3F3HA

Crystal structure and anti-tumor activity of lz-8 from the fungus ganoderma lucidium
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
110
structure length
110
Chain Sequence
SDTALIFRLAWDVKKLSFDYTPNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYNSGYGIADTNTIQVFVVDPDTNNDFIIAQWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of LZ-8 from the medicinal fungus Ganoderma lucidium
pubmed doi rcsb
source organism Ganoderma lucidum
molecule tags Antitumor protein
molecule keywords Immunomodulatory protein Ling Zhi-8
total genus 31
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09259 Fve Fungal immunomodulatory protein Fve
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f3hA00
1OSYA 3KCWA 3F3HA
chains in the Genus database with same CATH superfamily
1OK0A 3ZR6A 4UNVA 3RGHA 4GH7B 3NQIA 8FABB 3NVQA 3ILPB 5D96B 3VXSA 1FZKA 3ZKND 1BEYH 1OM3L 1RUAH 2Q87A 4YFDB 2ICEA 3JZYA 4M56A 4UNTA 4ELDA 5I1GL 2F74A 4FYRA 4MKMA 3D39B 1P4BL 3IAQA 1EH9A 1JPEA 1XBDA 1AHKA 1SEQL 2A6KB 3CXFA 4QRUB 3UGXA 5JZ7C 1GC1H 1P7BA 3AAZB 4HYTB 4KO6A 5JW3L 1S6NA 5JXAH 3V6ZA 4LSSH 2OJEA 3FQRA 4MJ5B 1AOZA 4HPHA 3BT2H 2WW8A 3QFDB 4LRIC 5HGGS 3QJOA 3ZL4H 4FC3E 4DW2L 5JW4R 2LFEA 4LL1A 4TL4A 2MCAA 1PZ2A 3SDXE 2GI7A 3U4AA 5BUAA 2DQMA 4FQPA 4JL1A 2DMKA 4Y89A 4KWUA 1R24B 3UCRA 1UZ6E 3ZIMA 4ABWA 1DTUA 1KN4L 3PL6B 4R8WL 4WNJA 1KEGL 3DIFB 3MLWL 1LMIA 5IVOA 2PTTB 3UTQB 4AK2A 3C8KB 4FFWD 5I75C 1FJ1B 4NAMA 1U8CA 1IC7L 2E6PA 2XKNB 3RGVC 1QA9B 1CE6A 3TH2T 2Z35B 4EI6B 4AJ0A 2FHFA 1AACA 4G8GA 3TZVB 1XB3A 4JGUA 1JZ4A 3VXMD 1ZPLA 3CSTA 1DN0A 4XAKE 4LPCA 4Z8FL 4GKOA 1ZTXL 5AW7B 3VA6A 3Q5YA 5C0FB 4LO9A 4IDJL 2A1WH 4UT6A 5H35B 5GZOA 3OLEA 2KZKA 4H7VA 1I7UA 1UM5L 2IG2L 1J10A 5EO0A 2DD8H 2QSCL 3VVWA 1I1YA 1AO7A 2JTDA 2R69A 4Z7QE 4YSTA 1ERNA 1QRNA 3SB3A 4I8DA 3RPBA 4FFYH 1H0DB 3RPKA 1Q94A 4X4MA 2DQHH 4XN8A 4JMNA 3SDXF 2AQQA 2WK2A 1F56A 1M6UA 3NRFA 2D03H 3PXJA 5FUZH 4TQEL 3CZJA 2LLGA 2ZOOA 2B1HL 2FT8A 4RESB 4IRJD 5C0BA 3VJ6B 2UZXA 2Y7LA 2G9HA 4NM4H 2EC8A 3TN0A 1MLCA 1I7RB 4OD1L 5EBGA 4NQCE 6PCYA 4JPQA 1JHKH 4L37A 1Q90A 4ZZFA 2QHLA 1I31A 1IE4A 3A21A 3K6NA 4UTBL 4Z9KB 3L3KA 1QWHA 5C07E 4AE1A 1TF4A 4HUCA 1C1EH 3BQVA 3M1OA 2BVOB 4Q97A 1WCBA 3NJGA 1OKEA 4JFEE 3ZO0A 4ACTA 3GSVB 2E4FA 4HWEH 2EUXA 2UY7B 3MBWB 4NXKA 4PJBB 3QEUA 4WWNA 4MS8D 2NY3D 3CMOL 5D7JC 1ZGLP 3OGCB 1IIKA 5E1QA 3BAWA 3QDMD 4X6EA 5HJ3B 5KVDE 2JKIS 2FAUA 1OT4A 2FJGA 4RMVA 5D7JB 4N85A 4PAZA 2J44A 4HH8A 2NNRA 2BFVL 5IMMB 2DV6A 1Z9MA 1S9KC 1OP9A 4LLYB 2WZAA 4FHJA 4P3WA 4Z7QB 1N64L 4LCCB 4V2BA 3GLZA 2Q8BL 4Y16A 2Y7OA 1P53A 1AFVL 4NKMB 4LSPL 5JQHC 4K3JL 1JN6B 2X38A 4HXBL 1IM9B 1OV8A 2DWSA 4EI6A 1MCWW 1W8EA 5B7MA 1T4KB 3ISYA 4K73A 3U1SL 1YYLH 2D4FA 4MQ7B 5GS0H 3DVGA 4HBCL 2W8CA 4LSQH 3L7EA 4K2UH 2H4EA 1L9RA 2AVGA 4OJEH 5GQBA 4A2DA 1QSEE 4RISH 2ID5A 5I18L 3RWIA 2F18A 3GYRA 3ULUE 3CFJA 1J1PL 1KBVA 3PQYB 1DQMH 3UC2A 4XCCL 4IEFB 4NC2B 3QEGH 4HC1H 2HTLD 3MRFB 3UAFA 5L0QB 3KEHA 4NQUA 3EH3B 3GWJA 3UH8A 4PD4K 2VN3A 2MQGA 1IKFH 1DQVA 2BP5M 1YEKL 2BCMA 3PJSB 2X1XR 3D07A 2GHZA 4X7SH 3SE9H 3F01A 3GJFA 2KT6A 5CZVH 2YJLA 4IDJH 1RZJL 3WTTA 4PJCB 4QHPA 1OIOA 1OTUC 2YLKA 2ADFL 5EUOA 2Q8AL 4FI6A 3H1ZA 4D9QD 4PJ5D 1Z9SA 2WAQA 2H2SD 3F6LA 35C8H 3BKYL 1KBGL 4JJ5B 3EUUA 3KWWA 3BUBA 3M46A 4PJGF 4JDTH 4JFDA 1VLXA 2B20A 5D93B 2EEXA 3RILA 3QPXL 1GIGL 1MCSA 4M7JL 1EEYB 4LNVA 3HZYA 3MRHB 2B5IB 2XQBH 2B4CL 1HCVA 5DUML 1DVQA 1OAJA 2YSSB 4A68A 4Z76B 3K5SA 5CEYA 1FC2D 2IAMD 2VJ0A 2ZIDA 4I0PB 4FEMA 3AS2A 5L2KB 3DNKA 4XI5D 2BNQD 2B1HH 3FB7A 4OZGF 1JF6A 1FPTH 4PG9B 1HCFX 4YX2L 4NQVB 5C0IB 3RWJA 4X4YB 5J56B 2VERA 1QHPA 2ADGB 3HMWL 1DSYA 1BVNT 4B60A 2RD0A 5F96H 3SDYH 2KERA 1ZOXA 4M5YH 1QD0A 1EZVY 3DIDA 2FNWA 3FH8A 3RIFK 3CVIH 4U4IA 2V5TA 1TTGA 2X6MA 3WLWC 2L0DA 5KVEE 1BCIA 1HHGA 4Z6AT 1TJIL 3KH4A 2BNUA 1K4DA 2QQKH 4LCUA 5JDSA 4NFBA 5FR3A 5CZKA 2FYYB 4L8BB 5L7XL 3AW5A 3CSBA 1HHJB 5F1OB 3V10A 4GKZB 3EDDA 1JBJA 3LRGA 1GYVA 2BSDA 2CIIB 3F65A 2N1KA 3UMTA 5FOBB 4DNLA 4F93B 1ECYA 2EILB 1Q1JL 1HS6A 1O9VA 2VITB 1FAKT 1UYWL 3Q9QA 3O6FA 5L4MA 1GJWA 1LP9A 3AGVA 3UIYA 5E2UH 1HCZA 3K72B 3EOBA 1HZHH 5D5MF 3ZHDA 1DEEB 4K7FA 4DOHE 3MUUA 2D9QB 1M2VA 3FTSA 2DW5A 2H8PA 2K70A 4F2EA 1U8KB 3HVNA 2PP9A 1BZ9A 1UKQA 3G5WA 3ULVE 1P4LA 2UXTA 2GTZA 3NACL 3V0WH 5ETUB 5HTSA 3PE9A 3QS3A 1DQJB 2EE3A 3HZMA 3JWDC 2P5EA 4KROD 4MZ2A 4XC1H 5DI8A 2B1AH 3VQLA 3ZDYE 5TDPB 3AAZA 2BINA 4K5NA 4MNHB 4HJ1A 4OCWH 2VLKD 3LEYL 2O5XH 5T1DL 3UPAA 4A55A 5B3JF 3K5RA 1CC3A 1FVDB 2JXMA 3I85A 4MDRA 4JPSA 4BM7A 2BY3A 2WQUA 5F8RC 4M7KH 4G1EA 4W1TA 1AGFB 3CDZA 2KQMA 5EC1B 3APFA 3FB8B 5D71L 1X6NA 2E8YA 1NFIA 1HX0A 2B59B 5GGRB 5KSBF 2J73A 3Q7JA 1IGFH 1SYVB 2AXFB 2X9XA 4HALA 4HG4J 1JGEA 5ANMB 5E1AB 2UWEB 4HWZA 1MJJA 1ZLSL 5JXEC 1AGEA 4PJDE 4IDLA 1WBXB 2GAZA 2WJ7A 5HVFB 1RURL 2C3GA 2H1XA 4QWWD 4O4YH 3RWFA 2PWGA 3P0YH 5SWSA 5H35A 4J3TA 3KBHE 3MLYH 5D5ME 1HL9A 5IW6B 3U1QA 1AE6L 2VLRD 2CBQA 1MWOA 4B9KC 5I1CL 5GS2D 4BH7B 4MA3B 2VMDA 3FN3A 1DN0B 1ZA3B 4GLRH 2CPCA 4JFFA 4BWUA 3DRQA 1JPTL 3IDIA 4L1BA 2X2HA 5J11C 1SLWA 3UTTD 4JEGB 2BY0A 4JKNA 2PCFB 5KYYA 4Q9QL 1AR2A 4ADIA 3ZE0F 3VFGL 2K4AA 3X14A 1YUHA 3VXUA 2CBPA 1G6RA 4HIHB 3V6OE 1IVLA 3VWKC 2Y7MA 2A2QT 3C2AL 1RJCA 2Y2YA 4HJSA 2AK4A 3GO1L 4G80B 4FL4C 2X7LB 2ERJB 1WV7T 1RZJC 5CLTA 3EDKA 3JWNG 1XGRB 4H8PA 2BHUA 4W6XB 5FGCE 1BZOA 3SPCA 3VWJC 2BNQE 3SDYL 3MNWB 3OPZH 3QIUB 3UROR 2XX0A 5C08B 4KRPB 4ANUA 1NCAL 2OTUA 4NM8H 1PDKB 2J12B 2YAHA 1NFDE 4XCCH 5F6HI 3DPBB 3FO9A 1QBBA 4GS7B 4LPUA 4WI8A 5JYMA 1DL7H 1K3IA 1I8LA 3L3OB 1PYWB 3L5XH 4NHCL 5F1NA 2IQ9H 1FFOA 1YPZE 4KX8A 2LR4A 2XG5A 3W1ZA 1LVEA 3BH4A 3L6FB 5GSRA 4YL4A 3SD5A 4AYEC 4JZJC 1CXLA 3IFLH 5F3HA 2GJ6A 3AS3A 1QX1A 3SY0A 3MUHL 4ZUTA 2AEQH 3H0TA 1MHPH 3RGVA 4XN1A 3NSDA 3VRIB 3TEWA 2W38A 1Y0LA 5T33H 1G7HB 4XC3H 1R3IH 4F1ZA 2EE6A 1KBGH 2HVKA 2GBAA 5LGHH 3IGKA 3C8HA 4JFHD 1HXMB 5D7LB 4X5QA 5E4OA 3Q6FA 3VFOA 3UOAB 1KYFA 4GP5B 1B4LA 1QZ1A 4KKCD 4XMZA 4LVOB 1EAPB 1WZKA 2IWKA 4C56E 1A7BA 4JBSA 3TN0D 1CGTA 5IMMA 2OMYA 2HKFL 5LGYA 4R90L 3RI5F 4GW1A 4D9LH 4DSYA 5D6DC 3EH1A 4CJ1A 3H3BC 3TFKD 5T1DH 1G4MA 4M62H 4PS7A 3BDBA 3FT4A 3RY6A 4FXTA 1WK0A 1YAIA 2YPKA 4L8SA 1NBYA 2XC8A 1SXSA 1DJGA 4AENA 2BWDA 4K71C 4L9LC 3OGOE 4UQCA 1MH5A 3FOMB 4L4VE 2AI0H 4TS6A 4P57A 5L2KD 5EU5A 3FQTB 4OJFH 2XWBB 4L1LA 5ABZA 2ADIB 4N25A 5ICUA 1CYXA 2COVD 3IMVA 4G3YH 5DJAB 3DOSA 5FC9A 3UXFA 4TL5A 4KX9A 1E40A 3KG5A 1GGIL 1EDYA 3LN4B 3MRDA 4OM1L 5I74C 3PS6A 5ISZA 4X5LA 5E5MB 3V8CA 3WGVB 3FCSB 5EZPA 3TT1L 2HKAA 2F53D 1NEPA 1RPKA 4UTAA 4AIZB 4DIXA 3GHBH 1Q0YL 2E9BA 1OEZW 2E27L 3E3QE 1JV2B 1VADB 3VFSA 4CADA 3FQWB 3QO1B 4U6HA 3VFTA 4NQDA 3VD5A 3KR3H 5FO9B 5DS8A 4RDBA 2WXHA 4KTYA 4LDCA 1CDGA 3VH8B 2A1WL 4OVUA 1U8JA 1Y18B 4Z23A 3EOYG 2ZAHA 4M43L 32C2A 5BO1L 1YPZA 5FYJE 2IANB 4IMLB 3L5JA 4HJ0D 1G43A 4G6JL 3QQ9D 1CDYA 1L6PA 2A6DA 2XBZA 3H2QA 3OKEB 3NFPA 3RQ3A 4A6YA 1KIRB 4JY4A 2OL3L 1GTNA 2P52A 1ITCA 2HTLC 4AYMC 2OR9H 1BMZA 2J72A 4FULA 5EBMA 2V8MA 1Q9OA 5IBLD 3QJVB 1TTCA 5CEXA 2GJ6E 5I1LB 3UTOA 1GZQA 2DS4A 4AYBA 4YSEA 3U6XS 3K2MC 5E95B 1AO7D 3IMRA 3GI9L 3OF6D 4PJEA 5TH2A 4ZMOA 3NGBB 3V4VB 5T3XE 5DLMH 5LBGA 3NJVA 4UUJB 4ODWB 2EQDA 3P9MA 5EF1A 1ZAGA 3H9SB 2H6UA 4F2MB 3KYKH 4CMMA 2F68X 4KNTA 4IYKA 3CHQA 4GAFB 3AU1A 2AEPL 3D12B 4P23B 3B9KD 1X4ZA 3LKRB 3C08L 3IXAB 4X4ME 1JRHL 2BW4A 4KUCF 4URKA 2GJJA 3BGFB 5F1KC 1NIEA 1RHHB 1X5YA 4QHKJ 2HFEB 2EZ0D 4OIBA 5ILTL 4QXUL 1O9WA 4X6DA 4KJQD 3QEHB 3QR0A 4Y1AB 1FO0H 4POUB 3ILEA 4PJFE 5IBUG 5JPMA 3ISRA 5MENE 3R06A 1E9QB 3VD3A 4E36A 4ENED 1PCXA 3IDIB 1U36A 2HJFB 1QMUA 1CFQA 3BYTA 4ODXA 4MVBC 2E0PA 4LCYA 4XVTL 1C12A 1IU1A 3U0WH 1R5VB 1E7VA 3P4OA 4OQ1A 5I6XB 1J87A 2MOGA 5AQ0A 5AVRB 5F6IB 2AI0L 1VERA 2X2YA 1IAIL 5LXVA 4LSRL 1TLKA 4ADGA 2CWRA 3T77B 3BAKA 5JO5B 2VDQB 4JQIA 4UI2A 4XNAA 3O2DH 4Q9CA 5MEPA 4EI5D 4X5XA 4IU2A 4I2XE 4G6ML 4D9RD 2DIBA 2IH8A 1M7UA 1F4AA 4P4KB 5E1IA 5BZDA 2NX5D 4ZSOE 2XFGB 2HRHA 3KPNB 3WY3A 3GSXB 5I16A 2CBMA 3GEWB 4PIRF 1AP2B 1BQLL 5FKPB 2GUOB 2Z0BA 4BGDA 3QEGL 4XI5C 2RBLA 3O6KH 4F2ME 1EO5A 3HG4A 4AGPA 2HLEB 2K6WA 2XV2A 3UZEA 4PSRA 5H37A 4UBDC 1AI1L 1SM3H 4GRWF 4EBQH 3LVEA 4N2NA 3OX8B 5IT2L 2UY7A 3GNMH 3U79A 3MRRA 5IIEB 5C0CE 1DUZA 3LEVL 4Z0BH 5FLUA 3I75B 3WIHA 4D8OA 5AB0A 4HFUH 5JHDA 3ABZA 4O2FB 1F5WA 5DJ8B 1IUZA 3LZPA 2GEQA 1N7ML 3LEXA 2R0KH 7PCYA 1L3WA 5AOLA 5FYLL 4YDNA 5I6KA 3L2LA 4KUCD 3IYLW 4PJFB 5IVXB 2BFVH 5DJAA 3K2UL 1MZZA 4LLMB 1T1XB 2HG5B 4M7JH 5HHPA 2CRYA 4AEIL 2IOIA 1YN7A 2VISB 7TAAA 2XQBL 4FQXA 2Z93A 4JN2A 1PZBA 5EU5B 3DOHA 3U30C 3MDJA 1I3VA 1MEXH 4FXKA 4NNPH 1CFSA 2Z8SA 3GMMA 2ARJQ 5FGBC 3WN5A 4AZUA 5KSBB 3ESUF 1GYAA 4HUUB 2YS4A 2P7TB 3L4CA 4JREB 4LL9A 4DGYH 4J3OD 4H20L 1LJMA 4NJ9H 3HPLA 3KGUA 1Q72H 4OB5L 3ULSB 3V0HA 4AQ1C 2ENJA 2V17L 1S3KL 4N8PA 3LCYA 2V37A 5ELIA 2XJLA 4BFEA 1QR4A 4JKWA 4PJ7B 3BUPA 3QHZL 3MJ9A 1KIPA 2QPFA 1LO2L 1GR7A 4LQ1A 4GMSL 1CFVL 1CZ8H 2YMOA 3DX7A 3I6SA 3TEXA 1NCHA 5IOPB 2YWZA 1D6EB 3D69B 5G4MA 2O61B 4XCFH 3V0JA 5DJZB 2JCCE 1T2JA 3TZVD 3MUGA 5I66B 1GOHA 4OF3A 4MXWH 1QLRB 3LSOA 5CU5A 2DWEA 4G8GD 3P2DA 5D1QE 4D0BA 5HYSA 5F7NC 5E4EB 1F42A 1J8KA 5EN2B 3G6DH 3IJEA 4M1GL 1RZ7L 2FLMA 3EO0A 3HZMB 5DI8B 5ESVA 4XZUB 3DVNB 3Q2CA 2A6IB 3MV9B 4EN3A 5T3XD 1MAJA 2CAKA 1RUAL 4U1LB 2XU9A 3HNSL 4ZK8A 4WSJA 4JM2C 5TDNB 5D2LE 2EDJA 4JRXD 2DI8A 3ASOB 4H4NA 4L8SC 4CSPA 3ECWA 3GPSA 4MVBD 1MCFA 2F54D 5DDHB 5HJBA 3IKCA 5AOIA 2OYLA 4NENB 5AW0B 1HE7A 2A9DA 3RUGE 1SQ2N 4UOW0 3SCMC 4CN1A 4HKBA 1CXKA 4POYA 3WTWA 5H94A 2FGWL 4AM0Q 2Z91B 4OF5A 4WUUA 4PGBA 4U6VL 3MLZL 3O9WD 3F6JA 3IWUA 1FBIL 3IRZA 4P23D 1XIWC 4I0PC 5ISZE 1AGBA 4JJHA 4TNWF 3KVQA 5J12B 5C0RL 4NI6A 1MHPL 4H8WC 1ZS8B 2QVMA 2XNAB 1KIQA 2YOCA 4PI0A 3NJKA 5T3ZL 2G2NA 4FYTA 4XH2B 1YNLL 4E9QA 1MCOH 3DHJA 3ATEA 3EXJA 4N6RA 3EJCA 4GG8B 4JGMA 2AGJH 4QGTA 4FCHA 2ZUYA 3LEVH 3E80A 1MW3A 3N9GL 4HS8L 3K1DA 1S9XB 3UJJL 3IJ8A 1IAKA 2G30A 3CCHA 2XA3A 4PRIB 4YLQT 1NKRA 3HUJE 3BP5B 5DO2D 4OGAD 4BH7A 1RPQA 4UMSA 5FB8B 2H2SC 1CFMA 5KN5B 3K2UH 2X4SB 3DV4A 3HHSA 2CMRL 4E9LA 4OFKA 4I0PA 1XF3A 3WN5C 1ND0B 5HI5C 2G75B 5GGQL 3SYAA 1RUMH 1NIAA 1OAXL 3FMGL 1UUSA 1CR9L 2F1AA 2WWMC 4XHJD 1R0AH 4WQOA 1U8LA 3FRUA 3NACH 4OLEA 4X6DE 5JLZA 5C0DA 5KVEH 3QXDA 5M94B 2BSRA 5G4NA 3HG1B 4X98B 4K3JH 1U8HB 2WP3O 2WO4A 4DPRA 2O6PA 2CCVA 4WWOA 5EUOB 2Z4QA 4OCNC 3LKQB 2R4RH 4CA4A 2A4ZA 1MW1A 5EUKB 4DGIL 2A99A 3N40P 2WXMA 1TSHA 1KNOA 4TM9A 5E99H 3WIAA 5LN4A 5C08E 1E5UI 4N3TA 3K6SB 2CGRH 2XWXA 4PW4A 5AVSB 4ZX6A 2YPVL 5FDWB 4UBDD 2HAZA 3UAJD 3JT0A 1HI6B 4TLKA 2AQNA 3EYQC 4O51B 2PPEA 3I75A 3BD5A 3SPJA 2E9WA 5AW3B 1U3HB 4QHMA 2WB7A 4NSKA 4PLJD 3O3EA 3MLSL 1OF2A 2VL4A 4K3DH 1XF2A 5EC2B 1JZGA 4KVCL 4U1NB 3S5LA 5ENWB 4TNEA 3V5HB 5T33L 3H9HA 1QW8A 2OCCB 3U1PA 2VLRB 4MGXA 3KBEA 3SOTA 1NJ9B 1ZHLB 5CINL 3NABL 1DLHA 4BJLA 2F0CA 3QPQC 5AUMB 4F8TA 1YECL 3BAIA 5DEGB 3X2QB 1QTSA 2FEDD 4R4BB 2CDGB 4BH8A 2IV9A 1QRKA 3HN3A 2R59A 3I50L 2EACA 3ARDC 2G0LA 3W5NA 4KKPA 3LXBA 5T1LB 1IT9L 1YJDL 3TJEH 2VDMH 1LL1A 3KL0A 4LGPB 3T6QC 3TJPA 3I9GL 3FT3B 3GTTA 1VCBC 4BZ1A 3LN9A 1SBSL 1ED3B 1KTCA 4FQXC 1W6LA 3D0LB 3X13B 3KZ8A 2ADJA 4XP1H 1CD0A 4G8GE 3WTUA 3RZCB 1FVCA 1CLZL 1PLAA 2JKXA 2QQQA 5CSBA 4A2LA 1XV8A 4X99A 4YC2B 2WKGA 3ABMB 3WN5B 3T3PE 1X7QA 3MV8B 3U7WH 1AQKH 4OTXL 1RIVL 3SDXB 4LHUA 2R0LL 1OAKL 1P2CB 1A7QH 2NY0B 1NCDL 4QHNA 1OT1A 1L7TL 1JK8A 4YHIB 2YD9A 3H55A 1NEZA 3FT9A 4RA0C 4P59L 3MACL 3FO0H 4GKNA 2ROXA 2Q10A 1JHKL 3KPPB 4QRUA 5F6HJ 5IREA 1NKOA 3GDBA 1E9OA 4Z3HA 4WK2B 3HE6D 4GBXC 4FTVB 4DO5A 4PGEA 4AK1A 4CMHC 4AQAA 1ACCA 1D5XB 1MFBL 1T22A 5F9AC 3L95B 4PRHE 1TPXB 1ZLDA 3U2SB 2CM6A 1RJYA 3QCTL 5HI3C 5HHOA 2BMKB 1TR7A 1KXQE 2R29H 3IU3A 1VKXB 4NZ8A 4GSUA 2A0LD 2H32H 5FA4B 5C0EA 2CHNA 1RP9A 1X9LA 4FNLH 3T0EA 4MDJB 3IN2A 2I85A 2AXGB 3MFFA 5DD3H 3HNVL 1KTLB 4ZW7A 2WWMD 3CIQA 4PRAA 3PWUB 4YIQA 1IEAB 3GBEA 1U41A 3ASWA 1SJMA 4HPOH 5E6ID 4YHYC 1NMCC 3D4ZA 3EYFA 1KYOJ 3OKKA 3P4NB 4MAYB 3ERXA 3BWSA 5JHDD 2BHFA 5E8NB 4M9OA 4DEUA 5MHSE 1YNLH 4OCXH 1ZD6A 5JHBA 1D7CA 2O1AA 3ALWA 1KIUA 4Z7OE 4L0YA 3G5YB 5E5RB 3S88H 5DUPH 4NPKA 3ELQA 3H42L 3OAZK 3MYJA 4NN6C 2ARWA 4GP4B 3SDAA 5AYTA 3VXUD 3FUEA 4P5SA 1X7TA 3HW7A 2XN9A 2KDYA 3BEWB 1AJ7L 1TCRB 2HJKA 3OBAA 5GZNA 2FHCA 3V4PA 1AE6H 5I1CH 3BSZL 3MNWA 5I15H 3MI6A 5I8CB 1ZE3C 2Z8VC 4AC4A 4MD4A 5CLYA 4QRRE 4U3SA 4MJ5A 1UACH 2LVCA 2OJEB 3IE9A 3CDGB 1X5IA 3CN2A 2ICES 3RIAK 4XAWH 3OHMB 1NM9A 4NN6B 3OL2A 4PCSA 1RJZA 4FZ8H 3D39A 4R7NA 1NCBH 2OA9A 4KJPD 5DQ9B 3OAWA 1OALA 3RHWF 5GPRA 3NIFB 1FO0L 1KCBA 3BESR 3CNKA 5BS0E 3MROB 5F9JB 2X12A 1EWHA 1OPOA 3ETTA 3OAUL 2NTSP 1UA6L 1OGAA 5D6DA 1LDPH 1CFTA 3WIHL 2KLRA 5JW5A 4LLVA 4LFHD 3ELAT 3LEYH 4LBEB 2Z92B 2OMXA 2DQDH 1DHKA 1JMXA 1H8NA 3RBGA 4M1CD 4J7RA 5GRJL 3VFWA 2Z65C 1YY8A 3L1OH 1E90A 4XHQA 3VMNA 4P2CG 3MKKA 2P8MA 1F90H 3ZR5A 2OBGA 4UOQA 1AKJA 3LRLA 2BSEA 4XC1L 4TQHA 1A5FL 3QXVA 4KAQL 1LO2H 1MXDA 4PJCE 4LQFH 1KPUA 5F9WB 1IAOB 5GHWH 4RMRA 4ZO9A 5TJWK 4YDIL 1KBBA 4PS4H 3D0VA 3FPXA 4Z18A 1ADWA 1T21B 2GBVA 2PPDA 2XI9A 3IJHB 3HC4H 3DWTA 1T7VA 4NGHH 1BQSA 2BVPA 4LEXH 4YE0A 5C0FA 5FCUL 4PJIB 5INDA 5CU9A 3C6EA 2VAAA 2GJ6D 4N2CA 2A83B 1ULVA 2OQJA 5DS8B 2X89D 3QXUA 4F57H 3AM8A 3ZSTA 5AVWB 1SHWA 4F7KA 1J8HA 4WENB 5F89A 2FSEA 3KPOB 3O6LH 5FYJD 1U91B 1U3JA 2C3XA 3RPIB 1ZDQA 1Y07A 4GUOA 4WUUD 3OR6B 4L4TE 2HP4A 2OR8A 2QR0B 4ODSH 3LKPA 4XP6L 2NUTA 4HWUA 3IDJB 4JCLA 4XGZA 3SDCA 3O2VL 1OF0A 4N0CD 4MAUL 1U4EA 4YO0B 4ZW3A 4HHGA 1LWJA 4J3VA 1U92B 4MDJA 6CGTA 3HR6A 1S7WB 3QZLA 3PDGA 4U3SB 4XP1L 4L9LA 3HG5A 2K3TA 1F3RB 2R1YA 4JFOB 1CIUA 1J5OH 3ESPA 2H6OA 2Z9TA 3V6BR 1P5VB 4MMXB 3CHOA 1U8NA 3G6AB 4I3SH 3UPRA 3KLSA 3KD4A 2KHAA 5F93C 2KC0A 3JWOH 5EIQA 3B2UD 1WFMA 3DGCR 1X6LA 4TVSa 5BV7C 2NZIA 3NCYP 2OX5A 4S1QL 4V33A 4Z77A 2DYPD 2BJML 3H2PA 3GZOA 4N0CC 4G9DA 4P5MA 2M26A 3TO4D 5HDRA 1PVHA 4TUJA 4QHKI 2EDRA 1SJEB 1ZA6A 1QWNA 1EIBA 3QHZH 3TA4D 3QYNA 3HTLX 1Z6JT 3OXRB 4QWWC 5ERWB 2XVBA 2A9ML 1IGTA 4MNQA 4WO4C 4NWTH 3TONA 4BKTC 2AZAA 4KJWC 4W4NA 1W91A 5J57B 2QDVA 4YIQB 4LFHG 4GEJA 5C0AB 2XWRA 2QKIB 4JANA 4PGDB 3GK8H 4JM4H 5KVMC 4FI8A 3NFSL 4IW4C 3IF1B 1HXKA 2Q3AA 1TVBA 1UKSA 2XOTA 4N0RA 2JCCB 1SDDA 1MRDH 5DYOA 4NFCA 3MCKA 2DLFL 2EE2A 4TUOA 3MMEB 3SE9L 1CG9A 3MUY1 1T7ZA 2VKXA 4ISVB 5B1AB 2V9UA 4LLWB 4TUKH 4YDMA 2IXQA 4FG6D 1SN2A 4KK6D 3SQBB 5LGHL 2VL5A 4JM2F 3ZDXB 4ZNCD 1RZ8B 4FNSA 5FO7A 5AWNL 1JPTH 5JPMB 4FFZL 1E4JA 2V5RA 2NY2B 5EO9B 5DD1L 1LEIA 4XNYH 4ZW8A 4MJ6A 4HMCA 1ZANH 1MQKL 1NAML 1U8MB 2XKUA 4LF3A 3VWJA 5DK0A 4PM1A 4E0RA 1HJBC 2TSBA 1NAMB 3ARGC 1A7OH 2FATL 5CUSH 3KPRA 3SKNA 4KXZH 3VFUA 1S7XB 2YUZA 4GAYA 4Y5XA 1YC8A 3O41A 4OUUB 4NI3A 1P4LB 5LWYL 3AJ7A 3KPLB 5I6MA 3MNMA 3RB7A 3D1MC 2ORBH 1KEML 2WHVA 4F7EA 2AXWA 3D2TA 3DHUA 5I19H 3OPZL 5I8KH 1MCNA 4H0GA 4G8FA 4BA8A 4W68A 4WU7A 3GI9H 2VDRL 3QZMA 4YVNA 2VMEA 1IQDA 1PD6A 2XN0A 3QFJE 1PF3A 4NUMA 2KPNA 3W37A 3QDGE 1XH3B 2VXUL 1QFWH 4BXSV 4X7TB 2DJUA 3AVEA 2CLRB 1J0ZA 1PNDA 3QHFH 4HJTA 4GUCA 2I25N 1E0OB 5DJXA 2PPFA 3VXQB 4DAGH 4XB3A 5AOKA 3N9GH 2C1PA 1REIA 4ZT1A 5I74B 2ZSWA 4GYBA 2EE9A 4MMZC 4C54A 1TZOA 4UT6H 3EO1A 4DJMA 2IPUG 3LZOA 1PLGL 2NY7L 3L4YA 4XC3L 4P46C 1QSEB 3PWUA 1OAZL 1BXXA 4HCRH 1G1KA 2VIRB 1CXEA 1QSFB 4PLKD 3A4FA 2Q7NA 1I8KB 2VJXA 1OANA 1FI8C 5C0EB 4RWHA 3O4LA 1SBSH 3WDIA 2Y22A 1QHOA 4X5PA 2EE0A 2FH8A 4QHUA 2XTJC 3CC1A 2E56A 5DQDL 4B3EA 2HT2D 2FR4A 2XXMB 3SDDB 1CGWA 2XICA 2YSTA 4QLWA 1F90L 4U1KA 2BHYA 4NZRH 3N41F 4NQSB 2XG4A 4WHDA 1JWMA 1T1YB 1GW6A 5JORB 3QDJA 5TF1H 3QB7C 3UO1H 4WCYH 4OM0H 2JE8A 2G60L 4LLVB 1A6VL 4MD0A 3RA7L 2R23B 5CZXC 2JJTC 1KZYA 1QFWM 1SPDA 5L8JB 3NFNA 4G5ZH 2ZUQC 3CX5K 2NLJA 3EGSA 5DVLA 3U7YL 4EVNB 1EV2E 5IBUB 4PJ6A 4TSCH 4YC2C 5IVXA 4U33A 3T0BA 4QRPB 4WO4B 3WS3A 5C6PB 4XX1E 4DZ8B 2O30A 2YRZA 3DK2A 1OGSA 3HG2A 1RD6A 5FYKU 1U2HA 4HLEA 2CK0L 1EFXD 2X4UB 4POZD 1N0LA 1JZDC 4YSOA 1PZ3A 1I75A 4K7FB 3JVGC 3X17A 5KYWA 4I2XA 1WAEA 3V4UH 3AADB 1RSFA 1J1OL 4BQ8A 4LLDA 4N24A 1DE4B 1MFDL 1OGTB 3BN9C 3STBA 1EBAA 1JZ6A 5E2TL 3DKHA 1XF4A 1M1SA 1Z0MA 2EDHA 1MSPA 1XZ0B 3MTXA 3M7OA 5C07A 1XF3B 1INEL 4OZGA 3GHEH 4P9HH 3E1ZA 1I7UB 4QTFA 4GQZA 5CSZA 4MB5A 3OB0H 5GJTH 2D2CC 4XCEA 1QTPA 3SYPA 3KR3L 3U36A 4KHXH 1K8IA 5I9QC 4IU2B 1T4KA 3E38A 4LAQH 3T6ZA 2M83A 2FHBA 3FYIB 3MLPA 2AF2A 1UM4L 2BDNH 3Q6FB 3RL1A 4YJZL 3BZ4B 2AKRA 4FCAA 3T0VA 3TPKA 1RFDL 1TVHB 4CBZA 5C2UB 2GK2A 4NZFA 1G7HA 1CD1A 3L08A 3VWKB 1DLFL 2WINB 4M1CC 1JJUA 2WXFA 2O5XL 4OIFA 3LQAL 4K3EH 3S6CA 1E43A 5AW2B 3EAKA 2CRZA 1XSJA 1I3RA 1VGEL 2IDTA 5ICYA 4J27A 1FYTD 4DN3L 4ZD3H 5C9JB 1JWMB 2XG5B 4LGSB 3APMA 2AFNA 4U0RB 1QZNA 3IJHA 3ZUNC 3F7YA 5I15L 3QWQB 1X3DA 1SUHA 1DL7L 1ZRUA 3HEIB 3HS9A 3RWGB 3GLEA 5DSCA 3UTPE 1E42A 5LCVA 2WKLA 4G1MB 1WS7A 2VN5A 4NENA 1F3DJ 1SJXA 4L3CB 4UZUA 5DDHA 5DGRA 4WFGE 4M4PA 1FH5H 1M7DA 4OLVH 5FWRA 3VWJD 3SKNB 2WNXA 4E9WA 5F2FA 3CXHJ 4YUEL 4B50A 1U93A 1DSFH 1OL0A 4I1NB 4U3HA 5I2IA 2AK4B 4MJ6B 3L4TA 5CWSB 1OSEA 5JIQA 5TDOB 4NXSA 4C4BA 2YLHA 4ALAH 1X4YA 3SGDI 3OD3A 5IFHH 2R4SL 1NIFA 4KOCA 3E7JA 1MFCL 3P9LB 2V3FA 2D3LA 4R83A 5K59F 5DHXB 5DHVA 3KMDA 3UCQA 2N0MA 1EFQA 1IFHL 3PHOB 2C8NA 5GRXG 3B5TA 4UQ3B 3MMEA 4MHHI 5EBMB 1FGNH 1BG9A 3RLSA 1EGJL 3TJEL 2BS9A 3QUZA 1BA9A 2AP2A 4U1GC 4FA8A 4W9ZA 1C5BL 4PRNA 2XQ0A 3FONA 4Z3GA 3D7PA 5I8KL 3V7MA 1UB5A 2E86A 2HT2C 5CGBA 4AEIH 1RU9L 2VDRH 4L9DA 1GGYA 4UYPA 2X05A 4Z78B 2GFBB 2ZCLL 4PJ7F 3OHXC 2J5WA 4OBRA 2OZNA 1MHCA 4IMLA 4F27A 1UENA 3NMEA 1XBRA 5J12C 2XN9B 5LCVH 1S7XA 1MJUL 1QSFA 3THMH 3ULUC 3LX9A 25C8L 4XBPB 3O3DB 2XBTA 3CBRA 4ZSOA 5F88B 3LNGA 2IQ9L 3EO1B 2WQAA 5DGQA 4S1DD 3UJTH 3GBLA 3MACH 3DX8A 2GG1A 2VDNL 2D7TH 1WA0X 1F45A 4DVRH 1JYNA 1BQLH 4XP6H 4UTBA 4LCVA 2CIKA 2JTYA 3F84A 2P5WA 4JM2B 2ARJB 1NPNA 4KKQA 2YAFA 2QFRA 4DUVA 2EEAA 3LPOA 4ZI8A 3QDJD 4CU8A 4QHMB 5BRQA 3STZA 3GQFA 2LW3A 4FEIA 5FUOH 4N1EA 1T0PB 2XFXA 4KHXL 5DJ6B 4B9PA 3QCUL 4DPCX 2UZIL 3N43F 3K0WA 3MRLB 3B4NA 5LNDA 2VLMD 4JPVH 5IIEA 4LPYA 5HHNB 3IGAB 1RIUL 2VMJA 1KBWA 3P11H 4LASL 3KPRB 5JUEL 2ZXEB 3ATAA 4NUQA 4Y1AA 4LSQL 4Y5VA 5FW6A 1TZGH 1SYSB 1JCKA 4K5MA 3SSGA 2HLAA 4ONHA 1TEFA 4WI6A 2Y24A 4WWKA 2A3TA 1JNNH 1G7PA 4XP9L 1RZKH 1BBDL 4X9IA 1FNEB 1RSYA 3WHXA 3BHBB 1RVFH 3Q8EA 3SOBH 4L8CA 4F3FA 1WEJL 2JK5B 4KAQH 4ZXBA 4FRWA 2CJ3A 4GRMA 4JM0A 4V1DE 1NBZB 1ZWIB 3U25A 1PAZA 4FXGB 3WCYA 1OZUA 3LZQA 2NNFA 4PJ7A 1I9EA 2X4OA 5F1IB 2GT9A 4XPAL 3LNIA 2VXSL 1FZJA 5D1QA 2YAEA 5DVNA 5L2KE 1BX2B 5CIPB 5E8OB 1LWRA 4QTHA 1R46A 3VO0A 3WNJA 3CG8A 4I1RA 1TEGA 2B3RA 1A14H 2ADJB 4DN4H 4WI0B 3OKOA 3I2CL 3HC0A 4G6AD 3FC8A 2MCPL 3HA0A 3STLA 1I4FA 3W56A 5INCA 5CGMA 3NCBB 3ZZLA 1LP9F 3BPLC 4TTGA 2H0PA 2OI9C 2BIPA 3C6SB 3BW9B 1RI8A 4S2SB 5CR1A 4Q56A 1G7JB 1V05A 3OJ2C 4LHUD 3WFDL 3N1QC 4D0CA 1ODAA 3VXME 3N1GC 4WJG3 4JN1H 3JZ7A 3UDWA 4B9JA 2F8XC 2OR7A 4H8QA 4CL7A 1AY1H 3VXRA 2APSA 2ATPB 1R33A 3MA9H 1OTUD 3GI8H 2WVVB 4O9HH 2VABA 1X9UA 3JTSB 1KLFB 1LQSR 3OKYA 4JFOA 4JKMA 5CO1A 1JZIA 3NJMA 4RNRA 3ROLA 1MKFA 4UINH 4M8RA 1QW9A 3DVIA 1XGZA 3QWNA 3P9MB 3NAAH 3OX8A 1T5KA 4WI7A 5FM4A 1XGYH 4K3GA 3RAJL 3AITA 4PP2B 1CLYH 4WTXA 4AEEA 3DOIA 3DTDA 4LOEA 4ZUSA 1L4IA 2FQDA 1K2DA 3ZE1B 4P5TA 3AG3B 4LVOC 3LKPB 3UAEA 2O4EA 1AP2A 2Z31A 3HI1B 5ITFA 4FP8L 5I9QB 5DHVB 2CHXA 3CLEL 3KPSE 1E3ZA 3HBZA 1DSFL 1FYTB 2AJSH 2DDQH 4YDZA 2WBJB 4FFWC 4B9FA 2BO0A 3T4AC 2R56H 1PNCA 1WZMA 4XNMB 5FM5M 3S3DB 4PJ9B 3ZE0E 3LQZA 3LQAC 3UZVA 1E67A 5D7IB 4KPHH 3O3BB 4KKBD 4GNKB 3ASNB 1N6VA 3PWLA 3WIIH 4BINA 3OKDA 1E6JH 3T0EE 1HE8A 2YD1A 1WGVA 5DQDH 3GSNL 1OVZA 1FGNL 3MGOB 3ZHKA 3AZUA 3DJSA 1GS8A 4C57C 5DHDA 5E8PB 1QSZA 3GC3A 4WY7H 1C5BH 5AWNH 3CFUA 1QSFD 2DYRB 5K1NA 1OAUL 2F8VA 5EDSA 4XX1G 3MBED 3BGFC 1I9JH 1A7RL 5D2LB 4KRPC 4A7QA 3QEQA 1I3RB 3UYRL 4JQIH 3IVKB 5KN5A 5TE7L 2V3EA 1JUFB 3Q9PA 5E6RB 3AG2B 2EVHA 1A6WH 1KPRB 3FCBA 4JFHE 4R5VA 2YBRA 3BUQA 4MAYD 5MEQB 1RK0B 2MWCA 1BF2A 4HHAB 3A6OA 4PJGA 2EVJA 2MQCA 5IJCC 3DOSB 3FO1B 4QY8B 4FABL 4XX5A 1UC6A 1ZSDA 1E4XI 3NZUA 3WMSA 3OMIB 1H9DA 5D5MA 3CH1A 5DLLA 3JWNH 4DVRL 2FJFB 1J9QA 3MV01 1BMWA 4S1SH 2A9MH 2VDKL 1DBMH 3TZVC 4KUZH 4ZMNA 2MTPA 1I9RH 4I5BA 4WVRA 3MSPA 3LNHA 4LHJB 1D5RA 3H7LA 5C6TH 4KY1H 1EEZB 8CGTA 2AXHA 4ZUSB 4QOKE 4M5SA 1KGYE 4PU2A 2CK2A 4AZ8B 2ITCB 1V7MH 1Z1WA 3EJRA 4YHMH 3GMNA 4OLYH 3NFPB 5E03A 3DX8B 2NZ9D 1O7DC 1BEXA 1JVOA 1KUMA 5ICXB 3S4SG 4MCZA 2J8OA 5I26A 2FYVA 2PWFA 5GSVB 1WIPA 2WCGA 3UP1A 3LOWA 3FU3A 1BFVH 2W80C 5E8DH 4FFZH 1HNGA 2KUTA 1OK8A 5AZ2H 4GP8B 2HFGL 4LPTA 2PWHA 4AVHA 2UX6A 4F9LA 3QO0B 2VQ4A 5IFAL 3BLBA 1BP3B 1DLFH 3IDUA 2VTFA 3FCGA 3U0TB 1OOWA 4QHLB 1IAIM 3NP3A 4EZLA 8PAZA 4Y2OB 2OK0L 1LO3H 5IHUL 1WH0A 3HBPA 1F8TL 4P2QB 4MX7B 5J13C 5B1JC 4ZS7L 2VR4A 4FQQA 4R4FL 2AJVH 3ZT6A 4NOFA 1OTSD 3PGFL 4TSAH 4Y7MA 2ORBL 2KZ1B 4PJ8D 1D6EA 4P5RA 2O61A 4HJGA 3BDYH 3KGTA 5CIPA 5IMLB 3CVHA 3QA3B 3H7BB 2K6YA 1G0YR 4GIAA 1C9SA 1QACA 2ZYHA 3K46A 3MOBH 1OHQA 3WO4C 2QVFB 3X12B 5HHXH 1WT5C 2FIKA 1HOEA 2LE9A 2DM2A 2H2PC 2C1OB 3FTUA 3D2UB 4DAGL 1LK2A 2CDGA 2BVQA 1KJ2B 2H0JA 4AQ1B 5KUMA 4OGYH 4X98A 2O72A 1WZAA 3CU7A 4QDGA 2VLKE 3ZDZB 3PJSA 2JJTA 5MEQA 2YRLA 2UY6A 5IFJB 1CQYA 3AQXA 3OKLA 4U1MB 5AW1B 5KSAD 5I1HL 3AMLA 4KKBC 5I1KL 2WZ6A 4KVPA 2BVTA 5BZZA 1HESA 2GC7C 2QKIC 3H9SA 1NCNA 1VACA 4FQJL 5HYJA 4YHOL 3GZQA 3GSRA 2NT1A 4FS0A 3OC8A 3RZCA 4OZIE 3M8OL 4LRNH 1NOLA 1UH2A 4ODTH 1PKQB 2FCBA 2IALB 3QCTH 3WXVL 1COBA 5IQNA 1HQRB 2DWTA 1EHLH 4UQBA 4ONOA 1H6UA 2DEWX 2JSFA 2H45A 3T3MB 3OKEA 1T6BX 1LWHA 1MWAA 4LCWD 4JZJB 4ORGA 1OAYL 4LSTL 3SO3C 1ZGLM 5BUPA 1A5FH 2JKJA 3TCLA 4IHOA 1MCQA 1OAQL 5J9PB 2FTAA 2VM9A 3EBGA 4MXQC 5E1HB 1F11A 4ODHH 1QG3A 1VEMA 3W9EB 5I1EH 5D93C 4DETA 1H6TA 1KXVA 1BQHG 2COQA 3L1OL 4FD0A 5EO9A 3VX0A 4OZGB 1I82A 4YHKL 3DV6A 4OCXL 2YQBA 4LP5A 1U8LB 3FRUB 4U1IB 1SF3A 1JTPA 2CPUA 3DO7B 1DBBL 3L1EA 3S88L 2PW2B 4X0KB 3TN0C 1IKFL 4NKQB 3QEQD 5F71A 4JPKH 2DYSB 4G42B 4BE5A 2GIXA 2XTJD 4OLVL 3CQQA 1JAEA 1MHEA 2E8ZA 1GHFL 2ZKXA 2PXYC 1INQA 1BIHA 1BZ9B 4N2MA 1NFAA 4G7VL 4C4KT 3MOAH 2P9RA 1PPIA 2ATPA 5AOZA 2IV8A 5AZ2L 5ISZB 3SKOA 3COOA 2ALWA 4WDIA 4PLKC 5HYFA 1WITA 2LU4A 1ZTMA 2HG0A 5FUCC 5BUGA 5I6XC 3P11L 2RFXA 1A4BA 5FV2A 3LD8C 5KZCD 4XN5A 4GXVH 1E9QA 1S7TA 4J5VA 3CQFA 1N10A 2A74A 1BF5A 1NCBL 2NOYA 2DKSA 4CUCA 1GKOA 3CHPA 5CGYC 3GB7B 4AY0A 1A2YA 4JG9A 3D0AA 2QPUA 3L9RB 1TJGH 3OZ9L 3BUIA 3BPNC 3B34A 3DURA 4UIKH 3WIFB 4M61A 4D0DA 1U93B 3I6LD 1DVFD 1ZT4B 5K9QI 2JQMA 3WKML 1TJMA 2IGLA 4Z7OB 1IC4L 4YSQA 4GRWE 4GSRA 1YLBB 1RK1A 2Z3FA 5C97A 3GJFH 1JNLL 3RE0A 2FX9L 2AABH 3QR2A 5DSCB 4A7TA 3FH7A 1AQKL 1N68A 4OTXH 5BS0B 2XIIA 2BJMH 1DJYA 3B37A 3CLFH 2XVLA 3BFWA 3FCTB 3BO8B 4ONGH 4S0TD 4ZQKA 5TE4L 1MCHA 3NIGF 1HU8A 4U1HA 4MX7A 3RDTD 1DANT 1AR1B 4KMTL 3WO4B 2VQ1A 4LBAA 3X1FA 5JXED 1PIFA 5FHBH 5CSGA 3T6XA 4ZMPA 1JG9A 3QUYD 2IF7A 4HXAL 1L9QA 3VXSD 4P5TD 5JW4M 1CK0H 4TRPH 1JP5A 1NAMH 5DZNA 1ESOA 4JDZA 4OQTA 2VXTL 3WS6C 2BWQA 2JELH 3TVMC 2NQDA 2Q1EA 1X5XA 5CM1A 3MJ8A 1T20B 5IUSA 1B9KA 1R5IA 3F64A 4H5SB 1ASOA 4PI2A 1HOCA 2VXQA 4G9FD 3FCUB 4N2LA 4LP8A 5D7SL 3QUKA 1LHZA 1DVUA 4DT2A 3W38A 1DJZA 5AW9B 4IRZA 4BFFA 1K6QL 5TQ0H 4IOIB 3F00A 3TFKC 4TOYH 3WKYA 3L1GA 4S11A 3NIDF 2OTPA 3NIGE 3MA7A 4WK4B 2EYRB 3IGFA 1TNNA 4HKZB 3UJTL 2WVSA 3B9AA 5IB5A 4ZX4A 4K5LA 2FZ3B 1MHCB 5A40E 3SDAD 1V3JA 4FQLH 3W57A 4NCDA 3JWOC 5HD8D 2EXYD 1OW0C 1TPXC 2B16A 4R8WH 4JANB 4FG2A 5FYLH 5DT1H 1WD9A 4UM8B 1A14L 2B5IC 4TQPA 1INQB 2IPKB 3Q06A 1YJDC 1OCWH 3ES6B 4J12A 2WZPA 5J4MA 4WTWA 4PP1D 3O3AB 3KYOA 5C0BD 4HX1A 4NKDB 5TTRA 1E4HA 3PP4L 2IO5A 3K1KC 2J71A 1SFHA 3GMLB 3L3DA 3JWNC 3WJJA 3KYNB 4NQCA 4K15A 1KCSL 3U2IA 4X5WB 3TNNB 3C5ZA 1CDCA 2CD0A 3W5MA 4XTRC 1J0YA 2BXYA 1AGFA 3ARVA 3ESOA 3GO1H 3RVXD 4LIQL 3QORD 5C0BE 5TDOA 4G8EB 3LKSB 1JK9B 4FABH 1KXQA 2ICCA 3QP3A 3S35X 1JVLA 3SYQA 1A25A 4WCYL 4IKNA 4ABVA 4RGOL 4PWKA 3NIDE 4HKBB 3SBPA 5HHPB 5I82A 2W65A 1OT2A 5CBEA 2OULB 2W0KA 2Y36L 3KH3A 2K45A 4PP1C 3M17B 4QLRA 3K6OA 5HDLA 1G7QA 1S5HA 2GTZB 5D96C 2EXTA 1OSPL 5AD0A 1U8CB 1OTTD 1CLVA 3DI3B 3V7AE 2V7NB 2YUVA 3RWEA 1NCCL 4F8QA 3WJMB 4BFKA 4J2QA 4NBZB 2BS71 2AEOA 2WWNA 1C12B 4MSWB 5JPNB 1NBCA 2DQFA 3RIAF 3P0YL 3B9EA 5BO0D 1HEZB 3ATFA 2BZ7A 2FT6A 2G9KA 5EZLB 1MCKA 4HDIA 2VR7A 4WW2A 3CIAA 3N44F 4Y2DD 5KOVC 1FG2A 2WLIA 2OXGA 1HWHB 2GIMA 4FQ2L 1EDQA 5IFJA 5E8DL 4JR9H 1I1YB 2WQRA 3CFMA 4Y4HB 2ZICA 3KPSD 2QZQA 4ALAL 3GXMA 2LTQB 5IFAH 2X4PA 5C0CB 2FNBA 4FX5A 1JF5A 4GSXA 3O9WA 1KPRA 2HRPL 3TA3C 2X9WA 4ZAKD 1QSVA 5CBAA 1X5ZA 1DVFB 2HRLA 1P9MC 3QUYC 3M6DA 4NO5B 3S0PA 3VD0A 1SQMA 5F0MB 3WXWH 3S8GB 1DBAH 2BSSA 1I4FB 2H3KA 4YXKH 3NJNA 4YHLL 4PLOB 3KYOB 5ALBL 4KC3B 3RTLA 1QFUH 3PNRB 1UXWB 1WAAF 4IRJB 2DOCA 4LLWA 4QRRB 4XNQA 3RURA 4YX2H 2XWTB 4OQTL 1RU9H 3SKMA 3QZBA 4EOWL 1ILUA 2CO2A 3DUHA 3MRNB 5TE6L 4ZODA 1A2YB 2VDPB 3MOQA 5HHXL 4OJFL 3N5AA 2BVOA 3Q0HA 1W0WA 3QORB 3TJHD 2BVEA 4WI2A 4M00A 3HZ3A 1SVBA 1XZWA 2Z7UA 4M6NH 1T1XA 1N70A 4MNQB 3KPMB 3TO4A 3ZRCC 3D25A 2GITB 4LXFA 5FO8A 4L1SA 2I9TA 4WDIB 3N6YA 2NY3B 5K69A 1J8HE 5ICXA 1DJWA 4ONHB 5A16B 3PV6A 1E5YA 1BDYA 2VLRA 4PWFA 1KCVL 3JV6A 5A2FA 4QOKB 1F4WL 4ZS6D 4LCWE 2FEJA 3ZTEA 2Y2WA 1P7QB 1WS8A 2P5EB 4U1KB 1MCWM 1CGSH 1F0LA 1T20A 3MLXH 4Y4KA 1XGUB 1ACYL 2ZF8A 4GSDL 4MB1A 3FCSA 3QC5X 4W81A 2V7NA 5KJRH 1OD9A 4HF5H 4JQXA 2DI9A 1HEHC 2GY7B 3OKDB 4IGBB 5D70L 5LGKA 4BK8A 3ME0B 3HHMA 1YEGH 4Y5XC 1MCPH 2YGNA 3SO3B 4X5XB 5BQ7A 1RP8A 1ZT1B 3WSQH 1T0OA 5FO2A 1BFSA 5EFIA 2B0SH 4K94L 5DUMH 3GXFA 3HLAA 3BP7A 2AJYL 1NCOA 4FF9A 2HMID 3O6FD 5DC2A 1NC2B 2CKBB 1LO4H 1M9WA 5EIIA 1G0DA 4KZ0A 3PFUA 4JG0H 4JHWH 2Y0SA 1JUFA 4YPJA 1NBYB 4Q0XH 2YPKB 1K2DB 4L8SB 4OZHA 3G7TA 4XNQB 3TEUA 5AKVA 2CJSA 3KYNA 3VI3E 5F7YC 1LYQA 1YYCA 1L3NA 4JFDE 5ECGA 2RMNA 1VPOH 1EHAA 1WTLA 3C60A 4ZOBA 2G5RA 5C6WH 3GKZA 5DXWA 4NWUL 1MI5B 3MV11 1VESA 1RUQH 2WTRA 4IS6B 2Y4SA 3JTSA 4X8JB 1HT6A 4IU3A 4WFEE 4NO2A 3TWCH 2ZOUA 3S35H 4KK6C 4Y1SA 2V2WA 1D5IL 1S2EA 1KCLA 3ARDD 1HZHL 3T8MA 2HT4D 3CAFA 5GRYA 5JYLA 5FGCB 3SE6A 3GUTB 2XTJB 1NMAH 2D4DA 4LEBA 4TTDC 4Z76A 5E00A 1WFTA 3X1BA 4XNMA 4EUPG 2HLAB 2O5NA 4OZHE 1S7VB 2XN2A 3AXLA 1S7QB 4KHTH 2R2BB 4LHUB 4YFLF 4YSPA 1MLCB 3VNZA 4L3AA 1TJGL 3OZ9H 3GMOB 3OLIA 3B1TA 2AJXL 1Q0XH 4BK5A 4M6OL 4OQTH 5EWIH 1P7QD 5CEXB 2AMGA 5I1LA 2EYSB 5I5MA 3VXRD 1E5AA 4WJKB 1VB9A 1I1FA 1YA5A 1QBML 2O6EA 5GGSB 2ITFA 4S1RL 3S7GA 5GGTA 3QAQA 4JFUA 4OLUH 4S0HA 4P4RB 2WQVA 2E74C 5LBSL 3WUZA 4CC4A 1I8IA 3WE6B 3ULVC 2X4OB 1B4TA 1K4CB 1AZVA 1LEGB 2QBWA 4XVUD 5T1LA 1G7IA 1OP5H 3ZIYA 1DVZA 3IFOB 3TNMB 1JIBA 4P59H 4ZOEA 1XIWD 3QDAA 1UH4A 1RZKL 4M29A 5L0QC 3DDFA 5I8OH 1SEBA 2UXGA 4G11A 3RUGF 1G9HA 4XN7A 3N0AA 3S3PA 1U95B 2VUYA 5SWSD 4CDHA 5DD5L 4DVBA 1PZCA 1U21A 2EADA 2NY4B 2VMFA 3QDMB 1TMQA 5D8JH 2VDPH 4OZHF 5IROC 4DEWA 1IL1A 1SLVA 3G6AA 4JMXA 2Z1KA 3MUGB 4AZ8A 5C0JB 5I66A 1J9RA 5CF3A 5ILTH 1MWAB 2G4GA 1ZV9A 1WZLA 4MAYA 1JHTA 1A3QA 3FJTA 2X1OA 2N0KA 4BWTA 1CGYA 1IIIA 3BC9A 3G04B 1O0VA 1RHFA 3JV0A 4NJAH 4L4VB 2KS0A 4L9LB 2XA8H 4BFIB 2J1KA 5LVEA 1IKOP 3D48R 1QSFE 4ES8A 1OAZH 1U4FA 5I6LA 2VZVA 1JHLL 3FFDB 4W9KC 4QF1B 2GW5A 3NCJH 1WJ3A 2Y1AA 3FU7B 3QJHB 5EO1B 2AK1H 2ED8A 1EHLL 3CFBA 4GW4B 3RHWK 3CU1A 2BIOA 3F2LA 2B59A 3M1CA 4U3XA 3FB8A 3P9LA 3VG0L 3D85D 3JV6B 4AV5A 4YSUA 5IQ9B 1G7PB 4JVUA 3WEAA 5JW4N 4G6MH 5I2IB 1T2XA 4R4NC 3KJ4C 3R4RA 2WZPD 3CFQA 3UBXB 1OQOA 2Z93B 1TQBC 1T4WA 4EN3D 2NY4D 4AIEA 2WNKA 4AMKH 1F02I 5L6YH 1LO5A 3X1GA 3DLQR 1J05B 4UOW1 1RVFL 4P9HC 4F5CA 5AW8B 3WTVA 2RFXB 4F7CB 2YKKA 3H53A 3HAEA 2OMYB 1AIZA 1UZGA 1T83C 3DX1A 5E8EB 5I5IA 3ZDYB 4LKXB 5IB1A 1J88A 3KJ6L 1FSKB 2W9EL 3LEXB 5J6GA 2FSDA 1B0GA 4XAWL 2MQ3A 2XFXB 3GM0A 3QIWA 5DJ6A 2R8SH 4XMPL 3DJTA 5JQIB 1CGSL 3MLXL 1R3HA 4XHJC 1G9NL 2EXWD 4JFZL 5FFGA 2WBJC 1DO5A 5SV3A 4RMUA 2H3NA 2I9LB 1A1NB 4R7DA 1CQKA 1LEKA 1RZJH 4BZ2L 2PW1B 4R90H 3BRFA 4D9LL 2ERJC 2F1BA 4M62L 4K23L 4LMQE 1WLHA 3L5HA 4YBHA 1QBMH 5F88A 3RFRA 3UYRH 3HCVB 2WQSA 3KXFB 1K9TA 1RJZB 1F18A 1S9VA 2VT0A 2ZUTA 3J7HA 5J9PA 2HX9A 5C08D 4UQ9A 2YA0A 1L9NA 3FL7A 5EZIH 5TDPA 3OSKA 3EOAB 3VW3H 5F8QC 4O2CB 1PTZA 1RZGA 2RCSL 3FQNA 4UNUA 1V3MA 4JUTA 4PRBB 4AYSA 3QULB 4G7RB 1BSIA 3SDDC 1VAHA 2C1PB 1BAFL 3HE7A 1J9TA 1JGLH 3MNZA 2JF1A 3VSQA 1P9MA 3QUYA 2ENPA 4I0PD 4N2FA 5GS1B 3S2AA 3QWRA 1BOYA 1T89C 5AL0A 5IZ7A 1QEWB 1DEEA 4U1SA 1OF2B 2ZCLH 4NPYA 3WNOA 1NUDA 4NSKB 4HGKC 4LEOA 4HETA 4A63A 2GC4C 4GMSH 5F9WC 2VW6A 3OAYH 5T3ZH 3S35L 1THCA 3VXUB 3L5XL 1WA2X 4HZAA 1SJHA 2VLLB 3LV3B 2DZEA 2V4LA 3MUZ1 3RVVC 5E00B 2YA1A 3L48A 4FP8H 4HS3B 3ULVL 4JM2D 1D5BB 1E8ZA 2F5AL 2J6EH 2F1EA 5EPMA 4RGNE 2C9XA 3ROOB 5EOQL 3UJIL 3IBOA 2H3XC 1JGDB 3F7KA 5IKCA 2C5DC 3MJ9H 2P5WD 2YBGA 4NQDD 5D7LE 4JRXE 5ADOL 1OOAA 3HE7C 3L1FA 5C07D 4IOFD 4Q4IA 4XN2A 3DUUA 4RIRB 1IGIH 1HCYA 1C16B 1T1YA 2V2TB 3G9AB 1RZ8A 4MWFB 3VXSB 1WUZA 4PJEB 1SHXA 3ARYA 3Q44A 2AQ1A 5HPMA 2GPZA 3QUXC 3HR5B 1E2WA 1CDBA 1KLUA 3CQPA 2PYEA 4JO4H 2AS5M 4KZCA 2OL3A 3DV4B 3BJLA 3WI9A 4L18A 4Z7UA 3L5WB 1OAYH 4LSTH 1IBGL 1GH7A 2HYMA 3EYOB 4ZOCA 4M4RA 3KYMA 4UV7L 1AR1C 3PG2A 4G8IB 1Z5LA 1A0QH 4UTAL 3L3KB 2BRRH 5DD6A 3DECA 4YFLI 4AGOA 1AZZC 4F7TB 3DX2A 4E68A 3MAWA 1E4WL 5AOMA 3C5SB 4I0KA 5CEZD 5GRUL 1FDLL 1SJEA 1ZA6B 3RIKA 4PSPA 3D5OF 3KYKL 1L7IH 1NLBH 1M42A 2EYRA 3HPJB 5FA3A 1SFDA 3SE4A 2ODIA 4NQDB 3UJJH 2IWEA 2FEEI 3VFSB 4CADB 4J23A 3EH5B 1MAKA 4X6EB 5C07B 4WGVB 4RGMC 1NC4B 2PKDA 3RGVD 4IKLA 2FUTA 4JRFA 3UZQB 4A2HA 2P8LA 1KV7A 1TLMA 3BYYA 3QCVH 3FU7A 1R5WB 1L9MA 3QJHA 4N8UA 1SMAA 3JSSA 4DQOH 1WA1X 2DEXX 3WFBL 5I6PA 1SY6H 1PFCA 2D0HA 1X5FA 3FFCB 4C58B 5KZCB 1BJMA 4HSQA 1WRFA 4PEEA 3WTXA 4D0CB 1OB0A 2PCXA 3FB5A 3IAGC 5IHWA 4TYUA 1S5IH 4MNGB 4H8WH 5HHMB 4PBXA 1ZSDB 3FQTA 3WXWL 3LD8B 3SPIA 1RAMA 1Z32X 3WUWA 4JAMA 4HUNB 1E5ZA 2NCEA 3EGSB 5FO7B 4QKTA 4GS7C 1JWUA 2DRUA 5GGVY 5TQ2L 4KO9A 2ED6A 2EO1A 1J86A 1AS7A 2B14A 3LIUA 1TZIA 3P40A 4I9WE 4YOKA 3QDHA 1LO3L 2CBTA 2XV3A 1H3WM 1MCRA 3O3EB 3NZ8A 1XF2B 3JWNE 5I0YA 1F00I 4PJIF 1P4BH 3QYCA 2N7SA 1KLUB 1WHPA 4P9ML 4L5FE 4YE4H 3NCFB 4LSSL 2QL1A 4FG0A 5E8PA 1P6WA 5ADPH 2XZZA 3ULUD 5GJSL 1XDTT 4WO4D 2L8AA 3ZE2E 3MV9E 2ESVA 4WFFD 2X88A 3CXDL 1X44A 4YGVB 4PJCF 2LU5A 1KB5L 4I88A 3QIWC 2JI3A 3D2UA 4PGCA 3UP6A 3NJFA 2AV7B 5K59E 2R29A 4LKCB 5GGRY 1TQUA 2D7NA 2APWA 1H19A 4B9GA 5EHFA 5DFTA 3WY4A 4I7ZC 3ZPDA 3SY0B 1T03H 2EH7H 1OGAB 1HEZA 4M6OH 2ZKHH 2CJUL 5AKRA 1Z5HA 5BPPA 2XZAL 1HHIB 4BQ9A 4JY6A 4GSDH 4GY4A 4IRJC 4H8UA 5MEND 1CXIA 3WOVA 4AVIA 1HDMB 2N7AA 1ZPUA 3V79C 4RMQA 4U6YA 1CI5A 4RRPA 4YEFA 2OTWB 5CJ8A 4QYOB 2Y7QA 4F8NA 5JHDE 1AD0B 4DGYL 3LMJH 1NQBA 1FFTB 4PGDA 2WLZA 3IJSB 1IGYA 3RNQA 1AXSA 5EEVA 4LNRB 3FB6A 1G5AA 1PX4A 1Z9PA 3IJYA 4PY7B 4JM2A 2X1WL 1ZKAA 1C08A 3W39A 4NNPL 2VLKB 3ZDZE 4DP8X 4OZIA 2EDLA 4L3EA 1ID2A 3TTYA 3HS0B 4X6CE 4XPGH 1KTKE 3RYMA 5K9OB 4TQ8A 2ZYIA 1YNKL 2Q7YB 1U8JB 3I9AA 3PJNA 1T6WA 1ZK9A 5HI4C 4MNGE 2GCYB 5HHME 1DVTA 4A6YH 4DP6X 4N2EA 1LILA 4N5EC 3CVBA 4NEHB 2XWJB 3VI3B 4Y19D 4NQCD 5IMOA 3NN8A 1OSYA 4R7VA 5E8NA 2FIRT 3QDGB 4UT7H 4QXGH 4CILA 4MXWL 4CKQA 4AT6B 1XD0A 1I8LC 2FBJL 3T0XA 2SEBA 3RFZC 2VZOA 1CFVH 1CZ8L 4H1LB 1A3LL 1I9RL 1ZT1A 2FJSA 4XO8A 1A9VA 4BCZA 4AMXA 5IB2A 3MRGA 5JO5A 4XPTH 3BCDA 1JZ7A 4TVUA 4LOUC 1KY7A 2HUEA 4ONGL 1NMAL 2IMNA 1HJCA 3UMNA 4MJJA 2EDKA 4FOMA 4N2KA 3QH3A 2BSTB 4TF4A 4BUQA 1QYGL 2FX8L 3BQUC 2DN7A 2ZUQB 3L7FA 1AHWC 2N3JA 1FG9C 3FO1A 1E27A 1FE8H 2H0EA 4P2AA 1G1OA 4OI9A 3O8XB 4J3OH 3TJHC 1P7QA 5EBWA 2XIBA 3UX9B 3S8WA 5MHSD 4G1EB 5BNXD 4L29B 5ACMA 2ZKWA 3BN9D 3HFFA 5CP7A 5IBTL 4ETQB 4RGND 4Z77B 3MGAA 3CFDB 3DO4A 5K1JA 1EZVX 1DCLA 2HX7A 3KLDA 4E5XB 4EZJA 4OGZA 2P43B 5E6YA 2GITA 2NY6D 1CGUA 4LQFL 4Y19B 2GSGA 4KGJA 1B4JH 1JSYA 3TIEB 5GS2H 3DSFH 2ENQA 4K9EH 4GW5B 3SGJA 4QRPD 4PJXA 1W16A 3QFJD 3FUMA 2WBJD 4W4OA 3AFLA 4CMHB 4DKAA 4JG1L 4F2FA 2R0ZH 4PGZA 4AGNA 1BQUA 3IFPB 4NCC2 3U6RA 2XZQL 4K2UL 2OMZA 4NQTA 4HJUA 1WUNT 1NWPA 5J3HC 1GZQB 2MPAH 3PWVB 2CXGA 1OLLA 3CD4A 2DQCH 1AXTL 3DX9B 4JFYA 5HGBA 3TT1H 3NSFA 3A6BH 4FN0A 4Z7WF 2WO3B 2EUZA 2EICA 4NRZB 4AIXA 2BSCA 5F89B 1O6VA 2IADB 4HS8H 4LCIL 1ZVSA 3MODH 4CDGC 2BM3A 5IG7A 4JN2B 2J5LC 3PJLA 4FYQA 5FX3A 1QLEB 5A2KH 4RDQF 1GJIA 2I5YL 2M1KA 3V0IA 4QIRA 2J21A 4MAUH 4TUUA 4YBQD 2PYFB 1OSZA 3ARFA 4G72B 1NAKL 3T6WA 5E8OA 3LMJL 3ECBB 3WMQA 4WNQA 1R24A 5D7KD 2YMXH 5L4IA 3CDGA 3TBWB 7PAZA 3PQYE 3V9CA 4MHHG 5SWZD 3VYOA 3BAEH 1FNHA 4K07A 2H1LM 3KPLA 2CR6A 3MRMA 4J3SA 1KB9K 5F7WC 5KBDA 1O5DT 1NICA 3PWPA 4R2GD 3SE8L 4X0NA 3GUFA 5CJ5A 2RJMA 4FKHA 2JB6A 4DGIH 2WD0A 2Y36H 1V8HA 4EOWH 1QABA 3WE6A 3IPBA 4LPWA 5HY9B 3PDOA 5F0LB 1ML0A 1L9TA 4QTIL 3ZQXA 1XGPB 4PJ5A 4R4FH 4AOFA 5I73C 3BKMH 4PJ9C 3GB7A 1NL0L 2ICEB 5AVQB 5JPMC 5CP7B 4YWGH 1V55B 1HHIA 1E9PB 3H54A 3OWRA 1FZKB 3CFCL 5KVGE 2EXYC 4UQEA 3HS0C 2DIAA 4Z7WE 1KGJA 2AQSA 5I0WA 5I1IH 2MIZA 2TAAA 1KY6A 5DRWB 1DANU 3INOA 5IW6A 3VSVA 5AAMC 4YBQC 3CBJB 4YK4B 2JKTM 6FABL 3VFRB 3G5XA 2EIZB 2ZWZA 4RQQA 3U2JA 4LDOB 3PUUA 1URLA 1FHGA 2EDBA 5JLZB 1W80A 3OJMB 2R0WH 4OLWH 3MRFA 2A4EA 3SDDA 2ODHA 2CIKB 3PV7A 3F7YB 3L3DB 1QPKA 1MW0A 4LLUA 2APXA 1TZGL 2NYYD 5HP5A 5DJYA 4OD3L 2XWJA 3TBCA 3VI3A 2QLVB 1WHOA 2X2IA 1PKQE 1B0RA 5FV1L 5TFSH 2BOCA 5FB8A 3G6JF 3FOLA 4A2EA 1S78D 4N1HB 7FABL 1MRFL 1ZVHA 3DI2B 3A0OA 4BA0A 5HGAB 4U31A 2OMWB 5A1AA 5IJVA 4POZC 1A1OB 3S3BB 1BVKB 5D4QA 3QNZA 4OJDH 2Y25A 4JO1L 2DM4A 2A9CA 3SPHA 2PO6D 3MZGB 3A4EA 1N8ZA 4N6RB 3SODB 1IJNA 1A7QL 3KPQA 5B1BB 2WBJA 5MERB 3NK3A 5DZLA 3ECUA 2R1WB 1U8KA 3NSXA 4KKAC 4U1NA 3S5LB 4R5TA 1KFAH 1X7QB 1ZS8A 4R26L 1S7SA 5LWYH 4XMTA 2VR3A 1AXIB 5GSRB 1HH6B 2W59A 1SRDA 1MCBA 4HGWA 4L3EE 4OV5B 1WVZA 2Y1VA 3RWDA 4Y4KB 1Q9LA 3ARBD 4KVNL 2WXKA 3ILDA 4M1DL 5HHVH 4JO5A 5CCGE 5FKAA 5T5NF 5KSAB 4H2CA 5D4JA 5AD0B 3BQUD 3AT9A 2VOTA 1R5IB 2HTKC 1F3DH 4ZUVA 2QTVA 2AMUA 1S7UA 1A3RH 4PRBA 1II4E 5J8OA 3TXAA 4A39A 3UO8B 1UT2A 4XODA 2H1PL 1S46A 1K4DB 2CZNA 1TZHB 2XPZA 4XVSH 1CDIA 3VDBA 5DR5H 4UT9A 1SOQA 5BOPA 1N7MH 4NP9A 4P06A 3PGDB 3WL9B 5DD1H 1FL6A 1JPGA 4CN4A 4UU9B 4J8QA 3PL6C 4F58L 3OG4B 4YR6A 2GTWB 4F33A 3WS6A 4OAWB 1KPUB 3Q05A 3VJ6A 3PAYA 5F3BB 3PFQA 5CD5C 2GJZA 3CVHH 2KI6A 4L4TA 4PYHA 2Q5BA 3MV8A 5JMOC 5LQBH 4RGMB 5EC2A 2AC0A 3KW7A 4QRRD 3NTCH 5C9JA 1TVBB 1MPAL 1QNZH 2FLRT 2IH1B 2UVEA 1KTJA 4JFFB 3CDCA 2XYCA 1B88A 3JBG7 3B6SA 2DQJH 2IPKA 2QFPA 3TBVA 2WINA 5KBKA 4J3OF 3F3HA 2LU7A 3HI5H 3LHPH 1SXBA 5DHYB 5E9DE 1VZGA 4N2DA 3Q5OA 4V11A 3MCYA 2YR3A 1NANI 3BVXA 2AV1B 3IFNH 5E4EC 3U7WL 1BQKA 2LABA 2BW5A 2EKSB 1LO4L 2NY6B 4FYSA 4B97A 5CILH 1C1EL 4JG0L 1IGML 4JHWL 2QEJA 5DJ0A 3UBXA 1TKWB 3UTZB 1FFPB 4P57B 4EI5B 3HFML 1UCBL 1OW0A 2VDKB 4RBPK 2X4TA 3ARGD 5HGHB 4RBPH 1J1OH 3GS4A 5KSBA 1DYZA 1CFSB 2D7QA 1KGUA 3OHXB 5HDOA 2FB4H 1HZKA 3LV3A 4F9PA 2YZ1A 1RZIB 3IWVA 1YN7B 1HL8A 4KX7A 4P3DA 4JY5H 1MVUB 1XAUA 2DH2A 2ZXDA 1IQDB 1E8YA 3MXWH 3W11C 4TULH 4JPIB 5KG9A 3K4DA 3D9AH 3DVGB 2NXZC 1XR9B 4OCSL 2GIYA 4JREC 4MQ7A 3EHBC 2BDNL 4KFZC 2UZYA 2CO6B 5MI0B 4F1SA 4OLUL 4MJID 3U82B 5GZOC 2CUMA 2FO4B 1T5WA 1UA6H 4OI8A 2GSIA 5E08H 3FQNB 5LJYH 4HWBL 1F86A 1LLAA 4FQIH 3X3GH 3QQNA 1T1ZA 4PJ8A 3TVMA 4G8IA 1CS6A 4R96B 2Y06H 4IBVA 3F58H 3KYMB 4F9PC 2ZD0A 3X11B 1M53A 3SKUD 4XMKH 1JGVL 1MG2C 3MLZH 4PY8I 4PLJC 4HEPA 4UTBH 3K81A 2OYKA 5E99L 2FWOA 5F7DA 1ODUA 5EBLA 3S3SA 3VFMA 2A7BA 2YWYA 4H1LH 3IU3B 3ZE1E 4X5WA 5C0GB 5IW1A 3O3DA 4XNBA 3D0VB 5GS1C 4CVXB 4F57L 1HXYA 3ATBA 3CFEA 1J5IA 3G5VB 4NC0B 3L4ZA 4GBXB 3LIZH 4A37A 1G9NC 4XMXA 4MS6A 4A2GA 3QW9A 4PRPE 4K71B 4Y2DB 2VQTA 1VFBB 2Y6SC 3SGDH 5EN3A 4NGHL 2G2RA 5JOFB 4PW9A 3FHQA 3U46A 4GRLA 3HE7D 5DRNB 1UJ3B 4AGLA 1N19A 2WLJA 4JPWL 4ZFGL 1D5BA 4GG6B 5JA9A 4M5TA 3GMMB 2I7OA 1Q0YH 4MS8C 1TJHL 3BLPX 3PP4H 2MH4A 3WD5L 4LAQL 3RIFF 4EIUA 3OHXA 4PJ8C 1A7OL 1GW0A 3RZCC 1IBHA 1AQDB 1KMGA 1FPTL 1N59A 2CO7B 1ZHKB 3A24A 3P30H 2BVQB 2Z7WA 2H32A 4I0CC 4Z7VA 1N0XH 4G71B 4JQVC 4I87A 4OKVA 2BH0A 3QUMA 2E4TA 4I9XA 3MGTB 4X5RA 4MD4B 1GGTA 2D31A 3NJJA 4ZFOB 4LSDA 3TBTB 3D6GA 1FH2A 2DBJA 2XY2A 1D3CA 2WXPA 4HUXA 4JDVA 1EXHA 1KN4H 1BJ1H 2OMTA 4JB9L 2X41A 3LIZA 4K55A 3W2DH 5IY5B 3Q2NA 4GAGL 2TRYA 3MYJB 4KGLA 4EKXA 4KFMA 2FQEA 2W07A 3A5VA 4UM9D 2NY1C 5GGRA 4HVBA 1WT5A 1NCCH 2WXOA 2YFOA 2V33A 3II2A 4X7SL 4N5UA 4IRZH 4ACPA 4J3XA 5CZVL 1LNUB 5JW4Q 1KB5H 2F9BT 2C9PA 1GC1C 4QOKD 4I48A 4BQBA 4Z3JA 3QJTB 2X09A 3KLAA 3PWJA 2DWEB 5DK2A 5ALCH 4YR6B 1RK7A 1J5HA 2D0GA 5K33A 1DQJA 2UZPA 5ETUA 2ZWLT 3BP6B 1E65A 3D30A 3FUDA 3T8XA 4N9GA 1OZTG 4NQED 1BIIA 3EFOA 2V8LA 1V27A 2VUKA 2OMWA 4FFTA 4J6RL 4HD5A 3SE3C 1MVYA 2WVUA 2P5PA 2BCKA 4KTDH 3OF6A 4YFEA 4JRYA 4YAQB 1AO7E 2V0AA 3P02A 3K2KA 2WV3A 5JHDB 1I85A 2FATH 5CUSL 4F9LC 2Y07L 1A4KB 3FQRB 4IK6A 3SGEH 3U2SA 4WAFA 1VADA 3BH8A 3FH5A 4QTIH 4ZMZA 1IT9H 1I1CA 1VACB 1ZJBA 2HH0L 3TL5A 3UG3A 3TA3A 4QXWA 1IB5A 1FRGH 2R15A 4U05A 3VFNB 3BPLB 4WWPA 5T5FH 3DURB 4JO3L 1PGRB 2NY4C 2VN6A 3GXUB 1MCCA 2HFTA 3JT2A 5ESAA 1JXJA 3T2OA 5JIPA 3GBNH 2NXYB 1IM3A 5E6SB 5I24A 4FLQA 1MZYA 1A7PH 3AXLB 1WYJA 3MRBB 4E2OA 1MCJA 4XPHH 3RWCA 3EGDA 5L7XH 2C3HA 1ZXQA 1UGKA 1MCEA 2E47A 4L1HA 5CJQL 1KYDA 4QRAA 2ICWB 4KJYA 2RTTA 2BFGA 4G2AA 4U7SA 2VXUH 1DUYB 4AV4A 5IEHA 3B2VL 3U4EA 2YRBA 1HVXA 4DP9X 4MYWB 4PRIA 1MHEB 5E2TH 3OPUA 4RAUB 3D0LA 3X13A 1FUNA 4XPTL 4YPGB 5LG1A 4E9SA 3BEWA 4XMPH 5CR8A 4OT1H 4Y0GA 3QDGA 4ZPVA 4MLIA 4HUVA 1EJOL 4L5FL 3GLAA 2ZF9A 4X0KA 1HH9B 1R6VA 5CGTA 3O6ML 1IQWL 2X0UA 4NT6B 1H0DA 2GTQA 3ZTDC 2YGOA 1WCQA 1HL5A 1GA2A 5EBLB 5C0GA 1EAPA 2IAAC 2Z1PA 4KH9A 5E70A 4ZSOB 3A47A 4Z0BL 3VFVB 5KBMA 1P4IL 1HQ4A 3TCTA 3I74A 1KJVB 2CDEA 2OJ1A 2V2XB 1G9MC 3BMWA 4OIIH 5KVFH 3BCFA 4OZIB 2WMPB 1THAA 4LOFA 2X6AA 5EOCJ 1VGKA 3DMMB 3MO1B 1JTTA 3DGGA 4EJ1C 1L5GA 4PWGA 4LNRA 3INUH 4CGUB 1KFAL 2P49B 4H40A 4ODBD 1FYHB 1XGYL 1N5AA 2Y5TA 3VTAA 4C47A 4Q9RL 1QNIA 5C09D 2OKMA 5M95B 3AS0A 1C5CH 4NRZA 3ZTJG 5IHLB 4WGKA 4G6AC 5T1LD 1FJ1A 4GRLD 2NW3A 3T2NL 5DWUL 2C4XA 2PTTA 3UTQA 4XGZB 3SDCB 3P4OB 3OSVA 3NCXA 1XEUA 4M7ZB 3QUML 4M7LH 1X5JA 2KH2B 3S96B 3X3FL 2W07B 4XPFH 4LEOB 4Z7NE 2F5BL 5H2BB 5GGSY 5DEFA 3GRWL 1PDKA 1ZLVH 4JX0A 4Y5YB 2P47B 1TG8A 4AH2A 4YSAA 1S7VA 1FAIL 1S9YA 3LPWA 2QGDA 3BMVA 1WFNA 2EEDA 1YEHL 2FO8A 4JO2L 2CUHA 3ZKMC 1LDSA 5DD5H 2Z4QB 4NO0A 4H2AA 4LLQB 4Y5XB 1PS3A 1G7LB 1SY6L 4K5OA 3GXTA 1KLGB 4U1JB 5E2WH 4P2YA 1BZDA 3BWZA 1W8OA 2CH8A 4WFHE 3RTQA 3L3OC 1PY4A 1MAML 2L04A 4MMYB 4RWYH 1N2RB 5D7IF 4WV1A 1OCOB 1PEZA 1IGCL 1L0XA 2K1MA 1LEIB 1FNLA 2C4FU 1BD2B 4I4WA 4QT5B 1U8PB 2DQEL 2E59A 3HMXL 2IADA 1Q9KB 1KOAA 5EU4A 2DD8L 2QSCH 3STLB 2UYLA 4IKJA 3G3LA 2YN3A 5BMFH 4GG6A 1LEKB 3PHQB 3HAEH 4YPGA 1V7NH 4Z5RB 1XCXA 4JFXB 2EDWA 2NY0C 2R2HA 3QXAB 3FTYA 3MGOA 2FL5B 3BOVA 1OE1A 3QIBD 3ARGA 2WGNB 1GKEA 1ED3A 3RAJH 1IZKA 2XTJE 4AW4A 1R3HB 3K4ZA 5B1KA 1KIRA 2OS7A 1M9SA 1TU2A 2K3HA 3IXTB 4XCNB 4FQHB 2YHGA 2FZ3A 1WQVT 4HU2A 4HUMB 4C56A 5I6NA 4GAJL 1FFRA 4OCYL 1A65A 4R7NB 3MA7B 3JV4A 3EYSH 4N4YB 1CO1A 1I7RA 3F12B 2IJ0C 3TC9A 5CP3H 3VGDA 3CMGA 4E5XA 1T0MA 3Q8AA 1CGVA 1YRKA 1JZFA 1S7RA 3VH8A 5G4OA 1MFVA 3K3QA 2VLRE 4RMWA 2H26B 3CGTA 3VFNA 5H94B 2XSKA 3MLRH 1E6JL 2GB2A 1G7MA 1WSST 1YG9A 3GIZL 5SV4A 5H2BA 1YEWA 1A4KA 3QPKA 3QZWA 3SIKA 1CYWA 3DXAD 2NX5A 3VD1A 1K3ZA 1IFHH 4ORZC 1NOFA 3KW8A 2EUVA 3MRMB 3SEPA 4P5TC 5EOCL 5GGVH 5IHBA 3NA9H 1BFVL 2NW3B 3SBWC 3V6FA 3DK0A 4GFTB 4WI9A 1DO6A 4BFOA 3BAXA 4R0LB 3GSXA 2JCCF 4BHUI 4ETYA 5E08L 2LTQC 1JFHA 3ECBA 4RGOH 3BP6A 2R39A 1A02N 3MV9D 3FAXA 1KYUA 4H0LC 3EKCA 4BIKA 1I3GH 1FIEA 5D5MB 3INUL 3NFNB 4WHYH 4OF8A 4LSUH 4Z7OF 4ZMAT 5EEUA 3HMWH 1EHXA 5SWQB 3EYVB 4XOAA 1C5CL 4YHNB 1MIEL 2G3NA 4RFOH 5F6IC 5IJVB 4XP5H 5KYYB 3VI3F 2OR9L 2ICEC 5KVFE 3WNIA 5IMOB 3MRNA 3FHAA 1UZ8B 1NEZG 3JWOL 1FVCB 3MLUL 1AHWA 1H15B 1PBYA 1ZA3A 4J8RB 5JDSB 3HR5A 1YEFL 5HPMB 4LHQB 1DBKL 5D2LF 1SOXA 4IKKA 1FFPA 4K9EL 3JV5A 2VC2L 4JFXA 5IESL 2B8OT 3PHQA 1MY5A 4A2FA 3VH8G 4BSWA 4L05A 1MWAL 3E8UL 4MWFA 1BPVA 3VXPA 2VWEE 3MOBL 3BX7C 5DF0A 3ARZA 3HRZB 4MJ2A 3MV8D 2NUPA 2BP3A 5C0NC 3HVDA 2DIEA 1DQTA 4M1DH 2MRYA 3VXMB 3CUPB 3OJDB 1SF5A 4ONFH 3AABA 2EDXA 3I9PA 5ACZB 3UTTB 4J2XA 4ODVH 3FF8A 4P4RA 4RH4A 2P7TA 1YN6B 2J5LB 3DYPA 4N8VB 4ELMF 3D33A 4QAMB 2BX5A 1U9KA 3A67H 4AI7A 3BFQG 1DZ0A 1Y7VA 1M05A 4HDIB 2YEZB 5H37G 1X5KA 5DJDA 2HFGH 3CZFA 4AQOA 2J1YA 1G9MH 4PUBL 4RFNC 3S8FB 3DBSA 1JYXA 4F8LA 4PJFA 1CLOL 3O11A 4Z7WB 1JYWA 5G5DB 4GEIA 1DJXA 5ICZA 3DTUB 2WP3T 4G59C 3ZE2B 1U3NA 1I8MB 3I50H 2VQUA 1PZAA 2EXSA 3SOBL 4D3CH 1H5BB 1NTDA 3FU9A 2G5UA 3MNVB 2E7LA 4L3ED 4PB9H 4HIEA 4ICXA 3NIDB 1F6LL 3GMQB 5TDNA 4AC2A 1CF8H 3H85A 1QO3B 3Q8BA 4MMZB 3L2NA 1B3IA 2A73A 4GKZA 1QUPA 4G7QB 1P84K 3CLEH 1IZJA 1O6TA 4YHZL 2VAJA 2DL9A 1MW2A 5I0DA 1KYOK 4QRQB 4XPGL 3AT8A 2YMTA 2GCYA 5BZXA 4LCUB 4ELME 2VQ1B 4XPBL 2PO6C 4GSQA 5MERA 5JIKA 3S5YA 3VD2A 4KKLD 5FYJL 4D9QE 1CG9B 5CJXC 2PCFA 3GSUB 1R75A 4JUSA 2DQIH 1FL5B 2KBGA 3ULAB 2J55A 4ZQKB 1IC1A 1GPOH 2QMJA 1U58B 2Z7ZA 2HVJB 2VRAA 3CFKB 2HJLB 5DJCA 5DD6B 2XN9E 3OR7B 5E1GA 1Z5LB 4Z78A 3C9NA 5SX5K 3RL2A 1BVOA 3DX7B 2JKLA 1N4XH 3VG9C 4K3HA 5LKNA 3O2WH 4HSAC 4BBWA 1OAUH 5IHZA 3W3BA 2YPLA 3FUJA 4HIIB 2J2ZA 4OVVA 5DC0A 4ZW5A 1N6QH 4Q9QH 4C56D 4YNYA 1DBJL 1SDAB 3ARPA 1ZLVK 4EAEA 3MV7A 3K8KA 3QQXA 3ULSA 3BSZA