH 1AY6H 1JRSA 2GTBA 1GHVH 3K65B 1NBMD 1SI5H 3GDSA 1O2LA 3JZ1B 3U98H 2KAIA 2C90B 3WY8A 2YMSD 1P02A 1QB6A 2YMSB 1Z1JA 1L0ZA 4J1YA 1FV9A 3SNDA 2JDID 1L1GA 3V3MA 1S81A 2QYIA 2Y82A 3PMBB 4DCDA 3DSGA 4ZXYH 3SHCH 4AN7A 3KYFA 1F5LA 1C2KA 4TPIZ 1O0DH 3BV9B 3FP8E 5EG4A 1FX0B 1Z8JB 4X1RU 1UVOA 3U9AH 4NFFA 1UTPA 4QT8C 3RXHA 2HLCA 2CMYA 1O2JA 3OYPA 1YPJH 4CRDA 1L4DA 1NBME 3P8FA 3P95A 1YM0A 1DWCH 2UWOA 2LNCA 1CGJE 1LKBA 1GHZA 3ATWA 3GS9A 1OWDA 4I8JA 1L1JA 1F0UA 5C1UA 2CF9H 2F9PA 1K28D 2B0FA 1MUEB 5EW1H 1GMDG 1ZHPA 3TGKE 1H8HD 1TRNA 2OQ5A 4MNYA 1AKSA 1C1WH 1FPCH 3A8DA 3RXUA 4NIYA 5F8TA 4D8NA 2RDLA 2TGDA 2FP7B 3U1IB 1V2NT 1YWUA 2BXTH 1SFIA 1O3KA 1O2QA 4IBLH 1DXWA 2AGEX 5EODA 3SV9A 1F0SA 2QE7D 4AZ2B 1E36B 1O2TA 3H7TA 4SGBE 3ZZ8A 1NRNH 1O3CA 2CXVA 1ARBA 1XUFA 3VGCB 1C5MD 3TPIZ 4CRGA 2PTCE 3SU3A 2F4LA 1BOQA 3MOCA 1N8OB 1CHOG 1YPHE 1KLJH 2G55A 2W7UA 4FU9A 5E0HA 1U6QA 2BOHB 1TNKA 2OD3B 1ANEA 1SKYE 1VZQH 1WOFA 2J94A 1P05A 3NK8A 5GDSH 1V2RT 2Q6GA 5A8YA 3QX5H 4I31A 1DE7H 2ZEBA 3A85A 1BQYA 1AVGH 1O2RA 5HMAA 3KL6A 2ZHEH 2BY7X 3K6ZA 1A5IA 3EQ0H 3EE0B 3RC6A 1WTHD 2G81E 4FUHA 4VGCC 4CH2B 2K8IA 1YYY1 2PV9B 3AVZA 2ZDLA 1K1MA 4R0IA 1BMAA 1O3OA 2P8OB 3GY8A 2EI6A 3EA8A 3MO9A 2ANKH 1OWHA 5A8XA 2GX4A 1NS3A 2OC1A 1OWEA 1TMTH 2J9NA 2W26A 5EXNA 2VIVA 2ZDNA 1UTLM 2WV9A 1GJ6A 1TBZH 3L6PA 1D6WA 1YLDA 3RC4A 3OE7D 3W95A 1IQKA 2GCHG 1V2TT 1CHOF 1J9CH 2Z94A 1FN8A 3Q3KA 2ODPA 1O2KA 3E91A 4K1TA 2JH5D 1ACBE 3I77A 1ELAA 1IHSH 3RP2A 1XUHA 2ZTYA 1NZQH 4NGAH 1C1OA 1ZJKA 1BCUH 4I8LA 3KGPA 1MAYA 1NC6A 2HLDD 1C2EA 4I8HA 1IQMA 1P57B 4JMYA 2YNBA 2KCAA 4MLFB 1CT0E 7GCHG 4UONA 2Y5FA 2WINI 1KYNA 4X2VA 3SV7A 1ORFA 4AFUA 3OTPA 4YOIA 1J14A 5F8XA 3PLKA 4Q2KA 2ZFRH 1GJAB 4GLYA 3VB4A 5DP9A 1YCPH 3VFEA 3RXFA 4IC6A 3TJNA 3V7TA 2WUBA 2P3FH 2UUFB 4XFQA 2VH6A 3RXBA 3F68H 2JH0D 3RLWH 1FNIA 3SZNA 2DE8A 2GCHF 3P8OA 1T32A 3GDVA 1SLVB 1SOTA 5FPTA 2ZA5A 1B0FA 5IDKA 1P06A 1TNGA 4AB9A 1KY9A 1QL8A 2ZI2H 3KCGH 5GWZA 2V35A 3K9XB 3RXPA 3QN7A 4ABAA 2AYWA 2BDCA 1LKAA 5L2ZH 3DCLA 1OX1A 5EPNA 1V2UT 1UCYH 4UFEH 2FOHA 1CBWB 2ZFSA 3KQCA 4XDEA 1UVPA 1KSNA 5GCHG 3MFJA 3PLBA 4H6SB 7GCHF 3TJVA 3SU4A 5CMXH 3MWIU 1CO7E 1MKWK 3ENSB 3CP7A 3LKWA 1MTVA 4F49A 3HKJB 1LPZB 4I86A 1C5PA 2OLGA 3SU5A 4FVBA 6CHAC 2AIQA 3M5OA 4FUJA 1SGRE 1SGYE 1GGDB 2O9QA 1GI3A 4R8TB 2LP6A 4DT7B 3GICB 4Y8XA 3TGJE 2ZFQH 2JETC 2M5TA 1Y5BT 1ZR0A 4DVAU 1GL0E 2ZQ1A 1G3BA 5LPFA 1HJAC 1ZOMA 1UTQA 2VVUA 4CRCA 1LHCH 2D2DA 1IQFA 5FL7D 3BTDE 3UOPA 3B8JA 1TGBA 4D7FA 1J8AA 2Z9LA 3E0NB 1W7XH 3RU4T 1C2MA 1T8OA 2A7CA 1F7ZA 2VWNA 4IS5A 3UTUH 3GY7A 1OKXA 2GJGA 2J95A 3NCLA 2FLRH 1PPCE 4DW2U 3G01A 5C5OA 2CN0H 1TGSZ 2B7DH 4A1VA 5L30H 1WTGH 3SOSA 2G5NA 3TH2H 3PTBA 2FWWA 3OEHD 1FAKH 4A92A 4X8SH 4BAQB 4Q4LA 3PRDA 3I29A 2WYGA 1E35B 1SFQB 4ISHH 2BD8A 2VWLA 5I46H 1DVAH 1QB1A 3B23B 3VXFH 4WMDA 1DUEA 1IQJA 1HJ9A 4CBNA 5CE1A 1ABIH 2PGBB 1TQ0B 2F9NA 1TWXB 4CR9A 4HGCA 1MKXK 3M36A 1AB9C 4MNWA 4FUGA 3UAIC 3F2FA 1O2NA 2BB4A 2GDEH 1BTPA 3RXAA 4LZ1H 3Q76A 1V2JT 1V2ST 1J15A 1RTLA 2D8WA 3P92A 4OS6A 2BMGB
chains in the Genus database with same CATH topology
2W6JD 1E1RD 2IJD1 3NRLA 3SU6A 3F3BA 5FPYA 3WW7A 2CK3D 4DT4A 3LONA 4YXWD 4KTCA 3O8BA 1N1LA 1BT7A 3O8CA 1SKYE 1CU1A 1WXRA 2KZ4A 5C0TA 1H8ED 2A4RA 2IJOB 3PV2A 4I31A 3M5NA 5C0UA 4B73A 3SUEA 3DCLA 4OM9A 5EPNA 3VG8A 3RC5A 3WWFA 2KM0A 2OINA 2YMSC 4NWKA 5HKKD 1NBMD 4TT3D 5CHBA 2KCPA 4B75A 4I32A 3RC6A 3LOXA 3ZIAD 3SU4A 3SUGA 2YMSD 5EQQA 1MABB 2K8IA 3F0PA 2YMSB 3LKWA 1W0JD 3EYDA 2K1QA 3DSPA 2JDID 2L6OA 4B74A 3KF2A 3AK5A 3FN8A 3SU5A 2K0QA 5FPSA 3M5OA 4FETA 1W0KD 3SU0A 2OBOA 1S6LA 2XCNA 3SUDA 4WF8A 4Z1MD 4WH6A 4R8TB 5EQRA 4Q63A 2OK5A 5CDFE 4K8BA 3UB0A 5IK2D 1NS3A 2KR7A 2OC1A 5B6LA 3KN2A 1OHHD 1FX0B 2FOMB 3PRBA 2WV9A 4XD7D 1COWD 2KCYA 2WPDD 3L6PA 5FL7D 3FOAA 3RC4A 2F43B 2LELA 3OE7D 2JIZD 3P8NA 5ETXA 5H4IB 4ASUD 1JXPA 2WZQA 3FKSD 4ZCNA 3OYPA 5EPYA 1DY8A 3SV6A 2AHME 1NBME 3F2HA 5GNDA 5GPIB 4A1XA 1KMHB 2XCFA 3SU1A 4U01A 2V7QD 3KEEA 4I33A 4A1TA 2WHXA 4F55A 5GJ4B 3SUFA 4B71A 4RI0A 3GS9A 3W1EA 2A4GA 1EFRD 5C17A 1DXPA 3H09A 2OC0A 2VBCA 1A1RA 2A4QA 3SZEA 1DY9A 1W3CA 2XOKD 2JJ1D 2KCOA 3F2GA 2XNIA 2HLDD 4A1VA 1H8HD 3DSOA 4TSFD 5DN6D 4JMYA 3OEED 3E90B 2KCAA 2FM2A 2OC7A 4B6FA 3SU2A 2FP7B 2OBQA 3OEHD 2QV1A 2GVFA 2WSSD 3SV7A 4A92A 1E1QD 3U1IB 3WWBA 4Q4LA 3OTPA 2JJ2D 2M2AA 3KNXA 2F9VA 3PRDA 3PV5A 2YOLA 5T1VA 2O8MA 3U1JB 2QF4A 3O8DA 2KFWA 2J5UA 3FO8D 3SV8A 1BMFD 3M5MA 4NWLA 2QF5A 3O8RA 1DXWA 5EQSA 4B6EA 3SV9A 2QE7D 3N99A 3N7EA 5DSFA 1RGQA 3N7DA 3M5LA 3OAAD 2W6ID 3OFND 4M9FA 4B76A 3F0OA 2OC8A 2F9UA 2GGVB 5ESBA 3F2FA 2XNDD 3P8OA 3SYJA 2P59A 4TYDA 3SU3A 2F4LA 5FPTA 1RTLA 5F53A 5IDKA 4WH8A 1E79D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3B A; 
#chains in the Genus database with same CATH topology
 2IJD 1;  1FLE E;  1EQ9 A;  3SNB A;  3U28 C;  1AWF H;  4BXW A;  5KED A;  1TGC A;  1GBE A;  5JPM H;  1IQL A;  1P12 E;  1S85 A;  4H4F A;  3RXV A;  1SHY A;  2IJO B;  2ZU4 A;  2EI7 A;  4LXB H;  4JK6 A;  3RXK A;  4BAH B;  1OP0 A;  1C5Z B;  3H7O A;  5I25 A;  3KHV A;  1O5A B;  5AFY H;  2STB E;  2XWA A;  3UR9 A;  5FCK A;  1TAL A;  2RDE A;  5LGO A;  3U8T H;  1A0L A;  2C8W B;  1JWT A;  3MH4 A;  1TNH A;  4INH A;  2FX4 A;  1PYT C;  1RTK A;  3GCN A;  2FPZ A;  1O2X A;  3OU0 A;  1SBW A;  1S5S A;  1WQV H;  4K2Y A;  1A61 H;  1SGI B;  1HNE E;  3LU9 B;  5IK2 D;  2KR7 A;  5B6L A;  2H9H A;  1O2S A;  1DWE H;  2W3I A;  4HFP B;  1C2H A;  4H6T A;  2AGG X;  2WPD D;  3GYM A;  5DGJ A;  2F3C E;  2QXG A;  2UWL A;  3DFL A;  8LPR A;  1O3I A;  3M7T A;  1C5Q A;  1K1N A;  3QTV H;  5TJX A;  1YPG H;  2BYA X;  3W1E A;  2A4G A;  2V3O H;  2V6N A;  5C17 A;  1Y3W A;  1QR3 E;  1SLW B;  2GCT C;  1NFY A;  3EGK H;  1FPH H;  2VIW A;  4M7G A;  1CGI E;  3QUM P;  3BEI B;  2ZU3 A;  3F2G A;  3RMN H;  4ABI A;  1G3C A;  5K7R A;  3NPS A;  1LHF H;  1QHR B;  2ZPQ A;  2WPL S;  1PPZ A;  1X7A C;  1SGP E;  4WY3 A;  5F6M A;  2SGD E;  3P6Z B;  1HUT H;  2R0K A;  1C5R A;  3KNX A;  2F9V A;  1A0H B;  2QA9 E;  4X2X A;  5L6N H;  1UHB B;  1AI8 H;  1LCY A;  4IGD A;  1TPA E;  1A5H A;  1F5R A;  1ZMJ A;  1SLX B;  1EX3 A;  2ALP A;  1C1V H;  2ZDA H;  1C2J A;  4ABH A;  2FOE A;  1DFP A;  1HAX B;  3FFG A;  4ISI H;  2H9T H;  2XC0 A;  1GI8 B;  3LC5 A;  3SHA H;  3PLP A;  2QN5 T;  1GHA G;  1WU1 A;  4Y8Y A;  1NRS H;  1ELE E;  1SGT A;  1E79 D;  2ANW A;  2J34 A;  1TAB E;  4ISN A;  4ZAE A;  1GBA A;  4ASH A;  4X6M A;  1CU1 A;  1O5F H;  1D4P B;  3RXS A;  4DOQ A;  3SO3 A;  3ZZD A;  3M5N A;  3RDZ A;  4DUR A;  2BY5 X;  1QGF A;  2P93 A;  2VGC C;  5CHB A;  1P2J A;  2CHA C;  3Q00 A;  3SNE A;  2A32 A;  1O38 A;  1GI6 A;  3ZIA D;  4YM9 A;  3F0P A;  1YCP M;  1C1P A;  5JYI A;  1C5O H;  4MPV A;  3IIT A;  1C2F A;  5C2Z A;  2SGQ E;  5C3N A;  2K0Q A;  2VIN A;  5EGM A;  4KKD A;  5TCC A;  1O3D A;  4J2Y B;  1TE0 A;  4NCY A;  2ZPR A;  4Z1M D;  4Q63 A;  1BTW A;  2SGF E;  1G37 A;  2PUQ H;  2BDG A;  2O8T A;  3P17 H;  3TH3 H;  4GHQ A;  1GHA F;  1XKB C;  4ZCN A;  2EY4 C;  3FKS D;  5LPR A;  1P01 A;  3KEE A;  4F55 A;  4RT0 A;  5DJ7 A;  2B8O H;  3UIR A;  1W11 U;  2EC9 H;  1CGH A;  1V2M T;  1EFR D;  1DXP A;  1QTF A;  1VKY A;  1VJ9 U;  3QTO H;  1BHX F;  1GBC A;  4X1P U;  2XOK D;  4KP0 A;  1H1B A;  2VJ1 A;  3B9F H;  3ATK A;  3VB5 A;  4ABB A;  1EB1 H;  3ZZB A;  2ZU1 A;  2O8M A;  1MQ5 A;  4AX9 H;  1MTN C;  3ATL A;  1SGF A;  1MBM A;  4B2B A;  1GDQ A;  3M5M A;  4NWL A;  5C20 A;  1IAU A;  1CA0 B;  1K1O A;  1EAT A;  2NU4 E;  5DSF A;  1OYT H;  3UR6 A;  4IC5 A;  4M9F A;  1HAY B;  1IQI A;  1Z8I B;  1ESB A;  3TIT A;  5B6O A;  2Y81 A;  1E37 B;  4FUF A;  4FUI A;  2PSX A;  2PWX A;  4UFF H;  1DPO A;  3QO6 A;  5A0C A;  4X1S U;  3BTE E;  4ABJ A;  3A7T A;  1P3C A;  3PO1 B;  1C5W B;  4ACB A;  4YXW D;  3TH4 H;  1BTX A;  2TGA A;  3KQB A;  4GPG A;  1KXB A;  1FQ3 A;  2KX4 A;  2Z6B D;  4X8U H;  5T3H A;  1QBV H;  4MG3 A;  4E7N A;  3SUE A;  1EAW A;  4TY6 A;  4NWK A;  1MZD A;  1C2L A;  2P94 A;  3TU7 H;  3U8R H;  2HVX A;  3AAU A;  4Y7B A;  1HRT H;  4ZRO A;  3D49 H;  4KTU A;  3SGA E;  1GDU A;  3FN8 A;  3PMH B;  1EAU A;  5FPS A;  4U30 A;  1ZHR A;  4XOJ A;  1P03 A;  3A81 A;  4UEH H;  5A09 A;  1BTY A;  2OK5 A;  2TRM A;  2BVS H;  1O2O A;  1OHH D;  5PTP A;  2PHB A;  2XRC A;  3FAO A;  1B7X B;  3S7H B;  5C5N A;  1H9H E;  2F43 B;  3P8N A;  4XRN A;  5H4I B;  1AN1 E;  3F2H A;  2ZC9 H;  1TYN A;  2Y5G A;  3STI A;  1MKW H;  4TWW A;  4HZH A;  4A1X A;  1ZHM A;  2XWB I;  3BG4 B;  3TK6 A;  4Y79 A;  1AZZ A;  3S9B A;  1IQE A;  2TPI Z;  1GBJ A;  1GBF A;  2Z9J A;  3TK9 A;  1EJM A;  1LHD H;  1QY6 A;  3HK6 B;  1A1R A;  1NO9 H;  1JBU H;  3A7W A;  2KCO A;  1T4V H;  2FTM A;  4NSV A;  3UNR A;  5EJL A;  1PQ8 A;  5HXF A;  2JH6 D;  2OC7 A;  3MU5 A;  3SU2 A;  1KXF A;  4CH8 B;  1AZ8 A;  1D9I A;  1GI7 B;  6LPR A;  1WDI A;  1TX6 A;  2J92 A;  1GMC G;  5EU8 A;  4DG4 A;  2BD3 A;  2QF4 A;  2ZGJ A;  2OUA A;  1OXG A;  5GIB A;  1OPH B;  4ZHM U;  3BG8 A;  4B2A A;  1O2H A;  3LGI A;  1AWH B;  2TGT A;  3OFN D;  4MPX A;  4X1Q U;  1PQ5 A;  2P3T B;  2A7H A;  2GGV B;  3CEN A;  4DIH H;  1C5Y B;  1GG6 B;  4TYD A;  1F2S E;  2BY9 X;  1TPO A;  1ZRB A;  4NA7 A;  5F53 A;  1C5U A;  1NT1 A;  1HAV A;  2ODQ A;  1TON A;  1EZS C;  2EQN A;  3GY2 A;  5DP6 A;  2FMJ A;  2G4T A;  2IPQ X;  4JZ1 A;  4P02 A;  1ELC A;  5E8E H;  3S9A A;  2V0B A;  3EDX B;  1RS0 A;  1TMB H;  1O3H A;  1QA7 A;  4ABG A;  2ZEC A;  1VIT G;  4X8V H;  2H5D A;  4B75 A;  1Y3V A;  1MQ6 A;  4FUB A;  4OS5 A;  2BDY A;  1MKX H;  1P8V C;  1GMC F;  2R3U A;  1HIA B;  1AND A;  1P3E A;  2BHG A;  2ZHF H;  3DSP A;  4AYV B;  3KF2 A;  1LVO A;  1QRX A;  2I6S A;  4UFD H;  2FS8 A;  3SOR A;  5TCA A;  3SN8 A;  4YZU A;  4Q7Z A;  1KXA A;  1DST A;  2BDB A;  1OOK B;  2FI4 E;  3C1K A;  5FBE A;  3ATI A;  1TBQ H;  2HGT H;  2KCY A;  3EST A;  2VB0 A;  2V3M A;  4X6P A;  1EP5 A;  3MU0 A;  1Y3U A;  7KME H;  4AGJ A;  1DM4 B;  4A1T A;  4JZF H;  1HAG E;  1PFX C;  3UFA A;  1D3P B;  3R0F A;  3LH3 A;  1FMG A;  2W5E A;  1NPM A;  2FOF A;  1QRW A;  1UTJ A;  2ANM H;  3PM3 A;  4AFQ A;  1D3D B;  3SZE A;  3MU8 A;  3F9G A;  2FS9 A;  1VIT F;  4O97 A;  3TJO A;  5SGA E;  2PKA B;  5DP4 A;  4ZUH A;  4FVD A;  3OEE D;  3RXR A;  1DDJ A;  3KQ5 A;  1DOJ A;  3JZ2 B;  1AU8 A;  3EA7 A;  3SI3 H;  2SGP E;  2A45 B;  1O5C B;  2ZDK A;  3LJJ A;  3ZZ4 A;  2GZ7 A;  3FVF B;  2A5K A;  4CHA C;  1TOC B;  1MU8 B;  5C94 A;  1G9I E;  4DII H;  2A31 A;  4UDW H;  2VID A;  1TRM A;  2R0L A;  3M5L A;  1JOU B;  3ZZ9 A;  4Y76 A;  4BTT B;  1ETT H;  1AVW A;  1O35 A;  4IN1 A;  5CHA C;  2I6Q A;  3CNR A;  2VVC A;  1QQ4 A;  3RML H;  3BTM E;  5AHG H;  4DT4 A;  2SFA A;  4NA9 H;  3SJK A;  1H9L B;  1BMN H;  3O8C A;  2ZPS A;  3W94 A;  3MO6 A;  4AOQ A;  1HCG A;  1UJ1 A;  1YLN A;  2P95 A;  2DE9 A;  2H1U A;  1UK4 A;  3OTJ E;  3LOX A;  2B9L A;  3VEQ B;  1BTU A;  1O2U A;  1MAB B;  1AFQ C;  3RXJ A;  1D6R A;  1W0J D;  1V2Q T;  2K1Q A;  3ZVG A;  2BQ7 B;  4B74 A;  3AK5 A;  1LPK B;  3RM2 H;  1BB0 B;  1JIM A;  4ACA A;  5A0A E;  3MH7 A;  1EXF A;  1ZML A;  1TMU H;  1HB0 B;  2PLX A;  1ELF A;  3QK1 A;  2C8X B;  5EQR A;  5FBI A;  1ZPC A;  4NIV A;  1UVT H;  3NKK A;  2BD7 A;  4K1S A;  3ZV8 A;  4B1T A;  4XBB A;  4CRE A;  1WSS H;  1UW7 A;  2GT7 A;  2CV3 A;  3F1S B;  3MMG A;  1HIA A;  1C4Y 2;  1HJ8 A;  1HFD A;  1K1I A;  3FP7 E;  3OX7 U;  4ISL A;  4XD7 D;  1NRR H;  1GHB G;  1ZRK A;  1M9U A;  1QL9 A;  4GSO A;  4TPY A;  1OP2 A;  3PWC A;  5HYO A;  2JET B;  2AEI H;  1O37 A;  1SMF E;  3UOU A;  1HJA B;  5GND A;  5GPI B;  3I78 A;  4K1E A;  2AIP A;  2Z9G A;  1GBB A;  8GCH G;  1CHG A;  2ZDM A;  3A8A A;  2FDA A;  4LK4 A;  5T6G A;  4OS4 A;  2VIO A;  3P70 B;  3TVJ B;  1GMH G;  2HPP H;  2BOK A;  2VBC A;  4ZMA H;  1A46 H;  2F83 A;  4E7R G;  1W3C A;  2TIO A;  4O3U A;  4Q80 A;  1G3D A;  1FY1 A;  1QB9 A;  3A7V A;  4PRO A;  4ZKN U;  2J98 B;  2OTV A;  1K2I 1;  3E90 B;  3LGW A;  1LO6 A;  3LT3 A;  2ZU2 A;  1GCT B;  1YBW A;  2P16 A;  2C93 B;  5ABW A;  1Y5A T;  1P04 A;  2M2A A;  2YOL A;  1P2O A;  1QNJ A;  1AGJ A;  2W3K A;  2FLB H;  4A5T S;  3TGI E;  1KXE A;  4MDS A;  1EJN A;  2J5U A;  4AG2 A;  3KQD A;  3RXL A;  2PKA A;  1ZGV A;  5EQS A;  4D7G A;  5LPE A;  5EW2 H;  3PWB A;  1GI0 A;  3GYL B;  1W10 U;  2PW8 H;  3GY3 A;  1Z71 A;  3IWM A;  1GHB F;  4ISO A;  4A6L A;  1KIG H;  1C5X B;  2SNV A;  1C1Q A;  2C8Z B;  3FAN A;  1NY2 2;  2WYJ A;  3K2U A;  3ZYD A;  1FDP A;  1MZA A;  1NRO H;  1HGT H;  3BEU A;  5F03 A;  3WW7 A;  2A7J A;  3ITI A;  3LGV A;  8GCH F;  5HIY A;  1UK3 A;  5JBB S;  3LON A;  1TA2 A;  3HKI B;  5DP3 A;  2HAL A;  5HM2 A;  1GMH F;  1N1L A;  2FOB A;  3GCT G;  1LVM A;  1O34 A;  4X1N U;  1C4V 2;  1G30 B;  3LC3 A;  1ANB A;  2A4R A;  2Z3C A;  4Y8Z A;  1RTF B;  5E0G A;  3NXP A;  2OIN A;  3FP6 E;  1B5G H;  1FY8 E;  1XUG A;  3M7Q A;  1C9T A;  1PPG E;  3KID U;  3PMJ A;  3ZZ3 A;  1DIT H;  2ZTX A;  1ELV A;  2O8L A;  2YNA A;  1OSS A;  1O3G A;  3EYD A;  2HRV A;  4H42 U;  2AFQ B;  3HGP A;  3SV2 H;  4GVU A;  3RXI A;  3SU0 A;  2XCN A;  1EUF A;  2EI8 A;  2GD4 B;  4YT6 H;  3RU4 E;  1BA8 B;  2EST E;  4BTI B;  1TNL A;  1C2I A;  3T25 A;  2ZF0 H;  2VIQ A;  1F5K U;  1GL1 A;  2J2U A;  2VVV A;  2G00 A;  2BLQ A;  1FON A;  1TOM H;  2D1J A;  3UQO A;  2JIZ D;  1ANC A;  2Y7X A;  3UNS A;  1NRP H;  2PKS C;  2ODY B;  1Y5U T;  3GCT F;  4AG1 A;  1ELD E;  3RXM A;  3BIV H;  5DG6 A;  5DK1 A;  1GBM A;  1BBR E;  1T4U H;  2O8U A;  1UCY E;  4K3J A;  1EAI A;  2FOG A;  1BUI A;  2R3Y A;  3GCH B;  1IQG A;  1DY9 A;  2O8W A;  2FIR H;  3ZVD A;  1KXC A;  3D23 A;  1SQR A;  1SSX A;  4YLQ H;  5FAH A;  4FU8 A;  2Z9I A;  1FY4 A;  5BRR E;  4MNV A;  3VB3 A;  1ID5 H;  1GHX H;  2WV4 A;  2GVF A;  1D3T B;  1E1Q D;  2HVY B;  2FEQ H;  1O2G H;  1GI2 A;  3U69 H;  1CA8 B;  1ELB A;  1MAX A;  2BVX H;  1O2M A;  4NZL A;  1XMN B;  1YY3 A;  2KFW A;  4BAM B;  2B5T B;  4Y0Y E;  3F9F A;  3H5C B;  5G4B A;  2J98 A;  2XTT B;  2HOB A;  1SB1 H;  2PUX B;  6EST A;  1MCV A;  1J17 T;  1PPF E;  3OAA D;  4B76 A;  1C9P A;  1EPT C;  3F0O A;  1HDT H;  4NG9 H;  1C4U 2;  3E0P B;  1P10 A;  1RIW C;  1TNI A;  4CRA A;  3QWC H;  2QAA A;  1V3X A;  4YO9 A;  2H2Z A;  5LH8 A;  1PPH E;  4WH8 A;  3PTN A;  2BD9 A;  1BZX E;  2R2W U;  1F0R A;  1Q2W A;  3O8B A;  2XBW A;  3C27 B;  2QC2 A;  1NTP A;  1PQA A;  4AGK A;  1C5V A;  3PV2 A;  1SQO A;  3M3V A;  3E8L A;  2Q1J A;  4K8Y A;  4TT3 D;  4I32 A;  3E3T A;  1UTK A;  3SUG A;  5E2P A;  4WXV A;  2BTC E;  4BAO B;  2VGC B;  1GBT A;  4THN H;  2CHA B;  1DT2 A;  3Q77 A;  1LQE A;  5FXL A;  4U2W A;  3ZZC A;  1EOL A;  4WF8 A;  1OWK A;  1AE8 H;  4DJZ B;  4Y0Z E;  4FOU C;  1ZSJ A;  1EKB B;  3T27 A;  2FOA A;  3LGY A;  5EST E;  4HG6 A;  3A84 A;  1DIC A;  1NU7 B;  2QXI A;  2BD4 A;  3FOA A;  3UUZ A;  3MNX A;  3A8C A;  2J38 A;  3T62 A;  1E38 B;  1BHX B;  1GI4 A;  1P9U A;  1DWD H;  4YTA A;  1C5L H;  1O3J A;  1K1P A;  3S69 A;  1O30 A;  1BBR K;  1GDN A;  1UCY K;  1GJC B;  1TPS A;  2H5C A;  3GIS B;  1WUN H;  1DLK B;  2FXR A;  2GMT C;  1CT4 E;  2Y6T A;  3AAS A;  1TQ7 B;  2F9O A;  2GV7 A;  1LQD B;  3RXG A;  1ARC A;  3N7O A;  4TY7 A;  1BTH H;  3MQK C;  2C8Y B;  2UUK B;  4O03 A;  1C1S A;  1KXD A;  4Y10 E;  2QF0 A;  4AC9 A;  1RJX B;  2FX6 A;  2PTN A;  2SGA A;  1O31 A;  3U1J B;  5DKM A;  2WPJ S;  1GCD A;  1Q31 A;  4IMQ A;  1GJ9 B;  9LPR A;  1ZYO A;  1FJS A;  4UFG H;  2WPM S;  4FU7 A;  2BY8 X;  3LGT A;  1D3Q B;  3N7E A;  4MPU A;  3SJ9 A;  1ZJD A;  3NWU A;  1MTN B;  3DT0 H;  3RM0 H;  3M7U A;  1XX9 A;  3RMO H;  2ZTZ A;  1TX7 A;  4OGY A;  1LHE H;  4P00 A;  1HAH H;  3UNQ A;  3ZYE A;  1K0H A;  1C1R A;  4WVP E;  3NRL A;  2H6M A;  2EA3 A;  1ESA A;  2CK3 D;  4AOR A;  1BRU P;  4INK A;  3M3T A;  1HPG A;  3R3G B;  3SNA A;  4ABF A;  5EIY A;  1O3L A;  5C0T A;  1H8E D;  2VH0 A;  1P2K A;  1QBO A;  1T8N A;  1TBR H;  1ZMN A;  1IOE A;  4OM9 A;  1ZPZ A;  4FXG H;  2KM0 A;  1GJ4 H;  1SLU B;  2OP9 A;  1TAW A;  3ELA H;  1DWB H;  3GY6 A;  2RA0 A;  2AGI X;  1AKS B;  5EQQ A;  1BJV A;  2A2Q H;  1UVS H;  2HNT C;  1QZ8 A;  3MH5 A;  1AMH A;  1Q3X A;  2A2X H;  3BIU H;  1UHB A;  2ZCK P;  3RXQ A;  1SC8 U;  5JB8 S;  1XXF A;  2H9E H;  1O2Z A;  2Z3E A;  1EJA A;  1QFK H;  5C1X A;  3GY4 A;  4CRF A;  8EST E;  2ZQ2 A;  4D76 A;  3KYG A;  1BML A;  3PRB A;  1SVP A;  1BIT A;  1RFN A;  1O2V A;  2RG3 A;  3RXE A;  2FI5 E;  2VIP A;  2HNT F;  1PJP A;  3QLP H;  4ASU D;  1JXP A;  3MH6 A;  2EEK A;  1C1U H;  2PR3 A;  1C1T A;  2WV5 A;  3ZVF A;  1CA0 C;  2XCF A;  4Q7Y A;  3ZZ7 A;  2WHX A;  1K22 H;  1MTU A;  3PRO A;  1O3E A;  1IQH A;  1OWI A;  1OP8 A;  3MU4 A;  1SPJ A;  3TNT A;  1QBN A;  1YPK H;  3BTQ E;  1MTS A;  3DA9 B;  2C4F H;  2RCE A;  4A7I B;  4Y6D A;  4GHT A;  1XUI A;  2FOC A;  3RXT A;  1O5E H;  4B6F A;  1HAO H;  1O3F A;  3MNC A;  1SOZ A;  2QV1 A;  2WSS D;  1EB2 A;  3WWB A;  1MTW A;  2ZGH A;  2JJ2 D;  2OQU A;  5FX5 A;  2R2M B;  3O8D A;  1L2E A;  4MNX A;  1FZZ A;  4NSY A;  2G4U A;  1V2W T;  4B6E A;  1G3E A;  1QQU A;  2ALV A;  3N7D A;  1HYL A;  2VWM A;  1SQA A;  2ZO3 H;  1BIO A;  1PPE E;  2XND D;  4K60 A;  3SYJ A;  3LJO A;  1VCW A;  1O36 A;  2IN2 A;  4XBD A;  3TIU A;  1SG8 B;  1VGC C;  2A5I A;  1N6X A;  1LDT T;  2GV6 A;  1K1J A;  3ZVB A;  2HPQ H;  1FN6 A;  1FAX A;  3V13 A;  4E05 H;  2GZ9 A;  4NZQ A;  3MYW A;  1OYQ A;  4WWY A;  1HAZ B;  1XKA C;  3NZI A;  1H9I E;  2YMS C;  3TK5 A;  1V2V T;  3FZD A;  1AE5 A;  1TFX A;  3LPR A;  3GDU A;  4Y11 E;  3F9H A;  1W2K H;  3BG4 C;  4IMZ A;  1TGN A;  4OS2 A;  4X0W U;  1BDA A;  1Z6E A;  3BEF B;  1K9O E;  4JYT A;  2BX4 A;  4X6N A;  5JDU B;  1SGD E;  4OS1 A;  5HIZ A;  3BTH E;  1P09 A;  3F6U H;  3RUO A;  2C3S A;  1T8L A;  4CRB A;  1C2D A;  3SNC A;  2ULL A;  1C1N A;  1RRK A;  3TJU A;  3RXD A;  2J97 A;  1COW D;  1P2M A;  1THR H;  5J4S A;  1W8B H;  1ZPB A;  8KME 2;  2WPH S;  1XVM A;  1W13 U;  1O33 A;  3EAJ A;  1YPL H;  1H8I H;  5FCR A;  3LIW A;  5DPA A;  4FUD A;  4U01 A;  2BD2 A;  1GVL A;  4DY7 B;  1AD8 H;  2R9P A;  2AMQ A;  4VGC B;  1QJ7 B;  1DS2 E;  2W7S A;  1V2L T;  1YPH C;  1GG6 C;  4UE7 H;  2XYA A;  4RN6 A;  1O3B A;  2AH4 X;  4XE4 A;  2Z7F E;  4AYY B;  2XNI A;  3CS7 A;  1K21 H;  1P2I A;  1V2P T;  3PV4 A;  1GHY H;  1O3N A;  3URD A;  2FM2 A;  4XBC A;  2XXL A;  2ZHW H;  4E06 H;  4OS7 A;  2BLV A;  1EOJ A;  1EZU C;  1RXP A;  4JYV H;  4BAK B;  3PV5 A;  2A0Q B;  1LPG B;  5J4Q A;  1RD3 B;  2Y7Z A;  3FO8 D;  2ANY A;  1H8D H;  3VXE H;  1GMD F;  2QF5 A;  5IYT A;  3VGC C;  2FYR A;  4Q7X A;  3MI4 A;  2QCY A;  1JMO H;  4CHA B;  1N8O C;  5AVD A;  4MTB A;  5F8Z A;  1AHT H;  4KEL A;  1A3B H;  3T26 A;  2W6J D;  2Q6F A;  5EOK A;  4EST E;  2ZNK H;  3SJI A;  1GI5 A;  3A82 A;  3NUM A;  1AQ7 A;  3SQH E;  5CHA B;  1MMJ N;  4BAN B;  2ZFP H;  1S6F A;  4YLU A;  3ZZA A;  1MD7 A;  1O32 A;  2NU0 E;  5C0U A;  1HAP H;  1AFE H;  1EAS A;  3VG8 A;  1NU9 A;  1VR1 H;  3BTK E;  3OY6 U;  1AO5 A;  1UTN A;  3A87 A;  1YPE H;  2AS9 A;  2P8O C;  5BPE A;  2BLW A;  2AMD A;  1O2W A;  2BD5 A;  1MCT A;  4X8T H;  3RXO A;  1T8M A;  2L6O A;  2TBS A;  2PGQ B;  3ZZ5 A;  1EST A;  2XBY A;  3V12 A;  1KTS B;  2QXJ A;  7LPR A;  1AFQ B;  2ZDV H;  5T6D A;  3UB0 A;  1QJ1 B;  4ABE A;  2PSY A;  3MU1 A;  3KN2 A;  1DAN H;  1XUK A;  2FOM B;  2G52 A;  2RA3 A;  1WYK A;  3GOV B;  3A80 A;  1Z8R A;  4MPW A;  5DP5 A;  3URE A;  3UY9 A;  1A3E H;  1OWJ A;  4ZKR U;  2TGP Z;  2CJI A;  2ZU5 A;  1GBD A;  1W0Z U;  1ELG A;  3SUF A;  4WMF A;  6GCH G;  2Z3D A;  2HWL B;  2GZ8 A;  1GHW H;  4SGA E;  5FX6 A;  1HLT H;  1LHG H;  2THF B;  1TRY A;  6CHA B;  5DO4 H;  1YC0 A;  1GBK A;  1MH0 A;  3AW1 A;  4X2Y A;  4YT7 H;  1WBG B;  3A7Y A;  2BX3 A;  3STJ A;  3VB6 A;  5K0H A;  1VCQ A;  1G32 B;  1S83 A;  1IQN A;  1P9S A;  2ZZU H;  3K6Y A;  1WAY B;  4ZHL U;  1XVO A;  2ZGX H;  1FIZ A;  1AVX A;  1P0S H;  4JYU H;  3SBK A;  4XSK U;  1S0Q A;  2BM2 A;  1RGQ A;  1BBR H;  1ELT A;  1Z7K A;  2VNT A;  2ZWL H;  1SGC A;  2GKV E;  5KGO A;  4NA8 A;  4BXS A;  3P8G A;  3DD2 H;  5ESB A;  1PQ7 A;  1NFU A;  5E2O A;  3IG6 B;  3AAV A;  3S7K B;  2FYQ A;  2ZFT A;  4JCN A;  1TLD A;  1E1R D;  3SU6 A;  1YKT A;  2P3U B;  5FPY A;  4AFZ A;  1TB6 H;  6GCH F;  4KTS A;  3UWI A;  1QA0 A;  1CBW C;  3MNB A;  4FUC A;  3MHW U;  1V2K T;  4IW4 E;  3M3S A;  4LOY H;  1FXY A;  3OSY A;  4B73 A;  3SI4 H;  4YOJ A;  7EST E;  1O5D H;  5HKK D;  1ZZZ A;  3RLY H;  5FHT A;  3T28 A;  1YGC H;  2Z9K A;  3ATM A;  4NIX A;  1ETR H;  3GCO A;  3MTY A;  1O5B B;  1SHH B;  1O2I A;  1GGD C;  1UVU H;  1GI9 B;  3M61 U;  4WXI A;  1ZTJ A;  3A7X A;  1C2G A;  3A86 A;  3BTT E;  1T31 A;  1AB9 B;  3RU4 D;  1G36 A;  1W0K D;  1L1N A;  1WQS A;  4ZXX H;  2FOD A;  2XBX A;  3T2N A;  2FO9 A;  2ZGB H;  4MVN A;  1YP9 A;  4BOH A;  4K8B A;  2GT8 A;  1GCT C;  1CE5 A;  1NRQ H;  3GY5 A;  4JZD H;  2ZFF H;  3D65 E;  3LH1 A;  4IN2 A;  1UTM A;  5GCH F;  2XC4 A;  4JZI A;  1INC A;  1QJ6 B;  5AFZ H;  1J16 A;  2OXS A;  1C1M A;  2ZGC A;  1KLI H;  4UD9 H;  3A83 A;  5JBA S;  2XW9 A;  1DY8 A;  1ABJ H;  1GJ5 H;  2AHM E;  2GP9 B;  2WPK S;  3SV6 A;  4JZE H;  1KMH B;  3SU1 A;  1QIX B;  2ZHD A;  4I33 A;  1KTT B;  2CGA A;  4HI3 A;  1KLT A;  3SJ8 A;  1XM1 A;  1NFW A;  2QGR A;  1PYT D;  2ZCH P;  2PKS B;  2BY6 X;  2ZKS A;  1C5T A;  2ZP0 H;  1QRZ A;  1YF4 A;  2JJ1 D;  2NU1 E;  1NN6 A;  1W0Y H;  3DSO A;  3T5F H;  1CQQ A;  1GBL A;  1HXE H;  4DGJ A;  1C5N H;  1UMA H;  3OY5 U;  5HM9 A;  4O3T A;  3VPK A;  1E34 B;  1BRB E;  2J4I A;  4WME A;  4GUX A;  5DP7 A;  1KDQ B;  1ZSK A;  1TIO A;  1O3P B;  5L2Y H;  1GBH A;  3A7Z A;  2QY0 B;  3HK3 B;  1O39 A;  1O2Y A;  3N99 A;  3DHK H;  1EAX A;  1JRT A;  4BNR A;  4I8K A;  1EZQ A;  3M37 A;  2RFK C;  1ZTL A;  3HAT H;  3EE7 A;  1GPZ A;  1Y59 T;  2L74 A;  2SGE E;  2STA E;  1EP6 A;  2F9U A;  1FUJ A;  1E0F D;  2BZ6 H;  2GCT B;  1A7S A;  4Z0K A;  3ZVA A;  3SJO A;  1O5G H;  2P59 A;  1GI1 A;  1YLC A;  4TWY A;  1UK2 A;  2AMP A;  2QIQ A;  1EPT B;  2PP6 A;  1S0R A;  2JKH A;  1RIW B;  3CS0 A;  1P11 E;  1W7G H;  1O3A A;  1DLE A;  1GVZ A;  1NES E;  1WXR A;  2KZ4 A;  4JK5 A;  2DUC A;  2SNW A;  5JBT A;  3SW2 B;  1P2N A;  3RC5 A;  3WWF A;  1SR5 C;  2XBV A;  1W12 U;  2QF3 A;  1GVK B;  2VU8 E;  4GCH G;  2ZIQ H;  5E0J A;  4LZ4 B;  1FIW A;  2G5V A;  2GDD A;  2FZZ A;  2WUC A;  1TA6 A;  5EJ1 A;  3BF6 H;  2F91 A;  3PMA B;  1LVB A;  1GJ7 B;  3E6P H;  1A2C H;  3M35 A;  1HAI H;  1P2Q A;  2ZG0 H;  3GCH C;  2D26 C;  1SGF G;  1CSO E;  5AF9 H;  1MBQ A;  1S6L A;  1S6H A;  4MQA A;  3SUD A;  2XC5 A;  3L3T A;  4WH6 A;  1Z6J H;  5CDF E;  4U32 A;  1Y3X A;  4RSP A;  1QCP A;  2BVR H;  2ASU B;  2BXU H;  3QZR A;  1NFX A;  2NWN A;  3D62 A;  5ETX A;  2WZQ A;  5EPY A;  2UUJ B;  1VCP A;  5EJZ A;  4Z6A H;  2V7Q D;  4B71 A;  1YCP K;  1LVY A;  3LGU A;  4RI0 A;  4I7Y H;  1C5S A;  1SQT A;  1BMM H;  4NIW A;  1B0E A;  3H09 A;  5GXP A;  1BTZ A;  1TPP A;  2A4Q A;  1QL7 A;  4B2C A;  4GCH F;  4RKO B;  4WJG 2;  4CR5 A;  3SQE E;  4CBO A;  3BTF E;  5KEC A;  5DN6 D;  2FES H;  1THP B;  3ODF A;  4K69 A;  5DP8 A;  1GBI A;  2GMT B;  2V3H H;  1K1L A;  4INL A;  2OBQ A;  4AFS A;  3U8O H;  1TNJ A;  1WV7 H;  1ETS H;  2UWP A;  1F92 A;  4AB8 A;  2CF8 H;  1HV7 A;  1V2O T;  2A4O A;  2A5A A;  3S0N A;  1PPB H;  3SV8 A;  3TNS A;  3O8R A;  2BZA A;  1BJU A;  1AUT C;  1LTO A;  4Y71 A;  2W6I D;  1NM6 A;  1HXF H;  1SGN E;  2OC8 A;  1GJD B;  1G2M A;  4RT1 A;  3RMM H;  4X2W A;  3A88 A;  1G2L A;  1KDQ A;  1DX5 M;  4KGA A;  2BDH A;  3F9E A;  2KAI B;  1S84 A;  1A4W H;  3V0X A;  3BTW E;  3F3B A;  1OS8 A;  1GJB B;  4KTC A;  3LDX H;  4D9Q A;  1BT7 A;  2IPH A;  4FUE A;  2Y5H A;  5JB9 S;  4BTU B;  1AUJ A;  3QDZ B;  1XUJ A;  4NFE A;  4RKJ B;  3E1X B;  1IHT H;  3Q3Y A;  1S82 A;  3A89 A;  1ZTK A;  2KCP A;  3BSQ A;  4ZKS U;  1EPT A;  3ZZ6 A;  1MU6 B;  2LPR A;  4YOG A;  3SGB E;  4F48 B;  2PFE A;  1LMW B;  3MO3 A;  1BRC E;  5T6F A;  2QXH A;  9EST A;  3ZV9 A;  4FET A;  1A0J A;  2NU2 E;  2OBO A;  1UTO A;  1SGQ E;  1W14 U;  2BLO A;  2F9B H;  3AW0 A;  1DSU A;  2BQW B;  1O3M A;  5A2M H;  1ZGI A;  3URC A;  4ZH8 A;  3TLO A;  2WPI S;  4Y7A A;  1AIX H;  3PB1 E;  3HGN A;  1V6D A;  5JBC S;  2LEL A;  4X6O A;  1XXD A;  1VJA U;  3HPT B;  3T29 A;  3MNS A;  1GJ8 B;  1JIR A;  5GJ4 B;  1HAV B;  1FY5 A;  2ZCL P;  3QGN B;  4YES B;  5C67 A;  2FI3 E;  1DUA A;  3ODD A;  3UQV A;  2G8T A;  3UPE A;  2OC0 A;  2FTL E;  4O9V A;  4ZKO U;  2Y80 A;  4GAW A;  1TX8 A;  2HNT E;  1SL3 A;  1O2P A;  4TSF D;  4ZHA A;  3SGQ E;  1Y8T A;  1Z1I A;  4OGX A;  1CVW H;  1FY3 A;  1QUR H;  4D9R A;  1ZLR A;  5A0B A;  5T1V A;  3E16 B;  2BQ6 B;  3PYH A;  3BN9 A;  1T7C A;  1SGE E;  1BMF D;  2VWO A;  3EA9 A;  2IOT A;  3KQE A;  3L33 A;  1THS H;  1UO6 A;  4K5Z A;  3ZVC A;  4F4O C;  5A8Z A;  1F0T A;  1Z8G A;  2AER H;  1GWA A;  1N6Y A;  5EXM A;  4HTC H;  2G51 A;  5HGG A;  3BTG E;  3FZZ A;  1MD8 A;  4I8G A;  3RXC A;  1FI8 A;  1WCZ A;  3QGJ A;  2ZHQ H;  5C1Y A;  3PO1 C;  1H4W A;  3DFJ A;  2OCV B;  2Q6D A;  3VB7 A;  1A5G H;  3A8B A;  3S9C A;  1L4Z A;  2A1D B;  4ABD A;  2ILN A;  3QZQ A;  1YPM H;  3Q3X A;  1EZX C;  1Y3Y A;  3DUX H;  1HBT H;  2BDI A;  1TGT A;  1BRA A;  1CT2 E;  2NU3 E;  1VGC B;  5EXL A;  2BDA A;  3ZVE A;  1ZSL A;  2UUY A;  1VIT H;  3UWJ H;  1AY6 H;  1JRS A;  2GTB A;  1GHV H;  3K65 B;  1NBM D;  1SI5 H;  3GDS A;  1O2L A;  3JZ1 B;  3U98 H;  2KAI A;  2C90 B;  3WY8 A;  2YMS D;  1P02 A;  1QB6 A;  2YMS B;  1Z1J A;  1L0Z A;  4J1Y A;  1FV9 A;  3SND A;  2JDI D;  1L1G A;  3V3M A;  1S81 A;  2QYI A;  2Y82 A;  3PMB B;  4DCD A;  3DSG A;  4ZXY H;  3SHC H;  4AN7 A;  3KYF A;  1F5L A;  1C2K A;  4TPI Z;  1O0D H;  3BV9 B;  3FP8 E;  5EG4 A;  1FX0 B;  1Z8J B;  4X1R U;  1UVO A;  3U9A H;  4NFF A;  1UTP A;  4QT8 C;  3RXH A;  2HLC A;  2CMY A;  1O2J A;  3OYP A;  1YPJ H;  4CRD A;  1L4D A;  1NBM E;  3P8F A;  3P95 A;  1YM0 A;  1DWC H;  2UWO A;  2LNC A;  1CGJ E;  1LKB A;  1GHZ A;  3ATW A;  3GS9 A;  1OWD A;  4I8J A;  1L1J A;  1F0U A;  5C1U A;  2CF9 H;  2F9P A;  1K28 D;  2B0F A;  1MUE B;  5EW1 H;  1GMD G;  1ZHP A;  3TGK E;  1H8H D;  1TRN A;  2OQ5 A;  4MNY A;  1AKS A;  1C1W H;  1FPC H;  3A8D A;  3RXU A;  4NIY A;  5F8T A;  4D8N A;  2RDL A;  2TGD A;  2FP7 B;  3U1I B;  1V2N T;  1YWU A;  2BXT H;  1SFI A;  1O3K A;  1O2Q A;  4IBL H;  1DXW A;  2AGE X;  5EOD A;  3SV9 A;  1F0S A;  2QE7 D;  4AZ2 B;  1E36 B;  1O2T A;  3H7T A;  4SGB E;  3ZZ8 A;  1NRN H;  1O3C A;  2CXV A;  1ARB A;  1XUF A;  3VGC B;  1C5M D;  3TPI Z;  4CRG A;  2PTC E;  3SU3 A;  2F4L A;  1BOQ A;  3MOC A;  1N8O B;  1CHO G;  1YPH E;  1KLJ H;  2G55 A;  2W7U A;  4FU9 A;  5E0H A;  1U6Q A;  2BOH B;  1TNK A;  2OD3 B;  1ANE A;  1SKY E;  1VZQ H;  1WOF A;  2J94 A;  1P05 A;  3NK8 A;  5GDS H;  1V2R T;  2Q6G A;  5A8Y A;  3QX5 H;  4I31 A;  1DE7 H;  2ZEB A;  3A85 A;  1BQY A;  1AVG H;  1O2R A;  5HMA A;  3KL6 A;  2ZHE H;  2BY7 X;  3K6Z A;  1A5I A;  3EQ0 H;  3EE0 B;  3RC6 A;  1WTH D;  2G81 E;  4FUH A;  4VGC C;  4CH2 B;  2K8I A;  1YYY 1;  2PV9 B;  3AVZ A;  2ZDL A;  1K1M A;  4R0I A;  1BMA A;  1O3O A;  2P8O B;  3GY8 A;  2EI6 A;  3EA8 A;  3MO9 A;  2ANK H;  1OWH A;  5A8X A;  2GX4 A;  1NS3 A;  2OC1 A;  1OWE A;  1TMT H;  2J9N A;  2W26 A;  5EXN A;  2VIV A;  2ZDN A;  1UTL M;  2WV9 A;  1GJ6 A;  1TBZ H;  3L6P A;  1D6W A;  1YLD A;  3RC4 A;  3OE7 D;  3W95 A;  1IQK A;  2GCH G;  1V2T T;  1CHO F;  1J9C H;  2Z94 A;  1FN8 A;  3Q3K A;  2ODP A;  1O2K A;  3E91 A;  4K1T A;  2JH5 D;  1ACB E;  3I77 A;  1ELA A;  1IHS H;  3RP2 A;  1XUH A;  2ZTY A;  1NZQ H;  4NGA H;  1C1O A;  1ZJK A;  1BCU H;  4I8L A;  3KGP A;  1MAY A;  1NC6 A;  2HLD D;  1C2E A;  4I8H A;  1IQM A;  1P57 B;  4JMY A;  2YNB A;  2KCA A;  4MLF B;  1CT0 E;  7GCH G;  4UON A;  2Y5F A;  2WIN I;  1KYN A;  4X2V A;  3SV7 A;  1ORF A;  4AFU A;  3OTP A;  4YOI A;  1J14 A;  5F8X A;  3PLK A;  4Q2K A;  2ZFR H;  1GJA B;  4GLY A;  3VB4 A;  5DP9 A;  1YCP H;  3VFE A;  3RXF A;  4IC6 A;  3TJN A;  3V7T A;  2WUB A;  2P3F H;  2UUF B;  4XFQ A;  2VH6 A;  3RXB A;  3F68 H;  2JH0 D;  3RLW H;  1FNI A;  3SZN A;  2DE8 A;  2GCH F;  3P8O A;  1T32 A;  3GDV A;  1SLV B;  1SOT A;  5FPT A;  2ZA5 A;  1B0F A;  5IDK A;  1P06 A;  1TNG A;  4AB9 A;  1KY9 A;  1QL8 A;  2ZI2 H;  3KCG H;  5GWZ A;  2V35 A;  3K9X B;  3RXP A;  3QN7 A;  4ABA A;  2AYW A;  2BDC A;  1LKA A;  5L2Z H;  3DCL A;  1OX1 A;  5EPN A;  1V2U T;  1UCY H;  4UFE H;  2FOH A;  1CBW B;  2ZFS A;  3KQC A;  4XDE A;  1UVP A;  1KSN A;  5GCH G;  3MFJ A;  3PLB A;  4H6S B;  7GCH F;  3TJV A;  3SU4 A;  5CMX H;  3MWI U;  1CO7 E;  1MKW K;  3ENS B;  3CP7 A;  3LKW A;  1MTV A;  4F49 A;  3HKJ B;  1LPZ B;  4I86 A;  1C5P A;  2OLG A;  3SU5 A;  4FVB A;  6CHA C;  2AIQ A;  3M5O A;  4FUJ A;  1SGR E;  1SGY E;  1GGD B;  2O9Q A;  1GI3 A;  4R8T B;  2LP6 A;  4DT7 B;  3GIC B;  4Y8X A;  3TGJ E;  2ZFQ H;  2JET C;  2M5T A;  1Y5B T;  1ZR0 A;  4DVA U;  1GL0 E;  2ZQ1 A;  1G3B A;  5LPF A;  1HJA C;  1ZOM A;  1UTQ A;  2VVU A;  4CRC A;  1LHC H;  2D2D A;  1IQF A;  5FL7 D;  3BTD E;  3UOP A;  3B8J A;  1TGB A;  4D7F A;  1J8A A;  2Z9L A;  3E0N B;  1W7X H;  3RU4 T;  1C2M A;  1T8O A;  2A7C A;  1F7Z A;  2VWN A;  4IS5 A;  3UTU H;  3GY7 A;  1OKX A;  2GJG A;  2J95 A;  3NCL A;  2FLR H;  1PPC E;  4DW2 U;  3G01 A;  5C5O A;  2CN0 H;  1TGS Z;  2B7D H;  4A1V A;  5L30 H;  1WTG H;  3SOS A;  2G5N A;  3TH2 H;  3PTB A;  2FWW A;  3OEH D;  1FAK H;  4A92 A;  4X8S H;  4BAQ B;  4Q4L A;  3PRD A;  3I29 A;  2WYG A;  1E35 B;  1SFQ B;  4ISH H;  2BD8 A;  2VWL A;  5I46 H;  1DVA H;  1QB1 A;  3B23 B;  3VXF H;  4WMD A;  1DUE A;  1IQJ A;  1HJ9 A;  4CBN A;  5CE1 A;  1ABI H;  2PGB B;  1TQ0 B;  2F9N A;  1TWX B;  4CR9 A;  4HGC A;  1MKX K;  3M36 A;  1AB9 C;  4MNW A;  4FUG A;  3UAI C;  3F2F A;  1O2N A;  2BB4 A;  2GDE H;  1BTP A;  3RXA A;  4LZ1 H;  3Q76 A;  1V2J T;  1V2S T;  1J15 A;  1RTL A;  2D8W A;  3P92 A;  4OS6 A;  2BMG B; 
#chains in the Genus database with same CATH homology
 2W6J D;  1E1R D;  2IJD 1;  3NRL A;  3SU6 A;  3F3B A;  5FPY A;  3WW7 A;  2CK3 D;  4DT4 A;  3LON A;  4YXW D;  4KTC A;  3O8B A;  1N1L A;  1BT7 A;  3O8C A;  1SKY E;  1CU1 A;  1WXR A;  2KZ4 A;  5C0T A;  1H8E D;  2A4R A;  2IJO B;  3PV2 A;  4I31 A;  3M5N A;  5C0U A;  4B73 A;  3SUE A;  3DCL A;  4OM9 A;  5EPN A;  3VG8 A;  3RC5 A;  3WWF A;  2KM0 A;  2OIN A;  2YMS C;  4NWK A;  5HKK D;  1NBM D;  4TT3 D;  5CHB A;  2KCP A;  4B75 A;  4I32 A;  3RC6 A;  3LOX A;  3ZIA D;  3SU4 A;  3SUG A;  2YMS D;  5EQQ A;  1MAB B;  2K8I A;  3F0P A;  2YMS B;  3LKW A;  1W0J D;  3EYD A;  2K1Q A;  3DSP A;  2JDI D;  2L6O A;  4B74 A;  3KF2 A;  3AK5 A;  3FN8 A;  3SU5 A;  2K0Q A;  5FPS A;  3M5O A;  4FET A;  1W0K D;  3SU0 A;  2OBO A;  1S6L A;  2XCN A;  3SUD A;  4WF8 A;  4Z1M D;  4WH6 A;  4R8T B;  5EQR A;  4Q63 A;  2OK5 A;  5CDF E;  4K8B A;  3UB0 A;  5IK2 D;  1NS3 A;  2KR7 A;  2OC1 A;  5B6L A;  3KN2 A;  1OHH D;  1FX0 B;  2FOM B;  3PRB A;  2WV9 A;  4XD7 D;  1COW D;  2KCY A;  2WPD D;  3L6P A;  5FL7 D;  3FOA A;  3RC4 A;  2F43 B;  2LEL A;  3OE7 D;  2JIZ D;  3P8N A;  5ETX A;  5H4I B;  4ASU D;  1JXP A;  2WZQ A;  3FKS D;  4ZCN A;  3OYP A;  5EPY A;  1DY8 A;  3SV6 A;  2AHM E;  1NBM E;  3F2H A;  5GND A;  5GPI B;  4A1X A;  1KMH B;  2XCF A;  3SU1 A;  4U01 A;  2V7Q D;  3KEE A;  4I33 A;  4A1T A;  2WHX A;  4F55 A;  5GJ4 B;  3SUF A;  4B71 A;  4RI0 A;  3GS9 A;  3W1E A;  2A4G A;  1EFR D;  5C17 A;  1DXP A;  3H09 A;  2OC0 A;  2VBC A;  1A1R A;  2A4Q A;  3SZE A;  1DY9 A;  1W3C A;  2XOK D;  2JJ1 D;  2KCO A;  3F2G A;  2XNI A;  2HLD D;  4A1V A;  1H8H D;  3DSO A;  4TSF D;  5DN6 D;  4JMY A;  3OEE D;  3E90 B;  2KCA A;  2FM2 A;  2OC7 A;  4B6F A;  3SU2 A;  2FP7 B;  2OBQ A;  3OEH D;  2QV1 A;  2GVF A;  2WSS D;  3SV7 A;  4A92 A;  1E1Q D;  3U1I B;  3WWB A;  4Q4L A;  3OTP A;  2JJ2 D;  2M2A A;  3KNX A;  2F9V A;  3PRD A;  3PV5 A;  2YOL A;  5T1V A;  2O8M A;  3U1J B;  2QF4 A;  3O8D A;  2KFW A;  2J5U A;  3FO8 D;  3SV8 A;  1BMF D;  3M5M A;  4NWL A;  2QF5 A;  3O8R A;  1DXW A;  5EQS A;  4B6E A;  3SV9 A;  2QE7 D;  3N99 A;  3N7E A;  5DSF A;  1RGQ A;  3N7D A;  3M5L A;  3OAA D;  2W6I D;  3OFN D;  4M9F A;  4B76 A;  3F0O A;  2OC8 A;  2F9U A;  2GGV B;  5ESB A;  3F2F A;  2XND D;  3P8O A;  3SYJ A;  2P59 A;  4TYD A;  3SU3 A;  2F4L A;  5FPT A;  1RTL A;  5F53 A;  5IDK A;  4WH8 A;  1E79 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...