3F3MA

Six crystal structures of two phosphopantetheine adenylyltransferases reveal an alternative ligand binding mode and an associated structural change
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
160
structure length
155
Chain Sequence
MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKGTFSLEERMDLIEQSVKHLPNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title The structure of Staphylococcus aureus phosphopantetheine adenylyltransferase in complex with 3'-phosphoadenosine 5'-phosphosulfate reveals a new ligand-binding mode
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 49
structure length 155
sequence length 160
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3f3mA00
2QTMA 1JHDA 2HGZA 1T9GS 3A04A 3CLSC 1O95D 1A8HA 1EFPB 2A88A 3K9WA 3FDXA 4A91A 5HUHA 1TQ8A 4ND7A 3ZGZA 4MW9A 1M8FA 3ND6A 3HGMA 2WSIA 4F3RA 3AG6A 3MLBA 1ZJWA 1Q19A 2BTEA 3H05A 4Q16A 3KFLA 2QUJA 1NYLA 1R6XA 4EG8A 2IP1A 4S1OA 4JYZA 1TYCA 2DR2A 5DASA 1NZJA 4YBRA 4MVXA 1COZA 2DUMA 5J59A 3PNBA 4I6GA 2OV4A 5LFAA 1QJCA 4MW0A 2BYTA 3PRHA 3HFJA 5HUJA 3FG9A 3IOBA 4CDMA 3ISJA 1N3LA 3CVUA 2JA2A 2CT8A 2VXOA 1KAQA 2CYAA 3CA8A 4DDKA 1F4LA 4MQ6A 3SDBA 4KR7A 1O96A 1VBKA 4ZT6A 3AKZA 3ZUGA 1J70A 4HJRA 1P7PA 1WQ3A 1TFUA 3Q4GA 2J09A 3IMCA 1N78A 1XNGA 1EUYA 3UY4A 1K92A 2AG6A 3N2YA 1VLHA 2HZ7A 1J1ZA 3SP1A 4EG6A 2CV2A 3G5AA 1MB9A 4JZYA 1I6KA 1TYAE 2DEUA 2HMAA 2QTRA 3IUBA 3TQIA 1ZH6A 1B6TA 1O94C 3LE8A 1J1UA 3KT0A 1NI5A 2PXHA 2G36A 1I6MA 1IQ0A 2AZXA 1EJ2A 3TZLA 3MUEA 1J21A 4ZCSA 5IHXA 1JGTA 1T6YA 2J4DA 1Q77A 1WXIA 2OQ2A 3QTBA 2J5BA 4MUKA 4OJMX 3ZJUA 3CLTC 3COYA 1IRXA 4DLPA 1QRTA 2NSYA 4GRIA 2D13A 1EFPA 1Q11A 3TQOA 1WJGA 4HK4A 4ZT3A 3SZ3A 3N8HA 1F9AA 1XNJA 2QUIA 1CT9A 3FNRA 5BNZA 4OUDB 1KH2A 3AFHA 4EG4A 3SZGA 1DNPA 2QUKA 4NATA 2TS1A 2X3FA 4UZFA 2RD2A 3A2KA 3IODA 3MXTA 3D6UA 3PNVA 1R6TA 1WKBA 3HZRA 1O0BA 2C5SA 1IQRA 5FO1A 4U63A 3KT3A 4YP6A 1ZH0A 1KKUA 4GU5A 5EKDA 5KWVA 3G59A 3DPIA 5FO0A 1KORA 5K0SA 5IJXA 1QTQA 5JBNA 4K03A 5LM3A 3PNYA 1HYBA 4XFJA 2O5RA 2CFOA 4X0EA 1M8GA 1K4MA 1O0CA 4NZPA 2Z3VA 4ZCTA 1IH8A 1IHOA 2QJOA 4MUIA 4MW7A 1F7VA 2A1TR 1NUQA 3ELBA 3IMGA 3U1VA 4Q93A 2ZUFA 2A84A 5KCMA 3ND7A 4E1AA 1NUTA 1OD6A 1F7UA 4U7JA 1IVSA 1OWPA 3IOEA 3CVXA 4MVCA 2IJGX 1IFXA 1M8JA 1MC1A 4RPIA 1LI7A 3RHSA 4L2IA 1N2IA 2YWCA 1M8PA 1G8FA 3COVA 4K0RA 3IDFA 3FH0A 2DETA 2V0GA 1GN8A 3SYTA 3KT6A 1NUUA 5FNZA 5TS2A 1N2GA 4PBSA 3AG5A 1G8HA 2J08A 4MWEA 3CLSD 3RBAA 4H3SA 2ZUEA 1VL2A 4MUEA 2QJFA 1VBNA 2I1LA 3PXUA 1N2HA 2A1UB 5TEWA 3FHJA 1JIIA 1K97A 1JIJA 1NUSA 1PG2A 3VU8A 1QRSA 3I05A 3L93A 3FY4A 3COWA 3D6VA 4UZEA 1S4MA 3RK1A 1K4KA 2DERA 1NP7A 3ZJVA 1N1DA 1M8KA 1KQNA 4OUDA 3QE4A 1PFUA 3LCJA 2YY5A 2X1LA 1OWOA 1NURA 3C8ZA 2E89A 2E21A 1OBCA 4L2IB 1FFYA 3IUEA 3NBAA 3TNJA 3SEQA 3IOCA 4CT0A 1NUPA 3COZA 1GZUA 1PG0A 3H9BA 3MMXA 2H29A 1U3CA 4HPWA 1T6XA 3M5WA 2J07A 5KHAA 4KPUB 4MUFA 4YP5A 4MW4A 1XJQA 2PZBA 4JXXA 1MAWA 1J09A 2CYBA 4JFAA 4KR6A 1I2DA 2YXNA 4MUHA 1JZSA 1Q15A 3CLUC 1O5TA 1YULA 4MWCA 3H9CA 3MLAA 4G5YA 1NSYA 1ULHA 4XSVA 3FI0A 5DEOA 3ZIUA 4EGAA 2V0CA 1Y42X 4ARCA 2A1TS 4MUNA 2A4MA 4MWDA 1WZ2A 3H99A 3N05A 1IQUA 3P0JA 1KP3A 1WXFA 4EF6A 2A7XA 1O95C 4MW6A 1O94D 3CR8A 3P0HA 1TYDE 4XFDA 4ZCRA 1TEZA 1YIAA 4DDHA 1O6BA 2WQ6A 1EUQA 1WY5A 2CV1A 2CYCA 1O97C 3HMQA 5H7XA 4EG3A 2GOYA 4MUGA 1JEEA 1X8XA 3G6KA 3UOWA 3CLTD 1WXGA 4NDAA 4G6ZA 2PIDA 3A4IA 3UC5A 4QREA 3KT8A 1WQ4A 1N2OA 1PFWA 4R2MA 1RQGA 3CLUD 1GAXA 3FWKA 4MWBA 1XNHA 1MAUA 1KAMA 4YMIA 2A1UA 1H3EA 2DPLA 2VTBA 1ILEA 2QUHA 1G8GA 3F3MA 1MOPA 2EJCA 3IMEA 4MW5A 4YP7A 3DO8A 1TYBE 3FIUA 1N77A 2Z08A 1SURA 1V8FA 2JAXA 4QBTA 2CV0A 3RJZA 1MBZA 4WSOA 3SEZA 3CVYA 4FZJA 2QTNA 5H16A 1N75A 2Z09A 4NAHA 1QRUA 1GPMA 4DJAA 2JANA 1O97D 4J75A 1OBHA 4ARIA 3GMIA 4EG5A 3A05A 4JXZA 1KQPA 4HJXA 4MVWA 5TEVA 3UMVA 2GKSA 4AQ7A 5F23A 4KR9A 4J76A 4KPUA 2QJTA 4BWVA 4MLPA 2VTBB 5DB4A 2XRZA 2XRYA 1BS2A 1YI8A 4I6JA 1WXHA 1T9GR 2R5WA 3LOQA 1JIKA 1X6VA 1D2RA 1PFVA 4MUJA 4KKVA 3DV2A 1N2JA 5DK4A 1GLNA 3ZXSA 4NAUA 1M1ZA 2YWBA 1OWMA 1YIDA 4QRDA 1WXEA 4F4HA 3IVXA 3VGJA 4RUKA 2DLCX 4R0NA 1ZUNA 4WNYA 1V47A 1U7DA 3P52A 4EG7A 1N2BA 1U3DA 3AL0C 4MVYA 4PY2A 5HG0A 3IH5A 1OWNA 1H1TA 1OWLA 3TZEA 1YUNA 1PFYA 2CUZA 3CVWA 5K0TA 4ZCPA 3NV7A 3ILVA 1QQTA 4U8HA 3X1KA 4CDNA 1KR2A 1N2EA 3DLAA 1QU2A 1UFVA 2AKEA 1J20A 1G59A 1EXDA 2H2AA 2ZP1A 4P2BA 2RE8A 4ZT4A 3INNA 1EFVA 3CLRC 2DXIA 3AIIA 1JMVA 3Q12A 3NBKA 1U0BB 2WB2A 3X1JA 4ZCQA 4DNXA 5J58A 2NZ2A 3IVCA 3ND5A 3S3TA 3N9IA 2D54A 3IVGA 3JXEA 1MJHA 1O96B 1T6ZA 1GTSA 3VRHA 4DDMA 5TGTA 1H3FA 1JZQA 1MB2A 2PFSA 2D5BA 3OTWA 4PBTA 4MW1A 1M83A 4ZT5A 3RFFA 4R2LA 5AHWA 3HL4A 2GM3A 4DE5A 2IELA 1FYDA 4I6EA 1YUMA 3GUZA 4ZT7A 5LLTA 1U7XA 4EG1A 2PZ8A 3Q10A 2WQ7A 1VBMA 3QTTA 2PG3A 1KQOA 4NX2A 2EL7A 3BL5A 4MAFA 2O8VA 3FOCA 3L92A 2E0IA 3TS1A 3X1MA 4PBRA 5J5AA 1EE1A 4MW2A 4CQNA 1JECA 1MRZA 1GTRA 4ZT2A 3ZJTA 2X0KA 3P0IA 1JEDA 1QNFA 1LI5A 4G5FA 4MULA 1QU3A 1KH1A 3UK2A 3FETA 1EFVB 4TS1A 2X1MA 1WOYA 3RK0A 2CSXA 3GLVA 3CLRD 3K32A 1KP2A 3ZXIA 3CVVA 1H3NA 1KH3A 2PZAA 1R6UA 2A86A 3H97A 1LW7A 4EFKA 3HV0A 3OP1A 1I6LA 4AS1A 3E27A 2E18A 1JILA 4ND6A 2B7LA
chains in the Genus database with same CATH superfamily
4ROTA 3EVTA 5L53A 3H04A 4HMOA 1CUJA 2QTAA 3ZWBA 3M4YA 5CA1B 1DBVO 1T9GS 4I3HA 3CUTA 5K1ZA 3TUZC 1A9QA 4ETMA 3OJCA 4Q93A 1T5TA 4A91A 1MC8A 1OGYA 5J2TB 1PYDA 1UJ6A 1DKMA 4F3KA 3QWIA 1AGNA 1K8XB 3EIHA 2QL5A 2WTNA 3GUCA 4QHSA 5LQDA 3TH5A 4BNUA 1P5JA 2JLVA 1EUCA 5GJVC 4N12A 5CIWA 1V4NA 1JQLB 5IUKC 1MXFA 3DZKA 5KTSA 4OX9Y 3PE3A 2ERXA 2KQUA 5DSZA 4KOAA 1XA4A 2IE0A 4A1OA 1Q0PA 4U4AA 2WF7A 2Z6VA 3NHBA 4AMBA 3UXMA 3AF2A 3RNLA 3QOWA 4KE7A 1R74A 2SHKA 3PDJA 2D5LA 5EZYA 3M82A 3T7IA 3TIVA 1COZA 1U7TA 1F12A 3KOXA 5H3LA 2FU5C 3O84A 4ZAXA 1P2TA 4RHTA 4UNIA 2HXYA 2WQ6A 1BFKA 1YMVA 4TVBA 2JFUA 3PRHA 5JQGF 2YINC 1HT0A 3UB2A 1LUAA 2VUTA 1Y4UA 2Q1TA 3SQDA 4JUBA 3CVUA 1XRPA 3AUXA 5FTKA 3QPDA 1TL7C 4A6DA 1DAPA 3UT0A 5C53B 4JJ8A 4XD7D 3PF8A 3QOFA 1WMFA 5B7QA 4S0XA 1UP4A 1XX6A 1JQ3A 1J0XO 2PT7A 4Q3BA 1XQXA 3UEOA 4MJ3A 2RONA 3WXBA 5KJ1A 3FCUB 1BDHA 2VRBA 1RLUA 4WACA 4BTEA 4R71A 4LDRA 5FPSA 4RK1A 1WQ3A 3O31A 4LJ8A 1TFUA 2WAAA 1G8AA 5B64A 5EINA 2OOKA 2WOOA 4RMIA 3S44A 3G9QA 1ZNXA 2QGFA 4DXHA 1V4VA 1VIYA 1R8SA 1Q7BA 3MLEA 4GVPA 4R16A 4ZC8A 4FLFA 4JI6B 3ZQKA 3QYAA 3N7TA 4QXQA 3I64A 4LOJA 2X40A 4DMUB 2YXBA 4B0PA 3NDJA 4LX8A 5SYAA 3ZR4B 3ZX4A 5EEHA 2EZ9A 3KEOA 2PBFA 2KYRA 2AYXA 4QO8A 2BMFA 3R7WB 4BJ3A 3FPAA 2VPPA 1DRKA 3RS7A 3UMRA 3V1KA 3UMCA 3WQBA 4BB6A 5JPCA 4MLZA 4YYEA 5KX5A 1IN5A 4G97A 1QHHB 2GSDA 3INRA 5CM2Z 3REOA 2PL9A 1LSJA 4ARVA 2A9PA 4RJIA 3TKAA 4IJQA 2ILVA 1ZM9A 4HX9A 4B87A 2BFFA 4GICA 1O94C 2X42A 2I76A 2ZTSA 1FDVA 1NN1A 1SU6A 4DIBA 4FCVA 3M3DA 3RBZA 1MPXA 2OORA 2RCNA 4EFLA 2IQIA 5CIQA 2GLXA 4KXNA 4R8KA 4Y7DA 1EMDA 1FMTA 1SVIA 3L0DA 3JQ8A 3NNSA 4E22A 3VZRA 4EJSC 2XYRA 4ZCSA 16PKA 5JNVA 2HI0A 1SH7A 2RG1A 4RFSA 2BWJA 5IF9A 1OFHA 1IPHA 3ZJUA 4F3CA 1WCWA 1QRTA 3BULA 4RU1A 3WJAA 1IBKB 4OHWA 4WKPA 2ATEA 5HA5A 4Y6LA 1MFZA 1XE3A 1XN1A 5F12A 3CKKA 4WY5A 1O77A 1SCKA 3TQOA 2ZAIA 3GJZA 3W79A 4FCCA 1AO0A 2BZ0A 4CTKA 1XNJA 4OMCA 5B4VA 1CT9A 1HE5A 3K5HA 3QOYA 3O9MA 5BPFA 3EUEA 3P9KA 3AZQA 3W5AA 2L18A 4EKGA 1E5QA 1NLFA 4UASA 2IZ1A 3MXTA 5CA0F 4ZJUA 4RVFA 4G56A 4R5HA 2ZRJA 2DE0X 2QAGA 3CF6R 2C5SA 4D8TA 5FRDA 5FO1A 2YOGA 3U40A 1L7AA 4IGEA 4XLTA 5ALHA 4WD3A 1RDFA 4WKNA 3C1TA 4F4UA 4IGIA 1UK9A 3GJ8A 5EKDA 3MJ4A 2AK3A 3S5JA 4B40A 3OCCA 2BE9A 3WL5A 4DYVA 3ZXXA 4OIFA 1W2GA 3S40A 2XODA 3NASA 4TTVA 4G09A 4ZQEA 4L9SA 1TF2A 1S8FA 2AXNA 1VA5A 3E82A 4P35A 4J1QA 2YS6A 5SY6A 3ZZNA 5JAPA 3UCEA 4E21A 3RHFA 3E5NA 3KQUA 1GQYA 1KMQA 1SZDA 1PLJA 3FWNA 3NWOA 4TKVB 3V5NA 1M8GA 1XMVA 2VSXA 3WLIA 5AVOA 1K4MA 1NGSA 2WTEA 4EEXA 5HQJA 3ZDEA 3AHJA 4Y6PA 1WAMA 5I7VA 1Q12A 3D3EA 1VMIA 1KFKB 1PHRA 2P4SA 3NM4A 1M2WA 4JAVC 5FBHA 3V34A 4PLWA 3UHAA 4I1OA 1T5DX 1RQXA 4YI5A 1PEDA 3PQCA 3S2EA 3FPHA 4N8SA 3HSSA 2ZROA 3N28A 4GW3A 2GXQA 2O2YA 2OHOA 1FQKA 3CQ9A 5IKPA 5K20A 1JQBA 5TPWA 5BRAA 5JZOA 3ER9A 3TFWA 2FGKA 4D4KA 4D98A 3G68A 3OMLA 1M7GA 5AQ1A 3G89A 3PFIA 3FNQA 2L0XA 4JJIA 3SMQA 2PNJA 3P9NA 1E2NA 1Z4NA 1JPUA 1QHEA 5EJ9A 3UK7A 4OLHA 1HMYA 4PX3A 3OZWA 3BMQA 2HIGA 4RY8A 2XYHA 4TLAA 3DBHB 4LOHA 1V37A 5HMMA 1QQBA 1YBVA 3A27A 1HX7A 1TTTA 3RRJA 2MYUA 1DCFA 1JTEA 3U6BA 2ERYA 1EK1A 3FYUA 1GQQA 1DKLA 4BMYA 4EHAA 3AM5A 3KT6A 1OB2A 3AVXA 2O8BA 1O5IA 4PBSA 3KKZA 1HY3A 1G8HA 1RLJA 4LXYA 2GZ3A 4MWEA 5AXDA 3ABOB 2OGZA 5ECGC 3SC4A 3EFOA 3KV3O 3LX4A 1Z3IX 2W4QA 4PCAA 3GT0A 3CG0A 3IELA 5A3VA 4CKEA 3IBYA 4RIFA 4Z1OA 2NQ2C 2R2GA 3RS0A 5BT8A 3B85A 5AW5A 1ZHOA 4IYJA 2PKCA 3PNQA 3JS5A 1ZGAA 3TTTA 1QG6A 1VCIA 1ZIPA 4P84A 1MXHA 4RHEA 4NPCA 3QEAZ 3MD9A 1NUSA 5K6TA 3VOBA 1NLMA 2ZB3A 1ZUD1 5ESWA 3U49A 1DBWA 3D6VA 1DKQA 1T0HB 4S1WA 5IAKA 3MTDA 2ZRFA 3OZAA 4KGXA 4ZC1A 5HFJA 3T94A 1N1DA 4FP9A 1LVGA 4RDCA 1DJPA 2AH5A 2WWXA 3B5EA 4PE5B 5K3SA 3WDKA 4IUYA 4E1BA 1VTKA 3C8ZA 1SJ9A 3LBNA 3CR3C 3NDRA 4JBHA 4IIGA 4LVOA 5LA6B 1S4QA 3W9SA 4XR4A 3K9NA 1GQFA 3PNKA 4LQDA 1FNNA 3W1WA 3B20A 5KTTA 2VWPA 1ZCFA 3Q5DA 4O4IF 4PHCA 2C8KA 3AU9A 3NOVA 4DBZA 5CDSA 3PD0A 1GZUA 3IEXA 2QNRA 3PJDA 4A1FA 1TAUA 4M76B 5DM60 3FPCA 1TU4A 2C97A 4Q3OA 5DE3A 4KFSA 1VDZA 4BQIA 1KI1A 1X3SA 4NMXB 1LX6A 3UMBA 1TVEA 2CB9A 1Q1EA 4YUXA 1KK1A 1LPNA 2VP9A 1CUFA 4ZXFA 3RUIA 4Q3EA 2HCFA 4RSGA 3S8MA 5FFNA 5E0OA 4PPGA 1ODJA 4DREA 3LT4A 4L5AA 1ZEJA 4FYYA 3ST7A 1M5UA 3VKWA 2FZGA 4LTDA 3K0CA 2QTFA 4IUBS 1LRLA 1M2HA 5IXSA 3IIEA 4PAGA 1Z83A 3SVTA 1LSSA 3ZW8A 1YVRA 2IYEA 3CMCO 2JCSA 2A5DA 1HZJA 2JFXA 1ZUHA 1NSYA 2PBRA 1YR2A 1ULBA 3DOJA 3FI0A 2FSUA 2V0CA 1VLZA 4MYDA 2X0FA 4F2PA 2QE6A 4ARCA 2FDRA 1HTBA 2Y1KA 2VIIA 3K09A 1H22A 1MO6A 1WXWA 1N36B 3I5XA 3IOYA 3GN1A 1GSOA 1Z2NX 4YIHA 1GG9A 1WDKA 3LLSA 1HDIA 1ZMTA 5E4FA 5EWMA 1XCOA 1WXFA 2ECKA 3NZEA 4QIHA 5CK4A 4NOKA 2DR3A 1RSZA 1DLJA 1GGKA 2LGJA 4MEAA 3STUA 2GHTA 2QT1A 4U2KA 4ACAA 5GJBA 2ON6A 1ZD3A 3L18A 3DULA 2FJPA 3GGDA 3SIXA 4PO3X 3LIPA 1L5HB 5J2UB 3UZUA 1PJTA 3FSRA 3JYNA 3KVYA 1T25A 5ETJA 4RM3A 4KUEA 4TMXA 4OKSA 3TTYA 1T29A 2I6TA 5A4AA 5ED4A 4P81A 2BFEB 4RXMA 4CFYA 1BX0A 2C59A 1E2MA 1JSXA 1Q14A 3G6KA 3KDAA 3OUZA 4KR0A 4QDKA 4RK4A 1ZSNA 5J23A 1Z0KA 3M6IA 2AYZA 5G4KB 3V1LA 4DA9A 3AB7A 3HJUA 3NHKA 4FHGA 2RK6A 5AI4A 2YQ5A 1UBFA 3A4IA 3EXEA 3O3OB 3R6DA 3T5DA 5BORA 4ABYA 5T8KC 2WSMA 2BGRA 3WGQA 1SCUB 3GROA 2HJRA 3I32A 4QFMA 5KINB 3MOSA 3ZBQA 3KOYA 1XTJA 4BRWA 3FWKA 1KNQA 1ATIA 3OT1A 3UPUA 5CHEA 3TMKA 2EF0A 4GPTA 4OQDA 2XB2A 1CNMA 2ZT7A 3NEPX 1UJBA 2ZE7A 4P4UA 3HZZA 1EPUA 4YQYA 5C0OE 1E94E 4FYXA 4C4YA 4KITB 5A4KA 1Q21A 3GFPA 3K70C 1PZNA 3I8SA 4DMGA 2L2QA 3QJGA 3ASZA 4OMDA 4K1LA 4PCLA 4WLEA 4CWAA 4YCNA 2I5PO 2FN3A 3OCJA 2BGTA 1G0OA 1FDUA 1HEUA 1KSFX 2EIXA 4R69A 3D4LA 4OHVA 4A27A 3NT4A 1ZBQA 4H9GA 1FX1A 1KZYC 1RM3A 2W58A 2WTAA 3JU3A 1W1IA 3LQ4A 3SEZA 4TQAA 3VM6A 5JQGA 2QYSA 3OAAA 2IHZA 1X3LA 3JD3A 3PX2A 4NAHA 1JB1A 4NZOA 3LHSA 1TJNA 2YH2A 3IE2A 3L7AA 4G63A 5JVDA 2OL4A 4EVRA 2HUPA 2FPIB 1T8UA 5DEIA 1T6NA 1NZDA 1VECA 2QG6A 5B7NA 5ES4B 1COWA 3THYA 4LF5B 3GDHA 4N76A 5FA6A 2X8JB 5F77A 4F3NA 1JVNA 4KCGA 2AOUB 1U8FO 1RKQA 1F4VA 4YP9A 1BMDA 4FLMA 1KPGA 3DR3A 1BCSA 4G5SA 4O4JF 4FHZA 1KOLA 3ZGLA 3AI2A 2IC5A 3H4IA 1SCIA 3FTQA 1SEVA 4G5GA 4PAWA 1A9YA 1F38A 5HJ2A 3QTLA 3DE0X 4F46A 3LBAA 2ZAOA 2C2KA 2ZK7A 5IKMA 5A5VA 4AMUA 1JIKA 3U4QA 3OHPA 2C4VA 3G17A 5FT9A 4QBFA 4QYIA 2NLOA 3G5TA 4G1UC 3DVAB 4UMEA 1W88B 1WXQA 3DV2A 1R0YA 4CYMA 4FBMA 4D3FA 3NHFA 1GQSA 2OBLA 3PD1A 4I7EA 2FX2A 2JDID 3VGJA 3TOCA 2NXNA 1FXWA 3QITA 4GG1A 4RXTA 4CBVA 4HVCA 4D0SA 5KYXB 4X1IA 1U3DA 3FKSD 1TT5B 4IDGA 4MVYA 1G6KA 1RT9A 4RTOA 1XMJA 4I5GA 1J99A 2RHGB 3NGLA 2C1XA 2O23A 4FD3A 5TGDA 3EF0A 3QI2A 4HFJA 3K4QA 2D7DA 2QBYB 2C03A 4I14A 4CV2A 2QY9A 4OX9B 2XUIA 1V71A 4CTNA 2NSJA 2QRGA 5AQEA 1R4NB 3JASB 2XQKA 3F49S 2QL6A 1JB9A 5DLQC 3GRYA 2Z3WA 4CMBA 1FTNA 2RH4A 3RUCA 2YMLA 3X1KA 3VR1A 1KEEB 5DXFA 3OHMA 1C8LA 4AZVA 2ORED 2ENWA 4JEUA 4ZJZA 1V1RB 4DIFA 5J5CA 3KVVA 4RTMA 3KV1A 3TRJA 1WPXA 3GFOA 2DWUA 3KJHA 1P7VA 1U6IA 1XMOB 1XAIA 2WUFA 2GYYA 3R0JA 1U0BB 3QUCA 2P3SA 2IYVA 2JBAA 2JGLA 2VUIB 4KDRA 2C9ZA 3GVHA 1B42A 2CD9A 2RJOA 3EZGA 4JMPA 4QOGA 1M1XB 1MJGA 2L69A 5BWOA 4Q6BA 5JCOC 1E2BA 4PBTA 4UNRA 5KPJA 2C0QA 4O8CA 3AP1A 1F51E 1VOTA 4KAJA 2BFPA 4US1R 2OPHA 2G8LA 3UXEA 3B13B 4ZAZA 3W7BA 5HOQA 4RIEA 5B4UA 4HNQA 4OK6A 4RJ2A 4DUGA 3OJWA 2AC4A 2JFGA 2JLUA 3JQAB 3MWDA 4H27A 1PZXA 4XRGA 2GEJA 2H63A 5A6SB 5C46F 4LBZA 2C5LA 4G0MA 3STTA 1E8NA 1W4ZA 2C42A 2XSZD 4NR0A 5FIUA 3REFA 4KB5A 4BO4A 4EARA 4FM9A 4B45A 2WJWA 4P3YA 3WGTA 5SZJA 1O5OA 2X0IA 3PIRA 4KDCA 1CF4A 5DGIA 1KO7A 5I9SA 1WCXA 3QMWA 2X76A 1NLYA 3BSWA 4KK3A 2XMBA 3IA7A 1GTG1 2XA2A 2Q3JA 3KFXA 3R3SA 3TB6A 1CQXA 2NIPA 2W7TA 3OF2A 4V02A 2GD1O 4QT4A 2FPGB 4INPA 4IZIA 4OL9A 3QEOA 5TVKA 4QXPA 2M6LA 3RH0A 1X38A 4YRGA 2HMSA 3T99A 1KK2A 2IYWA 3TRDA 4R6WA 1L1QA 2ZYRA 1QONA 4OYYA 1SKYE 2Q4TA 4H08A 4TTRA 2CXUA 1PR4A 3GOQA 1GCAA 3HDVA 1V11A 1XTIA 2A3RA 2DSTA 2R6GA 2QG4A 3K32A 4LJYA 3CW2A 3SYKA 1U28A 4PHFA 2SCUA 1KERA 2HJWA 1CR4A 1Z16A 2Q99A 4N3BA 4PYRA 3C98A 2XUHA 2PEZA 3TJMA 4G25A 2J0EA 3QX7A 5BW6B 4KWIA 3GU3A 1F2TB 1ZGZA 4BVLA 4EUFA 3AR9A 3E0XA 1A7AA 1K1EA 2ZBFA 5BQXA 1EAMA 9GPBA 1NJ2A 5EUMA 2V59A 2LP4Y 1GLVA 3P9ZA 2ZJ8A 4OKIA 4R84A 4AZ3A 4FDUA 2VSNA 4N01A 3RI3A 2DHCA 4UREA 5BQ5A 4PQGA 2D7CA 1JQKA 3H6HA 4COKA 3FFBA 4X8LA 1XKLA 1P73A 3G0GA 1SMKA 3FNHA 3CURA 4CNQA 2WFZA 5AK0A 4CKZA 4JENA 4DLBA 4C7OB 5I3CA 3MJHA 4EG8A 2J31A 1QZTA 4TQUS 4C6TA 2B8WA 2R60A 2UUOA 4FGSA 3I58A 2ACWA 3AR7A 2ZU0C 1AKUA 1E2EA 3EG5A 3EODA 4YJFA 1QH8A 3G6WA 1U2DC 5I7HA 3JQ9C 2ZFUA 3IPYA 1PZGA 5TARA 1VIVA 5IH3A 5LFAA 4HVLA 2PXCA 3WP0A 3K9GA 1BQ4A 1MNAA 3DE2X 4M9SA 3NCTA 2BYTA 2I2XB 1E0AA 4JLUA 4UNQA 4PLGA 2Y77A 4JN6B 4CXMA 1HYHA 1NV8A 2IUTA 1BVYF 1SR8A 2HO5A 1TZJA 5CUQA 4G86A 4DVJA 4W5HA 8OHMA 3O3NB 3R0XA 2XVMA 1WVMA 2RGCA 3H7AA 4FYKA 5K0BA 1YGPA 1Q16A 3I6IA 2X9QA 3K31A 2N1MA 3OPYA 3ZUGA 4MTCA 1JZTA 4QWMA 2XUQA 5TPZD 1GZDA 3HEBA 5F51A 5K09A 2JJMA 3C3KA 1WUKS 2CVZA 2VNKA 2PUCA 3HJFA 2PY6A 4IQ8A 3F6RA 2ZVDA 4ZVMA 1JBKA 3W6OA 2ZUBA 3SC2B 1XNGA 3CX4A 4N3AA 3VX4A 1IY0A 4HDRB 4HFNA 1NF2A 2NU6A 1Y7IA 2PQ0A 5IT9A 4ZOQI 4EGSA 4M4SA 1DC8A 4QGBA 1L2TA 4F4FA 1O1YA 4JVOA 2WMYA 3JWEA 4JBIA 5KSYA 2CV2A 1P2DA 1QP8A 2B9EA 4PZCA 2ZSHA 4UM8B 2DUNA 2JD1A 3G8BA 3QUQA 2Y1LA 5HKLA 2HMAA 1M5TA 1PS8A 1U1IA 4OUKX 1EFHA 1MENA 1P0MA 4P58A 1J1UA 3BAFA 3QWFA 2ST1A 2ZSFA 2ZUDA 3GLQA 1KAEA 5THQA 2F8SA 4E07A 4H1VA 2C58A 3L2OB 1QP7A 2POCA 3OPQA 3PXDA 2QLLA 3A26A 1TMOA 3V1YA 4XVUA 2H7CA 3D3WB 5ENDA 5EYPB 1PCXA 1XRLA 1ZD2P 1QNLA 4HLNA 1JGTA 4LYYA 4W9RA 5INTA 5F76A 2V6IA 5EQFA 3P0FA 5AUQA 2BCGY 4W7HA 3T9AA 3COYA 1RYNA 4XJTA 2R8PA 5GQSA 3MIIA 2XXBA 5IVKA 5ADWA 1R50A 3RLFA 1L7EA 3H0KA 5LJIA 1IXSB 1YR1A 3Q7QA 2D13A 1WHSB 5JSFA 1JKIA 1QO0D 3KL2A 3NPMA 5DW0A 3UC9A 4CKWB 1RI3A 2AN1A 2Q9BA 2WHYA 2OXIA 4U5QA 3OSUA 4IXWA 4PLHA 1A8UA 1LDNA 3LT2A 1C81A 3AF5A 3HSKA 2P0AA 1BJKA 3BWMA 4K6KA 3PZBA 4KW7A 4JLPA 3U5ZB 3G2LA 3ZCSA 3D6UA 3TLXA 2CNDA 3W8RA 4JJZA 1UPCA 4UCWA 1TADA 1P45A 2HZBA 5H4HA 3S2GA 5CIYA 1S1MA 4B82A 3HNRA 1TLTA 1VKRA 1JKJB 3DWFA 5EE0A 5FUBA 4BEBA 2HCTA 4YJGA 3RANA 4Z8XA 1GQ2A 4GUDA 1EVYA 3TAHA 3JQDA 3LV8A 3UWDA 4Q34A 2HJSA 3VUFA 5B58T 4EW3A 1DS6A 1X0VA 4XASA 5HOEA 2K6GA 2CBZA 2QA5A 3NP7A 1JDSA 5K0SA 3G82C 1P75A 3RBVA 4E2WA 4EHKA 1BNCA 2Z2ZA 5JBNA 5KWSA 1VXRA 2XF2A 3EJ6A 3WQSB 2C7VA 5LQMA 2A0XA 5DLPA 1SEPA 2GBIA 4TL7A 3SMVA 5H70A 5EIEA 1PV4A 4XWOA 3QEJA 1J97A 2LVBA 1GZ6A 5BN5B 4XCVA 4OGKA 3ZU6A 1USUA 5EUCA 4TUYF 4HDNB 3PSHA 3OCYA 4RTKA 4F56A 1XKXA 1OXMA 2G67A 2I6SA 3TMYA 3N7UA 3UW3A 4K88A 3K9HA 5B1IA 3EXFB 1Y6ZA 1UKEA 4YMSA 2HJGA 3AI1A 5ESXA 5K0EA 4E1AA 3WYAA 4L15A 4EO4A 1DZ3A 1RHMA 4B6QA 2PKRA 4KNWA 1N6IA 3LL7A 4ENTA 1F7UA 1OXTA 1Q0LA 3A1EA 5KNBD 2I87A 4JJKA 2ZW9A 2VJOA 2W8ZA 2X4LA 4L85A 2CHGA 3QHPA 1W44A 3L8YA 4WKBA 4CW7A 1A71A 2VEOA 3LA8A 3LVFO 3HDHA 5JBQA 3CO5A 4TT3A 1SUDA 3DE4X 4QYWA 1UBHS 2B0JA 3TE6A 1L7QA 2XGGA 3HGTA 2BM0A 3EXHA 1DQPA 5DT9A 5BT9A 2C1EA 1E79D 3KR0A 1XTVA 4BV9A 4DG5A 4RL6A 1G6HA 2MT9A 1DAHA 1DUIA 2FMKA 4L2IA 2NPFA 4CUKA 4CQMB 1CRWG 1A4UA 1XWWA 4GGMX 1OTYA 2NQTA 3PGKA 3DXZA 4IDBA 3S55A 5BR8B 3F7MA 2IXFA 2PUFA 5IBCA 1QIKA 2J9FA 2BTOA 3IUNA 3O95A 3PBKA 4Q7LA 4IMPA 1JH8A 2BV3A 1NUUA 3KRTA 3VQTA 5IM4A 1IXYA 4UBIA 2FWRA 1FTWA 4DV4B 5IAGA 5EHGA 3RBAA 2ZYSA 4R01A 2ATVA 1T15A 1JQEA 4M7RA 3LP6A 4I0WB 4YRAA 4ARAA 4BFTA 4F9TA 1HL3A 3ICWA 5EMNA 3CXRA 2DFTA 1N2HA 2A1UB 2JS7A 2UZ1A 1RYBA 3ZLJA 3SICE 3CSSA 2LBPA 5JS7A 3N8KA 3JAKA 2I91A 5EVCA 1U0JA 4WXMA 1E4EA 3HWSA 3I9OA 3OE1A 4XB2A 3HV2A 1CVRA 1EK6A 1WCIA 3FMFA 4UBMA 4EAQA 3IJ5A 3UENA 1PQUA 1XD8A 3MGGA 4J4TA 4UPVA 4COOA 3RYCB 1TQ6A 1R4MB 1ZYUA 2B0CA 2ZRAA 3BE5A 3BM5A 3NANA 5EY5B 5A1TA 3QE4A 3VISA 4NFYA 3U80A 3ZE9A 5IWAB 5A4MS 2NUAB 2ZREA 1XVAA 1QKJA 2OC4A 3I0ZA 2HCBA 2PLWA 2QN3A 2E89A 4GPAA 2X9LA 3L6UA 1T8SA 3HQ4O 3QQPA 4RA9A 4WL0A 3MWLA 2CLLB 3W4KA 4DV5B 3KKOA 3OLVA 4UDYX 3MFQA 3SBEA 2XUPA 4ZALA 3QIAA 3PA8A 1EKXA 1PG0A 3NIFB 2BFBA 3H9BA 4O2AB 4TPKA 2J9XB 1HC7A 1ZK3A 2QGNA 2WOJA 2CXTA 5BXQC 3T5AA 4B2PA 3EEOA 5JNLA 2P4HX 1KNXA 1YJBA 3PI6A 3KUCA 2EXXA 2IZZA 3OU2A 5JDIA 4YP5A 1K2VN 3MAJA 4DSZA 3I0MA 1W5TA 3AGQA 2J67A 2P11A 1HURA 5DV9A 1PVOA 1HFJA 3AF6A 2OLJA 2F4VB 1ISFA 2R5NA 3VDXA 4CL8A 4GIBA 1QR2A 4MKHA 3VU9A 1BA2A 3CLUC 4DV3B 5DXJA 3OOYA 1IM5A 5EP1A 2Q7XA 5IPFA 1ZL0A 3GFGA 1E9RA 1SQ5A 1H42A 3LVQE 4G67A 4Z3DA 5AVQA 2LCFA 4BMDA 1GAEO 2O59A 3SOZA 1U02A 4RVCA 5IULC 4FIDA 5AKLA 3DE3X 3E18A 5GIOE 1MHTA 4BPBA 1XTRA 4L3VA 3Q3EA 1PW7A 2GZAA 3QE0A 1KFBB 3KZNA 3H5RA 3CR8A 1GIAA 6ABPA 1A04A 1W5BA 4V0RA 2C99A 2F1OA 3O75A 5AJUA 3IX7A 1FFWA 2RBEA 2VK8A 3VKUA 1YJAA 2OXTA 4IFTA 3R9KA 1XVLA 2DY0A 4IJ6A 2GXUA 2AUTA 4LY9A 4MUGA 2QXYA 3BIOA 4QYMA 4O8ZA 4AUEA 1JHAA 1MA3A 5LC1A 3UOWA 1GJRA 3MWYW 5H9WA 3JRNA 5G0WA 3L79A 4DPMA 1TMKA 3M7IA 3ELYA 5BSGA 3KHTA 2QW0X 1P3DA 4XGIA 3I04A 3IULA 1Z5OA 1B0AA 3ETNA 4NOLA 2EF1A 2ZR7A 1QVZA 2F48A 3GMTA 4RK7A 2ZTHA 5E2BA 4E5VA 2OZKA 2FPLA 3ZH9B 1TEHA 3SJZA 2VS1A 4YQEA 2EWVA 3NORA 3QU9A 2P40A 4HQFA 2CXOA 3JQGA 3JYPA 4UU1A 2I2WA 1MOPA 2H9AA 5EPUA 2F9LA 4QPJC 1NBAA 3TUIC 2CZCA 2JJQA 2JRLA 3CZ4A 4I8XA 4Y1GA 3U0VA 2FZ4A 3RIGA 4CM9A 2FZKA 1PK7A 5CXXA 3UMJA 4Z4EA 5HKKD 1LLFA 1YCDA 4EPYA 5IC5A 5BNIA 1N77A 1Y3BE 3IDQA 1YTUA 1QLJA 1Y1RA 3TCKA 1UMDB 4X90A 4GKBA 1XPRA 3M4XA 4LECA 4MROA 2OSBA 1U90A 4ZJYA 2BCEA 5A02A 3IV7A 4B4OA 4CN8A 4DARA 5B1EA 5BWBA 5D3ZA 5BMOA 2HRBA 1JHVA 5NLLA 1IZ9A 2VQDA 9LDTA 4ZZ1A 1OJ7A 1RWKA 1S89A 3T9CA 4BLPA 3CN7A 1I4TD 1Q0UA 3UQYS 3EULA 4UU0A 3I76A 4TMTA 3SFVA 3QVWA 2I2CA 4GR5A 4ZDWA 3JW8A 5KYKA 3EIOA 3C7CB 1FU4A 3AO0B 2IP4A 3KVRA 1GU1A 1NVAA 3JPYA 5IKOA 2V8BA 2ZJ2A 4TYNA 1ESEA 4A73A 3VPAA 4Y1FA 3TDKA 2WJAA 3MQFA 3QPUA 4JJEA 1VHWA 4ND2A 2RHLA 4FZVA 4LHSA 5AO9A 2R5WA 4F91B 4RDHA 4DHEA 1V39A 2J3MA 1RPNA 1XQ6A 1RCFA 1JI3A 3ZWMA 2GF2A 5BW5A 3OZGA 3K70D 3VPBA 1XYVA 3BXXA 2VXCA 1HO3A 2IBTA 3ONNA 3R0QA 1CPYA 1QHGA 4V03A 4YJ2B 5AWFC 1L4EA 3DHNA 3V8MA 2E6KA 4NENA 2HEIA 1CY8A 1N2BA 4ZV9A 1Y8ZA 2ARKA 4XPIB 1KO8A 1L9KA 1Y1PA 5D3MB 3V9AA 1C14A 1FTSA 1KHTA 5JO0A 2B4TO 5D51S 3COPA 4ZOLF 2Y9PB 4JEHA 2BSQA 4JI7B 2NZUG 4NKRA 4HAIA 4ZVKA 3BWVA 3LBFA 3FE2A 4R1LA 1QQTA 3OIYA 4UAVA 4L6IA 2R8YA 1KR2A 5LXTA 2JI8A 2WVGA 3BK2A 1SC3A 1C3VA 1VBFA 2O2GA 2F3RA 2QMZA 1JT9A 2CLKB 3BJEA 4GSLA 5FWXA 1UFVA 2CNBA 3RRNA 4BFLA 2WUDA 4Z0TA 1F1JA 3A6JA 3LBIA 3I01M 3EPHA 4R6XA 4L78A 1ABEA 1HDXA 3L82B 5JCXA 5ALEA 4JMLA 2FI1A 5BOSB 2FOXA 2TMYA 3FVWA 3KAPA 4OK3A 3P2MA 2FG7C 2MMGA 2C2HA 1M2GA 1RAHA 2ZBVA 5FPTA 2KPOA 4TM8A 2GA8A 3G2JA 2NZ2A 4HDSA 2R6DA 4IAOA 4NCXA 4U0KA 3S3TA 2QROA 3BDIA 3BMNA 8ABPA 5F64A 2O3UA 2DP4E 4B44A 5A3JA 1QBGA 4MIEA 1UWCA 2JFZA 1PGQA 5KTYA 2CXSA 2PAAA 2CGEA 4B5KA 2WIJA 5HHTA 2ODNA 1YUMA 1XA3A 2I6XA 4XARA 3QW4B 3T9DA 5LLTA 4DB2A 1T4CB 4MRPA 1EINA 1PL6A 3LLMA 5SV2A 2O0KA 2LW7A 1PUXA 2RC5A 4IJVA 5A9SB 3B1ZA 5I9LA 3QTTA 2BEJA 4DCPA 3L7LA 1L5RA 3SM9A 3W2TA 4HMPA 4OREX 4BVKA 2Q3EA 4LSGA 1SKAA 3C8MA 3OM1A 4LZNA 5KYUA 3F2VA 3TS1A 1O89A 1ZH8A 3EUAA 2I7XA 1T9DA 2AS0A 4LV8B 1PR9A 5G4LA 2Q6VA 1Y89A 1QNFA 3FXAA 5JO9A 4BNIA 1A72A 4ITRC 5IRCD 4EX7A 2OV1A 2FWPA 3IS3A 2XBLA 1KH1A 3SDZA 4ZEXA 5JSZB 3GLGE 5LL6P 2MYTA 5EJEA 3HO8A 3R7LA 3FETA 4DGQA 4X65B 1I94B 2V6GA 5C1OA 2VDQB 2H5JA 4JKIA 3PYMA 1TA0A 4NG5A 3K6JA 4QUEA 2JFPA 1EG2A 1KP2A 5KYVA 4WZAB 4PZZA 3ESCA 1UMBB 3CWZA 3DE5X 3F9CA 1Q2UA 2QMOA 2AK2A 4CFSA 4H17A 4FD2A 2CHQA 1QH9A 1BXKA 2PL1A 3DE6X 3HO6A 1TKRA 1ZD5A 3KVOA 4WXEA 2DTEA 1QP4A 2XQVA 2B7LA 2W48A 3HBMA 1UPFA 4ND6A 1OVGA 1F2UA 2QTMA 3HY3A 3NTOA 4LC9A 1MD9A 2ZJZA 2GAIA 2I80A 5F3DA 4Z1MD 1BKSB 4JWTA 1P18A 3UUEA 1E1QA 3TM4A 4WEQA 1RYZA 5K0CA 1YL7A 1H69A 1GTL1 3DLCA 4KNVA 3W5DA 4X60A 1C1YA 2RHWA 1KYYA 1SNYA 2ZB4A 2C92A 5ULLA 3RAJA 1PJBA 4J0CA 4HF7A 5F1PA 4EBFA 2BGJA 2Y1DA 3K6SA 2WD7A 4NU8X 3TVYA 2FN8A 4HWGA 1IZ7A 1SVWA 5DK6A 2C29D 5AESA 4F3RA 3EGIA 1YZYA 4HLDA 3ZD8A 2G9UA 2NSHA 2NYVA 3DTVB 1MDFA 1XEAA 2I71A 3H05A 3LP8A 2FSGA 1I5EA 5COQA 3RIXA 1WS6A 2X1VA 5K4AA 2IXDA 3G2KA 3LCUA 2ZPUA 2WIKA 1VA4A 4MKFA 4U7GA 4OGWA 1EFAA 1LS6A 2ZBRA 3T7TA 2UZ0A 5CT9A 1RFGE 2J45A 1L4LA 3P71T 4QYTA 3R6GA 4EKYA 3QHAA 2GTHA 3S29A 2I4MA 2R97A 3PRJA 9LDBA 2XWBF 3H1GA 3K3PA 5KKAA 3FG9A 4H2DA 4B4VA 3WL4A 4D97A 3F8SA 4WNAA 2VRCD 1LPPA 2Y1XA 3STYA 1K7SN 1V1MB 1NBMD 3FFAA 4KRFA 3Q9UA 2GPNA 3MRTA 1MZVA 3GGJA 2UYGA 3T1HB 4KQEA 2I78A 1R0XA 3AH8A 4HH3C 4KR7A 1I2AA 1O96A 1H1LB 2FK8A 3LOUA 5K2OA 4GLFA 4AKTA 2VNAA 5EZSA 2I55A 4KVFA 2BF7A 2BFDA 1ITZA 1C29B 2LUOA 1JAXA 2DBYA 2P1DA 2Z8YA 3G2PA 3OIVA 4JDUA 3TD2A 2FR8A 5AXAA 3UMSA 2QP3A 2OKCA 3VUEA 3VU1A 4YRBA 3NATA 5E3IA 5LQNA 5A7FA 1OIXA 3KHUA 3DOFA 1SWVA 1Q1AA 4RKFA 4W8GA 3II6X 1JTFA 2G6TA 4DA0A 3ZKAA 4UQLA 5DIZA 4I4NA 3BZWA 1M2FA 1D2NA 4IIUA 3WV4A 4A2PA 1MVOA 1RM5A 3HUEA 5CYFA 4YT2A 4EJ2A 1BSVA 2W11A 2C4WA 3WNCA 2CLOB 5I47A 4F3TA 1T36A 2B37A 4AICA 1KYXA 3EVBA 1JNYA 3A6GA 4IL5A 3C24A 3L0OA 4F3YA 5AI9A 3FTPA 4BCBA 3BGWA 1JG7A 4CEJB 1MABB 1AGYA 3OLWA 4OSPA 5LP6C 2DPXA 2XDQA 2XOXA 4EZEA 3H5NA 2GZRA 4UXHA 3TG8A 4GYJA 2HQRA 4W8OA 3WKAA 1JEOA 2NX2A 4NONA 2TECE 1WBBA 4ARUA 3EXIB 4IILA 4UHHA 2QKYA 4YFYA 3TGWA 3N0XA 4Z4QA 3KX2A 4GFDA 4X91A 1X7XB 1ZZGA 4H18A 3PRKE 3H8SA 3QTBA 5CX1A 4Q7QA 5K3EA 2J5BA 4MUKA 1SKMA 4I4TB 3FWZA 1Y7TA 2AJTA 2OXRA 2JKVA 4L7VA 4S2UA 4XDZA 5MHTA 4UTVA 1BC5A 1FLVA 1CUYA 1CQZA 5JJIA 1OCEA 1TEXA 2PJZA 5IW8A 3ZH2A 2FRDC 4DCVA 1YF3A 3ZE1B 1TX4B 1T2AA 2NP7A 1E6WA 3UAZA 3CSDA 4E6EA 4CFZA 3SZ3A 4ZT3A 4RTQA 3RRYA 2YW2A 4E08A 1E2KA 4UBKA 4B73A 3GO4A 2OAGA 1QE3A 4NCIA 2DFKB 2HU2A 3GLRA 4LVNA 5AD1A 2OZVA 3IODA 5D5PA 3C7TA 4ARZB 3DL4A 2EQ5A 3PNVA 1R6TA 1Q6ZA 1I14A 1E5DA 1D2AA 1I51A 4LRUA 3GLUA 3BBPA 2GI4A 2X7JA 3HS3A 4GL4A 4UVIA 4BMVA 3RG2A 4YUYA 4TLCA 1NIJA 4HEQA 5I5GA 4RMJA 4ZAWA 3VVCA 3OQOA 1Q95A 3GLFB 4DSUA 3FMGA 4M36A 2QL9A 1SG6A 4PYJA 1Y48E 1ZWLA 4KLZA 2AFHE 2XVZA 3IT1A 2Z2XA 4WZ6A 4R9VA 2NUTB 2EKBA 4WBNB 2ZUVA 2GDJA 2WV9A 1N2XA 1RPJA 3N3AC 5FADA 1ABFA 4KFUA 1V41E 3GP3A 1L8XA 5TE9A 5B1YA 3EDYA 5B55A 1JG4A 3SQLA 5FOUA 3DBIA 3QV1A 4PC2A 4DLNA 4PWYA 3CZRA 3LBYA 2WMNB 2O8CA 4M8IA 2C3PA 1CJSA 1VGVA 2XE6A 1OLXB 2AFVA 2Z3VA 3DB2A 3K2EA 2GEVA 4ZHQB 2O8FA 1W2HA 4Y1EA 2YMQA 5CW2A 3J81A 2VSYA 1ADGA 3I5YA 4D0NA 1ZX1A 1G1AA 4REQA 1YQXA 1E0JA 2O1WA 5L4NA 4GOLD 4JC8A 1ULZA 1OD6A 2VZ0A 1LA2A 2Z2IA 1IMOA 5IAJA 4B3DA 3QX9A 4LRQA 1WKCA 3AHDA 4DT1A 4UJ5A 1XDGA 3Q9NA 3WBKA 2CVFA 3HM9A 1GVNB 1T2VA 1AF7A 5FTWA 3GNSA 3R3VA 5TMEA 4GC9A 1UT8A 3VPDA 3CVXA 3FR8A 3DKPA 1F3LA 4B6GA 3I5UA 1KYZA 1H93A 3MFYA 4MAAA 4QASA 4REOA 3U3JA 2D0IA 4E14A 3JRXA 4LGCA 4O63O 4BRZA 2H4ZA 4G0YA 1KSJA 2IZOA 1AVTA 3LX8A 5ITWA 2X1HA 3DLHA 3TLCA 5BWMA 1YDMA 2RGUA 4KH1A 4MP8A 1P77A 2WIAA 1WY7A 3L7CA 4LMRA 4UTOA 2VTKA 4XX0B 5CFRA 2JIPA 4RTLA 5A62A 1D7OA 3JYOA 3SYTA 2G5CA 4UVGA 3UT6A 3GZNA 5FEUA 1SXGA 1RHUA 2J08A 1Z38A 3E23A 2XCSB 5T41A 3G2NA 3HSYA 4YJ3A 3GIDA 1QX4A 1CJBA 4ZP1A 2OCXA 5JDCA 3DLPX 2V65A 3Q7IA 3U0BA 5KDDA 1EZ1A 3FYDA 4EW6A 2QQ0A 3PXUA 4EHHA 1T2CA 4L4SA 4RHYA 1Y34E 4Q1VA 5AJHA 3W6NA 1FK8A 3D7MA 1FP2A 3K0AB 2OCAA 4U7WA 4JIGA 3VU8A 1QRSA 2EBWA 2QD5A 5EMKA 5CBPA 3H87A 3COWA 2ZSDA 4JS0A 3RK1A 4P0PB 4Q82A 4AMZA 3DLIA 2FP3A 2HLHA 1EBFA 4PX5A 3T1QA 2ZVJA 5LWQA 2WKWA 1NN5A 4MUBA 4DKXA 1OWOA 4S0ZA 4AXXA 3E2PA 3NJRA 3BFKA 3QVMA 3TG2A 1R7RA 2R9VA 3DDOA 3ETJA 3NVMB 3P7MA 3QVJA 3VJLA 4X64B 3AU8A 3K9LA 3PDWA 5CURA 3EY4A 5HJEA 3OX1A 3H19A 3ML1A 4C5CA 1C5KA 2F00A 5KYNA 3S2ZA 1S01A 1AS3A 2IFTA 4U9UA 5IJWA 4U7DA 2ZQ5A 1ODLA 3DZFA 1Y37A 3OC6A 3PITA 5ES3A 1PUIA 4TRRA 3K73O 5MN5A 5JH7F 1HSOA 1TVKA 3OBIA 4LYFA 4NL4H 4JJ4A 2VOJA 4FILA 3TNFA 1ONNA 4DCTA 1MAWA 2HBYA 4JQOA 4U1RA 1NAHA 4GLOA 3VZQA 4HNVA 3D4BA 2I9PA 3LRXA 3AUKA 4FFBB 2P9ZA 2WRZA 2VTEA 3UJNA 1NR1A 3KS9A 2GHRA 3A1TA 1EDDA 4TTAA 5EHQA 1NX9A 5CLIA 1QZ3A 2GO7A 4EJMA 4B8YA 5IH7A 4XCXA 2BBWA 2X9GA 4I1PA 3OU6A 5COBA 4D80A 1UT6A 5B4TA 2A1TS 4MUNA 5D84A 1YO6A 2DY1A 4DV7B 1N1EA 3BXOA 2FCRA 1MX1A 2BEKA 1HFKA 3ZG6A 2B20A 4D57A 1E3EA 3DB1A 2Z6AA 4O4LF 1P33A 2YMMA 3LUDA 3LYAA 4KVZA 5EQJB 1JEQA 2GGSA 2XECA 5ALTA 3SAJA 4MWGA 3IEUA 5IAEA 2CE2X 2G04A 1TEZA 1OX4A 3F2IA 1PQWA 3B53X 1F1BA 2UDPA 3RYHB 1YBAA 4MI6A 4IIDA 2YBDA 4OTZA 1ZU4A 2HA6A 3QXSA 1G8SA 4F6RB 3CT4A 3BMXA 4FR2A 4OQ4A 4ETIA 2VJPA 3H83A 3HDGA 3PDCA 1O3YA 1VHQA 4NNPA 4GI5A 3DZIA 3V8PA 4DV2B 3LS2A 3UWOA 1NBHA 4R1MA 1T0JB 4L5IA 1C9EA 4F38A 2ZKLA 2NTYC 4OHKA 3EWIA 1Q7EA 5FJIA 2OGUA 3CLKA 1I5RA 4IIJB 3VR6D 3DV0B 3CGGA 1EP9A 3C39A 3CLUD 3L1JA 4HH0A 5EXDA 5AUPB 1J24A 1FUIA 3C3JA 3R75A 2BP7B 3TPFA 2EG9A 5ILGA 2AR9A 3QVUA 3I9V6 3TW6A 3DE7X 4OLJA 3R0VA 4MQEB 2GYVA 4BV3A 1OB5A 2IH5A 4CLEA 4Z3OA 5IDXA 4B76A 4MR9A 4DQXA 2W6ZA 3H5IA 4X41A 2R0QC 1R18A 1Z82A 5TB5A 8ADHA 5E7QA 2HCJB 3AUFA 4WN9B 1HBJA 3BD6A 4DHWA 3D5TA 4EY5A 3MILA 4A0HA 4OM8A 1QIFA 4K9SA 1H0RA 3TBKA 4LDJA 1WUYA 3CZPA 4PWZA 1SZJG 4J2TA 2Z1MA 2W0MA 3VU0A 2NWQA 4ND1A 2FK7A 4YJHA 4PLFA 4M2LA 4X93A 1R37A 4GYKA 1JF8A 1U9CA 1M1UA 2B1IA 2ZRIA 4WOCA 5LXTF 5C4MA 3M6UA 3WWCA 4YAGA 3RWOA 4URYR 4AQ7A 2R1TA 4FNAA 3G9TA 4RVDA 3KU1A 1G2QA 13PKA 5IZCA 1M9NA 1CRQA 2PXAA 3MWEB 1NBME 3NYIA 4BNLA 4EA7A 3H2ZA 1DQZA 1N4AA 2CNLA 3GBPA 4N0EA 1FP7A 4QEKA 4PHTA 3MCZA 3HCFA 1P0PA 2H5LA 1QC5A 2HNBA 2JDIA 3BEDA 1M6VB 3QKIA 1D2RA 4ME6A 4B84A 5CDYA 1X1SA 1TJ5A 3AKCA 4YO7A 2FSVA 1FFSA 2BEUB 2JG3A 1N8TA 1PWZA 2YWBA 1OWMA 4EB3A 2R85A 4GWGA 4V0LA 1ENYA 2OZLA 3IVXA 4OQXA 1P0IA 3KR2A 1QQ6A 4L51A 1NVEA 2Q46A 2G09A 3RIEA 2JEYA 3TL3A 2NO0A 2WTBA 1G1MA 2FP4A 1AMNA 3EEFA 1N6KA 4YASA 4YV7A 3B1JA 4RETA 4U6SA 2RHDA 3V4SA 4TWIA 1FUYB 1I2MA 3ZZTA 2RFLA 4LBYA 2MSDB 2PT5A 1PR5A 4QRIA 3HCDA 1CNFA 1Q74A 2B8NA 1FP1D 3ZHVA 4DLSA 2QSJA 1II8A 4CNBA 3CT6A 1A69A 2ZT8A 1BOFA 3TBHA 2DPMA 1IWOA 1P1JA 2EZ4A 4RADA 4Q1EA 1QH0A 2YIDA 2G88A 3DZJA 3U3OA 4RL4A 3WIBA 4ERXA 4K9OA 3C1UA 2AZTA 2C5HA 2HU7A 2V3CC 2QN1A 2NO9A 4ARBA 4WH0A 1DG1G 2MJLA 3I73A 2FZWA 3BCUA 3DL0A 1QQAA 3H5WA 3LJKA 4GR9A 4BFUA 2OC9A 3X1JA 1V7QA 4DRYA 3K0BA 3WYBA 1FC0A 2L19A 3DM5A 3LF2A 5D5HA 4MQ5A 1NVDA 1ADBA 4XZ3A 3GP5A 5DWVA 4AY6A 3ESDA 3O90A 5H9VA 3T1OA 4XQCA 3OTWA 4EYOA 1REQB 3E3NA 3OTHA 3JQCA 3RFFA 2V7GA 1USGA 2Q3HA 2XSZA 3K5IA 3WGLA 2BN4A 1V5IA 4EUNA 3PC7A 4NV3A 3B2EA 4DWVA 3GUZA 1YU9A 2F1JA 2YUTA 4QUKA 4TSKA 2ZIXA 3DZDA 1U2GA 3SK0A 2V98A 4HYQA 1LV7A 3M6WA 4KHZA 3WP1B 3NOQA 4BVFA 3UWPA 1Y3FE 2VJMA 3E84A 5KQLA 1ZKMA 7ABPA 1Y1LA 4ZMRA 3HCEA 1BAPA 2AXQA 2A9OA 4PBRA 4Y2TA 1U3GA 1EUDB 3ZU4A 2YVLA 2C31A 2C4UA 3RSHA 3E81A 5AJTA 2PDAA 4ZT2A 3A6HA 3HA5A 1VFPA 4BGVA 3QBTA 1MVNA 4N41A 4UBOA 1KYQA 1KO1A 1LXCA 3GRUA 5FXMA 3BICA 3MBIA 1TECE 4R7GA 1KI6A 2ZQYA 4IXDA 1GV1A 4DVGA 2PRSA 1OZGA 3UOGA 4BMPB 2G0AA 3R7NA 3B6KA 1CWUA 1OROA 1QM5A 1H6DA 1KSHA 2A86A 2D06A 1SHKA 5E1DA 4RKEA 1OAKA 3WWPA 2R4UA 3GRVA 4EFKA 5HS6A 3NC1C 3CEPB 3UK1A 3I6ZA 5KQRA 5IJ9A 2JJ1D 3BA6A 2KBFA 3PGXA 4L8YA 3SC3A 2JGAA 4Y2PA 4PN7A 4NJEA 1XKQA 2VFAA 4H7HA 4QLOA 4GWKA 4FJ1A 5LKAA 1GDTA 3NBFA 2Y1FA 4QULA 2I34A 5DP2A 3U7QB 4RTRA 3UK0A 4A8HA 2CNWD 1EFPB 2NPIA 3HKCA 4Z7JA 3FDXA 5TQVA 2PYIA 3WLOA 1EQ2A 3PQ3A 3CO0S 3PEVA 3ANSA 3LKZA 4E5PA 3QEBZ 1M67A 2E4WA 5E3HA 3ND6A 1UKZA 2YVQA 3LRPA 4G84A 4US0R 2R79A 3H3JA 4L07A 2Q2NA 2I0FA 4J6EA 1H9BA 1M2OA 4P3XA 2X23A 4GR4A 1U2EA 2G6BA 3MGKA 3R0IA 1N6RA 1GPUA 2PWZA 2XCOA 3KFLA 4NFLA 2OECA 3AR5A 1R6XA 1Z26A 2EYUA 5DMHA 2B2CA 5ABPA 1YVPA 2XDWA 1A9OA 2Q5CA 1N2CB 3VNQA 4S05A 5L3RA 5JNTA 2Q6IA 4BB9A 2AD1A 4UTRA 1SIOA 3EXG2 3IAS6 1C9DB 1SD1A 4NP6A 1JALA 4BO5A 2BGKA 1PGNA 1BXGA 1ZC3A 4I9HA 4OFWA 4I6GA 5F5NA 1HWYA 3GUYA 2XTAA 1ZQ1A 3PQ5A 1QJCA 3QWAA 4TSFD 4F1KA 1NNEA 4G0PA 5BO5A 1TU3A 1RJFA 3Q2KA 4CEIA 1E1KA 1R66A 4RPHA 5SZIA 2J87A 4ZANA 4A2QA 1X1RA 5DM70 1SUCA 2EFHB 4IVQA 5FTNA 4B3RB 1KAQA 3K0FB 4FFLA 5TPZA 5HGXA 5ICCA 1F4LA 2FN7A 4P7KA 4YMUA 1T8WA 4GQAA 2Q6KA 3V8BA 4RY0A 2O9JA 4EG0A 1V8OA 3VBEA 2D7JA 2H1IA 2H2WA 2X2EA 4MVJH 3SM3A 3U37A 3VVBA 5JD4A 1UEXC 3VNVA 4NE7A 5IT5A 1L1FA 2JVIA 2FCAA 3AWIA 1RJWA 2HH9A 3Q11A 4PNZA 5B5SA 1RWQA 1QSGA 1XWFA 2W9XA 4AMYA 5EIFA 2HPVA 2HSEA 2PGIA 1ZH2A 4RZQA 1JPJA 5JH7A 3JQAD 2WMDA 4MEBA 2XB8A 1N7JA 1C2YA 1YL5A 2VJCA 4I81A 2WIDA 3AGPA 3QKRA 1ZNZA 2PCLA 1NU8A 1TTPB 2B83A 3ZQ6A 1DCTA 4B2YA 2B69A 1ZHFA 4BNMA 1UOQA 3VKVA 4AXBA 1EEXB 1DRWA 2AN9A 3EZ7A 4UOZA 2F1HA 1XU4A 5AI0A 2AC7A 3GC6A 1BRTA 3GVXA 2G36A 4FS3A 4HWOA 5KTKA 4CL3A 2HC9A 1F0KA 4RVSA 1DJOA 1ADYA 2VK4A 5F52A 5J1SB 1E8DA 2VK2A 2VPQA 4LDPA 5IHXA 1BVUA 3ROMA 3WGIA 2OB1A 1X1BA 4DBLC 1U0LA 1PQYA 2I4TA 3T7KA 5BVHA 1BE1A 1X7GA 1Z4QA 3NBUA 4OXKA 5A5EA 2I7VA 4PR3A 4MR8A 4HH1A 1ZW1A 2MSKA 3FFXA 3WIVA 6LDHA 3ZW9A 5K0FA 3HKBB 1CRZA 4WW0A 2P6UA 1Z4OA 2PSSA 3DBRB 4UBJA 5HIAA 4AQYB 4V3BA 4G0VA 3NKVA 1QLWA 4X71A 1NFQA 4ZIRA 4JNKA 3VPHA 2GN2A 2YYAA 1PKEA 4DY6A 2QM0A 1NVBA 3GJ0A 3KLMX 3SQWA 1FFCA 1FXSA 5BNZA 1RADA 4HWSA 1E63A 1KH2A 2HLPA 3D4IA 1AQ6A 4KOEC 2RHTA 3A31A 4A8PA 3AVYA 4MGZR 3VPFA 4I46A 1SQ6A 1O94A 4G89A 1ECLA 4AG6A 4CIYA 1J22A 2RC6A 1U3UA 3T5TA 4D0GA 3IMFA 2NO7A 4X6XA 2VK1A 1UJ5A 1T8PA 1E5TA 3IQEA 4U02A 4B6OA 3O73A 3L4KA 1M34B 4GMFA 3AVWA 2O2SA 3I6BA 4EJSA 3V4LA 4DCNA 4Y2GA 4OF4A 2WNHA 3IESA 1Z6XA 3BVPA 3HADA 3KLNA 2ECQA 2LZ0A 4CCYB 2DKOA 2OV8A 1TCUA 1XQ1A 5FO0A 1SOMA 1UMCA 1T9AA 3AESB 3B7WA 5AW9A 2WNIA 4IV5A 5FI5A 4N0MA 5L7TA 2M6RA 1W4LA 4IM7A 3ZOZA 5EIBC 2CL5A 5B6JA 3ZWKA 4YCJA 5KJCA 2RK4A 2QQEA 2ZAMA 1IVYA 1G4HA 2P4UA 2QV7A 4GUAA 2XGOA 4LK2A 4YRKA 3VHLB 4E0BA 1JHZA 1GNRA 1YQ9A 2MOKA 1GTVA 3OFVA 3ECAA 1A98A 3OOHA 5KNBA 2GPSA 4IX1A 3Q8MA 1H9AA 3G0OA 1T0BA 1OI7A 1MGOA 2D74A 1UT5A 3OESA 1ICEA 4DNFA 2J6IA 1PNOA 1Z0DA 3AFOA 1Z08A 2D2FA 2QD4A 3GA0A 3C8HA 3DAFA 2AXPA 1HOXA 3YASA 1BDIA 1RXIA 3MNFA 2P8JA 2XTZA 1YR8A 3LW8A 3RDPA 5FQNA 2VHXA 1J49A 4FJ0A 3AFMA 2WJJA 2GEDA 1T2UA 4KGZA 4Q01A 2YW9A 2RH8A 3HCRA 1K2WA 2OCBA 2F90A 2H4YA 1AY0A 1XB2A 2NUPA 3D81A 2P77A 1LI7A 1XP8A 4QYXA 1U8TA 3DONA 5M34A 1N0IA 1FMFA 1HQYE 2J3KA 2H4JA 4FT4A 5K01A 3L7OA 1SBZA 1VSQA 2HK7A 3K1TA 4NCHA 4L6AA 5K2MA 5KHLB 1UZLA 1SCDA 4M0PA 5IJZA 4IEFB 5SZKB 1TZKA 1X1AA 1GN8A 3P2YA 4RE6A 3NTLA 2MR5A 2KX7A 3AG5A 3LHKA 5EWLA 4DSNA 3SHTA 1EUZA 2F8MA 2OXCA 4AMGA 3EA4A 3D0RA 1O6ZA 4HS9A 4L75A 5IC4A 4JLNA 3LMKA 1XCJA 3NXKA 5LDGA 1N34B 4C0LA 1XZGA 3ID6C 3L6EA 1AS2A 2PT9A 1UM9A 4C03A 2UYHA 3SJAA 1SB9A 3W5UA 4FJ2A 3BWEA 4QOIA 3RYIA 5AJYA 2B2NA 5B6IA 5CJJA 2C7OA 3PXGA 1JIQA 1ZFNA 3OKCA 4NBNA 1UBEA 3BWYA 3C5HA 3EC1A 2OV6A 1ZINA 4ZQFA 3U16A 4ANFA 2VTDA 1MG5A 3ETDA 5FPYA 1YB4A 1H9CA 3JQPA 4TV8B 1OLUA 2W00A 4K81B 3ZYZA 3HPQA 2EYQA 1GNVA 1PFKA 4M0MA 4C0AC 2UKDA 1CXZA 4CT0A 1IM8A 4WLOA 4EKIA 4E15A 5KVVA 2V5VA 3EY9A 4UHCA 1HPLA 1K66A 1NW8A 1RC0A 2FW6A 4GBJA 4W8HA 5EFZA 1UXOA 2GEKA 5HE9A 1XMXA 5C1IA 5LU9A 1Q3KA 2PH7A 1KPHA 5KNDH 3DJFA 1RWNA 4PFSA 4BNDA 1Y8RB 4AJJA 1P80A 4MI1A 4BFZA 2VP6A 5DGDA 2Y8EA 3DOHA 4GZMA 3TD6A 2B99A 3IAHA 1GPLA 4YCSA 3HC7A 1U8XX 1ZD4A 3GEEA 2QI9C 3UAXA 4C4RA 3FGZA 3GFSA 2YHIB 4G5YA 5DEOA 3PRYA 4XSVA 3WGMA 4H1HA 4B31A 1XL1A 4LDAA 4BHTA 1SUSA 3FFWA 5JZ9A 5KJEA 2OAQ1 3IE1A 3WB0A 4A92A 5A2GA 1NJSA 1Z3CA 4ZI3A 4FW8A 2DQZA 3F1KA 5GJWC 4BQRA 3GMSA 3GZ4A 2OCPA 2QL7A 1S8OA 2VHCA 3PYLA 3E9QA 1ZRHA 4B33A 1YE3A 1AA9A 1RCTE 1SXJC 2W6NA 3AKDA 2OBMA 3IHWA 1TCAA 1IVNA 1O95C 4IQGA 4KWTA 4DF3A 5ADVA 4KXQA 3P0HA 2OP0A 3U56A 3FAKA 4OHZA 1D0VA 1DKPA 3O8OB 4ASUA 3D7KA 2YQZA 4O2LA 3TTXA 4DDHA 4TS4A 2ZCJA 3V8VA 2AFHA 3EZFA 1IN4A 1B26A 1R12A 1UBLS 3L6OO 2UYOA 2Z9BA 4FOLA 1VZ3A 5LZ2A 2EJWA 3DNPA 1D2EA 3ZNQA 2HJHA 4J0HA 5H7XA 4F0JA 1JEEA 4HX2A 1D4ZA 4U3JA 1IAVA 2AWOA 1VG8A 4LX0A 1FRVA 2P8SA 2RHHA 4Q00A 4DW8A 1JEYB 4M38A 3GLIB 4Z7NB 4OBEA 4HGYA 3LHFA 2Q3FA 3WNDA 2XVXA 4A82A 1CE8A 3LDFA 5TF0A 3M6FA 2M1XA 3A4YA 3G1UA 3KT8A 1KDYA 1EFCA 3H5TA 3S5UA 3O4RA 4EYKA 4AJKA 3DXXA 3HCNA 1JR3D 1RM0A 4KN5A 1EA7A 1G9TA 3NOXA 4U7HA 2V6JA 1H3EA 1WSWA 2M98A 2DPLA 2GCIA 3FM9A 3PHCA 4LN1A 4N47A 5HKKA 1MAVA 2WBLC 4UE2A 2EJCA 1BCRB 4UATA 4GYYA 4EHDA 4LGVA 4CMIA 2JARA 2VZ8A 3V4FA 4JBNA 3EF1A 4KQKA 5BR7A 1Z2CA 3M6AA 4IX9A 1V7PC 3OMXA 1E61A 1RWWA 3O03A 4D8WA 1EDEA 4FGUA 1E3SA 1RS0A 1FMJA 4BO3A 1Z5ZA 4R81A 4JP3A 1E3JA 3BMCB 2IEYA 2X5NA 2YXEA 3KWFA 5K3FA 3I30X 4D3SA 2CZQA 5BV7A 2JANA 4Q5IA 2HHJA 3IQGX 2XIJA 1RAIA 2VZEA 1SIWA 2ZBGA 5LJLA 5EJAA 1NQVA 4UUBA 4RGYA 4ARIA 2IEZA 1QK5A 4BO8A 4KQ9A 5T8KA 4Z2YA 4UAJA 1ZM3A 2WWYA 2C7RA 3ADBA 3T0GA 1WVGA 1V96A 2JFNA 4R3NA 3UT5A 3HI6A 5DMXA 3G9UA 3W9UA 2PQ6A 3IPXA 2HWXA 3UMVA 4J0KA 1UJ4A 2HDHA 1JLSA 4BCCA 4KR9A 2AX4A 3VTZA 1LZLA 1HNNA 2ZEJA 3ENVA 2QJTA 2WU4A 1MEOA 5JAIA 3RREA 1XNRB 3TFOA 2Q0XA 1U2QA 2JGMA 4L5JA 1VPLA 3AT1A 3WIOA 4Q1DA 3C3BA 2I2BA 5TDHA 5LMCA 2ZWOA 2NZYA 2BFWA 1L7PA 3L1HA 1B2LA 1YVEI 4URHA 1U0NA 1T24A 2FB9A 4HAZA 2DOKA 3SJ7A 1N0UA 4PW0A 2XOKD 4HQRA 4WJLA 2IYAA 2BKAA 2WF9A 2JW5A 4RF4A 1JXAA 1IBRA 2OORC 1XMSA 2RH9B 1JFSA 1FZQA 1WUTA 1BJRE 3HU5A 2YRXA 2RHCA 4QTTB 4W7SA 1POWA 1ILWA 2B8TA 3CZQA 2P6NA 4N03A 3IAM6 4KWEA 4R1TA 1EDOA 2GJSA 4IOKA 3FTNA 4PY2A 4C0WA 3CRZA 4Q4AB 4HYYA 5DJ5A 1IK4A 4QQ8A 1TM7E 4GDFA 3OE5A 3FPFA 4CN9A 3MJFA 5JSKA 3CZCA 1AKVA 4BBAA 2R6ZA 4C4SA 4J9UE 1L7OA 4LY6A 5B3LA 4G36A 2W2XA 3BD8A 1PRYA 1DAKA 1QB8A 3U26A 4CDNA 4JY7A 4KRXA 1IEVA 3LXRA 1RI5A 4B81A 2JIBA 3F3KA 3MCAA 4H6VA 4QHTA 5ALNA 1KK0A 4G4JA 3C4QA 3LWBA 4P82A 1LNQA 4X94A 3EVZA 3TXYA 4LF6B 1J20A 3R5TA 2AW5A 4PEVA 1KY5A 5AOVA 1NF3A 5JI3E 1H6BA 3F8TA 2A0KA 4NLLA 1EFVA 1EM8B 3O0DA 2Z2JA 1A9PA 1PGJA 1Y8AA 1HT3A 1II0A 3GUUA 4JOSA 1OSNA 3NDBB 1XF9A 2IUEA 2ETXA 3KB8A 1A95A 2A9FA 2H85A 3EK2A 4MYTA 3B9QA 1WZEA 4IF6A 2G4CA 4PM4A 5F33A 1KL7A 2W2MA 2Y4OA 3N9IA 1NR7A 4IFEA 3N2KA 2QZSA 3MZ0A 3SQMA 1HQDA 1HRDA 1H3FA 4HWTA 3P9RA 4X1YB 1M83A 2PR7A 3TECE 4BGIA 2GM3A 4B1FA 2VJDA 4EOGA 2X0JA 5M2QA 1AQLA 3EG9B 5SY4A 4JROA 2REQB 3S1SA 2BVNA 1DMRA 3F7OA 2Q1WA 2Q9CA 3U7EB 1E7MA 2FZCA 2QJRA 2VZ9A 1K8QA 1ODTC 2EL7A 3S2UA 2IUYA 4ALJA 4CETA 3FSGD 2GK6A 2W6JD 2YC4C 1LTHR 1EX1A 1WMEA 2CMDA 4MV6A 4XXHA 1MX3A 2CW5A 2WU8A 3IERA 1CF9A 4NABA 5DN9A 2WFLB 3V1NA 3REQA 3EWNA 2X0KA 1M6WA 1CB7A 2JGFA 3PC2A 1LI5A 2DVMA 4ZI7A 2QTGA 3L8MA 4LXHA 3ZD9A 2NU9A 2A9JA 4GQBA 5EERA 1SXHA 5JROA 4RXUA 4D2IA 1GPWB 2KSQA 2N1BA 4JWKA 3GLVA 5LYYA 3DEIA 4IRXA 4F11A 3HVKA 3ET5A 5JCOA 3AEKA 1ISRA 1IZZA 1DJQA 3AF0A 4AJPA 3BD9A 4HB3A 1DWQA 3K53A 3H97A 3OCWA 4K6MA 3E9EA 4Z1MA 1WBDA 1V3UA 2X8BA 3HCAA 3A4MA 1CFJA 1QKKA 2OD9A 2Y0EA 3OJXA 4IHJF 1IWBB 1NP3A 3ZC3A 3DEYX 1ARZA 3RT1A 4CKBA 3AB8A 4NZ9A 7AT1A 1G5TA 3EUWA 1HE8B 5ALZA 1R27A 3IUSA 4XB6B 3SBXA 4BQFA 2ZDGA 2J5RA 4RF2A 4ENQA 3WKBA 5SICE 5IXJA 1PR2A 4KEAA 4JYAB 2Z5LA 3I4LA 4V2IA 2GNOA 3M81A 2ETVA 1N5KA 2GRJA 4BJHB 2KW5A 5EESA 4BNHA 2VHQA 4JT8A 4QELA 1SU7A 4MW9A 3EGOA 4OHOA 2V96A 4B74A 2NADA 4ER5A 5AHXA 1QHIA 2WHPA 2VCYA 2WSIA 2Z30A 5IYZB 2FEXA 2XMGA 3T8YA 3KU4A 1OC4A 1UDCA 3EC7A 4U9IS 3BH7A 3FCXA 5IJ0B 4Q16A 4E2XA 2BCJQ 2C77A 2QUJA 2AEFA 4HP8A 2Q07A 3VH3A 4C3OB 5F78A 4JCOA 4L08A 1SKQA 3H5VA 4Z0HO 4CZ2A 3E58A 5JISA 4W5RA 4Q18A 1SUFA 1Y6QA 4BNFA 1QOZA 1T1IA 4EMUA 1N3BA 4MVXA 2VRCA 3OP4A 4EA6A 2D0OB 1QAOA 1NBMA 2QLNA 4ZD6A 4XGKA 3WL8A 5F4ZA 3JALB 2G77B 2EARA 3KOWA 2RBKA 1ADJA 3JQRA 5CG2A 2XMPA 3NBQA 2OHFA 4P4SB 4PPYA 3CE6A 4GPD1 3N86A 4JUIA 3W78A 4AYXA 1GXSA 1GAWA 5TQ2A 2CLFB 3KJFA 3I23A 5JFOA 3K1AA 3R9XA 1T5IA 4HGPA 1T9HA 4GPIB 4ZT6A 1PJ4A 4LDZA 4WFIA 5CU7A 3WO0A 5BW8A 3IUPA 3H4TA 3PGJA 2DR0A 3Q3IA 1C3OA 5LYJB 1FJGB 4FDMA 5A05A 2W6ID 1KGSA 1DPGA 2IBMA 3BMOB 1EWKA 4B46A 4DILA 4KNYA 3NS7A 4BQQA 4LF7B 1BWQA 1P2FA 3GAZA 1ZUWA 2C5AA 3H0CA 1J6UA 4W1PA 1KAHA 2WTMA 5I9BA 3DF7A 5E6UA 6GPBA 4TL6A 1NXOA 3HLTA 3V4VB 2RKWA 2J3JA 3LY9A 1U2DA 1Z0ZA 2AI3A 3JQ9A 1CC1S 2GSWA 3LVRE 4MV7A 4Y9UA 3V8NA 3KQHA 4ESVA 4GMDA 1VRVA 1J1ZA 4INOA 3IHKA 2M32A 3SP1A 3TTWA 3ZWYA 2DULA 2Q4BA 1EGQA 1LBIA 2LDBA 3A6ZA 2AJ8A 1KVUA 4BNJA 4M8SA 4R98A 3UANA 2IDZA 3A4TA 4J0JA 2AN4A 2XMDA 4P92A 2ZB2A 3Q8WA 5DGCA 5KMGB 2G9ZA 3U60B 2GD6A 5DF1A 5MDHA 3G88A 1T1JA 3DAPA 4M7WA 3JAMA 3KZXA 1TCVA 1AUVA 2C04A 3DD1A 1LDMA 4WOPA 3MYYA 3GPLA 2F8LA 3D6FA 2FJUA 3EGWA 4LYGA 4YDSA 1VPWA 4FZ3A 5CVJA 1G55A 2C07A 5E2AA 5JD3A 2CN1A 4K9QA 3JD2A 3VJRA 1ZVMA 2FVXA 4MWOA 5IAAA 1CRPA 1QQ7A 2FUCA 2QVZX 2YCLA 3PC8A 3G13A 1QWOA 1TRKA 3T7JA 3OZRA 4DLPA 2HPAA 1JR6A 1BH2A 1RJ9B 2IH2A 3T3PB 5CH5A 1JAHA 1E0SA 4IEIA 3UJCA 4HDMA 4HDCA 2WKSA 2H00A 4PCUA 3NC4A 1B8PA 2WY2D 2FPRA 3H0EA 5D1HA 2RHJA 1J8QA 5J2TA 4HVAA 3OSZA 1NXPA 1CR2A 2B35A 3AZOA 3RU9A 5DLDA 3T1YB 2JCXA 2XHZA 1OKKD 2WWHA 4HUQB 4ZVSA 2OV2A 3DHYA 3QKTA 5KDLA 5J63A 5LLSA 5HRUA 3RVPA 5KAMA 2O5EA 5M7EA 1I3NA 1H2XA 1XAHA 4FBGA 4C5AA 1HGXA 1L7DA 4O0LA 3AYZB 1WKBA 5GVRA 3CMMA 4HADA 1OOEA 2I99A 4KMMA 3E6AA 3UBTA 5EHIA 3MT9A 1VIMA 2ORWA 4MUMA 3HHPA 4CV3A 5CCEA 1B00A 1XFAA 4IMIB 3CVJA 5FPKA 1TUEA 4MGKR 2X15A 4PQFA 1DAGA 1ECGA 2EIHA 1NV9A 1QVAA 1IDN1 1P2UA 1X2EA 2ISCA 3DTVD 4RZUA 4TTJA 1VLJA 5HE8A 3EPKA 1CZNA 4XWWA 1NL3A 3DS8A 3IO5A 3LG2A 1Q7RA 3DOCA 3V4ZA 5JNSA 1OHHD 4QU5A 1P0QA 1HFWA 1VPDA 2Q6TA 3JVIA 4O2BF 3O3MB 4A3SA 1AMUA 4WA7A 4AIIA 1DINA 4TVOA 4WRRA 1JR3E 1SZPA 2FFQA 1HV8A 3GVCA 4ZVOA 1PWEA 1YC5A 3STVA 2GUWA 4FMCF 4DADA 2G71A 4KDEA 5LU8A 3MJSA 1M73E 3VR4H 3DOIA 4RK0A 4OU5A 3T41A 1GZSA 3IMGA 3QXHA 4PZAA 3SCZA 4RGVA 4QKQA 3OQIB 2JAUA 2GILA 2EZTA 3EAFA 4AJ4A 4UEKA 1BW9B 3FPLA 1H4SA 5CJPA 3OKPA 1VKZA 4P86A 1UANA 1IVSA 3EIUA 1QQ5A 3TNLA 2LPMA 3GJQA 2XGJA 2ZWMA 3BB4A 3FROA 1LX7A 2VN8A 3SQNA 2FE1A 1HT2E 5EP3A 3A3OA 4UAUA 2ZITA 2OVBA 1RE1A 3AB3A 2EBHX 3ZU2A 4YHHB 1QHHA 3IFSA 3ILSA 2FSFA 3UJ7A 1G21E 5GZ1A 4FCWA 4W9MC 4Q9LA 3ZY6A 4RJTA 5TVGA 4DIMA 1PT6A 3RUHA 1RXWA 4XIYA 5TY0A 1CR0A 4JVSB 4PQYA 5CH3A 4K0RA 3IDFA 5J47A 2PT6A 4LA4A 1JIVA 4KJXA 4Y8VA 3G9XA 1X1CA 2GN0A 2D3TA 3PQDA 3MRXA 1EBBA 3VPGA 1NP6A 1EGAA 1WD5A 1G17A 2G1AA 1G4UR 5EIBD 5HXAA 1G7TA 1G64A 2PH5A 3FCAA 3UG6A 3DVQX 1C0IA 2Y6UA 4L8FA 2C00A 3U3ZA 3PSAA 3QLJA 3SI7A 5ALOA 3WL6A 3VR2A 3DCNA 4IF4A 4D9CA 2Y93A 4PSDA 4LYDA 6NULA 4CIBA 3HXPA 2G28A 1A5AB 1UZUA 4DKJA 3AOEC 2RHRA 2Y71A 4GBGA 4I9UA 3CV3A 1K5PA 3ZEAA 2DQYA 2RGWA 1DC7A 1T3ZA 2PVSA 3BL6A 1NF8A 3E9YA 4JV5B 1H6AA 3L93A 4JU9A 4DRZA 5JJCA 1QHXA 1M2EA 2FPOA 1KKMA 3QG5A 2BGNA 2XBUA 1FYVA 3LC1O 4C6SA 4DLYA 1JQJC 2JKYA 2XE4A 4BDTA 3WYEA 1VI5A 3V6LA 2QS9A 3T4PA 5IKEA 2JLXA 2O2EA 1TM3E 4B09A 5DCUA 5G1PA 5IFKA 1ORVA 4TKLA 2PX2A 1QTIA 1I1QB 2ASVA 2NZXA 2O0LA 2R47A 2J32A 2ZYDA 1MO4A 3E61A 3MWGA 1I7SB 3NBAA 1RE0A 1E4VA 1UKCA 2J46A 2XRMA 4LZZA 4W9NA 5AW7A 3M4JA 3QELB 3GBSA 3ZXYA 2AJLI 3G7NA 2PH1A 2BMVA 2XXJA 4P4TA 4QGFA 3CLHA 4HDOB 3QBVA 1QTRA 3IPLA 1LWNA 2H29A 4ZYLA 2FPPB 3X2FA 3W5HA 3KQKA 4A8TA 1XVUA 4IDOA 1HH4A 3W2EA 3OEYA 2ZYGA 5KHAA 4J43A 2OCKA 3KSBC 3SHVA 4KN6A 2BMEA 5THKA 3P26A 4FMDF 1VFNA 2RB4A 1D03A 2V7BA 5DNUA 5CD9A 1GCGA 2V03A 4Z6KA 1JE1A 2FG5A 3ELUA 3Q6IA 1U99A 3V2HA 3ZYCA 4I55B 2Z9CA 2BFMA 3L8EA 2GM4A 1DT5A 5ILOA 1K7EB 1IWPB 1U0OC 2QTZA 3VHXA 1GFIA 1RWOA 2GZMA 4PR0A 1UAGA 1T0PA 2X8LA 4NH0A 4K05A 1RZRD 2VPXA 5AM4A 1ONSA 4BVEA 2IHTA 4L4RA 4LTMA 3MWJA 4BP1A 4KYVA 2X2FA 2FSPA 1JLKA 4IIXA 4R9RA 3MJDA 3BJZA 4RABA 4AROA 3FOEC 3BRCA 3QVGB 3NHLA 3FDFA 1T3TA 4QPCA 3TLKA 4MHOA 4D8YA 1CUIA 1LH0A 4RWZA 3KYJB 1IMJA 2VR1A 5ALRA 4GS5A 5CB4B 5KNBH 4ZK2A 1E2GA 3EAQA 5ILQA 3LPLA 3VZSA 1Y3CE 4M6WB 5BV0A 3LQ2A 1CIPA 3WHPA 1ORHA 5DNYB 2QORA 1DKNA 5CNIA 2CLIB 3OG9A 4WOBA 1W4RA 4WXYB 5JSHA 3HMQA 1ID1A 2GB4A 4OI4A 5B1SA 4EDHA 4U7TB 3JTEA 3DBHA 3BWDD 2X13A 2YUIA 3K16A 4UQPA 4Y2RA 1VSBA 4INJA 2YX1A 3D1LA 3KXDA 2BGUA 4ILKA 4EHBA 3CLTD 3FPKA 1G3UA 2QHXA 1W5SA 2PSEA 5LP6F 2YV1A 2A0UA 1GRVA 1KZ4A 1YZGA 3LAWA 4FT2A 5CFNA 1RQNA 5B1HA 1MIHA 3PFNA 4LJKA 5DBIA 4BC1A 4OEHA 5EIAA 1LPSA 5JCPA 2V6BA 4J1NA 3NVAA 4P6VF 3F9IA 2EHDA 3NHRA 2XUDA 3O4JA 3P2KA 1U8UA 4D4GA 3FR7A 4YAKA 1DTWB 3WAKA 2CVQA 3BB3A 3LUPA 3PR2B 5M5BA 3TPZA 1P1CA 2QUHA 2CFCA 1YMQA 1Y8CA 3QNMA 2O5VA 2P0YA 2FX5A 4M0FA 2O6HA 3OPYI 1SK8A 4LI0A 4O59O 4DA4A 1NMXA 3KHSA 2Y0CA 4RANA 1TYBE 2CLHB 3FVQA 1SXJD 4UMDA 3IQFA 2CHEA 3RUAA 1Y98A 1SXQA 4OYRA 3VO9A 5DISB 4BEWA 1XEWY 4M60A 3OQBA 4F72A 1KIMA