3F3FA

Crystal structure of the nucleoporin pair nup85-seh1, space group p21
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
347
structure length
308
Chain Sequence
HMQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKLQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A fence-like coat for the nuclear pore membrane.
pubmed doi rcsb
molecule keywords Nucleoporin SEH1
molecule tags Structural protein
source organism Saccharomyces cerevisiae
total genus 70
structure length 308
sequence length 347
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3f3fA01
4GQBB 3IKOA 4PC0A 2AQ5A 4O3UB 3UR4A 1B9XA 3F3GA 2G99A 5CYKB 4CY2A 3MXXA 2PM9B 1JJUB 2BCJB 3CFVA 3ULEC 3NVXA 3GFCA 5H17A 4R7AB 3EI3B 4O9DA 2P9NC 4GMBA 3SN6B 4G56B 3I8EA 4A08B 3F3PA 2CN2A 5TEFA 4N14A 3UVNA 2H9LA 2CE9A 4L1QD 1SHYB 2XU7A 4A09A 4PSWB 2YMUA 1K8KC 3I7PA 4CZXA 3EI1B 3DXMC 2YBAA 5KDOB 2HJ4A 3NVNA 4NSXA 2H14A 4QQEA 4ERZA 1OLZA 5JWZA 3KRXB 5CXCA 3FM0A 4CY1A 4ZOVA 2Q7QA 2HYEA 5FKQA 1P22A 3UVMA 2P9SC 4UI9R 3GREA 5IT9g 2H47A 3OTTA 4FAND 3P4FA 3UKRC 1NR0A 3RSEC 5GXIA 2H6QA 3BG1A 5CXBB 5EM2B 4E54B 5I5MA 4PSXB 3OL2A 1K32A 2P9PC 3EI2B 1MDAH 3MKSB 2BBKH 3C5MA 2YNPA 4A0BA 3FGBA 2PBIB 4LG8A 4J79A 2HJBA 4OWRA 2Z2PA 3OKTA 4GM8A 3PXTD 4AOWA 4ERQA 3ODTA 5IJ8E 3SBRA 4HDJA 2IWKA 4TZ4A 5EMKB 4IA9A 4D6VA 1PI6A 4JD2C 4CY5A 2HKRA 4JSXC 4I79A 2H13A 2P9LC 4A2LA 4FHLA 1U2VC 3AL8A 4E5ZB 1MG3A 5GXHA 2AGWA 5TDHB 1GP2B 4LGNA 3MZKA 4CC9A 5C9ZB 5GSAA 1B9YA 4OZUA 4JSPC 4CI2A 3U4YA 2OVQB 3EI4A 3I2NA 3K27A 4L3GD 3ZWLB 1SQ9A 5FKRA 4A2MA 4A11A 3PSLA 2HESX 2IWFA 4J8BA 4X61B 5I5IA 2J56H 3RN1D 4XYHA 2XL3A 5K19A 4MK0B 4JXMA 3EMHA 3W15A 5FLXg 4IMMA 4FB1D 3JB9L 3PXWD 3RFGA 1S4UX 5EAMA 4CY3A 1A0RB 2GNQA 4H5JA 3EWEA 5FQDA 5CYKA 5I5JA 3FRXA 3AL9A 4ESGA 2AGZA 2OJYA 3VH0A 3V5WB 2PM9A 5GMKn 3SJLD 2AGLA 2HKMA 3RFHA 3EI3A 5HQGA 4J8GA 1QNIA 2I3TA 3JZHA 4A08A 3HFQA 4Y5RD 4BUJC 5HE0B 2YB8B 3VGZA 5AMSA 4U7AA 2P9UC 3EU7A 5EMLB 1RI6A 2CNXA 5HE3B 2EBSA 3I7HA 4K3JB 3IIYA 2B5NA 3EI1A 2OVPB 4PBYA 3IIWA 1JMXB 4GGCA 3OKYB 4YVDA 1JOFA 4U1EI 5THAA 5EMMB 4EWRA 2CO0C 3JZNA 2OVRB 1Q47A 4CZYA 3J80g 5HYNB 4X3EA 2GC7A 4GGDA 5HE2B 3SBQA 4A7JA 1L0QA 1R5MA 4AEZA 5EARA 5FKSA 2GC4A 1ERJA 1OMWB 5EM2A 2AH1A 3CIKB 5EMJB 4O3TB 4ZOZA 3PVUB 2OIZA 4XEIC 3UVOA 4ZOXA 3PE7A 4GQ1A 4A0AB 4GM3A 4J84A 5A2Qg 4GQ2P 5IJ7E 4CZVA 4CI8A 3BWSA 3JZGA 1GXRA 4L9OA 3KRWB 3IJ0A 3RRMC 3DSMA 3SWSD 3UVLA 2J55H 2IURA 3V9FA 1TYQC 3IJCA 3I8CA 1N6DA 5EALA 5HE1B 3RLMD 2YNNA 2I0SA 2OK4A 2CE8A 2H3XA 4E5ZA 1XIPA 3JAMg 2UZYB 4ES0A 4BH6A 4GGAA 4J82A 1MG2A 4JSVC 2XYIA 3I7OA 4QRJA 1VYHC 3E0CA 4X60B 3JROA 4ERYA 4QT8A 5EAPA 4CI1A 2H9NA 3I7LA 5IC7A 4J78A 2B5LA 3OKWA 4FA4D 4A11B 3N0EA 2IAAA 1PEVA 4J87A 1FWXA 2I3SA 4Z8LA 5FA5B 2H9MA 3VA6A 3SMRA 2H6NA 3L4MD 2G9AA 3MZLA 3RMZD 2H9PA 2YNOA 3CFSB 4GZ8A 2Z2OA 2HXCA 2I0RA 2J57G 2QC5A 3OKYA 2O9KA 2IUQA 4J81A 4QL1A 2QXVA 4J77A 2P9KC 4BL0A 2OK6A 1YFQA 4H5IA 3C99A 4FAVD 1SQJA 5TEEA 3SXTD 4A09B 2Z2NA 5TF2A 3SVWD 3PVWB 4JT6C 2H6KA 3DM0A 3L4OD 2CN3A 4J0WA 5H14A 4K3ID 1NEXB 4J0XA 3SCYA 3I7NA 2H68A 5CXBA 3I89A 2IUVA 4L3HD 4E54A 3IJ1A 5CXCB 3SFZA 1XKSA 3JPXA 3V7DB 4JSNC 3OW8A 3AFCA 4O1QD 3EI2A 3NVQA 4PNKB 3RN0D 4J73A 2UZXB 3N0DA 4A0AA 3PXSD 1N6FA 4FWWA 5C2WB 5IGOA 3A0FA 3C9CA 5AJAA 1GOTB 3C75H 1JMZB 5H1MA 2TRCB 2P9IC 3MKQA 3OL2B 2IUPA 4ZN4A 2B5MA 4Y7RA 1N6EA 2XL2A 3MMYA 1TBGA 1PBYB 4GM9A 3BG0A 3UKUC 5SXMA 3K26A 2AGYA 5C2VB 4O45A 2W18A 4A0BB 3I7KA 3SBPA 5B4WA 3J81g 2PM7B 3B7FA 1U4CA 3F3FA 3SHFA 4ZOYA 4JT5C 5FKTA 5IGQA 3PSCB 4FA9D 1PGUA 2I0TA 3JRPA 4PBZA 5K1CC 4X63B 3AL8B 2AH0A 4KFMB 4XYIA 4J86A 4CI3A 3DWLC 2AGXA 4LG9A 2MTAH 2CO0A 1GG2B 3SLED 4FA5D 3DXKC 3ORVD 4FA1D 3EI4B 2B4EA 1XHMA 2PM6B 3EG6A 4PXWA 3UVKA 5AFU3 3AH8B 5FXYA 4D0KA
chains in the Genus database with same CATH superfamily
4GQBB 3IKOA 4PC0A 1U8CA 2AQ5A 4O3UB 5M5VA 1M1XA 3UR4A 1B9XA 3F3GA 3V4PA 2G99A 5CYKB 4CY2A 3MXXA 5M5UA 2PM9B 1JJUB 2BCJB 3CFVA 3ULEC 4AMYA 3NVXA 3GFCA 5H17A 4R7AB 3EI3B 4O9DA 2P9NC 3MUOA 3QI0A 4GMBA 3SN6B 2VDMA 4G56B 3I8EA 1TYEA 3F3PA 4A08B 2CN2A 5TEFA 4N14A 3UVNA 2H9LA 1BPOA 2CE9A 4L1QD 1SHYB 2XU7A 4A09A 4PSWB 2YMUA 1K8KC 3I7PA 4CZXA 4RE5A 1E8NA 2EIBA 3EI1B 3DXMC 2YBAA 1K3IA 5KDOB 2HJ4A 3NVNA 4NSXA 3IUJA 2H14A 4QQEA 3O4GA 4ERZA 1OLZA 3ZDXA 5JWZA 3KRXB 5CXCA 3FM0A 4CY1A 4ZOVA 3IUMA 5M5TA 2Q7QA 2HYEA 5FKQA 1C9LA 1P22A 3UVMA 2P9SC 4UI9R 4G1EA 3GREA 5IT9g 2H47A 3OTTA 1QFSA 4FAND 3P4FA 3UKRC 3VI4A 1NR0A 3RSEC 5GXIA 2H6QA 3ZE0A 3BG1A 5CXBB 5EM2B 4E54B 5I5MA 4PSXB 3OL2A 1K32A 2VZ1A 2P9PC 3EI2B 1MDAH 3MKSB 2QZPA 2EIEA 2BBKH 2EIDA 3C5MA 1VE6A 2YNPA 4MMYA 4A0BA 3FGBA 2PBIB 4LG8A 4J79A 2HJBA 2XZGA 3EQ9A 4OWRA 2Z2PA 3OKTA 4D9SA 4GM8A 3PXTD 4AOWA 4ERQA 3ODTA 5IJ8E 3SBRA 4HDJA 1C9IA 2IWKA 4NAAA 4TZ4A 4QAMA 5EMKB 4BCBA 4IA9A 3NIFA 3ZE2A 4D6VA 5C92A 1PI6A 4JD2C 4CY5A 2HKRA 4I79A 4JSXC 5M61A 2H13A 2P9LC 3ZE1A 1VZ3A 4A2LA 4FHLA 1U2VC 3AL8A 4E5ZB 1MG3A 5GXHA 2AGWA 5TDHB 4WK0A 1GP2B 1H2XA 4AX4A 4LGNA 3MZKA 4CC9A 5C9ZB 5GSAA 1B9YA 4OZUA 4JSPC 4CI2A 3U4YA 2OVQB 3EI4A 1UOPA 1YR2A 3I2NA 3K27A 1SQ9A 4L3GD 5FKRA 3ZWLB 1O6FA 4A2MA 4A11A 3PSLA 2HESX 2IWFA 4J8BA 4X61B 5I5IA 2J56H 3RN1D 4XYHA 2XL3A 1VZ2A 2VC2A 4MMXA 5K19A 4MK0B 4JXMA 3EMHA 3W15A 5FLXg 4IMMA 4FB1D 3T3PA 3PXWD 3JB9L 1GOHA 3RFGA 1S4UX 5EAMA 4NC4A 4CY3A 1A0RB 2GNQA 2VDKA 4H5JA 3EWEA 5FQDA 5E6RA 5CYKA 5I5JA 3FRXA 3AL9A 4BCDA 4ESGA 2AGZA 2OJYA 3VH0A 3V5WB 2PM9A 5GMKn 2VDPA 2VDLA 3SJLD 2AGLA 2HKMA 3RFHA 4L1MA 3EI3A 5HQGA 4J8GA 1JV2A 1QNIA 2I3TA 3JZHA 2VDRA 4A08A 3HFQA 4Y5RD 1GOFA 4BUJC 5HE0B 2YB8B 3VGZA 5AMSA 1E5TA 4MMZA 4U7AA 2P9UC 3EU7A 5EMLB 1RI6A 2CNXA 5HE3B 2EBSA 3I7HA 4K3JB 3IIYA 1A12A 4Z7NA 2B5NA 3EI1A 2OVPB 4PBYA 4BP8A 3IIWA 1JMXB 4GGCA 3OKYB 4YVDA 1JOFA 4U1EI 5THAA 1O6GA 5EMMB 4EWRA 2CO0C 3JZNA 2HU7A 2OVRB 4Z7QA 1Q47A 4CZYA 3J80g 5HYNB 4X3EA 2GC7A 4GGDA 5HE2B 3SBQA 4A7JA 1L0QA 5HDBA 1R5MA 4AEZA 2VDOA 5EARA 5FKSA 2GC4A 1ERJA 1OMWB 2HU8A 2WQ8A 4AMZA 5EM2A 2AH1A 3CIKB 5EMJB 4O3TB 4ZOZA 3PVUB 2OIZA 4XEIC 3T3MA 3UVOA 4ZOXA 3PE7A 4GQ1A 4A0AB 2EICA 3IURA 4GM3A 5C86A 2VZ3A 4DNVA 4J84A 2HU5A 5A2Qg 4GQ2P 5IJ7E 4CZVA 4CI8A 3BWSA 3JZGA 1GXRA 4L9OA 3KRWB 3IJ0A 3RRMC 3MVDK 3KCIA 3DSMA 3SWSD 1QFMA 3FCSA 3UVLA 2J55H 2IURA 2XDWA 3V9FA 1TYQC 3IJCA 3I8CA 1N6DA 5EALA 5HE1B 3RLMD 2YNNA 1L5GA 2I0SA 2OK4A 2CE8A 2H3XA 4DNWA 4WK2A 3OF7A 4E5ZA 1XIPA 4RE6A 3JAMg 2UZYB 4ES0A 3O4JA 4BH6A 4GGAA 4J82A 1MG2A 4JSVC 3IULA 2XYIA 3I7OA 3EQ8A 1H2ZA 4QRJA 1VYHC 3E0CA 3IVMA 4X60B 3JROA 4G55A 5FFOA 4ERYA 3IUQA 3ZDYA 2QR5A 4QT8A 5EAPA 4CI1A 2H9NA 3I7LA 2XE4A 5IC7A 4J78A 2B5LA 3OKWA 4FA4D 4A11B 3N0EA 2IAAA 3QHYB 4IRZA 5M5SA 5E6UA 4JHNA 1PEVA 4J87A 4DNUA 3MUNA 3NIGA 1FWXA 2I3SA 4Z8LA 5FA5B 2H9MA 3VA6A 3SMRA 3EQ7A 2H6NA 3L4MD 2G9AA 3MZLA 4G1MA 4AN1A 3RMZD 2H9PA 2YNOA 3CFSB 1UOQA 4GZ8A 2Z2OA 2HXCA 2I0RA 2J57G 2QC5A 3OKYA 2O9KA 2IUQA 2VDQA 4J81A 4QL1A 1I2MB 2QXVA 4J77A 4JHPC 2P9KC 1E8MA 4BL0A 3GD1I 2OK6A 1YFQA 4H5IA 3C99A 4FAVD 3K71A 4O2WA 1SQJA 5TEEA 1T2XA 3SXTD 4A09B 2Z2NA 5FFGA 5TF2A 3SVWD 3PVWB 2BKLA 3V4VA 4JT6C 2H6KA 3DM0A 3L4OD 2CN3A 4J0WA 3GC3B 4K3ID 5H14A 1NEXB 3O4IA 4WJKA 1H2YA 3IJEA 4J0XA 3SCYA 3I7NA 2H68A 3ZDZA 5CXBA 4BCCA 3I89A 2IUVA 4L3HD 4E54A 3IJ1A 3VI3A 5CXCB 3SFZA 1XKSA 3FCUA 3JPXA 3V7DB 4JSNC 3OW8A 3AFCA 4O1QD 3EI2A 3NVQA 4PNKB 3RN0D 4J73A 2UZXB 3N0DA 4A0AA 3PXSD 5E6SA 1N6FA 1JTDB 4FWWA 5C2WB 5IGOA 3A0FA 3C9CA 1VE7A 2JKXA 5AJAA 1GOTB 3C75H 1JMZB 5H1MA 2TRCB 2P9IC 3MKQA 3OL2B 1GOGA 2IUPA 4ZN4A 4NENA 1UOOA 2B5MA 4AN0A 4Z7OA 4Y7RA 1N6EA 2XL2A 3MMYA 1TBGA 3DDUA 4NBMA 1PBYB 3K72A 4GM9A 3BG0A 3UKUC 5SXMA 3K26A 2AGYA 5C2VB 4O45A 4UM8A 4O02A 2W18A 4A0BB 3I7KA 3SBPA 5B4WA 3J81g 2PM7B 3B7FA 1U4CA 3F3FA 3SHFA 1H2WA 4ZOYA 4JT5C 3K6SA 4UM9A 2VDNA 5FKTA 5IGQA 3PSCB 4FA9D 1PGUA 2I0TA 5M5RA 4BP9A 3JRPA 4PBZA 5K1CC 4X63B 3AL8B 3IUNA 2AH0A 3O4HA 4KFMB 4J86A 4XYIA 4CI3A 3DWLC 2AGXA 4LG9A 2MTAH 2CO0A 1GG2B 3SLED 4FA5D 4WK4A 3DXKC 3ORVD 4FA1D 3NIDA 3EI4B 2B4EA 1UTCA 1XHMA 2PM6B 3EG6A 4PXWA 3UVKA 5AFU3 3AH8B 5FXYA 4D0KA
chains in the Genus database with same CATH topology
4GQBB 3IKOA 4PC0A 2AQ5A 4O3UB 3UR4A 1B9XA 3F3GA 2G99A 5CYKB 4CY2A 3MXXA 2PM9B 1JJUB 2BCJB 3CFVA 3ULEC 3NVXA 3GFCA 5H17A 4R7AB 3EI3B 4O9DA 2P9NC 4GMBA 3SN6B 4G56B 3I8EA 4A08B 3F3PA 2CN2A 5TEFA 4N14A 3UVNA 2H9LA 2CE9A 4L1QD 1SHYB 2XU7A 4A09A 4PSWB 2YMUA 1K8KC 3I7PA 4CZXA 3EI1B 3DXMC 2YBAA 5KDOB 2HJ4A 3NVNA 4NSXA 2H14A 4QQEA 4ERZA 1OLZA 5JWZA 3KRXB 5CXCA 3FM0A 4CY1A 4ZOVA 2Q7QA 2HYEA 5FKQA 1P22A 3UVMA 2P9SC 4UI9R 3GREA 5IT9g 2H47A 3OTTA 4FAND 3P4FA 3UKRC 1NR0A 3RSEC 5GXIA 2H6QA 3BG1A 5CXBB 5EM2B 4E54B 5I5MA 4PSXB 3OL2A 1K32A 2P9PC 3EI2B 1MDAH 3MKSB 2BBKH 3C5MA 2YNPA 4A0BA 3FGBA 2PBIB 4LG8A 4J79A 2HJBA 4OWRA 2Z2PA 3OKTA 4GM8A 3PXTD 4AOWA 4ERQA 3ODTA 5IJ8E 3SBRA 4HDJA 2IWKA 4TZ4A 5EMKB 4IA9A 4D6VA 1PI6A 4JD2C 4CY5A 2HKRA 4JSXC 4I79A 2H13A 2P9LC 4A2LA 4FHLA 1U2VC 3AL8A 4E5ZB 1MG3A 5GXHA 2AGWA 5TDHB 1GP2B 4LGNA 3MZKA 4CC9A 5C9ZB 5GSAA 1B9YA 4OZUA 4JSPC 4CI2A 3U4YA 2OVQB 3EI4A 3I2NA 3K27A 4L3GD 3ZWLB 1SQ9A 5FKRA 4A2MA 4A11A 3PSLA 2HESX 2IWFA 4J8BA 4X61B 5I5IA 2J56H 3RN1D 4XYHA 2XL3A 5K19A 4MK0B 4JXMA 3EMHA 3W15A 5FLXg 4IMMA 4FB1D 3JB9L 3PXWD 3RFGA 1S4UX 5EAMA 4CY3A 1A0RB 2GNQA 4H5JA 3EWEA 5FQDA 5CYKA 5I5JA 3FRXA 3AL9A 4ESGA 2AGZA 2OJYA 3VH0A 3V5WB 2PM9A 5GMKn 3SJLD 2AGLA 2HKMA 3RFHA 3EI3A 5HQGA 4J8GA 1QNIA 2I3TA 3JZHA 4A08A 3HFQA 4Y5RD 4BUJC 5HE0B 2YB8B 3VGZA 5AMSA 4U7AA 2P9UC 3EU7A 5EMLB 1RI6A 2CNXA 5HE3B 2EBSA 3I7HA 4K3JB 3IIYA 2B5NA 3EI1A 2OVPB 4PBYA 3IIWA 1JMXB 4GGCA 3OKYB 4YVDA 1JOFA 4U1EI 5THAA 5EMMB 4EWRA 2CO0C 3JZNA 2OVRB 1Q47A 4CZYA 3J80g 5HYNB 4X3EA 2GC7A 4GGDA 5HE2B 3SBQA 4A7JA 1L0QA 1R5MA 4AEZA 5EARA 5FKSA 2GC4A 1ERJA 1OMWB 5EM2A 2AH1A 3CIKB 5EMJB 4O3TB 4ZOZA 3PVUB 2OIZA 4XEIC 3UVOA 4ZOXA 3PE7A 4GQ1A 4A0AB 4GM3A 4J84A 5A2Qg 4GQ2P 5IJ7E 4CZVA 4CI8A 3BWSA 3JZGA 1GXRA 4L9OA 3KRWB 3IJ0A 3RRMC 3DSMA 3SWSD 3UVLA 2J55H 2IURA 3V9FA 1TYQC 3IJCA 3I8CA 1N6DA 5EALA 5HE1B 3RLMD 2YNNA 2I0SA 2OK4A 2CE8A 2H3XA 4E5ZA 1XIPA 3JAMg 2UZYB 4ES0A 4BH6A 4GGAA 4J82A 1MG2A 4JSVC 2XYIA 3I7OA 4QRJA 1VYHC 3E0CA 4X60B 3JROA 4ERYA 4QT8A 5EAPA 4CI1A 2H9NA 3I7LA 5IC7A 4J78A 2B5LA 3OKWA 4FA4D 4A11B 3N0EA 2IAAA 1PEVA 4J87A 1FWXA 2I3SA 4Z8LA 5FA5B 2H9MA 3VA6A 3SMRA 2H6NA 3L4MD 2G9AA 3MZLA 3RMZD 2H9PA 2YNOA 3CFSB 4GZ8A 2Z2OA 2HXCA 2I0RA 2J57G 2QC5A 3OKYA 2O9KA 2IUQA 4J81A 4QL1A 2QXVA 4J77A 2P9KC 4BL0A 2OK6A 1YFQA 4H5IA 3C99A 4FAVD 1SQJA 5TEEA 3SXTD 4A09B 2Z2NA 5TF2A 3SVWD 3PVWB 4JT6C 2H6KA 3DM0A 3L4OD 2CN3A 4J0WA 5H14A 4K3ID 1NEXB 4J0XA 3SCYA 3I7NA 2H68A 5CXBA 3I89A 2IUVA 4L3HD 4E54A 3IJ1A 5CXCB 3SFZA 1XKSA 3JPXA 3V7DB 4JSNC 3OW8A 3AFCA 4O1QD 3EI2A 3NVQA 4PNKB 3RN0D 4J73A 2UZXB 3N0DA 4A0AA 3PXSD 1N6FA 4FWWA 5C2WB 5IGOA 3A0FA 3C9CA 5AJAA 1GOTB 3C75H 1JMZB 5H1MA 2TRCB 2P9IC 3MKQA 3OL2B 2IUPA 4ZN4A 2B5MA 4Y7RA 1N6EA 2XL2A 3MMYA 1TBGA 1PBYB 4GM9A 3BG0A 3UKUC 5SXMA 3K26A 2AGYA 5C2VB 4O45A 2W18A 4A0BB 3I7KA 3SBPA 5B4WA 3J81g 2PM7B 3B7FA 1U4CA 3F3FA 3SHFA 4ZOYA 4JT5C 5FKTA 5IGQA 3PSCB 4FA9D 1PGUA 2I0TA 3JRPA 4PBZA 5K1CC 4X63B 3AL8B 2AH0A 4KFMB 4XYIA 4J86A 4CI3A 3DWLC 2AGXA 4LG9A 2MTAH 2CO0A 1GG2B 3SLED 4FA5D 3DXKC 3ORVD 4FA1D 3EI4B 2B4EA 1XHMA 2PM6B 3EG6A 4PXWA 3UVKA 5AFU3 3AH8B 5FXYA 4D0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GQB B;  3IKO A;  4PC0 A;  2AQ5 A;  4O3U B;  3UR4 A;  1B9X A;  3F3G A;  2G99 A;  5CYK B;  4CY2 A;  3MXX A;  2PM9 B;  1JJU B;  2BCJ B;  3CFV A;  3ULE C;  3NVX A;  3GFC A;  5H17 A;  4R7A B;  3EI3 B;  4O9D A;  2P9N C;  4GMB A;  3SN6 B;  4G56 B;  3I8E A;  4A08 B;  3F3P A;  2CN2 A;  5TEF A;  4N14 A;  3UVN A;  2H9L A;  2CE9 A;  4L1Q D;  1SHY B;  2XU7 A;  4A09 A;  4PSW B;  2YMU A;  1K8K C;  3I7P A;  4CZX A;  3EI1 B;  3DXM C;  2YBA A;  5KDO B;  2HJ4 A;  3NVN A;  4NSX A;  2H14 A;  4QQE A;  4ERZ A;  1OLZ A;  5JWZ A;  3KRX B;  5CXC A;  3FM0 A;  4CY1 A;  4ZOV A;  2Q7Q A;  2HYE A;  5FKQ A;  1P22 A;  3UVM A;  2P9S C;  4UI9 R;  3GRE A;  5IT9 g;  2H47 A;  3OTT A;  4FAN D;  3P4F A;  3UKR C;  1NR0 A;  3RSE C;  5GXI A;  2H6Q A;  3BG1 A;  5CXB B;  5EM2 B;  4E54 B;  5I5M A;  4PSX B;  3OL2 A;  1K32 A;  2P9P C;  3EI2 B;  1MDA H;  3MKS B;  2BBK H;  3C5M A;  2YNP A;  4A0B A;  3FGB A;  2PBI B;  4LG8 A;  4J79 A;  2HJB A;  4OWR A;  2Z2P A;  3OKT A;  4GM8 A;  3PXT D;  4AOW A;  4ERQ A;  3ODT A;  5IJ8 E;  3SBR A;  4HDJ A;  2IWK A;  4TZ4 A;  5EMK B;  4IA9 A;  4D6V A;  1PI6 A;  4JD2 C;  4CY5 A;  2HKR A;  4JSX C;  4I79 A;  2H13 A;  2P9L C;  4A2L A;  4FHL A;  1U2V C;  3AL8 A;  4E5Z B;  1MG3 A;  5GXH A;  2AGW A;  5TDH B;  1GP2 B;  4LGN A;  3MZK A;  4CC9 A;  5C9Z B;  5GSA A;  1B9Y A;  4OZU A;  4JSP C;  4CI2 A;  3U4Y A;  2OVQ B;  3EI4 A;  3I2N A;  3K27 A;  4L3G D;  3ZWL B;  1SQ9 A;  5FKR A;  4A2M A;  4A11 A;  3PSL A;  2HES X;  2IWF A;  4J8B A;  4X61 B;  5I5I A;  2J56 H;  3RN1 D;  4XYH A;  2XL3 A;  5K19 A;  4MK0 B;  4JXM A;  3EMH A;  3W15 A;  5FLX g;  4IMM A;  4FB1 D;  3JB9 L;  3PXW D;  3RFG A;  1S4U X;  5EAM A;  4CY3 A;  1A0R B;  2GNQ A;  4H5J A;  3EWE A;  5FQD A;  5CYK A;  5I5J A;  3FRX A;  3AL9 A;  4ESG A;  2AGZ A;  2OJY A;  3VH0 A;  3V5W B;  2PM9 A;  5GMK n;  3SJL D;  2AGL A;  2HKM A;  3RFH A;  3EI3 A;  5HQG A;  4J8G A;  1QNI A;  2I3T A;  3JZH A;  4A08 A;  3HFQ A;  4Y5R D;  4BUJ C;  5HE0 B;  2YB8 B;  3VGZ A;  5AMS A;  4U7A A;  2P9U C;  3EU7 A;  5EML B;  1RI6 A;  2CNX A;  5HE3 B;  2EBS A;  3I7H A;  4K3J B;  3IIY A;  2B5N A;  3EI1 A;  2OVP B;  4PBY A;  3IIW A;  1JMX B;  4GGC A;  3OKY B;  4YVD A;  1JOF A;  4U1E I;  5THA A;  5EMM B;  4EWR A;  2CO0 C;  3JZN A;  2OVR B;  1Q47 A;  4CZY A;  3J80 g;  5HYN B;  4X3E A;  2GC7 A;  4GGD A;  5HE2 B;  3SBQ A;  4A7J A;  1L0Q A;  1R5M A;  4AEZ A;  5EAR A;  5FKS A;  2GC4 A;  1ERJ A;  1OMW B;  5EM2 A;  2AH1 A;  3CIK B;  5EMJ B;  4O3T B;  4ZOZ A;  3PVU B;  2OIZ A;  4XEI C;  3UVO A;  4ZOX A;  3PE7 A;  4GQ1 A;  4A0A B;  4GM3 A;  4J84 A;  5A2Q g;  4GQ2 P;  5IJ7 E;  4CZV A;  4CI8 A;  3BWS A;  3JZG A;  1GXR A;  4L9O A;  3KRW B;  3IJ0 A;  3RRM C;  3DSM A;  3SWS D;  3UVL A;  2J55 H;  2IUR A;  3V9F A;  1TYQ C;  3IJC A;  3I8C A;  1N6D A;  5EAL A;  5HE1 B;  3RLM D;  2YNN A;  2I0S A;  2OK4 A;  2CE8 A;  2H3X A;  4E5Z A;  1XIP A;  3JAM g;  2UZY B;  4ES0 A;  4BH6 A;  4GGA A;  4J82 A;  1MG2 A;  4JSV C;  2XYI A;  3I7O A;  4QRJ A;  1VYH C;  3E0C A;  4X60 B;  3JRO A;  4ERY A;  4QT8 A;  5EAP A;  4CI1 A;  2H9N A;  3I7L A;  5IC7 A;  4J78 A;  2B5L A;  3OKW A;  4FA4 D;  4A11 B;  3N0E A;  2IAA A;  1PEV A;  4J87 A;  1FWX A;  2I3S A;  4Z8L A;  5FA5 B;  2H9M A;  3VA6 A;  3SMR A;  2H6N A;  3L4M D;  2G9A A;  3MZL A;  3RMZ D;  2H9P A;  2YNO A;  3CFS B;  4GZ8 A;  2Z2O A;  2HXC A;  2I0R A;  2J57 G;  2QC5 A;  3OKY A;  2O9K A;  2IUQ A;  4J81 A;  4QL1 A;  2QXV A;  4J77 A;  2P9K C;  4BL0 A;  2OK6 A;  1YFQ A;  4H5I A;  3C99 A;  4FAV D;  1SQJ A;  5TEE A;  3SXT D;  4A09 B;  2Z2N A;  5TF2 A;  3SVW D;  3PVW B;  4JT6 C;  2H6K A;  3DM0 A;  3L4O D;  2CN3 A;  4J0W A;  5H14 A;  4K3I D;  1NEX B;  4J0X A;  3SCY A;  3I7N A;  2H68 A;  5CXB A;  3I89 A;  2IUV A;  4L3H D;  4E54 A;  3IJ1 A;  5CXC B;  3SFZ A;  1XKS A;  3JPX A;  3V7D B;  4JSN C;  3OW8 A;  3AFC A;  4O1Q D;  3EI2 A;  3NVQ A;  4PNK B;  3RN0 D;  4J73 A;  2UZX B;  3N0D A;  4A0A A;  3PXS D;  1N6F A;  4FWW A;  5C2W B;  5IGO A;  3A0F A;  3C9C A;  5AJA A;  1GOT B;  3C75 H;  1JMZ B;  5H1M A;  2TRC B;  2P9I C;  3MKQ A;  3OL2 B;  2IUP A;  4ZN4 A;  2B5M A;  4Y7R A;  1N6E A;  2XL2 A;  3MMY A;  1TBG A;  1PBY B;  4GM9 A;  3BG0 A;  3UKU C;  5SXM A;  3K26 A;  2AGY A;  5C2V B;  4O45 A;  2W18 A;  4A0B B;  3I7K A;  3SBP A;  5B4W A;  3J81 g;  2PM7 B;  3B7F A;  1U4C A;  3F3F A;  3SHF A;  4ZOY A;  4JT5 C;  5FKT A;  5IGQ A;  3PSC B;  4FA9 D;  1PGU A;  2I0T A;  3JRP A;  4PBZ A;  5K1C C;  4X63 B;  3AL8 B;  2AH0 A;  4KFM B;  4XYI A;  4J86 A;  4CI3 A;  3DWL C;  2AGX A;  4LG9 A;  2MTA H;  2CO0 A;  1GG2 B;  3SLE D;  4FA5 D;  3DXK C;  3ORV D;  4FA1 D;  3EI4 B;  2B4E A;  1XHM A;  2PM6 B;  3EG6 A;  4PXW A;  3UVK A;  5AFU 3;  3AH8 B;  5FXY A;  4D0K A; 
#chains in the Genus database with same CATH topology
 4GQB B;  3IKO A;  4PC0 A;  1U8C A;  2AQ5 A;  4O3U B;  5M5V A;  1M1X A;  3UR4 A;  1B9X A;  3F3G A;  3V4P A;  2G99 A;  5CYK B;  4CY2 A;  3MXX A;  5M5U A;  2PM9 B;  1JJU B;  2BCJ B;  3CFV A;  3ULE C;  4AMY A;  3NVX A;  3GFC A;  5H17 A;  4R7A B;  3EI3 B;  4O9D A;  2P9N C;  3MUO A;  3QI0 A;  4GMB A;  3SN6 B;  2VDM A;  4G56 B;  3I8E A;  1TYE A;  3F3P A;  4A08 B;  2CN2 A;  5TEF A;  4N14 A;  3UVN A;  2H9L A;  1BPO A;  2CE9 A;  4L1Q D;  1SHY B;  2XU7 A;  4A09 A;  4PSW B;  2YMU A;  1K8K C;  3I7P A;  4CZX A;  4RE5 A;  1E8N A;  2EIB A;  3EI1 B;  3DXM C;  2YBA A;  1K3I A;  5KDO B;  2HJ4 A;  3NVN A;  4NSX A;  3IUJ A;  2H14 A;  4QQE A;  3O4G A;  4ERZ A;  1OLZ A;  3ZDX A;  5JWZ A;  3KRX B;  5CXC A;  3FM0 A;  4CY1 A;  4ZOV A;  3IUM A;  5M5T A;  2Q7Q A;  2HYE A;  5FKQ A;  1C9L A;  1P22 A;  3UVM A;  2P9S C;  4UI9 R;  4G1E A;  3GRE A;  5IT9 g;  2H47 A;  3OTT A;  1QFS A;  4FAN D;  3P4F A;  3UKR C;  3VI4 A;  1NR0 A;  3RSE C;  5GXI A;  2H6Q A;  3ZE0 A;  3BG1 A;  5CXB B;  5EM2 B;  4E54 B;  5I5M A;  4PSX B;  3OL2 A;  1K32 A;  2VZ1 A;  2P9P C;  3EI2 B;  1MDA H;  3MKS B;  2QZP A;  2EIE A;  2BBK H;  2EID A;  3C5M A;  1VE6 A;  2YNP A;  4MMY A;  4A0B A;  3FGB A;  2PBI B;  4LG8 A;  4J79 A;  2HJB A;  2XZG A;  3EQ9 A;  4OWR A;  2Z2P A;  3OKT A;  4D9S A;  4GM8 A;  3PXT D;  4AOW A;  4ERQ A;  3ODT A;  5IJ8 E;  3SBR A;  4HDJ A;  1C9I A;  2IWK A;  4NAA A;  4TZ4 A;  4QAM A;  5EMK B;  4BCB A;  4IA9 A;  3NIF A;  3ZE2 A;  4D6V A;  5C92 A;  1PI6 A;  4JD2 C;  4CY5 A;  2HKR A;  4I79 A;  4JSX C;  5M61 A;  2H13 A;  2P9L C;  3ZE1 A;  1VZ3 A;  4A2L A;  4FHL A;  1U2V C;  3AL8 A;  4E5Z B;  1MG3 A;  5GXH A;  2AGW A;  5TDH B;  4WK0 A;  1GP2 B;  1H2X A;  4AX4 A;  4LGN A;  3MZK A;  4CC9 A;  5C9Z B;  5GSA A;  1B9Y A;  4OZU A;  4JSP C;  4CI2 A;  3U4Y A;  2OVQ B;  3EI4 A;  1UOP A;  1YR2 A;  3I2N A;  3K27 A;  1SQ9 A;  4L3G D;  5FKR A;  3ZWL B;  1O6F A;  4A2M A;  4A11 A;  3PSL A;  2HES X;  2IWF A;  4J8B A;  4X61 B;  5I5I A;  2J56 H;  3RN1 D;  4XYH A;  2XL3 A;  1VZ2 A;  2VC2 A;  4MMX A;  5K19 A;  4MK0 B;  4JXM A;  3EMH A;  3W15 A;  5FLX g;  4IMM A;  4FB1 D;  3T3P A;  3PXW D;  3JB9 L;  1GOH A;  3RFG A;  1S4U X;  5EAM A;  4NC4 A;  4CY3 A;  1A0R B;  2GNQ A;  2VDK A;  4H5J A;  3EWE A;  5FQD A;  5E6R A;  5CYK A;  5I5J A;  3FRX A;  3AL9 A;  4BCD A;  4ESG A;  2AGZ A;  2OJY A;  3VH0 A;  3V5W B;  2PM9 A;  5GMK n;  2VDP A;  2VDL A;  3SJL D;  2AGL A;  2HKM A;  3RFH A;  4L1M A;  3EI3 A;  5HQG A;  4J8G A;  1JV2 A;  1QNI A;  2I3T A;  3JZH A;  2VDR A;  4A08 A;  3HFQ A;  4Y5R D;  1GOF A;  4BUJ C;  5HE0 B;  2YB8 B;  3VGZ A;  5AMS A;  1E5T A;  4MMZ A;  4U7A A;  2P9U C;  3EU7 A;  5EML B;  1RI6 A;  2CNX A;  5HE3 B;  2EBS A;  3I7H A;  4K3J B;  3IIY A;  1A12 A;  4Z7N A;  2B5N A;  3EI1 A;  2OVP B;  4PBY A;  4BP8 A;  3IIW A;  1JMX B;  4GGC A;  3OKY B;  4YVD A;  1JOF A;  4U1E I;  5THA A;  1O6G A;  5EMM B;  4EWR A;  2CO0 C;  3JZN A;  2HU7 A;  2OVR B;  4Z7Q A;  1Q47 A;  4CZY A;  3J80 g;  5HYN B;  4X3E A;  2GC7 A;  4GGD A;  5HE2 B;  3SBQ A;  4A7J A;  1L0Q A;  5HDB A;  1R5M A;  4AEZ A;  2VDO A;  5EAR A;  5FKS A;  2GC4 A;  1ERJ A;  1OMW B;  2HU8 A;  2WQ8 A;  4AMZ A;  5EM2 A;  2AH1 A;  3CIK B;  5EMJ B;  4O3T B;  4ZOZ A;  3PVU B;  2OIZ A;  4XEI C;  3T3M A;  3UVO A;  4ZOX A;  3PE7 A;  4GQ1 A;  4A0A B;  2EIC A;  3IUR A;  4GM3 A;  5C86 A;  2VZ3 A;  4DNV A;  4J84 A;  2HU5 A;  5A2Q g;  4GQ2 P;  5IJ7 E;  4CZV A;  4CI8 A;  3BWS A;  3JZG A;  1GXR A;  4L9O A;  3KRW B;  3IJ0 A;  3RRM C;  3MVD K;  3KCI A;  3DSM A;  3SWS D;  1QFM A;  3FCS A;  3UVL A;  2J55 H;  2IUR A;  2XDW A;  3V9F A;  1TYQ C;  3IJC A;  3I8C A;  1N6D A;  5EAL A;  5HE1 B;  3RLM D;  2YNN A;  1L5G A;  2I0S A;  2OK4 A;  2CE8 A;  2H3X A;  4DNW A;  4WK2 A;  3OF7 A;  4E5Z A;  1XIP A;  4RE6 A;  3JAM g;  2UZY B;  4ES0 A;  3O4J A;  4BH6 A;  4GGA A;  4J82 A;  1MG2 A;  4JSV C;  3IUL A;  2XYI A;  3I7O A;  3EQ8 A;  1H2Z A;  4QRJ A;  1VYH C;  3E0C A;  3IVM A;  4X60 B;  3JRO A;  4G55 A;  5FFO A;  4ERY A;  3IUQ A;  3ZDY A;  2QR5 A;  4QT8 A;  5EAP A;  4CI1 A;  2H9N A;  3I7L A;  2XE4 A;  5IC7 A;  4J78 A;  2B5L A;  3OKW A;  4FA4 D;  4A11 B;  3N0E A;  2IAA A;  3QHY B;  4IRZ A;  5M5S A;  5E6U A;  4JHN A;  1PEV A;  4J87 A;  4DNU A;  3MUN A;  3NIG A;  1FWX A;  2I3S A;  4Z8L A;  5FA5 B;  2H9M A;  3VA6 A;  3SMR A;  3EQ7 A;  2H6N A;  3L4M D;  2G9A A;  3MZL A;  4G1M A;  4AN1 A;  3RMZ D;  2H9P A;  2YNO A;  3CFS B;  1UOQ A;  4GZ8 A;  2Z2O A;  2HXC A;  2I0R A;  2J57 G;  2QC5 A;  3OKY A;  2O9K A;  2IUQ A;  2VDQ A;  4J81 A;  4QL1 A;  1I2M B;  2QXV A;  4J77 A;  4JHP C;  2P9K C;  1E8M A;  4BL0 A;  3GD1 I;  2OK6 A;  1YFQ A;  4H5I A;  3C99 A;  4FAV D;  3K71 A;  4O2W A;  1SQJ A;  5TEE A;  1T2X A;  3SXT D;  4A09 B;  2Z2N A;  5FFG A;  5TF2 A;  3SVW D;  3PVW B;  2BKL A;  3V4V A;  4JT6 C;  2H6K A;  3DM0 A;  3L4O D;  2CN3 A;  4J0W A;  3GC3 B;  4K3I D;  5H14 A;  1NEX B;  3O4I A;  4WJK A;  1H2Y A;  3IJE A;  4J0X A;  3SCY A;  3I7N A;  2H68 A;  3ZDZ A;  5CXB A;  4BCC A;  3I89 A;  2IUV A;  4L3H D;  4E54 A;  3IJ1 A;  3VI3 A;  5CXC B;  3SFZ A;  1XKS A;  3FCU A;  3JPX A;  3V7D B;  4JSN C;  3OW8 A;  3AFC A;  4O1Q D;  3EI2 A;  3NVQ A;  4PNK B;  3RN0 D;  4J73 A;  2UZX B;  3N0D A;  4A0A A;  3PXS D;  5E6S A;  1N6F A;  1JTD B;  4FWW A;  5C2W B;  5IGO A;  3A0F A;  3C9C A;  1VE7 A;  2JKX A;  5AJA A;  1GOT B;  3C75 H;  1JMZ B;  5H1M A;  2TRC B;  2P9I C;  3MKQ A;  3OL2 B;  1GOG A;  2IUP A;  4ZN4 A;  4NEN A;  1UOO A;  2B5M A;  4AN0 A;  4Z7O A;  4Y7R A;  1N6E A;  2XL2 A;  3MMY A;  1TBG A;  3DDU A;  4NBM A;  1PBY B;  3K72 A;  4GM9 A;  3BG0 A;  3UKU C;  5SXM A;  3K26 A;  2AGY A;  5C2V B;  4O45 A;  4UM8 A;  4O02 A;  2W18 A;  4A0B B;  3I7K A;  3SBP A;  5B4W A;  3J81 g;  2PM7 B;  3B7F A;  1U4C A;  3F3F A;  3SHF A;  1H2W A;  4ZOY A;  4JT5 C;  3K6S A;  4UM9 A;  2VDN A;  5FKT A;  5IGQ A;  3PSC B;  4FA9 D;  1PGU A;  2I0T A;  5M5R A;  4BP9 A;  3JRP A;  4PBZ A;  5K1C C;  4X63 B;  3AL8 B;  3IUN A;  2AH0 A;  3O4H A;  4KFM B;  4J86 A;  4XYI A;  4CI3 A;  3DWL C;  2AGX A;  4LG9 A;  2MTA H;  2CO0 A;  1GG2 B;  3SLE D;  4FA5 D;  4WK4 A;  3DXK C;  3ORV D;  4FA1 D;  3NID A;  3EI4 B;  2B4E A;  1UTC A;  1XHM A;  2PM6 B;  3EG6 A;  4PXW A;  3UVK A;  5AFU 3;  3AH8 B;  5FXY A;  4D0K A; 
#chains in the Genus database with same CATH homology
 4GQB B;  3IKO A;  4PC0 A;  2AQ5 A;  4O3U B;  3UR4 A;  1B9X A;  3F3G A;  2G99 A;  5CYK B;  4CY2 A;  3MXX A;  2PM9 B;  1JJU B;  2BCJ B;  3CFV A;  3ULE C;  3NVX A;  3GFC A;  5H17 A;  4R7A B;  3EI3 B;  4O9D A;  2P9N C;  4GMB A;  3SN6 B;  4G56 B;  3I8E A;  4A08 B;  3F3P A;  2CN2 A;  5TEF A;  4N14 A;  3UVN A;  2H9L A;  2CE9 A;  4L1Q D;  1SHY B;  2XU7 A;  4A09 A;  4PSW B;  2YMU A;  1K8K C;  3I7P A;  4CZX A;  3EI1 B;  3DXM C;  2YBA A;  5KDO B;  2HJ4 A;  3NVN A;  4NSX A;  2H14 A;  4QQE A;  4ERZ A;  1OLZ A;  5JWZ A;  3KRX B;  5CXC A;  3FM0 A;  4CY1 A;  4ZOV A;  2Q7Q A;  2HYE A;  5FKQ A;  1P22 A;  3UVM A;  2P9S C;  4UI9 R;  3GRE A;  5IT9 g;  2H47 A;  3OTT A;  4FAN D;  3P4F A;  3UKR C;  1NR0 A;  3RSE C;  5GXI A;  2H6Q A;  3BG1 A;  5CXB B;  5EM2 B;  4E54 B;  5I5M A;  4PSX B;  3OL2 A;  1K32 A;  2P9P C;  3EI2 B;  1MDA H;  3MKS B;  2BBK H;  3C5M A;  2YNP A;  4A0B A;  3FGB A;  2PBI B;  4LG8 A;  4J79 A;  2HJB A;  4OWR A;  2Z2P A;  3OKT A;  4GM8 A;  3PXT D;  4AOW A;  4ERQ A;  3ODT A;  5IJ8 E;  3SBR A;  4HDJ A;  2IWK A;  4TZ4 A;  5EMK B;  4IA9 A;  4D6V A;  1PI6 A;  4JD2 C;  4CY5 A;  2HKR A;  4JSX C;  4I79 A;  2H13 A;  2P9L C;  4A2L A;  4FHL A;  1U2V C;  3AL8 A;  4E5Z B;  1MG3 A;  5GXH A;  2AGW A;  5TDH B;  1GP2 B;  4LGN A;  3MZK A;  4CC9 A;  5C9Z B;  5GSA A;  1B9Y A;  4OZU A;  4JSP C;  4CI2 A;  3U4Y A;  2OVQ B;  3EI4 A;  3I2N A;  3K27 A;  4L3G D;  3ZWL B;  1SQ9 A;  5FKR A;  4A2M A;  4A11 A;  3PSL A;  2HES X;  2IWF A;  4J8B A;  4X61 B;  5I5I A;  2J56 H;  3RN1 D;  4XYH A;  2XL3 A;  5K19 A;  4MK0 B;  4JXM A;  3EMH A;  3W15 A;  5FLX g;  4IMM A;  4FB1 D;  3JB9 L;  3PXW D;  3RFG A;  1S4U X;  5EAM A;  4CY3 A;  1A0R B;  2GNQ A;  4H5J A;  3EWE A;  5FQD A;  5CYK A;  5I5J A;  3FRX A;  3AL9 A;  4ESG A;  2AGZ A;  2OJY A;  3VH0 A;  3V5W B;  2PM9 A;  5GMK n;  3SJL D;  2AGL A;  2HKM A;  3RFH A;  3EI3 A;  5HQG A;  4J8G A;  1QNI A;  2I3T A;  3JZH A;  4A08 A;  3HFQ A;  4Y5R D;  4BUJ C;  5HE0 B;  2YB8 B;  3VGZ A;  5AMS A;  4U7A A;  2P9U C;  3EU7 A;  5EML B;  1RI6 A;  2CNX A;  5HE3 B;  2EBS A;  3I7H A;  4K3J B;  3IIY A;  2B5N A;  3EI1 A;  2OVP B;  4PBY A;  3IIW A;  1JMX B;  4GGC A;  3OKY B;  4YVD A;  1JOF A;  4U1E I;  5THA A;  5EMM B;  4EWR A;  2CO0 C;  3JZN A;  2OVR B;  1Q47 A;  4CZY A;  3J80 g;  5HYN B;  4X3E A;  2GC7 A;  4GGD A;  5HE2 B;  3SBQ A;  4A7J A;  1L0Q A;  1R5M A;  4AEZ A;  5EAR A;  5FKS A;  2GC4 A;  1ERJ A;  1OMW B;  5EM2 A;  2AH1 A;  3CIK B;  5EMJ B;  4O3T B;  4ZOZ A;  3PVU B;  2OIZ A;  4XEI C;  3UVO A;  4ZOX A;  3PE7 A;  4GQ1 A;  4A0A B;  4GM3 A;  4J84 A;  5A2Q g;  4GQ2 P;  5IJ7 E;  4CZV A;  4CI8 A;  3BWS A;  3JZG A;  1GXR A;  4L9O A;  3KRW B;  3IJ0 A;  3RRM C;  3DSM A;  3SWS D;  3UVL A;  2J55 H;  2IUR A;  3V9F A;  1TYQ C;  3IJC A;  3I8C A;  1N6D A;  5EAL A;  5HE1 B;  3RLM D;  2YNN A;  2I0S A;  2OK4 A;  2CE8 A;  2H3X A;  4E5Z A;  1XIP A;  3JAM g;  2UZY B;  4ES0 A;  4BH6 A;  4GGA A;  4J82 A;  1MG2 A;  4JSV C;  2XYI A;  3I7O A;  4QRJ A;  1VYH C;  3E0C A;  4X60 B;  3JRO A;  4ERY A;  4QT8 A;  5EAP A;  4CI1 A;  2H9N A;  3I7L A;  5IC7 A;  4J78 A;  2B5L A;  3OKW A;  4FA4 D;  4A11 B;  3N0E A;  2IAA A;  1PEV A;  4J87 A;  1FWX A;  2I3S A;  4Z8L A;  5FA5 B;  2H9M A;  3VA6 A;  3SMR A;  2H6N A;  3L4M D;  2G9A A;  3MZL A;  3RMZ D;  2H9P A;  2YNO A;  3CFS B;  4GZ8 A;  2Z2O A;  2HXC A;  2I0R A;  2J57 G;  2QC5 A;  3OKY A;  2O9K A;  2IUQ A;  4J81 A;  4QL1 A;  2QXV A;  4J77 A;  2P9K C;  4BL0 A;  2OK6 A;  1YFQ A;  4H5I A;  3C99 A;  4FAV D;  1SQJ A;  5TEE A;  3SXT D;  4A09 B;  2Z2N A;  5TF2 A;  3SVW D;  3PVW B;  4JT6 C;  2H6K A;  3DM0 A;  3L4O D;  2CN3 A;  4J0W A;  5H14 A;  4K3I D;  1NEX B;  4J0X A;  3SCY A;  3I7N A;  2H68 A;  5CXB A;  3I89 A;  2IUV A;  4L3H D;  4E54 A;  3IJ1 A;  5CXC B;  3SFZ A;  1XKS A;  3JPX A;  3V7D B;  4JSN C;  3OW8 A;  3AFC A;  4O1Q D;  3EI2 A;  3NVQ A;  4PNK B;  3RN0 D;  4J73 A;  2UZX B;  3N0D A;  4A0A A;  3PXS D;  1N6F A;  4FWW A;  5C2W B;  5IGO A;  3A0F A;  3C9C A;  5AJA A;  1GOT B;  3C75 H;  1JMZ B;  5H1M A;  2TRC B;  2P9I C;  3MKQ A;  3OL2 B;  2IUP A;  4ZN4 A;  2B5M A;  4Y7R A;  1N6E A;  2XL2 A;  3MMY A;  1TBG A;  1PBY B;  4GM9 A;  3BG0 A;  3UKU C;  5SXM A;  3K26 A;  2AGY A;  5C2V B;  4O45 A;  2W18 A;  4A0B B;  3I7K A;  3SBP A;  5B4W A;  3J81 g;  2PM7 B;  3B7F A;  1U4C A;  3F3F A;  3SHF A;  4ZOY A;  4JT5 C;  5FKT A;  5IGQ A;  3PSC B;  4FA9 D;  1PGU A;  2I0T A;  3JRP A;  4PBZ A;  5K1C C;  4X63 B;  3AL8 B;  2AH0 A;  4KFM B;  4XYI A;  4J86 A;  4CI3 A;  3DWL C;  2AGX A;  4LG9 A;  2MTA H;  2CO0 A;  1GG2 B;  3SLE D;  4FA5 D;  3DXK C;  3ORV D;  4FA1 D;  3EI4 B;  2B4E A;  1XHM A;  2PM6 B;  3EG6 A;  4PXW A;  3UVK A;  5AFU 3;  3AH8 B;  5FXY A;  4D0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...