3F3XA

Crystal structure of the transcriptional regulator bldr from sulfolobus solfataricus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
139
structure length
139
Chain Sequence
MQKIDEKLQLMNTIAKIYRGSIKEFNNRLGKLMNLSYLDFSILKATSEEPRSMVYLANRYFVTQSAITAAVDKLEAKGLVRRIRDSKDRRIVIVEITPKGRQVLLEANEVLRNLVNEMLSDVENVEELLEGLNKILSRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of BldR from Sulfolobus solfataricus provides insights into the molecular basis of transcriptional activation in archaea by MarR family proteins.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transcription
molecule keywords Transcriptional regulator, marR family, putative
total genus 54
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f3xA00
2OZ6A 4ZYDA 3QOPA 3WGIA 2EK5A 2QENA 1LQ1A 4P9UA 3KP2A 2HGCA 1ULYA 4Q47A 1K78A 5D8KB 4A0YA 1YYVA 3E6CC 2IA2A 3J81K 2JRTA 2EFNA 5CLSA 1ZYRF 2DK5A 4UVCA 3GVAA 2XV4S 1KGSA 1U2WA 3KP5A 1MZBA 2PMUA 2RC4A 1SD6A 4UXNA 1MD0A 2ELHA 4RB1A 5HS8A 2A5YB 5LLQA 1T6SA 3WU1B 3ELKA 1BC8C 3KEQA 2XVCA 4RS8A 3FXQA 2PJPA 1FP1D 1ZG3A 3K2ZA 2ZO4A 3D0SA 3R0AA 2IA0A 2JPBA 3ABTA 2V1DA 4OU0A 2ETHA 1P4AA 2FNPA 1DPRA 2Z99A 3ABUA 4CHUA 1D8KA 4GO1A 1EV7A 1R1TA 5BQTA 2J5OA 3M1EA 3EQLF 3QU6A 4GXOA 1MJBA 3FMRA 5F6FA 1KQ8A 1FNNA 5E8IA 5DEQA 1IXRC 2W57A 4ZYHA 4EQQA 5HVQC 4GYGA 3K0LA 2O3FA 3HRUA 4KYWA 2VC1A 3KZZA 4M6YA 3V7RA 1BN5A 4DNCA 4NQWA 3KEOA 4EMSA 5FLXZ 2VE8A 2PLYA 4Z2YA 3JSPA 2RQPA 4P96A 4L9NA 2M8EA 3K1MA 4UUVA 1QZZA 3TO6A 5CVVA 4O6JA 1FSEA 1TTYA 1WRJA 4I01A 3R0JA 3ZN1A 5DYMA 3GFLA 4EV0A 1RUOA 3ZP5A 2DPDA 5ERIA 2VT3A 4EM0B 4HQMA 4XSXF 2FE3A 3ZMSA 5L3GA 4AIJA 3KP3A 2A61A 3ZMVA 1XSVA 5KK1A 2PFBA 1OYWA 4KICA 2KKOA 4N9HA 1B1BA 3H3UA 2DU9A 4D0PA 2VBWA 1PP8F 2G7HA 1UHMA 1BIBA 1FWZA 2FQ3A 5D5WB 5FFZA 1YQAA 2ESNA 2HZTA 5ILUA 1XMAA 2HDCA 2HWVA 4MQVA 4M6XA 2MH2A 1U8RA 1FC3A 4QWQA 1ON1A 2O0YA 2YSRA 4M72A 1K79A 2QQBA 1ZRFA 3IWFA 3ZMDA 4HLYA 3KLNA 2FMYA 4ZZLA 1FYMA 4UVBA 5JR3A 2LF7A 2HTSA 1EH6A 1PDNC 1TNSA 1ZRDA 2K86A 2A68F 1SD5A 5E1WA 1IN7A 1HKTA 3BPXA 4Q48A 5CYVA 3RTRA 3L2CA 4ESBA 3MEXA 3WTXC 1I1SA 1SD7A 2QLZA 1S29A 2VBYA 1T2KA 4KNYA 4G7OF 3MCZA 5ILSA 2AS5F 1A04A 4LLNA 3WGGA 3K1PA 2EFWA 2H27A 4A6EA 2L01A 3JAMZ 2ZNYA 1Z6TA 2CWEA 2E7WA 1JXSA 3BJ6A 2UXNA 3IKVA 2JPCA 4M9XA 2EV6A 3C18A 4M9SA 3DFGA 3NRVA 2RV8A 2M5WA 4R79A 4U7BA 3S2WA 1DP7P 3B73A 4CICA 4MTDA 4WXCA 4H0EA 1ODDA 2CFXA 2OD5A 4P55A 4UHTA 2DTRA 3AAFA 2FRHA 4PGHA 3SZTA 3TO9A 4EGYA 4RAYA 2ESHA 1XGSA 2EA2A 5IT3A 1E17A 2OBPA 1XSDA 1RI7A 2DO7A 4WWCA 5A2QK 1W7PB 5L3BA 3HHHA 1R23A 1TLHB 4P9FA 3ULQB 1Z05A 2D45A 5F1RA 1VTNC 4L0YB 1YW8A 4HX4A 4ENJA 4IF4A 5LHIA 5H20A 3I59B 2Q8KA 1ZHFA 4IRGA 3GYHX 1Z7UA 3P9IA 5IT9K 1B59A 1I5ZA 3NEUA 1IRFA 2GAUA 3LA2A 4GYIA 2P6SA 1YFHA 3LSTA 4RGXA 5ICEA 3OV8A 2VOPA 4RB0A 3GFJA 1XDUA 3R61A 3FXUA 3WTTC 3R6SA 1IN6A 5FD5A 5EEGA 3WU0A 3TQNA 3DP7A 1BI3A 1ZG1A 4AIKA 2ZFWA 4UVAA 2Q2EA 3C7JA 5HDGA 1YS7A 2RVCA 3LFKA 1J59A 4RB3C 4ASNA 3ML6A 2UZKA 5E1XA 1HW2A 1KYWA 4ESJA 2LKPA 1XCBA 3KP6A 3SQNA 4S05A 2EWNA 5IT9Z 2F5CA 2RDPA 5HDNA 1LDKB 4KA4A 4U88A 1O3TA 1KQ9A 4TV7A 3ZMUA 3EYYA 4HV6A 1QZYA 1NHAA 3T8TA 4A0ZA 3H92A 2VODA 3GZ6A 4MEXF 1DDNA 1J0RA 5LRSA 3K69A 3F8FA 2QBYA 2KIMA 3IRRA 1FBSA 2VOOA 1W7PA 3I0TA 1BI2A 5K5QA 3GLXA 2VBZA 4U0WA 3V7CA 3WTYC 4I09A 3KP7A 1LVAA 4IPAA 1SFEA 3E5UA 1S7AA 3CUOA 2FEZA 2P5LC 3WODF 3N4MA 4PZJA 3WTZA 3KZYA 1GXQA 1U6GA 2Y0MA 4EJUA 3V8KA 2IVMA 4YIIA 5DV5A 1OPCA 2A3SA 5LBQA 3ECOA 1QGPA 5FLXK 1V4RA 1D3YA 2XHKA 3L7WA 4KUMA 3FWEA 2J5PA 3BPVA 3F8MA 4WXDA 3M7GA 3L9FA 2WWYA 1W7PD 2FXAA 1ZLKA 3GFMA 4IRHA 3J80Z 4MEYF 5F64A 2A69F 3RKYA 3SHFA 3FZVA 1S6LA 3HOTA 2K7LA 1STZA 1P6RA 2STWA 1T98A 2P7VB 3F22A 3U1DA 4ZH4F 5E1ZB 3TO7A 3PQJA 3RJPA 1B4AA 4HDUA 2K4JA 1FSHA 2E1CA 1HW5A 2D1VA 2FBIA 5LEJA 1IZ1A 3F6VA 1V3FA 4FX0A 1U78A 2UXXA 2RKHA 5HS7A 1R36A 1YS6A 5D5UB 4S04A 3BWGA 4N0BA 3F6OA 5E20A 2QUFA 4I2OA 1XSXA 4Y15A 2DK8A 3MWMA 2P8TA 3ZMTA 1OYIA 1IW7F 3DXJF 2GZWA 5L3EA 2RGVA 5TJJA 1UB9A 3J80K 1GHCA 4K2EA 3HSEA 4M9ZA 2CO5A 4G9YA 4U0YA 4M71A 4A5MA 1J75A 2L54A 2DW4A 1TW3A 2VXZA 4RAZA 2YX4A 1U5TA 4IVNA 3VFZA 5K1YA 4KMFA 3D5LA 5FB2A 3E3VA 3F8NA 1MJAA 2MC3A 2PEXA 3BJOA 1ONVA 1JGSA 2ZMEB 3L00A 1IN8A 5CVRA 1UCRA 4HZFA 3ERED 3RYPA 5CVIA 2W84A 2HYFA 3G3ZA 2GA1A 4HA8A 4HX7A 3WE3A 2AXLA 3IC7A 3RYRA 2GXGA 1EH8A 1ZARA 1F1ZA 5ICGA 1BIAA 2R3SA 5E18F 3WE2A 2Z5UA 5DD8A 4L9VA 3WTWC 3JTHA 4HV5A 4AWXB 5HLHA 3V8LA 1MKMA 2WC2A 3I4PA 3ZQ7A 3H3ZA 3T8RA 2L4MA 4LB5A 1KU7A 1ZG5A 3WTSC 1BJAA 4HOBA 5EEHA 3DPLC 4LGWA 5HDKA 5BS6A 4I0BA 2HYGD 4JK1X 5D6EA 4P5OA 3LA3A 3MQ0A 3KFWX 1U3EM 2O6GE 3DQVC 2BE5F 4FT8A 2LDUA 3FMQA 1DUXC 4MQ9F 2Y75A 1LDJA 1FPQA 2KRFA 3Q9VA 4XSZF 3EYIA 3TGNA 4L9JA 1IF1A 3DEUA 4BHCA 1GVJA 1L0OC 3KE2A 2CW0F 3RKXA 5AONA 1X3UA 4BH9A 4DQ2A 4EM2A 3G73A 2W25A 4EJWA 2IP2A 1XDSA 4YIFA 3E5XA 1D8JA 4I98B 3F3XA 2NNYA 5DD4A 1QPMA 1LEBA 3ZMZA 2ZKZA 5HLIA 3HRMA 4BQAA 2D2WA 1KYZA 2QWWA 1FBQA 1TQPA 1K7AA 2HQRA 2MD5A 2KIUA 3VEPA 1TBXA 4LD5A 1J5YA 1G6NA 5D4RA 5AIPA 2QM3A 3KP4A 1OYYA 3B02A 4F7ZA 6PAXA 3GXOA 5D5VB 1TW2A 4HAMA 1G4DA 2OAZA 4AD9A 3E97A 3JAMK 3E6DA 2XKPA 2PBIA 2FNAA 1FOKA 4IXAA 2VC0A 4OMZA 3ZN0A 4QLCU 4I02A 2MA3A 1S7OA 2VT2A 3PFIA 1U5TC 1ON2A 2FU4A 4I7HA 3GEZA 2HTJA 3CUQA 1ZAOA 3QP6A 5HS9A 5JI6A 2DT5A 3R4KA 3HRSA 4LFUA 4HQEA 3HOSA 1HSJA 1G3SA 4LMYA 1Z91A 4L0ZB 3HRTA 1WWXA 2ISZA 2O61A 3E6MA 4KN4X 1LNWA 4CYDA 3BP8A 4LG0A 4M74A 1FYKA 4PCQA 3MAJA 2X0LA 4ZYGA 2PG4A 1QO0D 2CQKA 3WGHA 3V7SA 1JHFA 2QYOA 4BAYA 1H9TA 4CXFA 2QQAA 1W5TA 1R1UA 3TOBA 3M8FA 5DDGA 1IXSB 3M9AA 2P5KA 3P9CA 2V1UA 3K9TA 4BNCA 4LK1F 4WX9A 1K78B 1F5TA 1S3JA 2ZXJA 4PDKA 1O3QA 5LGTA 2X4HA 3U2RA 2LSOA 2WTEA 1BC7C 3HYIA 3NQOA 2JZYA 5D5XB 2DQLA 2XKOA 5FO5A 5DUIA 3REOA 5ED4A 4WK8F 4EM1A 3CUQC 1S8NA 4HDVA 3P9KA 4I0AA 4MGRA 3BZ6A 2WV0A 1SFXA 1B6AA 4R1HA 3WG9A 3TDZC 4Y13A 1TNTA 1HW1A 2LF8A 3V4GA 4ESFA 3JSOA 4ON0A 4YFNF 2M87A 2L02A 2MLGA 1Y0UA 1E2XA 3DF8A 1ZREA 2DAOA 2RN7A 2W24A 3WTUC 1FZPB 4Q4ZF 2IW5A 4KIFA 2FBHA 3BJAA 3RKWA 5L3FA 1XN7A 2QQ9A 2F2EA 1SMYF 4LLLA 4OIPF 1K6OA 4A2UA 1W5SA 1AWCA 3PQKA 1J2XA 4CO8A 5BPDA 4XBFA 1WKMA 2XROA 1WQ2A 3W6KB 1I1GA 1IRGA 5ILVA 1O3RA 3T5XA 2HQNA 2DFIA 2A07F 4IRIA 5A2QZ 1USTA 5LEKA 1FT9A 3CJNA 4U0VA 3TKYA 4OIOF 1P2FA 3HSFA 1F4KA 2XAGA 3TOAA 1FYLA 2K02A 1YO5C 3SFZA 4YFKF 2M1BA 5K5OA 2XASA 3J81Z 1R1VA 3IWZA 2KJBA 2OZUA 4NHJA 1ZRCA 1T0FA 3LQRA 5ICCA 4KMUX 2FBKA 3FXRA 4LJZF 2EV0A 2OQRA 2DPUA 1B9MA 2ZNZA 2XAHA 2P6TA 2NNNA 4HF0A 2R7FA 3I71A 2IPQX 5LRRA 5FD6A 1JHHA 4U7DA 3BDDA 3FF5A 5BPIA 2IT0A 3CDHA 2YU3A 5HLGA 3MFKA 4WF2A 4AVPA 1FY7A 3QPTA 1SAXA 2ZCWA 4EJOA 4BXUA 2CYYA 4LK0F 1ZGAA 1MDMA 3F8CA 3I53A 4LB6B 3BROA 2A6EF 2OA4A 2IA1A 4BHBA 1W4MA 3QP5A 1T38A 4RGRA 3RIRA 5LHGA 2V79A 2P7CB 2LNBA 3ECHA 2F5FA 2NAZA 1ZH5A 2VBXA 2HS5A 1BBYA 5LHHA 5DCMB 1HSTA 3FM5A 4G8XA 2XGXA 1LJ9A 1DPUA 4HF1A 4R8HA 1YW7A 1IAWA 1HXDA 4RGSA 2XRNA 3KCCA 1YLFA 1P92A 4PGGA 3MZYA 1RZ4A 5L3DA 1SFUA 1GXPA 1LB2A 1T39A 2ZJ2A 3DPTA 3M8EA 1XB4A 4GGGA 3HSRA 4L5JA 4UV8A 3GF2A 1C0WA 1HKSA 2QVOA 2FSWA 3N97A 4CDGA 2HOEA 4AIHA 2FMLA 2HKXA 2EV5A 1XGMA 2BBYA 5BOXA 1FLIA 3O2PE 5HOOA 2ISYA 4UNOA 2EFQA 2ZMEA 1L3LA 1SD4A 2Z3YA 3O6BB 3LWFA 3T1BA 4B8XA 4WCGA 5L3CA 2C6YA 3F23A 2PMHA 3I64A 1XMKA 2EFOA 3V8JA 3CO6C 1Q1HA 1RNLA 3EETA 3EUHA 2GIVA 2Y48A 2B0LA 3DV8A 4N9IA 1TQIA 2COMA 4CZZA 4ENKA 1G3TA 4BYYA 2P4WA 2ACJA 3OOPA 1BI1A 3E5QA 5J6XA 3FHZA 1Z1DA 3RDIA 3W6JB 4EGZA 2FF4A 2JT1A 2EB7A 3GWZA 2FA5A 4EVIA 5CJ9A 3BY6A 1CGPA 5K5RA 1XD7A 3L09A 1Z6RA 4XRFA 2GXBA 5ICFA 1CF7B 1B9NA 2EJRA 3IKTA 4UV9A 3HTSB 2DBBA 4XLPF 3E6BA 2JSCA 4KN7X 1IN4A 1TQMA 2XAQA 4A0XA 1O57A 1YG2A 4FHTA 2MBFA 3T0YA 3IRQA 1H9GA 4HX8A 4KT5C 1MDMB 5LGUA 1XGNA 3Q5FA 3CTAA 3I54A 1I27A 3I58A 4A5NA 1XGOA 4HYEA 3VOEA 1HQCA 2QZ8A 4OIQF 1KU2A 2MH9A 4G94A 3LAPA 1ZN2A 4MNUA 3GW2A 2CSOA 2HKOA 2YR2A 3QU3A 2YPRA 1R00A 4G7HF 4LG0B 4KIBA 3ISPA 2H6CA 2G7UA 2OU2A 1YW9A 3JTGA 4MTEA 5E8GA 1J7KA 4HLXA 4G7ZF 2R7DA 1WI9A 2XUBA 2BV6A 3GX4X 4JQFA 2BGCA 1R58A 2O8XA 1R22A 4ENMA 3VB2A 2QBYB 2OQGA 2E1NA 2K27A 1RIOH 1LEAA 4EJVA 2ADUA 4HW0A 1D5VA 4OINF 2VONA 2HEOA 5H6QA 3CO7C 2STTA 1ZLJA 3CLOA 5DCFA 4KFCA 4KDPA 2G9WA 4Q5SF 1QQIA 3I5UA 1J9IA 2NRAC 4G6DA 1H0MA 2O03A 3ROUA 1REPC 5JFRA 2XAFA 1LDDA 1G3YA 5FGMA 3U9GA 4MHGA 4CGZA 1OKRA 2MLKA 1QBJA 1CF7A 3LAJA 2D1HA 3KLOA 4L5IA 4Y17A 2HR3A 1HKQA 1O7LA 2IJLA 4YG2F 4IHTA 3FM3A 1JE8A 3QAHA 2BEOA 4ENNA 3HTUA 2P5VA 2ZBKA 1HBXG 4GCVA 2VN2A 3CUQB 1IXCA 1KA8A 4OMYA 2FOKA 3LA7A 4YFXF 5H6RA 2EA4A 2RNJA 3TDUC 2XAJA 1O7FA 1MGTA 1ZGJA 2V1XA 3FMSA 5D8LB 2CGPA 3GZ5A 1USSA 2HFHA 1WSUA 2YX7A 3KETA 2IRFG 1OR7A 2NS0A 5DUKA 1BM9A 2VE9A 2PQ8A 2L3DA 1SMTA 4JBAA 5AIQA 2W85A 3GFIA 1G3WA 2F5DA 3RI4A 2KIFA 2Q0OA 3J7AO 3HHGA 5TRDA 1I6XA 3IL2A 1BI0A 1BOAA 2BYVE 2H09A 3O3KA 5CVJA 2UWMA 3QPHA 3DKWA 1QNTA 5FFXA 2V6CA 3C1DA 2A6HF 4B09A 2GWRA 5LGNA 4M73A 2JTVA 1YIOA 5J8CA 5BMZA 1OMIA 1PUEE 5J8FA 5DCMA 4L18B 1XCVA 1O3SA 3HUGA 4E70A 3HIFA 1UHWA 1U5TB 1R5HA 4O3MA 3VODA 4A6DA 3ZPLA 5D6FA 3BOQA 5KVRA 3GUDA 4G6QA 4HBLA 3I59A 5JVTA 3MZHA 1KU3A 1FX7A 3C3WA 2H94A 3R60A 2CG4A 2DQRA 4KIGA 5JHUA 1UFMA 3RPQA 4WXHA 3JW4A 4ZYEA 2F5EA 3F21A 4RB2C 1R7JA 2K4BA 4OOIA 3RPUA 3F8BA 1MJ9A 2L4AA 2Z9OA 4L9TA 1FP2A 1F9NA 1FBUA 5CVUA 1PP7U 3EDPA 4IHSA 3LQQA 3Q9SA 1IN5A 2PN6A 2M45A 1IUYA 3SXYA 4A12A 2EFPA 1P4XA 1R5GA 1YTYA 4RGUA 2M30A 2TDXA 2V9VA 2XIGA 1AOYA 3WTVC 4FX4A 5D4SA 3GO5A 4BHPA 4ZZDA 4NB5A 3FX3A 3QRFF 2GA2A 4IJAA 1P4WA 3K1NA 5E17F 1KU9A 1EH7A 2DI3A 2H6BA 3F72A 4LLGF 4XLNF 2NYXA 3IHUA 4EJTA 4HF2A 2KJCA 4O5VA 4OIRF 1Z9CA 1RUNA 2Z33A 4ETSA 2E7XA 2GQQA 3SZPA 3COAC 1KQ0A 2PI0A 3P7NA 2DLLA
chains in the Genus database with same CATH superfamily
5K7HA 2ECBA 2OZ6A 4ZYDA 3F0CA 4ABZA 3QOPA 3WGIA 3L2UA 2EZHA 2BZTA 2EK5A 3VSKA 2QENA 5C4XJ 3K4MA 4J01A 1LQ1A 1CQTA 4P9UA 3KP2A 5IYBJ 3ERMA 2HGCA 4XNFA 1N77A 1HF0A 1ULYA 4Q47A 2OTLI 2NVTJ 1K78A 2KRHA 5D8KB 5EEAA 4A0YA 4BQNA 5KCMA 1YYVA 5GTHC 3FXOA 3E6CC 2X6XA 2IA2A 3J81K 2JRTA 2EFNA 5CLSA 1ZYRF 2DK5A 3AG2H 4UVCA 5EYRA 1EF4A 3GVAA 1ZKGA 2ZSHB 3PNVA 1AHDP 3AL0B 2XV4S 1R9TJ 1KGSA 5DTDA 1U2WA 3A01B 4N4NB 4LIUA 2R7SA 3KP5A 2PJRA 1VZ0A 1MZBA 2F5VA 3FBIB 4IZZA 3QPSA 4E7JA 2DT6A 3OYHA 4E7LA 2PMUA 2RC4A 2ZB9A 1YJ9I 1SD6A 4UXNA 4A3LJ 1MD0A 2ELHA 4RB1A 5IP9J 5HS8A 2A5YB 5LLQA 1T6SA 3WU1B 3ELKA 1BC8C 2XSDC 3KEQA 2XVCA 4RS8A 3FXQA 2XF5A 4DIQA 2PJPA 1P7JA 1FP1D 5FJ8J 1D0ZA 1SVMA 2R5YA 1ZG3A 4M3FA 3K2ZA 3CP2A 2ZO4A 3D0SA 2E34A 3R0AA 4B47A 3MMYB 3NARA 2XC7A 2IA0A 2JPBA 3ABTA 3M3YJ 5C4JJ 3MD2A 1RC9A 4YIRX 2V1DA 1JKPC 4OU0A 4BEHB 2ETHA 1P4AA 2FNPA 3IAM2 2GLOA 1DPRA 2Z99A 3ABUA 3DCFA 4CHUA 2DOFA 1D8KA 4XN3A 4GO1A 2K9MA 1EV7A 3AFHA 1R1TA 1WH7A 5F0HA 1ORKA 1ETQA 5BQTA 1WJAA 2J5OA 3M1EA 3EQLF 5JHFA 3QU6A 5DM7F 4GXOA 1MJBA 2OC6A 3FMRA 2V6EA 5F6FA 2HNHA 1KQ8A 1FNNA 4ZDOA 3O8GA 5F27A 5DEQA 5E8IA 4F92B 4CYCA 1YI2I 5FLVA 1R71A 1A6IA 1IXRC 3WU2C 4ZC3A 2R0QC 2W57A 4ZYHA 3O8HA 4EQQA 3S8PA 5HVQC 4GYGA 2BXZA 3K0LA 2O3FA 4JOMA 3HRUA 4CSWA 4KYWA 2VC1A 3KZZA 4M6YA 1Z21A 2EIKH 2Y9YA 2DA6A 2DA1A 4DZPA 3Q3SA 4XOTA 3V7RA 1BN5A 4DNCA 4RDUA 3A4CA 4NQWA 3KEOA 4EMSA 5FLXZ 2VE8A 2PLYA 2WA0A 3L2RA 2CQXA 3MVPA 4Z2YA 3JSPA 1YITI 2RQPA 4P96A 4L9NA 2M8EA 3K1MA 4F93B 4UUVA 1X1CA 1ZTRA 1QZZA 3TO6A 3BTLA 4B3AA 3ASOH 4I76A 4O6JA 5CVVA 5EG0B 1MH4A 3PSIA 1FSEA 4BY7J 4B3XA 1TTYA 1WRJA 4I01A 3R0JA 1BW6A 3ZN1A 5DYMA 3GFLA 2JN6A 4EV0A 1RRJA 3J7YJ 1RUOA 3ZP5A 3EUAA 4U87A 5M5WJ 1A35A 2DPDA 3RZOJ 5ERIA 2VT3A 4EM0B 1S7EA 4HQMA 4XSXF 3I55I 2EBIA 2FE3A 2IGMA 3ZMSA 2LY1A 5L3GA 5M3FJ 4AIJA 3OIQA 1HCRA 3KP3A 2A61A 1KONA 3LSPA 4D1QA 5IY5H 3ZMVA 1WJBA 1XSVA 2LC2A 5KK1A 2PFBA 2ZMEC 4A3IJ 1OYWA 1FMVA 3OWTA 4KICA 2DJIA 2KKOA 4N9HA 2R92J 1B1BA 1FIAA 3H3UA 3K10A 2DU9A 2H8RA 4D0PA 5GADJ 2VBWA 1PP8F 2G7HA 3BTIA 1UHMA 4V2FA 1BIBA 1QVUA 1SFOJ 3HEFA 2ZSIB 1FWZA 2FQ3A 2KZGA 5D5WB 2JUCA 3K4LA 5FFZA 1YQAA 2ESNA 4PSXA 4BUPA 2HZTA 3HOVJ 4BQQA 5ILUA 3CQZJ 2ZJQF 1XMAA 5E3LA 2HDCA 3CD6I 2QKMB 2HWVA 3CCJI 4MQVA 4M6XA 2MH2A 1QHHD 2E35A 1U8RA 4V19K 3LOCA 3UR3C 1FC3A 4QWQA 2OV7A 1ON1A 2O0YA 2YSRA 4M72A 1K79A 2QQBA 1ZRFA 3IWFA 4MLOA 3ZMDA 4HLYA 5M3MJ 4C2UA 3KLNA 3BCBA 4DYQA 2CV1A 3ZQIA 2FMYA 4ZZLA 5LFAA 1FYMA 3OL4A 2DT7B 4FE4A 4UVBA 5JR3A 3OS1A 2JA2A 2Y9ZA 1MBKA 2LF7A 2HTSA 3A1YA 1EH6A 1PDNC 1TNSA 1ZRDA 4XKBA 3MKLA 2K86A 2A68F 1SD5A 5E1WA 1FTZA 1MBEA 1IN7A 2N8GA 1HKTA 3BPXA 4Q48A 2MW8A 1WZ2A 2R5YB 4C9YA 3AG3H 5CYVA 1OCOH 2QCOA 3RTRA 4A3EJ 2FJ1A 4G12A 3RKQA 2KZVA 4XR6A 3L2CA 2M9HA 4UUSA 3SDGA 4ESBA 3CCUI 3MEXA 3WTXC 3JRAA 1I1SA 4AVZA 4IHYA 5M5XJ 3TP0A 3OYEA 4RM3A 1LE8B 1SD7A 2QLZA 3SJMA 3AG4H 2DN0A 3P5JA 1S29A 2VBYA 3DEEA 1T2KA 4KNYA 4G7OF 4X6AJ 1MBJA 2IBDA 2JUGA 2AXTC 1VQ4I 2OCCH 3MCZA 4JX6A 2GOMA 5ILSA 2AS5F 1A04A 4LLNA 3NWTA 1X2NA 2GM4A 1ETYA 5J1YA 2OF7A 4XN0A 3WGGA 3K1PA 2ZC2A 1ENHA 2QF7A 2EFWA 2H27A 4A6EA 2L01A 3JAMZ 1BR4A 4RBOA 2ZNYA 1GUUA 3H35A 1Z6TA 4YEJA 2V9PA 2CWEA 3VYRB 2E7WA 3OYLA 1JXSA 3BJ6A 3C2GA 4E6KG 2UXNA 4XKCA 2JSPA 2ID3A 4CYCB 1DP3A 3DTKA 2KHMA 3W3CA 3IKVA 2JPCA 4M9XA 3D5SC 3TL4X 3OL3A 2EV6A 3C18A 1TWCJ 2WADA 4M9SA 3RQ4A 2ID6A 3DFGA 2L7FP 2DODA 3NRVA 2RV8A 2M5WA 1WJCA 2DMNA 2LLKA 4XLEA 3S2WA 4R79A 4U7BA 1DP7P 3B73A 4CICA 4MTDA 2DTZA 4WXCA 4H0EA 3CMMA 5FKOA 1ODDA 2CFXA 2OD5A 4P55A 4UHTA 2DTRA 4RM2A 3AAFA 1D5YA 2LP0A 3IAS2 4IO9F 2FRHA 4PGHA 3SZTA 3TO9A 1EA3A 2V7FA 2R7VA 1JTXA 4RAYA 4EGYA 2ESHA 3DEWA 3PM1A 3HGYA 4F3QA 1XGSA 2W4SA 2EA2A 5IT3A 1E17A 4CCOA 4QTRA 2LRDA 1E3HA 2OBPA 3FXLA 3S1RJ 2MYSA 2X85A 1XSDA 2MC4A 1RI7A 2DO7A 4WWCA 2JK3A 5A2QK 1HDDC 1W7PB 1BR2A 1YRNB 2GBYA 5L3BA 3EPZA 3HHHA 1R23A 1TLHB 4P9FA 3ULQB 1Z05A 2X1EA 2H8WA 2LVSA 2D45A 3HXLA 5F1RA 1VTNC 3HUGB 4L0YB 1YW8A 4B44A 4HX4A 4ENJA 4IF4A 5LHIA 1E3PA 4D9JA 2M0CA 1VQOI 2MABA 4A3GJ 1JKQC 2R7OA 4KITB 1JT0A 2MD0A 3CCSI 5H20A 3I59B 3LNQA 2Q8KA 2O7OA 3V42A 2VUMJ 1ZHFA 2L2OA 4IRGA 3GYHX 1Z7UA 2L5QA 2NS8A 3P9IA 5IT9K 4XRSA 1B59A 1ZR4A 1I5ZA 3NEUA 1IRFA 4XOPA 2GAUA 2NVUB 3CCEI 3LA2A 4GYIA 2VJ5A 3KX2A 3QYBA 3RCOA 2P6SA 5F04A 1YFHA 1X58A 3LSTA 4RGXA 1MW7A 2KDOA 2Q1ZB 4Y7NJ 1T8IA 4GDFA 5ICEA 1X4PA 3OV8A 2VOPA 2QSFX 3B6AA 4RB0A 4ANJA 3OSFA 2WY8Q 1EKEA 3GFJA 1TP4A 2QKLB 3C2BA 3KYCB 4XICA 1XDUA 3R61A 2XB5A 2LY9A 3FXUA 5DM6F 4XLCA 3WTTC 2RNGA 3R6SA 1OISA 1IN6A 5FD5A 1WH5A 2E5NA 3DPUA 4BKXA 5EEGA 3WU0A 3FXMA 3TQNA 1IDZA 3DP7A 1BI3A 5BNGA 4BGDA 1ZG1A 2HZDA 2BVMA 4AIKA 1XMXA 2IGOA 2ZFWA 4UVAA 1VQ7I 3LSGA 1WGXA 2WBMA 1RETA 2Q2EA 2XDVA 3C7JA 3QODA 5HDGA 3L2VA 3RPUD 1YS7A 2RVCA 3LFKA 4PUSA 1J59A 4RB3C 4LG3A 3BR6A 4ASNA 3ML6A 2UZKA 5E1XA 4E7ZA 2VJJA 3BG3A 1HW2A 1KYWA 4ESJA 4XKWA 1VQLI 2LKPA 3J7ZI 1XCBA 2PMZA 3S14J 3KP6A 3SQNA 4S05A 2EWNA 1S72I 4UB8C 2Y2ZA 5IT9Z 2F5CA 3KPHA 2RDPA 1N75A 5HDNA 1LDKB 2K9QA 2JA5J 2BHYA 3KZIC 4KA4A 5IPAA 4U88A 1O3TA 4AC0A 1W36D 1KQ9A 4CH7A 4TV7A 3ZMUA 3EYYA 1RPWA 3VSLA 4HV6A 1QZYA 4G6TB 2HOTA 3FXKA 1NHAA 2LD5A 2EPFA 3T8TA 3I4MJ 4A0ZA 3H92A 3IH4A 4II2A 2RAEA 2VODA 3GZ6A 4MEXF 2DA2A 1DDNA 5K7ZA 1UMQA 3S16J 2E5ZA 1J0RA 5LRSA 3K69A 2NOGA 1JTYA 3F8FA 2L0KA 3PSFA 4M3DA 2QBYA 2KIMA 1MSEC 3IRRA 3S17J 5EDNA 1YRNA 1PVEA 1FBSA 2VOOA 2BY2A 3HB9A 5GTIC 1W7PA 3I0TA 4UB6C 1BI2A 1SAUA 5K5QA 1A5JA 2DFFA 3GLXA 1KZHA 2WAQA 1X4OA 3G1OA 4D7MA 4HRIA 3Q0VA 2VBZA 1TWFJ 4U0WA 3TW7A 3V7CA 2WY7Q 1IRXA 2BHZA 3WTYC 4I09A 1YOVB 2CUEA 3CJRB 3FKIJ 2K40A 1WCMJ 3KP7A 1K61A 1LVAA 1QU3A 4IPAA 1SFEA 3H0GJ 3E5UA 4XORA 1S7AA 3ZXSA 4FQGA 2MGQA 2DFEA 4XIDA 2M34A 4BE2A 5IOZA 3S1MJ 3MKZA 2IAIA 3CUOA 4BEHA 3HGGA 1T56A 2FEZA 2P5LC 3WODF 3N4MA 1UG2A 1S5LC 3A01A 4QPOA 4XLAA 4IQJA 2X9DA 4GRIA 3GTJJ 4PZJA 4RA2A 3KZYA 3WTZA 1GXQA 1U6GA 2Y0MA 3BTJA 4EJUA 3V8KA 1R49A 1QRYA 2IVMA 2M0MA 3SFIA 1MNDA 3IUOA 1QHGA 3RQIA 4YIIA 5DV5A 1OPCA 2DCEA 2K85A 3ONQA 2A3SA 3FIWA 3ZQFA 2CRGA 3CMAI 3ZR8X 5LBQA 3ECOA 1QGPA 4M3BA 4DYRA 2FUG2 3LSRA 5FLXK 4IOAF 4A3BJ 1V4RA 1NG6A 2X1DA 2LTPA 5J1UA 1D3YA 3H5RA 2XHKA 3L7WA 4KUMA 3FWEA 2J5PA 3BPVA 3SDBA 3F8MA 1PJRA 4WXDA 3TMOA 1ETOA 1ZR2A 3M7GA 1FOXA 3L9FA 3QOEA 3CF5F 2K3FA 2WWYA 2G0EA 5JVGF 3HJEA 1W7PD 2QQ8A 4ITVA 2FXAA 3BC8A 1ZLKA 4B43A 2OTJI 3GFMA 4IRHA 3I3LA 4MEYF 3DU5A 4PJMA 4BJ6C 3J80Z 5F64A 1NK2P 2VPLA 2V1NA 4DOZA 2A69F 3RKYA 4OAZA 3SHFA 3FZVA 1S6LA 3HOTA 2K7LA 1STZA 1P6RA 3HPGA 3KEYA 1T98A 2P7VB 2STWA 2X48A 3F22A 3U1DA 4PJLA 3K4NA 2YS9A 1T95A 1OCPA 1IRZA 1N78A 2MSYA 2GOXB 4ZH4F 5E1ZB 3TO7A 4BBRJ 2R5ZB 2ECCA 3S2DJ 3H9GA 3PQJA 3RJPA 3FXJA 2DMPA 1FJLA 2LFBA 1B4AA 1XC5A 3G4SI 2CMPA 2H1LA 4HDUA 2K4JA 4NQWB 1ERDA 1FSHA 2NS7A 2E1CA 1HW5A 4IX7A 1VI0A 1IDYA 3G1MA 2D1VA 2FBIA 5LEJA 3EUHC 3MN2A 4RLFA 1IZ1A 3F6VA 1V3FA 3OR1C 4FX0A 1U78A 3F9KA 2UXXA 2RKHA 5HS7A 1R36A 1YS6A 3TEDA 3K70C 4JYKA 5D5UB 4S04A 3BWGA 4N0BA 4IHWA 3F6OA 1T08B 5E20A 2W1OA 2QUFA 4UUSB 5J4YA 2KP6A 4I2OA 1XSXA 4Y15A 1SEUA 2DK8A 2Z2SB 3MWMA 3LSJA 4CUGA 2R4GA 5J47A 4FE7A 2P8TA 2DA4A 3ZMTA 5LD2C 3UKGA 1OYIA 1K4TA 5F0FA 1IW7F 4PK4A 3OYKA 3DXJF 1X19A 2GZWA 1JUSA 1YJNI 2XSJC 1UHSA 5L3EA 2RGVA 1BA5A 1Y6IA 1VQNI 2Y31A 5TJJA 5KNLA 4II3A 5F08A 4FETA 4B4CA 5B1AH 1UB9A 4UY8I 1T33A 3J80K 1GHCA 4K2EA 3ZGKA 3HZJA 3HSEA 4M9ZA 4RAFA 2CO5A 4G9YA 4U0YA 4FISA 4CCLA 3S1NJ 4M71A 2V4JC 4A5MA 4ZDLA 1J75A 2L54A 2DW4A 3JCUC 1TW3A 2VXZA 3LFUA 4RAZA 2YX4A 1X1BA 1X1DA 1U5TA 4IVNA 5GP9A 3VFZA 5K1YA 4KMFA 3D5LA 5FB2A 3E3VA 1U9NA 2B63J 3F8NA 4Y4RA 1UELB 4PFPA 4NC6A 1MJAA 2MC3A 2PEXA 2HOSA 3BJOA 1ONVA 2KISA 1JUMA 1JGSA 2ZMEB 4RMNA 2LKXA 3L00A 1BL0A 1IN8A 2NOJB 4MFDA 3BZKA 1IJWC 5CVRA 2UV1A 1UCRA 3FBNB 4HZFA 3OYFA 3ERED 3VPRA 1GV5A 2Y69H 3RYPA 2XB0X 5CVIA 1XX5A 4DW6A 2W84A 2HYFA 1N25A 2M8GX 3G3ZA 2GA1A 4HA8A 4HX7A 3WE3A 1IGNA 2AXLA 3IC7A 3RYRA 2GXGA 5FKLA 2CU7A 1EH8A 1ZARA 1F1ZA 4F52A 4KISA 5ICGA 1YJWI 1BIAA 2R3SA 5E18F 3B6CA 3BT9A 3WE2A 1UG0A 2Z5UA 5DD8A 4L9VA 2XF7A 3WTWC 3JTHA 4NBQA 4HV5A 1PYVA 4AWXB 5HLHA 1VQPI 3V8LA 1MKMA 2WC2A 2XF6A 3ABLH 3BTCA 3I4PA 2L7KA 3CDLA 4IQ4A 3ZQ7A 3OYJA 3JRIA 3CMEI 3H3ZA 3T8RA 1TT5B 3MZ8A 2L4MA 4LB5A 4A3FJ 3S3MA 4XLFA 1KU7A 1ZG5A 1JJ6C 5CQEA 3WTSC 1BJAA 2XGEA 2P0WA 2ZXWH 4HOBA 4H4KC 5EEHA 3DPLC 1DU0A 1F36A 1UJ8A 4LGWA 4OWRB 5HDKA 5BS6A 4I0BA 2HYGD 1JKRC 5IP6A 4JK1X 5D6EA 4P5OA 3LA3A 5EGOB 3LL7A 1SANA 3MQ0A 3KFWX 1U3EM 3GTOJ 2O6GE 1VFCA 1IG7A 1LKXA 2XGCA 2XPUA 3DQVC 2V26A 2BE5F 4FT8A 4FCYA 2LDUA 3FMQA 1DUXC 2PX9A 4MQ9F 2Y75A 1LDJA 2RQQA 1FPQA 2KRFA 3Q9VA 1RESA 2EZKA 3A0HC 4XSZF 1H89C 1POGA 2XRLA 3EYIA 3TGNA 1I39A 4L9JA 3KYDB 1IF1A 1VQ8I 3BG6A 3DEUA 2KPMA 3PO2J 3QPLA 4BHCA 3ZQQA 1GVJA 4EATA 4CA0A 3JRFA 1L0OC 1GT0C 3KE2A 1MIJA 2CW0F 2LY2A 2F6CA 3RKXA 5AONA 1X3UA 1OR7C 4BH9A 4DQ2A 4EM2A 2HI3A 5K7FA 3G73A 2W25A 2ZXHA 2JVGA 3CP8A 2UUZA 4EJWA 2IP2A 1XDSA 4CCNA 2CQNA 4YIFA 3E5XA 5C44J 1D8JA 4CCJA 4I98B 3F3XA 4FASD 5JLXA 2NNYA 5DD4A 1QPMA 4C2MJ 1LEBA 3SEQA 3ZMZA 2VKDA 2ZKZA 4CCMA 3K4CA 2LKSA 2EQRA 5HLIA 3HRMA 4BQAA 2D2WA 2OPTA 1OCZH 1KYZA 1Y8QB 2QWWA 4AU7A 4QSHA 1TC3C 5E3MA 4Y3OA 1YHQI 1FBQA 1TQPA 1K7AA 2HQRA 3BG9A 3TP3A 3GBGA 1DGWY 5HODA 1WI3A 2DMTA 2MD5A 1G59A 1G2HA 2GXAA 2KIUA 3VEPA 1TBXA 4LD5A 1J5YA 1G6NA 1U9OA 3A03A 1DU6A 1FTTA 1Z7LA 4MIMA 4D5FA 3H9JA 4A3MJ 5D4RA 5AIPA 4ZTFA 1OCCH 2QM3A 2M7AA 3RSNA 3KP4A 1OYYA 2DYRH 2M3AA 2LH9A 1Y0NA 3B02A 4F7ZA 2VQLA 4F55A 6PAXA 3GXOA 3FK7A 1XTAA 5D5VB 1TW2A 2IEKA 4HAMA 2ELJA 1G4DA 5E79C 4XRSG 2OAZA 2QSGX 2CW8A 4AD9A 2R5ZA 3E97A 3H3VK 2WV1A 3JAMK 2DA7A 3E6DA 2XKPA 2PBIA 4JP0A 2FNAA 1FOKA 3ABMH 4IXAA 2VC0A 4OMZA 3ZN0A 4BJTA 4QLCU 2DDAA 4I02A 2MA3A 1S7OA 2VT2A 1YE9A 1P9QC 3PFIA 3WHCA 1U5TC 1ON2A 2FU4A 4I7HA 3GEZA 2HTJA 2Y0SN 2A05A 3CUQA 1ZAOA 3QP6A 5HS9A 5JI6A 1Z67A 2DT5A 4XL9A 3R4KA 3HRSA 2I8DA 2NVYJ 4LFUA 4HQEA 3A02A 1LFPA 3HOSA 2TCTA 3MKYB 1HSJA 4XKVA 5B1BH 3HOZJ 1IC8A 1SVLA 2VB6A 1HOMA 1G3SA 1J09A 4LMYA 1Z91A 1HDPA 3GZNB 3HDDA 4L0ZB 3HRTA 1I3QJ 1WPKA 2XPWA 1MBGA 1W0UA 3LMMA 1WWXA 4ZYAA 2ISZA 3MKWB 2O61A 3E6MA 3BZCA 3W6VA 2R93J 5GAEJ 1BJZA 1LNWA 4KN4X 4CYDA 2VPRA 3BP8A 3JRGA 3PJRA 4LG0A 5J1RA 4M74A 5FKMA 1FYKA 4PCQA 3MAJA 4E7KA 2X0LA 5EGOA 2IXSA 2O8KA 2DFHA 4ZYGA 1SFKA 2DA3A 2PG4A 1QO0D 4CCKA 2CQKA 3WGHA 1HA8A 3V7SA 1JHFA 2QYOA 4MO7A 2IS6A 4BAYA 1H9TA 2KT0A 4CXFA 2QQAA 1W5TA 3ZOBA 2LMDA 3OIOA 1R1UA 3TOBA 3M8FA 4BJ5C 2DYSH 3ASNH 5DDGA 3PIPF 1IXSB 1RR7A 3M9AA 2WAFA 2P5KA 3P9CA 1MSFC 4A3KJ 3K9TA 2V1UA 1WJDA 4LK1F 1LE8A 4BNCA 3RZDJ 2EH3A 3CMYA 4WX9A 2K3PA 3CJTB 3CCVI 1NG7A 1WVRA 4BBSJ 4X0GA 1K78B 1F5TA 1D1CA 1S3JA 2ZXJA 4PDKA 4ZDPA 2OUMA 2ICWG 2WAEA 4M3EA 4HNUA 5LGTA 4IOCF 1O3QA 2X4HA 3U2RA 3KYLA 1ZGWA 2LSOA 1E3OC 5E3NA 2WTEA 2K9LA 3UNGC 3SZGA 4IL6C 3HOWJ 1BC7C 3HYIA 1FOWA 2JZYA 3NQOA 2JQ7A 2R7RA 4LOCA 5D5XB 3S3NA 2DQLA 2IS2A 3ZRGA 2XKOA 4KT6A 5FO5A 5DUIA 3K2AA 3OYAA 3REOA 2W7NA 3TBIA 5ED4A 3G71I 4WK8F 1JJ8C 4EM1A 3CUQC 1WJEA 3VDXA 2I5UA 1S8NA 2HXIA 2NVQJ 1W5CC 4C3IJ 5C3EJ 4HDVA 3BR0A 3P9KA 4I0AA 4MGRA 1JUPA 3DKYA 3BZ6A 3IP4B 1YX5A 2GIZA 2WV0A 4OAYA 5B3SH 3JREA 1SFXA 1B6AA 2M4GA 5DS9A 4R1HA 3WG9A 3TDZC 3PNYA 4Y13A 1TNTA 1HW1A 2JRMA 2OCEA 5GAHJ 2LF8A 1Z77A 2HXOA 3V4GA 4ESFA 3JSOA 4ON0A 2JJ7A 3I9V2 4YFNF 1MBHA 4CZCA 2LR8A 2M87A 2KIQA 3JRDA 1R6RA 2L02A 2MLGA 3GTMJ 4C30A 2QEXI 2K5CA 2CFOA 4L5EA 1Y0UA 1E2XA 2XPVA 5HLTA 3DF8A 2JMWA 5IYCJ 2HQAA 1ZREA 5EG0A 2DAOA 3LSHA 1GLNA 2RN7A 2W24A 3DBLB 3WTUC 3BQZA 1FZPB 3HC7A 4Q4ZF 3LSIA 2ZFUA 2F4OB 5FKKA 1ZELA 2IW5A 3CCQI 3GTGJ 4KIFA 4P1WA 3PL8A 2VKHA 2FBHA 3BJAA 3RKWA 2AQFA 4E7SA 1OLTA 3K4JA 2PJRB 2LG4A 4W97A 5L3FA 3OR2C 1LPQA 1U0JA 4F91B 1XN7A 2QQ9A 2F2EA 1SMYF 4BY1J 3DU6A 4LLLA 4I6ZA 4OIPF 3CLQA 1K6OA 4A2UA 1OJLA 1W5SA 2Y30A 4M3GA 1JKOC 2M2EA 4AYBA 1AWCA 3PQKA 4RAGA 1J2XA 1M1EB 2E2HJ 4CO8A 4PFOA 5BPDA 4XBFA 1B72B 1WKMA 2XROA 1AU7A 1WQ2A 4Z6YA 2VJ4A 2JVHA 3W6KB 1I1GA 5B66C 3D1NI 1IRGA 2HQ5A 2VXDA 3HOUJ 3H5AA 4BXFA 3H9QA 5ILVA 4I99C 1O3RA 3T5XA 2HQNA 2DFIA 4D7NA 2K9SA 3DKXA 2A07F 4A3JJ 2TRTA 5A2QZ 1JGGA 1USTA 5LEKA 4IRIA 1FT9A 3CJNA 4U0VA 3TKYA 4OIOF 1GV2A 1P2FA 2E2IJ 2EZIA 3HSFA 2EZLA 1F4KA 2XAGA 3Q0UA 3TOAA 1FYLA 1SC7A 2K02A 1YO5C 4NNJA 3EUKL 3SFZA 4YFKF 3DTEA 1FIPA 1G8XA 1VQ6I 2M1BA 4YELA 2XGDA 2E1OA 5K5OA 2XASA 2VIXA 1R1VA 3J81Z 3J7AY 5J40A 3IWZA 4BU2A 2KJBA 2L9SA 4XQFA 1Z3YA 4BXXJ 2OZUA 4NHJA 1ZRCA 1T0FA 3LQRA 2E1MC 5ICCA 4KMUX 4BL0B 2JA7J 2FBKA 2M7BA 2VASA 2HYJA 1Z3XA 3FXRA 3S1QJ 3CC2I 4LJZF 2EV0A 2OQRA 2DPUA 2JWTA 3PUFA 3ZQLA 2DMUA 1B9MA 2ZNZA 2XAHA 2VL8A 2P6TA 3WHBA 2NNNA 4HF0A 2R7XA 2R7FA 3I71A 1YX3A 2BY1A 3OSGA 3NAUA 2E60A 2IPQX 5LRRA 5FD6A 5KAFC 1W36C 1JHHA 4NUBA 4A3DJ 1WJ5A 4U7DA 2CJJA 3BDDA 2ELKA 2W00A 2EINH 2LK2A 3CCLI 3FF5A 2VQGA 5BPIA 3AKZA 1ZQ3P 2IT0A 1OCTC 3CDHA 4X1EA 2YU3A 5HLGA 3MFKA 4WF2A 4AVPA 2HDWA 3HL2A 3L1PA 3OIPA 1FY7A 5FROA 1V5GA 3SEZA 3QPTA 3OOUA 1SAXA 2ZCWA 4EJOA 3S3OA 4BXUA 2CYYA 4YRVA 4LK0F 1ZGAA 3Q0WA 1MDMA 1MMGA 3A2KA 2QGUA 3X2QH 1AKHA 1TL8A 3S15J 1DQUA 3F8CA 3I53A 1XS9A 4LB6B 5H2FC 2D5VA 3BROA 2A6EF 2OA4A 2RREA 2IA1A 4BHBA 1W4MA 3QP5A 2X6WA 1T38A 4Y52J 4RGRA 4HG2A 2IGKA 3RIRA 5FKNA 5LHGA 2V79A 2P7CB 2L9NA 3DLLF 3GTQJ 2LNBA 3PO3J 3ECHA 2IS1A 2F5FA 2NAZA 1ZH5A 3HM5A 1APLC 1JI8A 2VBXA 2HS5A 1BBYA 3GTKJ 2HPIA 5LHHA 5DCMB 3DBHB 1HSTA 3FM5A 2PMZN 4G8XA 2XGXA 5EZHA 1UAAA 1LJ9A 3CZ6A 2ZJRF 1WJFA 4HF1A 1DPUA 4R8HA 1YW7A 1ETKA 2VLAA 1IAWA 5IYDJ 2BVLA 2E1MB 1HXDA 4RGSA 2XRNA 3FK6A 3KCCA 1YLFA 1P92A 4PGGA 3MZYA 1RZ4A 5L3DA 2LYCA 1SFUA 1GXPA 1LB2A 1T39A 2M4KA 4XLHA 2HVRA 2ZJ2A 3DPTA 3G1LA 3M8EA 1XB4A 4GGGA 2OJED 3HSRA 4L5JA 4B48A 2O5RA 4UV8A 1B72A 3GF2A 3FISA 3K4BA 1C0WA 1HKSA 3DLAA 3PUBA 2A6TA 2CUFA 2QVOA 2KMUA 3BLYA 3BR3A 2FSWA 3HBLA 4M6VA 3D5RC 3N97A 3CDIA 4DZJA 3M1CA 4CDGA 1HLVA 2HOEA 2MG4A 4AIHA 2QA4I 4BQOA 2DXIA 4HEA2 2HKXA 1GVDA 2EV5A 2FMLA 1XGMA 3AG1H 1EJ9A 3LSKA 5J3LA 2X6OA 4IEJA 2BBYA 4QIWN 1ETWA 5BOXA 1FLIA 3O2PE 5HNFA 3CCYA 1H88C 2VI6A 4D5CA 1PUFA 5HOOA 1VQKI 2ISYA 4UNOA 1Y56A 1LFUP 2DDBA 2EFQA 2ZMEA 4BS9A 5J4VA 1SVOA 3JRHA 2QSHX 1L3LA 1SD4A 2Z16A 2Z3YA 3O6BB 1I3AA 2VJIA 3LWFA 4KJZA 3T1BA 4B8XA 5IOYA 4WCGA 4J19A 1IUFA 2O9LA 5L3CA 2C6YA 3F23A 1BW5A 1JT6A 4PJJA 1VF9A 2PMHA 3I64A 1D1BA 1XMKA 2EFOA 3V8JA 3E1SA 3CO6C 2CUJA 2BY3A 2CH0A 5FRNA 1Q1HA 1Q1VA 1RNLA 1TWAJ 3EETA 3IH2A 1QA6A 4AYBN 3EUHA 2B7EA 2GIVA 2Y48A 4HSRA 3TW6A 2B0LA 2E19A 3DV8A 4N9IA 1TQIA 2EILH 3OYGA 2COMA 4CZZA 4ENKA 1G3TA 3U1KA 4BYYA 2P4WA 2ACJA 1Y1VJ 3OOPA 1BI1A 3DTIA 1O4XA 3E5QA 5J6XA 3FHZA 1Z1DA 3RDIA 3W6JB 4C2TA 4EGZA 2FF4A 2JT1A 2EB7A 3GWZA 4AM3A 1D0YA 2L9VA 2FA5A 3W2WA 4EVIA 5CJ9A 3BY6A 3K70D 1CGPA 1V55H 2WAQN 5K5RA 1XD7A 3L09A 3OMYA 3OY9A 3GMEA 1Z6RA 1MMSA 5GPAA 2EIJH 4XRFA 2GXBA 1FEXA 5ICFA 1CF7B 1B9NA 2EJRA 2W48A 3IKTA 1OQYA 4UV9A 3S93A 3OYDA 3HTSB 1ITYA 2FOWA 1TZLA 1B8IA 2DBBA 4E7IA 4XLPF 2AQEA 3C2HA 3E6BA 4BDYA 2JSCA 4C3HJ 4KN7X 1IN4A 2R7ZJ 3JRCA 3OYMA 1TQMA 1ACIA 3PFYA 3IV5A 4AIDA 2XAQA 4A0XA 1A6QA 1D0XA 1O57A 5TGTA 2R7TA 1K4SA 1YG2A 4FHTA 2JA8J 2MBFA 3T0YA 3IRQA 1H9GA 4HX8A 1AKHB 4KT5C 2CV2A 1WFXA 2ME0A 1MDMB 5LGUA 1XGNA 3Q5FA 1NK3P 3HKZA 3CTAA 3I54A 3BCAA 1MNMC 1I27A 2KLOA 3I58A 4EEFG 2HVQA 1XGOA 4A5NA 3DBRB 2E2JJ 3KIOA 4HYEA 2BY0A 2X6YA 1R5ID 2BW3B 3VOEA 1HQCA 2QZ8A 4OIQF 1KU2A 3IH3A 1R4MB 2MH9A 4JX5A 2X1CA 3BG7A 4G94A 3LAPA 1ZN2A 4MNUA 3GW2A 2DMQA 2CSOA 2HKOA 2YR2A 3QU3A 2L7MP 2ZXIA 2YPRA 1TWHJ 3H5NA 1R00A 4HPQA 1PUFB 2HVSA 1RKTA 3PIOF 4BE0A 1MNEA 2KQRA 4G7HF 4LG0B 2FX0A 4GFBA 4KIBA 2BXYA 1U8BA 5CPRB 1P7IA 2LREA 2L7ZA 2H6CA 3ISPA 2G7UA 2OU2A 1YW9A 5E3OA 1D1AA 3JTGA 4MTEA 5E8GA 1NH3A 1J7KA 4HLXA 2R7DA 4G7ZF 1WI9A 2XUBA 2BV6A 3GX4X 4JQFA 1QZEA 2BGCA 1R58A 2VKEA 2DOAA 2IS4A 2O8XA 1R22A 4ENMA 2EIMH 4JX4A 3W2AA 2B9SA 3VB2A 2QBYB 2OQGA 2E1NA 3OYNA 1TT0A 2K27A 1RIOH 4PJ0C 4PSWA 5IP7J 4C3JJ 1LEAA 2MFZA 4EJVA 2ADUA 1GDTA 2KDZA 4A3CJ 4HW0A 3S32A 1D5VA 3ZQHA 4XRMA 4OINF 2R7QA 4QPQA 2VONA 4HNTA 2HEOA 2F4IA 1Z0XA 1BOBA 4XK4A 1MMNA 5H6QA 3CO7C 3CCRI 2STTA 1ZLJA 3PNTA 1RKWA 3QYFA 2HU9A 3CLOA 5DCFA 2YU9J 4KFCA 4KDPA 4IHVA 1T0FC 2G9WA 4Q5SF 1QQIA 3I5UA 1J9IA 3BR5A 2NRAC 3WG7H 1I50J 5GAGJ 4IHXA 4G6DA 1H0MA 2CQQA 3CESA 2O03A 3ROUA 1REPC 4HSTA 5JFRA 2XAFA 1LDDA 1G3YA 1ETXA 5FGMA 4W1UA 3U9GA 4MHGA 2H1KA 1X1AA 4CGZA 4PJNA 1OKRA 2MLKA 1K83J 3QYEA 1QBJA 3L2QA 1CF7A 3LAJA 2F48A 5KHDA 2D1HA 1W0TA 1LUJB 3KLOA 4L5IA 4Y17A 2HR3A 4RLQA 1V5FA 2X51A 3E7LA 5F0CA 1H8AC 1HKQA 1O7LA 2KRCA 2IJLA 4YG2F 4IHTA 3FM3A 1JE8A 2F4MB 3QAHA 3OYCA 2BEOA 2CS3A 1I6HJ 5F1JA 2VKVA 4ENNA 2LOOA 2K9NA 3HTUA 3BR2A 1X1PA 2KFDA 3BQYA 5FLMJ 1ZK8A 2V9KA 2P5VA 2ZBKA 1HBXG 4GCVA 2VN2A 2A5WA 1WHUA 3CUQB 1IXCA 3HG9A 1KA8A 5TISC 3CCMI 2AO9A 1Y39A 4OMYA 3CJQB 2FOKA 3LA7A 3I56I 1YIJI 4YFXF 5H6RA 5JLWA 2CUZA 2EA4A 3LSMA 3GCMA 2P81A 2RNJA 3TDUC 2XAJA 4DJAA 1O7FA 1MGTA 5B5EC 1ZGJA 2V1XA 3FMSA 5M5YJ 5D8LB 4ZJZA 5EF6A 2KL4A 2CGPA 9ANTA 3GZ5A 1USSA 4A69C 2HFHA 1WSUA 2YX7A 3KETA 2IRFG 1OR7A 2NS0A 2VQCA 5DUKA 1BM9A 4NC8A 4IKFA 1UZCA 3N05A 2VE9A 2WB1A 2PQ8A 2L3DA 3BR1A 1VNDA 3ZCOA 1SMTA 2DOEA 4JBAA 2IGNA 5AIQA 4B1RA 3GTPJ 2W85A 4HNVA 2HOAA 1ETVA 3GFIA 1G3WA 2F5DA 1IO2A 5GPCA 3RI4A 2KIFA 1RR8C 2Q0OA 1V5EA 3J7AO 3HHGA 5TRDA 1I6XA 1LFBA 3IL2A 3H0DA 1BI0A 2NVXJ 1BOAA 3JR9A 2BYVE 2COBA 2H09A 3VYUB 1FOYA 3O3KA 2NXNB 5CVJA 3VYSB 4J00A 5FRMA 2UWMA 3QPHA 3DKWA 1QNTA 3FDYA 4ZTJA 4DBRA 2CW7A 5FFXA 3VWBA 4DGWB 2V6CA 1X3WB 3GTLJ 3I4NJ 3C1DA 2AHQA 2A6HF 4B09A 1Y1WJ 4NC7A 4DYCA 1IV6A 2GWRA 5LGNA 1R4NB 1XG1A 2JTVA 4M73A 3SYTA 1YIOA 5J8CA 1VQMI 2E71A 5BMZA 1OMIA 1PUEE 2HDDA 5J8FA 1E0EA 3K4KA 5DCMA 1B8IB 1XCVA 4L18B 1O3SA 3HUGA 2YUSA 4E70A 3DWLE 1V54H 3HIFA 3M8JA 2ME6A 1UHWA 2LBFB 4S0HB 1U5TB 1R5HA 2JA6J 3S2HJ 1HC8A 4O3MA 3VODA 4A6DA 3HOXJ 3CC7I 2DA5A 3K7AJ 5D6FA 5KVRA 3BOQA 3JRBA 2WB1N 3ZPLA 3GUDA 4A93J 4G6QA 2W82A 3I59A 4HBLA 5JVTA 3MZHA 1KU3A 1FX7A 3W2VA 3C3WA 2H94A 3R60A 3ABKH 1IV8A 3E0JB 1A36A 2CG4A 3QQAA 2R7UA 2DQRA 3M07A 4KIGA 1UFMA 1X2MA 5JHUA 3RPQA 2FD5A 4WXHA 3JW4A 2Z1DA 3HKZN 4UUTA 4ZYEA 5HNHA 1MBFA 2F5EA 3AL0C 1BR1A 3F21A 4RB2C 1W1WE 1R7JA 1DGRM 2K4BA 4OOIA 1S9HA 3ZQGA 3G2BA 3HPHA 3RPUA 2CQ7A 3F8BA 2HPMA 1MJ9A 1MMDA 4E4HA 2L4AA 4MFEA 4V2GA 3FKJA 3OYIA 1OCRH 4XMYA 3GLLA 2Z9OA 3OYBA 5CQGA 4FTHA 4L9TA 1FP2A 3BG5A 4Y33A 3K6GA 3ESWB 1F9NA 2Q2EB 1AA7A 1FBUA 3A0BC 5CVUA 4AUXA 4NDLA 1PP7U 3EDPA 4IHSA 3LQQA 1Y8RB 1QPIA 3Q9SA 3ZQCA 1IN5A 1A31A 2PN6A 1MMAA 1FMWA 2I10A 2L9RA 2BW3A 3OS0A 2M45A 3U21A 4BDZA 3SXYA 3FHNA 1IUYA 4A12A 2EFPA 2LBFA 1P4XA 4N4OB 4LIVA 2CV0A 1TWGJ 1R5GA 3OS2A 2FQ4A 1YTYA 4RGUA 1VQ5I 2M30A 2TDXA 2V9VA 3VYTB 1VQ9I 4BACA 2XIGA 1AOYA 3M4OJ 4XM3A 3WTVC 4FX4A 3NWSA 5EJCA 5CKTA 5D4SA 3GO5A 4BHPA 4ZZDA 2BOLA 1K6YA 4NB5A 1OFCX 3FX3A 3CF2A 2DJNA 4E7HA 3QRFF 1MH3A 2Y0SA 2GA2A 2E36A 4IJAA 1P4WA 3K1NA 4LITA 5E17F 1KU9A 1EH7A 2DI3A 4BE1A 2H6BA 3F72A 1LVKA 4LLGF 4XLNF 2R7WA 3H36A 5KAIC 2NYXA 3IHUA 1X3ZB 4EJTA 4HF2A 2KJCA 4O5VA 2VQHA 4OIRF 1Z9CA 1RUNA 2Z33A 2XAUA 2E7XA 4ETSA 2ZJPF 2GQQA 3SZPA 3COAC 4DBQA 1XPXA 3HOYJ 1KQ0A 2PI0A 3L2WA 3H1CA 3QWLA 3G6EI 3CC4I 1QVTA 3P7NA 1F43A 5EZGA 2DLLA 1NTCA 4XONA
chains in the Genus database with same CATH topology
2OZ6A 4ZYDA 3QOPA 3WGIA 2EK5A 2QENA 1LQ1A 4P9UA 3KP2A 2HGCA 1ULYA 4Q47A 1K78A 5D8KB 4A0YA 1YYVA 3E6CC 2IA2A 3J81K 2JRTA 2EFNA 5CLSA 1ZYRF 2DK5A 4UVCA 3GVAA 2XV4S 1KGSA 1U2WA 3KP5A 1MZBA 2PMUA 2RC4A 1SD6A 4UXNA 1MD0A 2ELHA 4RB1A 5HS8A 2A5YB 5LLQA 1T6SA 3WU1B 3ELKA 1BC8C 3KEQA 2XVCA 4RS8A 3FXQA 2PJPA 1FP1D 1ZG3A 3K2ZA 2ZO4A 3D0SA 3R0AA 2IA0A 2JPBA 3ABTA 2V1DA 4OU0A 2ETHA 1P4AA 2FNPA 1DPRA 2Z99A 3ABUA 4CHUA 1D8KA 4GO1A 1EV7A 1R1TA 5BQTA 2J5OA 3M1EA 3EQLF 3QU6A 4GXOA 1MJBA 3FMRA 5F6FA 1KQ8A 1FNNA 5E8IA 5DEQA 1IXRC 2W57A 4ZYHA 4EQQA 5HVQC 4GYGA 3K0LA 2O3FA 3HRUA 4KYWA 2VC1A 3KZZA 4M6YA 3V7RA 1BN5A 4DNCA 4NQWA 3KEOA 4EMSA 5FLXZ 2VE8A 2PLYA 4Z2YA 3JSPA 2RQPA 4P96A 4L9NA 2M8EA 3K1MA 4UUVA 1QZZA 3TO6A 5CVVA 4O6JA 1FSEA 1TTYA 1WRJA 4I01A 3R0JA 3ZN1A 5DYMA 3GFLA 4EV0A 1RUOA 3ZP5A 2DPDA 5ERIA 2VT3A 4EM0B 4HQMA 4XSXF 2FE3A 3ZMSA 5L3GA 4AIJA 3KP3A 2A61A 3ZMVA 1XSVA 5KK1A 2PFBA 1OYWA 4KICA 2KKOA 4N9HA 1B1BA 3H3UA 2DU9A 4D0PA 2VBWA 1PP8F 2G7HA 1UHMA 1BIBA 1FWZA 2FQ3A 5D5WB 5FFZA 1YQAA 2ESNA 2HZTA 5ILUA 1XMAA 2HDCA 2HWVA 4MQVA 4M6XA 2MH2A 1U8RA 1FC3A 4QWQA 1ON1A 2O0YA 2YSRA 4M72A 1K79A 2QQBA 1ZRFA 3IWFA 3ZMDA 4HLYA 3KLNA 2FMYA 4ZZLA 1FYMA 4UVBA 5JR3A 2LF7A 2HTSA 1EH6A 1PDNC 1TNSA 1ZRDA 2K86A 2A68F 1SD5A 5E1WA 1IN7A 1HKTA 3BPXA 4Q48A 5CYVA 3RTRA 3L2CA 4ESBA 3MEXA 3WTXC 1I1SA 1SD7A 2QLZA 1S29A 2VBYA 1T2KA 4KNYA 4G7OF 3MCZA 5ILSA 2AS5F 1A04A 4LLNA 3WGGA 3K1PA 2EFWA 2H27A 4A6EA 2L01A 3JAMZ 2ZNYA 1Z6TA 2CWEA 2E7WA 1JXSA 3BJ6A 2UXNA 3IKVA 2JPCA 4M9XA 2EV6A 3C18A 4M9SA 3DFGA 3NRVA 2RV8A 2M5WA 4R79A 4U7BA 3S2WA 1DP7P 3B73A 4CICA 4MTDA 4WXCA 4H0EA 1ODDA 2CFXA 2OD5A 4P55A 4UHTA 2DTRA 3AAFA 2FRHA 4PGHA 3SZTA 3TO9A 4EGYA 4RAYA 2ESHA 1XGSA 2EA2A 5IT3A 1E17A 2OBPA 1XSDA 1RI7A 2DO7A 4WWCA 5A2QK 1W7PB 5L3BA 3HHHA 1R23A 1TLHB 4P9FA 3ULQB 1Z05A 2D45A 5F1RA 1VTNC 4L0YB 1YW8A 4HX4A 4ENJA 4IF4A 5LHIA 5H20A 3I59B 2Q8KA 1ZHFA 4IRGA 3GYHX 1Z7UA 3P9IA 5IT9K 1B59A 1I5ZA 3NEUA 1IRFA 2GAUA 3LA2A 4GYIA 2P6SA 1YFHA 3LSTA 4RGXA 5ICEA 3OV8A 2VOPA 4RB0A 3GFJA 1XDUA 3R61A 3FXUA 3WTTC 3R6SA 1IN6A 5FD5A 5EEGA 3WU0A 3TQNA 3DP7A 1BI3A 1ZG1A 4AIKA 2ZFWA 4UVAA 2Q2EA 3C7JA 5HDGA 1YS7A 2RVCA 3LFKA 1J59A 4RB3C 4ASNA 3ML6A 2UZKA 5E1XA 1HW2A 1KYWA 4ESJA 2LKPA 1XCBA 3KP6A 3SQNA 4S05A 2EWNA 5IT9Z 2F5CA 2RDPA 5HDNA 1LDKB 4KA4A 4U88A 1O3TA 1KQ9A 4TV7A 3ZMUA 3EYYA 4HV6A 1QZYA 1NHAA 3T8TA 4A0ZA 3H92A 2VODA 3GZ6A 4MEXF 1DDNA 1J0RA 5LRSA 3K69A 3F8FA 2QBYA 2KIMA 3IRRA 1FBSA 2VOOA 1W7PA 3I0TA 1BI2A 5K5QA 3GLXA 2VBZA 4U0WA 3V7CA 3WTYC 4I09A 3KP7A 1LVAA 4IPAA 1SFEA 3E5UA 1S7AA 3CUOA 2FEZA 2P5LC 3WODF 3N4MA 4PZJA 3WTZA 3KZYA 1GXQA 1U6GA 2Y0MA 4EJUA 3V8KA 2IVMA 4YIIA 5DV5A 1OPCA 2A3SA 5LBQA 3ECOA 1QGPA 5FLXK 1V4RA 1D3YA 2XHKA 3L7WA 4KUMA 3FWEA 2J5PA 3BPVA 3F8MA 4WXDA 3M7GA 3L9FA 2WWYA 1W7PD 2FXAA 1ZLKA 3GFMA 4IRHA 3J80Z 4MEYF 5F64A 2A69F 3RKYA 3SHFA 3FZVA 1S6LA 3HOTA 2K7LA 1STZA 1P6RA 2STWA 1T98A 2P7VB 3F22A 3U1DA 4ZH4F 5E1ZB 3TO7A 3PQJA 3RJPA 1B4AA 4HDUA 2K4JA 1FSHA 2E1CA 1HW5A 2D1VA 2FBIA 5LEJA 1IZ1A 3F6VA 1V3FA 4FX0A 1U78A 2UXXA 2RKHA 5HS7A 1R36A 1YS6A 5D5UB 4S04A 3BWGA 4N0BA 3F6OA 5E20A 2QUFA 4I2OA 1XSXA 4Y15A 2DK8A 3MWMA 2P8TA 3ZMTA 1OYIA 1IW7F 3DXJF 2GZWA 5L3EA 2RGVA 5TJJA 1UB9A 3J80K 1GHCA 4K2EA 3HSEA 4M9ZA 2CO5A 4G9YA 4U0YA 4M71A 4A5MA 1J75A 2L54A 2DW4A 1TW3A 2VXZA 4RAZA 2YX4A 1U5TA 4IVNA 3VFZA 5K1YA 4KMFA 3D5LA 5FB2A 3E3VA 3F8NA 1MJAA 2MC3A 2PEXA 3BJOA 1ONVA 1JGSA 2ZMEB 3L00A 1IN8A 5CVRA 1UCRA 4HZFA 3ERED 3RYPA 5CVIA 2W84A 2HYFA 3G3ZA 2GA1A 4HA8A 4HX7A 3WE3A 2AXLA 3IC7A 3RYRA 2GXGA 1EH8A 1ZARA 1F1ZA 5ICGA 1BIAA 2R3SA 5E18F 3WE2A 2Z5UA 5DD8A 4L9VA 3WTWC 3JTHA 4HV5A 4AWXB 5HLHA 3V8LA 1MKMA 2WC2A 3I4PA 3ZQ7A 3H3ZA 3T8RA 2L4MA 4LB5A 1KU7A 1ZG5A 3WTSC 1BJAA 4HOBA 5EEHA 3DPLC 4LGWA 5HDKA 5BS6A 4I0BA 2HYGD 4JK1X 5D6EA 4P5OA 3LA3A 3MQ0A 3KFWX 1U3EM 2O6GE 3DQVC 2BE5F 4FT8A 2LDUA 3FMQA 1DUXC 4MQ9F 2Y75A 1LDJA 1FPQA 2KRFA 3Q9VA 4XSZF 3EYIA 3TGNA 4L9JA 1IF1A 3DEUA 4BHCA 1GVJA 1L0OC 3KE2A 2CW0F 3RKXA 5AONA 1X3UA 4BH9A 4DQ2A 4EM2A 3G73A 2W25A 4EJWA 2IP2A 1XDSA 4YIFA 3E5XA 1D8JA 4I98B 3F3XA 2NNYA 5DD4A 1QPMA 1LEBA 3ZMZA 2ZKZA 5HLIA 3HRMA 4BQAA 2D2WA 1KYZA 2QWWA 1FBQA 1TQPA 1K7AA 2HQRA 2MD5A 2KIUA 3VEPA 1TBXA 4LD5A 1J5YA 1G6NA 5D4RA 5AIPA 2QM3A 3KP4A 1OYYA 3B02A 4F7ZA 6PAXA 3GXOA 5D5VB 1TW2A 4HAMA 1G4DA 2OAZA 4AD9A 3E97A 3JAMK 3E6DA 2XKPA 2PBIA 2FNAA 1FOKA 4IXAA 2VC0A 4OMZA 3ZN0A 4QLCU 4I02A 2MA3A 1S7OA 2VT2A 3PFIA 1U5TC 1ON2A 2FU4A 4I7HA 3GEZA 2HTJA 3CUQA 1ZAOA 3QP6A 5HS9A 5JI6A 2DT5A 3R4KA 3HRSA 4LFUA 4HQEA 3HOSA 1HSJA 1G3SA 4LMYA 1Z91A 4L0ZB 3HRTA 1WWXA 2ISZA 2O61A 3E6MA 4KN4X 1LNWA 4CYDA 3BP8A 4LG0A 4M74A 1FYKA 4PCQA 3MAJA 2X0LA 4ZYGA 2PG4A 1QO0D 2CQKA 3WGHA 3V7SA 1JHFA 2QYOA 4BAYA 1H9TA 4CXFA 2QQAA 1W5TA 1R1UA 3TOBA 3M8FA 5DDGA 1IXSB 3M9AA 2P5KA 3P9CA 2V1UA 3K9TA 4BNCA 4LK1F 4WX9A 1K78B 1F5TA 1S3JA 2ZXJA 4PDKA 1O3QA 5LGTA 2X4HA 3U2RA 2LSOA 2WTEA 1BC7C 3HYIA 3NQOA 2JZYA 5D5XB 2DQLA 2XKOA 5FO5A 5DUIA 3REOA 5ED4A 4WK8F 4EM1A 3CUQC 1S8NA 4HDVA 3P9KA 4I0AA 4MGRA 3BZ6A 2WV0A 1SFXA 1B6AA 4R1HA 3WG9A 3TDZC 4Y13A 1TNTA 1HW1A 2LF8A 3V4GA 4ESFA 3JSOA 4ON0A 4YFNF 2M87A 2L02A 2MLGA 1Y0UA 1E2XA 3DF8A 1ZREA 2DAOA 2RN7A 2W24A 3WTUC 1FZPB 4Q4ZF 2IW5A 4KIFA 2FBHA 3BJAA 3RKWA 5L3FA 1XN7A 2QQ9A 2F2EA 1SMYF 4LLLA 4OIPF 1K6OA 4A2UA 1W5SA 1AWCA 3PQKA 1J2XA 4CO8A 5BPDA 4XBFA 1WKMA 2XROA 1WQ2A 3W6KB 1I1GA 1IRGA 5ILVA 1O3RA 3T5XA 2HQNA 2DFIA 2A07F 4IRIA 5A2QZ 1USTA 5LEKA 1FT9A 3CJNA 4U0VA 3TKYA 4OIOF 1P2FA 3HSFA 1F4KA 2XAGA 3TOAA 1FYLA 2K02A 1YO5C 3SFZA 4YFKF 2M1BA 5K5OA 2XASA 3J81Z 1R1VA 3IWZA 2KJBA 2OZUA 4NHJA 1ZRCA 1T0FA 3LQRA 5ICCA 4KMUX 2FBKA 3FXRA 4LJZF 2EV0A 2OQRA 2DPUA 1B9MA 2ZNZA 2XAHA 2P6TA 2NNNA 4HF0A 2R7FA 3I71A 2IPQX 5LRRA 5FD6A 1JHHA 4U7DA 3BDDA 3FF5A 5BPIA 2IT0A 3CDHA 2YU3A 5HLGA 3MFKA 4WF2A 4AVPA 1FY7A 3QPTA 1SAXA 2ZCWA 4EJOA 4BXUA 2CYYA 4LK0F 1ZGAA 1MDMA 3F8CA 3I53A 4LB6B 3BROA 2A6EF 2OA4A 2IA1A 4BHBA 1W4MA 3QP5A 1T38A 4RGRA 3RIRA 5LHGA 2V79A 2P7CB 2LNBA 3ECHA 2F5FA 2NAZA 1ZH5A 2VBXA 2HS5A 1BBYA 5LHHA 5DCMB 1HSTA 3FM5A 4G8XA 2XGXA 1LJ9A 1DPUA 4HF1A 4R8HA 1YW7A 1IAWA 1HXDA 4RGSA 2XRNA 3KCCA 1YLFA 1P92A 4PGGA 3MZYA 1RZ4A 5L3DA 1SFUA 1GXPA 1LB2A 1T39A 2ZJ2A 3DPTA 3M8EA 1XB4A 4GGGA 3HSRA 4L5JA 4UV8A 3GF2A 1C0WA 1HKSA 2QVOA 2FSWA 3N97A 4CDGA 2HOEA 4AIHA 2FMLA 2HKXA 2EV5A 1XGMA 2BBYA 5BOXA 1FLIA 3O2PE 5HOOA 2ISYA 4UNOA 2EFQA 2ZMEA 1L3LA 1SD4A 2Z3YA 3O6BB 3LWFA 3T1BA 4B8XA 4WCGA 5L3CA 2C6YA 3F23A 2PMHA 3I64A 1XMKA 2EFOA 3V8JA 3CO6C 1Q1HA 1RNLA 3EETA 3EUHA 2GIVA 2Y48A 2B0LA 3DV8A 4N9IA 1TQIA 2COMA 4CZZA 4ENKA 1G3TA 4BYYA 2P4WA 2ACJA 3OOPA 1BI1A 3E5QA 5J6XA 3FHZA 1Z1DA 3RDIA 3W6JB 4EGZA 2FF4A 2JT1A 2EB7A 3GWZA 2FA5A 4EVIA 5CJ9A 3BY6A 1CGPA 5K5RA 1XD7A 3L09A 1Z6RA 4XRFA 2GXBA 5ICFA 1CF7B 1B9NA 2EJRA 3IKTA 4UV9A 3HTSB 2DBBA 4XLPF 3E6BA 2JSCA 4KN7X 1IN4A 1TQMA 2XAQA 4A0XA 1O57A 1YG2A 4FHTA 2MBFA 3T0YA 3IRQA 1H9GA 4HX8A 4KT5C 1MDMB 5LGUA 1XGNA 3Q5FA 3CTAA 3I54A 1I27A 3I58A 4A5NA 1XGOA 4HYEA 3VOEA 1HQCA 2QZ8A 4OIQF 1KU2A 2MH9A 4G94A 3LAPA 1ZN2A 4MNUA 3GW2A 2CSOA 2HKOA 2YR2A 3QU3A 2YPRA 1R00A 4G7HF 4LG0B 4KIBA 3ISPA 2H6CA 2G7UA 2OU2A 1YW9A 3JTGA 4MTEA 5E8GA 1J7KA 4HLXA 4G7ZF 2R7DA 1WI9A 2XUBA 2BV6A 3GX4X 4JQFA 2BGCA 1R58A 2O8XA 1R22A 4ENMA 3VB2A 2QBYB 2OQGA 2E1NA 2K27A 1RIOH 1LEAA 4EJVA 2ADUA 4HW0A 1D5VA 4OINF 2VONA 2HEOA 5H6QA 3CO7C 2STTA 1ZLJA 3CLOA 5DCFA 4KFCA 4KDPA 2G9WA 4Q5SF 1QQIA 3I5UA 1J9IA 2NRAC 4G6DA 1H0MA 2O03A 3ROUA 1REPC 5JFRA 2XAFA 1LDDA 1G3YA 5FGMA 3U9GA 4MHGA 4CGZA 1OKRA 2MLKA 1QBJA 1CF7A 3LAJA 2D1HA 3KLOA 4L5IA 4Y17A 2HR3A 1HKQA 1O7LA 2IJLA 4YG2F 4IHTA 3FM3A 1JE8A 3QAHA 2BEOA 4ENNA 3HTUA 2P5VA 2ZBKA 1HBXG 4GCVA 2VN2A 3CUQB 1IXCA 1KA8A 4OMYA 2FOKA 3LA7A 4YFXF 5H6RA 2EA4A 2RNJA 3TDUC 2XAJA 1O7FA 1MGTA 1ZGJA 2V1XA 3FMSA 5D8LB 2CGPA 3GZ5A 1USSA 2HFHA 1WSUA 2YX7A 3KETA 2IRFG 1OR7A 2NS0A 5DUKA 1BM9A 2VE9A 2PQ8A 2L3DA 1SMTA 4JBAA 5AIQA 2W85A 3GFIA 1G3WA 2F5DA 3RI4A 2KIFA 2Q0OA 3J7AO 3HHGA 5TRDA 1I6XA 3IL2A 1BI0A 1BOAA 2BYVE 2H09A 3O3KA 5CVJA 2UWMA 3QPHA 3DKWA 1QNTA 5FFXA 2V6CA 3C1DA 2A6HF 4B09A 2GWRA 5LGNA 4M73A 2JTVA 1YIOA 5J8CA 5BMZA 1OMIA 1PUEE 5J8FA 5DCMA 4L18B 1XCVA 1O3SA 3HUGA 4E70A 3HIFA 1UHWA 1U5TB 1R5HA 4O3MA 3VODA 4A6DA 3ZPLA 5D6FA 3BOQA 5KVRA 3GUDA 4G6QA 4HBLA 3I59A 5JVTA 3MZHA 1KU3A 1FX7A 3C3WA 2H94A 3R60A 2CG4A 2DQRA 4KIGA 5JHUA 1UFMA 3RPQA 4WXHA 3JW4A 4ZYEA 2F5EA 3F21A 4RB2C 1R7JA 2K4BA 4OOIA 3RPUA 3F8BA 1MJ9A 2L4AA 2Z9OA 4L9TA 1FP2A 1F9NA 1FBUA 5CVUA 1PP7U 3EDPA 4IHSA 3LQQA 3Q9SA 1IN5A 2PN6A 2M45A 1IUYA 3SXYA 4A12A 2EFPA 1P4XA 1R5GA 1YTYA 4RGUA 2M30A 2TDXA 2V9VA 2XIGA 1AOYA 3WTVC 4FX4A 5D4SA 3GO5A 4BHPA 4ZZDA 4NB5A 3FX3A 3QRFF 2GA2A 4IJAA 1P4WA 3K1NA 5E17F 1KU9A 1EH7A 2DI3A 2H6BA 3F72A 4LLGF 4XLNF 2NYXA 3IHUA 4EJTA 4HF2A 2KJCA 4O5VA 4OIRF 1Z9CA 1RUNA 2Z33A 4ETSA 2E7XA 2GQQA 3SZPA 3COAC 1KQ0A 2PI0A 3P7NA 2DLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZ6 A;  4ZYD A;  3QOP A;  3WGI A;  2EK5 A;  2QEN A;  1LQ1 A;  4P9U A;  3KP2 A;  2HGC A;  1ULY A;  4Q47 A;  1K78 A;  5D8K B;  4A0Y A;  1YYV A;  3E6C C;  2IA2 A;  3J81 K;  2JRT A;  2EFN A;  5CLS A;  1ZYR F;  2DK5 A;  4UVC A;  3GVA A;  2XV4 S;  1KGS A;  1U2W A;  3KP5 A;  1MZB A;  2PMU A;  2RC4 A;  1SD6 A;  4UXN A;  1MD0 A;  2ELH A;  4RB1 A;  5HS8 A;  2A5Y B;  5LLQ A;  1T6S A;  3WU1 B;  3ELK A;  1BC8 C;  3KEQ A;  2XVC A;  4RS8 A;  3FXQ A;  2PJP A;  1FP1 D;  1ZG3 A;  3K2Z A;  2ZO4 A;  3D0S A;  3R0A A;  2IA0 A;  2JPB A;  3ABT A;  2V1D A;  4OU0 A;  2ETH A;  1P4A A;  2FNP A;  1DPR A;  2Z99 A;  3ABU A;  4CHU A;  1D8K A;  4GO1 A;  1EV7 A;  1R1T A;  5BQT A;  2J5O A;  3M1E A;  3EQL F;  3QU6 A;  4GXO A;  1MJB A;  3FMR A;  5F6F A;  1KQ8 A;  1FNN A;  5E8I A;  5DEQ A;  1IXR C;  2W57 A;  4ZYH A;  4EQQ A;  5HVQ C;  4GYG A;  3K0L A;  2O3F A;  3HRU A;  4KYW A;  2VC1 A;  3KZZ A;  4M6Y A;  3V7R A;  1BN5 A;  4DNC A;  4NQW A;  3KEO A;  4EMS A;  5FLX Z;  2VE8 A;  2PLY A;  4Z2Y A;  3JSP A;  2RQP A;  4P96 A;  4L9N A;  2M8E A;  3K1M A;  4UUV A;  1QZZ A;  3TO6 A;  5CVV A;  4O6J A;  1FSE A;  1TTY A;  1WRJ A;  4I01 A;  3R0J A;  3ZN1 A;  5DYM A;  3GFL A;  4EV0 A;  1RUO A;  3ZP5 A;  2DPD A;  5ERI A;  2VT3 A;  4EM0 B;  4HQM A;  4XSX F;  2FE3 A;  3ZMS A;  5L3G A;  4AIJ A;  3KP3 A;  2A61 A;  3ZMV A;  1XSV A;  5KK1 A;  2PFB A;  1OYW A;  4KIC A;  2KKO A;  4N9H A;  1B1B A;  3H3U A;  2DU9 A;  4D0P A;  2VBW A;  1PP8 F;  2G7H A;  1UHM A;  1BIB A;  1FWZ A;  2FQ3 A;  5D5W B;  5FFZ A;  1YQA A;  2ESN A;  2HZT A;  5ILU A;  1XMA A;  2HDC A;  2HWV A;  4MQV A;  4M6X A;  2MH2 A;  1U8R A;  1FC3 A;  4QWQ A;  1ON1 A;  2O0Y A;  2YSR A;  4M72 A;  1K79 A;  2QQB A;  1ZRF A;  3IWF A;  3ZMD A;  4HLY A;  3KLN A;  2FMY A;  4ZZL A;  1FYM A;  4UVB A;  5JR3 A;  2LF7 A;  2HTS A;  1EH6 A;  1PDN C;  1TNS A;  1ZRD A;  2K86 A;  2A68 F;  1SD5 A;  5E1W A;  1IN7 A;  1HKT A;  3BPX A;  4Q48 A;  5CYV A;  3RTR A;  3L2C A;  4ESB A;  3MEX A;  3WTX C;  1I1S A;  1SD7 A;  2QLZ A;  1S29 A;  2VBY A;  1T2K A;  4KNY A;  4G7O F;  3MCZ A;  5ILS A;  2AS5 F;  1A04 A;  4LLN A;  3WGG A;  3K1P A;  2EFW A;  2H27 A;  4A6E A;  2L01 A;  3JAM Z;  2ZNY A;  1Z6T A;  2CWE A;  2E7W A;  1JXS A;  3BJ6 A;  2UXN A;  3IKV A;  2JPC A;  4M9X A;  2EV6 A;  3C18 A;  4M9S A;  3DFG A;  3NRV A;  2RV8 A;  2M5W A;  4R79 A;  4U7B A;  3S2W A;  1DP7 P;  3B73 A;  4CIC A;  4MTD A;  4WXC A;  4H0E A;  1ODD A;  2CFX A;  2OD5 A;  4P55 A;  4UHT A;  2DTR A;  3AAF A;  2FRH A;  4PGH A;  3SZT A;  3TO9 A;  4EGY A;  4RAY A;  2ESH A;  1XGS A;  2EA2 A;  5IT3 A;  1E17 A;  2OBP A;  1XSD A;  1RI7 A;  2DO7 A;  4WWC A;  5A2Q K;  1W7P B;  5L3B A;  3HHH A;  1R23 A;  1TLH B;  4P9F A;  3ULQ B;  1Z05 A;  2D45 A;  5F1R A;  1VTN C;  4L0Y B;  1YW8 A;  4HX4 A;  4ENJ A;  4IF4 A;  5LHI A;  5H20 A;  3I59 B;  2Q8K A;  1ZHF A;  4IRG A;  3GYH X;  1Z7U A;  3P9I A;  5IT9 K;  1B59 A;  1I5Z A;  3NEU A;  1IRF A;  2GAU A;  3LA2 A;  4GYI A;  2P6S A;  1YFH A;  3LST A;  4RGX A;  5ICE A;  3OV8 A;  2VOP A;  4RB0 A;  3GFJ A;  1XDU A;  3R61 A;  3FXU A;  3WTT C;  3R6S A;  1IN6 A;  5FD5 A;  5EEG A;  3WU0 A;  3TQN A;  3DP7 A;  1BI3 A;  1ZG1 A;  4AIK A;  2ZFW A;  4UVA A;  2Q2E A;  3C7J A;  5HDG A;  1YS7 A;  2RVC A;  3LFK A;  1J59 A;  4RB3 C;  4ASN A;  3ML6 A;  2UZK A;  5E1X A;  1HW2 A;  1KYW A;  4ESJ A;  2LKP A;  1XCB A;  3KP6 A;  3SQN A;  4S05 A;  2EWN A;  5IT9 Z;  2F5C A;  2RDP A;  5HDN A;  1LDK B;  4KA4 A;  4U88 A;  1O3T A;  1KQ9 A;  4TV7 A;  3ZMU A;  3EYY A;  4HV6 A;  1QZY A;  1NHA A;  3T8T A;  4A0Z A;  3H92 A;  2VOD A;  3GZ6 A;  4MEX F;  1DDN A;  1J0R A;  5LRS A;  3K69 A;  3F8F A;  2QBY A;  2KIM A;  3IRR A;  1FBS A;  2VOO A;  1W7P A;  3I0T A;  1BI2 A;  5K5Q A;  3GLX A;  2VBZ A;  4U0W A;  3V7C A;  3WTY C;  4I09 A;  3KP7 A;  1LVA A;  4IPA A;  1SFE A;  3E5U A;  1S7A A;  3CUO A;  2FEZ A;  2P5L C;  3WOD F;  3N4M A;  4PZJ A;  3WTZ A;  3KZY A;  1GXQ A;  1U6G A;  2Y0M A;  4EJU A;  3V8K A;  2IVM A;  4YII A;  5DV5 A;  1OPC A;  2A3S A;  5LBQ A;  3ECO A;  1QGP A;  5FLX K;  1V4R A;  1D3Y A;  2XHK A;  3L7W A;  4KUM A;  3FWE A;  2J5P A;  3BPV A;  3F8M A;  4WXD A;  3M7G A;  3L9F A;  2WWY A;  1W7P D;  2FXA A;  1ZLK A;  3GFM A;  4IRH A;  3J80 Z;  4MEY F;  5F64 A;  2A69 F;  3RKY A;  3SHF A;  3FZV A;  1S6L A;  3HOT A;  2K7L A;  1STZ A;  1P6R A;  2STW A;  1T98 A;  2P7V B;  3F22 A;  3U1D A;  4ZH4 F;  5E1Z B;  3TO7 A;  3PQJ A;  3RJP A;  1B4A A;  4HDU A;  2K4J A;  1FSH A;  2E1C A;  1HW5 A;  2D1V A;  2FBI A;  5LEJ A;  1IZ1 A;  3F6V A;  1V3F A;  4FX0 A;  1U78 A;  2UXX A;  2RKH A;  5HS7 A;  1R36 A;  1YS6 A;  5D5U B;  4S04 A;  3BWG A;  4N0B A;  3F6O A;  5E20 A;  2QUF A;  4I2O A;  1XSX A;  4Y15 A;  2DK8 A;  3MWM A;  2P8T A;  3ZMT A;  1OYI A;  1IW7 F;  3DXJ F;  2GZW A;  5L3E A;  2RGV A;  5TJJ A;  1UB9 A;  3J80 K;  1GHC A;  4K2E A;  3HSE A;  4M9Z A;  2CO5 A;  4G9Y A;  4U0Y A;  4M71 A;  4A5M A;  1J75 A;  2L54 A;  2DW4 A;  1TW3 A;  2VXZ A;  4RAZ A;  2YX4 A;  1U5T A;  4IVN A;  3VFZ A;  5K1Y A;  4KMF A;  3D5L A;  5FB2 A;  3E3V A;  3F8N A;  1MJA A;  2MC3 A;  2PEX A;  3BJO A;  1ONV A;  1JGS A;  2ZME B;  3L00 A;  1IN8 A;  5CVR A;  1UCR A;  4HZF A;  3ERE D;  3RYP A;  5CVI A;  2W84 A;  2HYF A;  3G3Z A;  2GA1 A;  4HA8 A;  4HX7 A;  3WE3 A;  2AXL A;  3IC7 A;  3RYR A;  2GXG A;  1EH8 A;  1ZAR A;  1F1Z A;  5ICG A;  1BIA A;  2R3S A;  5E18 F;  3WE2 A;  2Z5U A;  5DD8 A;  4L9V A;  3WTW C;  3JTH A;  4HV5 A;  4AWX B;  5HLH A;  3V8L A;  1MKM A;  2WC2 A;  3I4P A;  3ZQ7 A;  3H3Z A;  3T8R A;  2L4M A;  4LB5 A;  1KU7 A;  1ZG5 A;  3WTS C;  1BJA A;  4HOB A;  5EEH A;  3DPL C;  4LGW A;  5HDK A;  5BS6 A;  4I0B A;  2HYG D;  4JK1 X;  5D6E A;  4P5O A;  3LA3 A;  3MQ0 A;  3KFW X;  1U3E M;  2O6G E;  3DQV C;  2BE5 F;  4FT8 A;  2LDU A;  3FMQ A;  1DUX C;  4MQ9 F;  2Y75 A;  1LDJ A;  1FPQ A;  2KRF A;  3Q9V A;  4XSZ F;  3EYI A;  3TGN A;  4L9J A;  1IF1 A;  3DEU A;  4BHC A;  1GVJ A;  1L0O C;  3KE2 A;  2CW0 F;  3RKX A;  5AON A;  1X3U A;  4BH9 A;  4DQ2 A;  4EM2 A;  3G73 A;  2W25 A;  4EJW A;  2IP2 A;  1XDS A;  4YIF A;  3E5X A;  1D8J A;  4I98 B;  3F3X A;  2NNY A;  5DD4 A;  1QPM A;  1LEB A;  3ZMZ A;  2ZKZ A;  5HLI A;  3HRM A;  4BQA A;  2D2W A;  1KYZ A;  2QWW A;  1FBQ A;  1TQP A;  1K7A A;  2HQR A;  2MD5 A;  2KIU A;  3VEP A;  1TBX A;  4LD5 A;  1J5Y A;  1G6N A;  5D4R A;  5AIP A;  2QM3 A;  3KP4 A;  1OYY A;  3B02 A;  4F7Z A;  6PAX A;  3GXO A;  5D5V B;  1TW2 A;  4HAM A;  1G4D A;  2OAZ A;  4AD9 A;  3E97 A;  3JAM K;  3E6D A;  2XKP A;  2PBI A;  2FNA A;  1FOK A;  4IXA A;  2VC0 A;  4OMZ A;  3ZN0 A;  4QLC U;  4I02 A;  2MA3 A;  1S7O A;  2VT2 A;  3PFI A;  1U5T C;  1ON2 A;  2FU4 A;  4I7H A;  3GEZ A;  2HTJ A;  3CUQ A;  1ZAO A;  3QP6 A;  5HS9 A;  5JI6 A;  2DT5 A;  3R4K A;  3HRS A;  4LFU A;  4HQE A;  3HOS A;  1HSJ A;  1G3S A;  4LMY A;  1Z91 A;  4L0Z B;  3HRT A;  1WWX A;  2ISZ A;  2O61 A;  3E6M A;  4KN4 X;  1LNW A;  4CYD A;  3BP8 A;  4LG0 A;  4M74 A;  1FYK A;  4PCQ A;  3MAJ A;  2X0L A;  4ZYG A;  2PG4 A;  1QO0 D;  2CQK A;  3WGH A;  3V7S A;  1JHF A;  2QYO A;  4BAY A;  1H9T A;  4CXF A;  2QQA A;  1W5T A;  1R1U A;  3TOB A;  3M8F A;  5DDG A;  1IXS B;  3M9A A;  2P5K A;  3P9C A;  2V1U A;  3K9T A;  4BNC A;  4LK1 F;  4WX9 A;  1K78 B;  1F5T A;  1S3J A;  2ZXJ A;  4PDK A;  1O3Q A;  5LGT A;  2X4H A;  3U2R A;  2LSO A;  2WTE A;  1BC7 C;  3HYI A;  3NQO A;  2JZY A;  5D5X B;  2DQL A;  2XKO A;  5FO5 A;  5DUI A;  3REO A;  5ED4 A;  4WK8 F;  4EM1 A;  3CUQ C;  1S8N A;  4HDV A;  3P9K A;  4I0A A;  4MGR A;  3BZ6 A;  2WV0 A;  1SFX A;  1B6A A;  4R1H A;  3WG9 A;  3TDZ C;  4Y13 A;  1TNT A;  1HW1 A;  2LF8 A;  3V4G A;  4ESF A;  3JSO A;  4ON0 A;  4YFN F;  2M87 A;  2L02 A;  2MLG A;  1Y0U A;  1E2X A;  3DF8 A;  1ZRE A;  2DAO A;  2RN7 A;  2W24 A;  3WTU C;  1FZP B;  4Q4Z F;  2IW5 A;  4KIF A;  2FBH A;  3BJA A;  3RKW A;  5L3F A;  1XN7 A;  2QQ9 A;  2F2E A;  1SMY F;  4LLL A;  4OIP F;  1K6O A;  4A2U A;  1W5S A;  1AWC A;  3PQK A;  1J2X A;  4CO8 A;  5BPD A;  4XBF A;  1WKM A;  2XRO A;  1WQ2 A;  3W6K B;  1I1G A;  1IRG A;  5ILV A;  1O3R A;  3T5X A;  2HQN A;  2DFI A;  2A07 F;  4IRI A;  5A2Q Z;  1UST A;  5LEK A;  1FT9 A;  3CJN A;  4U0V A;  3TKY A;  4OIO F;  1P2F A;  3HSF A;  1F4K A;  2XAG A;  3TOA A;  1FYL A;  2K02 A;  1YO5 C;  3SFZ A;  4YFK F;  2M1B A;  5K5O A;  2XAS A;  3J81 Z;  1R1V A;  3IWZ A;  2KJB A;  2OZU A;  4NHJ A;  1ZRC A;  1T0F A;  3LQR A;  5ICC A;  4KMU X;  2FBK A;  3FXR A;  4LJZ F;  2EV0 A;  2OQR A;  2DPU A;  1B9M A;  2ZNZ A;  2XAH A;  2P6T A;  2NNN A;  4HF0 A;  2R7F A;  3I71 A;  2IPQ X;  5LRR A;  5FD6 A;  1JHH A;  4U7D A;  3BDD A;  3FF5 A;  5BPI A;  2IT0 A;  3CDH A;  2YU3 A;  5HLG A;  3MFK A;  4WF2 A;  4AVP A;  1FY7 A;  3QPT A;  1SAX A;  2ZCW A;  4EJO A;  4BXU A;  2CYY A;  4LK0 F;  1ZGA A;  1MDM A;  3F8C A;  3I53 A;  4LB6 B;  3BRO A;  2A6E F;  2OA4 A;  2IA1 A;  4BHB A;  1W4M A;  3QP5 A;  1T38 A;  4RGR A;  3RIR A;  5LHG A;  2V79 A;  2P7C B;  2LNB A;  3ECH A;  2F5F A;  2NAZ A;  1ZH5 A;  2VBX A;  2HS5 A;  1BBY A;  5LHH A;  5DCM B;  1HST A;  3FM5 A;  4G8X A;  2XGX A;  1LJ9 A;  1DPU A;  4HF1 A;  4R8H A;  1YW7 A;  1IAW A;  1HXD A;  4RGS A;  2XRN A;  3KCC A;  1YLF A;  1P92 A;  4PGG A;  3MZY A;  1RZ4 A;  5L3D A;  1SFU A;  1GXP A;  1LB2 A;  1T39 A;  2ZJ2 A;  3DPT A;  3M8E A;  1XB4 A;  4GGG A;  3HSR A;  4L5J A;  4UV8 A;  3GF2 A;  1C0W A;  1HKS A;  2QVO A;  2FSW A;  3N97 A;  4CDG A;  2HOE A;  4AIH A;  2FML A;  2HKX A;  2EV5 A;  1XGM A;  2BBY A;  5BOX A;  1FLI A;  3O2P E;  5HOO A;  2ISY A;  4UNO A;  2EFQ A;  2ZME A;  1L3L A;  1SD4 A;  2Z3Y A;  3O6B B;  3LWF A;  3T1B A;  4B8X A;  4WCG A;  5L3C A;  2C6Y A;  3F23 A;  2PMH A;  3I64 A;  1XMK A;  2EFO A;  3V8J A;  3CO6 C;  1Q1H A;  1RNL A;  3EET A;  3EUH A;  2GIV A;  2Y48 A;  2B0L A;  3DV8 A;  4N9I A;  1TQI A;  2COM A;  4CZZ A;  4ENK A;  1G3T A;  4BYY A;  2P4W A;  2ACJ A;  3OOP A;  1BI1 A;  3E5Q A;  5J6X A;  3FHZ A;  1Z1D A;  3RDI A;  3W6J B;  4EGZ A;  2FF4 A;  2JT1 A;  2EB7 A;  3GWZ A;  2FA5 A;  4EVI A;  5CJ9 A;  3BY6 A;  1CGP A;  5K5R A;  1XD7 A;  3L09 A;  1Z6R A;  4XRF A;  2GXB A;  5ICF A;  1CF7 B;  1B9N A;  2EJR A;  3IKT A;  4UV9 A;  3HTS B;  2DBB A;  4XLP F;  3E6B A;  2JSC A;  4KN7 X;  1IN4 A;  1TQM A;  2XAQ A;  4A0X A;  1O57 A;  1YG2 A;  4FHT A;  2MBF A;  3T0Y A;  3IRQ A;  1H9G A;  4HX8 A;  4KT5 C;  1MDM B;  5LGU A;  1XGN A;  3Q5F A;  3CTA A;  3I54 A;  1I27 A;  3I58 A;  4A5N A;  1XGO A;  4HYE A;  3VOE A;  1HQC A;  2QZ8 A;  4OIQ F;  1KU2 A;  2MH9 A;  4G94 A;  3LAP A;  1ZN2 A;  4MNU A;  3GW2 A;  2CSO A;  2HKO A;  2YR2 A;  3QU3 A;  2YPR A;  1R00 A;  4G7H F;  4LG0 B;  4KIB A;  3ISP A;  2H6C A;  2G7U A;  2OU2 A;  1YW9 A;  3JTG A;  4MTE A;  5E8G A;  1J7K A;  4HLX A;  4G7Z F;  2R7D A;  1WI9 A;  2XUB A;  2BV6 A;  3GX4 X;  4JQF A;  2BGC A;  1R58 A;  2O8X A;  1R22 A;  4ENM A;  3VB2 A;  2QBY B;  2OQG A;  2E1N A;  2K27 A;  1RIO H;  1LEA A;  4EJV A;  2ADU A;  4HW0 A;  1D5V A;  4OIN F;  2VON A;  2HEO A;  5H6Q A;  3CO7 C;  2STT A;  1ZLJ A;  3CLO A;  5DCF A;  4KFC A;  4KDP A;  2G9W A;  4Q5S F;  1QQI A;  3I5U A;  1J9I A;  2NRA C;  4G6D A;  1H0M A;  2O03 A;  3ROU A;  1REP C;  5JFR A;  2XAF A;  1LDD A;  1G3Y A;  5FGM A;  3U9G A;  4MHG A;  4CGZ A;  1OKR A;  2MLK A;  1QBJ A;  1CF7 A;  3LAJ A;  2D1H A;  3KLO A;  4L5I A;  4Y17 A;  2HR3 A;  1HKQ A;  1O7L A;  2IJL A;  4YG2 F;  4IHT A;  3FM3 A;  1JE8 A;  3QAH A;  2BEO A;  4ENN A;  3HTU A;  2P5V A;  2ZBK A;  1HBX G;  4GCV A;  2VN2 A;  3CUQ B;  1IXC A;  1KA8 A;  4OMY A;  2FOK A;  3LA7 A;  4YFX F;  5H6R A;  2EA4 A;  2RNJ A;  3TDU C;  2XAJ A;  1O7F A;  1MGT A;  1ZGJ A;  2V1X A;  3FMS A;  5D8L B;  2CGP A;  3GZ5 A;  1USS A;  2HFH A;  1WSU A;  2YX7 A;  3KET A;  2IRF G;  1OR7 A;  2NS0 A;  5DUK A;  1BM9 A;  2VE9 A;  2PQ8 A;  2L3D A;  1SMT A;  4JBA A;  5AIQ A;  2W85 A;  3GFI A;  1G3W A;  2F5D A;  3RI4 A;  2KIF A;  2Q0O A;  3J7A O;  3HHG A;  5TRD A;  1I6X A;  3IL2 A;  1BI0 A;  1BOA A;  2BYV E;  2H09 A;  3O3K A;  5CVJ A;  2UWM A;  3QPH A;  3DKW A;  1QNT A;  5FFX A;  2V6C A;  3C1D A;  2A6H F;  4B09 A;  2GWR A;  5LGN A;  4M73 A;  2JTV A;  1YIO A;  5J8C A;  5BMZ A;  1OMI A;  1PUE E;  5J8F A;  5DCM A;  4L18 B;  1XCV A;  1O3S A;  3HUG A;  4E70 A;  3HIF A;  1UHW A;  1U5T B;  1R5H A;  4O3M A;  3VOD A;  4A6D A;  3ZPL A;  5D6F A;  3BOQ A;  5KVR A;  3GUD A;  4G6Q A;  4HBL A;  3I59 A;  5JVT A;  3MZH A;  1KU3 A;  1FX7 A;  3C3W A;  2H94 A;  3R60 A;  2CG4 A;  2DQR A;  4KIG A;  5JHU A;  1UFM A;  3RPQ A;  4WXH A;  3JW4 A;  4ZYE A;  2F5E A;  3F21 A;  4RB2 C;  1R7J A;  2K4B A;  4OOI A;  3RPU A;  3F8B A;  1MJ9 A;  2L4A A;  2Z9O A;  4L9T A;  1FP2 A;  1F9N A;  1FBU A;  5CVU A;  1PP7 U;  3EDP A;  4IHS A;  3LQQ A;  3Q9S A;  1IN5 A;  2PN6 A;  2M45 A;  1IUY A;  3SXY A;  4A12 A;  2EFP A;  1P4X A;  1R5G A;  1YTY A;  4RGU A;  2M30 A;  2TDX A;  2V9V A;  2XIG A;  1AOY A;  3WTV C;  4FX4 A;  5D4S A;  3GO5 A;  4BHP A;  4ZZD A;  4NB5 A;  3FX3 A;  3QRF F;  2GA2 A;  4IJA A;  1P4W A;  3K1N A;  5E17 F;  1KU9 A;  1EH7 A;  2DI3 A;  2H6B A;  3F72 A;  4LLG F;  4XLN F;  2NYX A;  3IHU A;  4EJT A;  4HF2 A;  2KJC A;  4O5V A;  4OIR F;  1Z9C A;  1RUN A;  2Z33 A;  4ETS A;  2E7X A;  2GQQ A;  3SZP A;  3COA C;  1KQ0 A;  2PI0 A;  3P7N A;  2DLL A; 
#chains in the Genus database with same CATH topology
 5K7H A;  2ECB A;  2OZ6 A;  4ZYD A;  3F0C A;  4ABZ A;  3QOP A;  3WGI A;  3L2U A;  2EZH A;  2BZT A;  2EK5 A;  3VSK A;  2QEN A;  5C4X J;  3K4M A;  4J01 A;  1LQ1 A;  1CQT A;  4P9U A;  3KP2 A;  5IYB J;  3ERM A;  2HGC A;  4XNF A;  1N77 A;  1HF0 A;  1ULY A;  4Q47 A;  2OTL I;  2NVT J;  1K78 A;  2KRH A;  5D8K B;  5EEA A;  4A0Y A;  4BQN A;  5KCM A;  1YYV A;  5GTH C;  3FXO A;  3E6C C;  2X6X A;  2IA2 A;  3J81 K;  2JRT A;  2EFN A;  5CLS A;  1ZYR F;  2DK5 A;  3AG2 H;  4UVC A;  5EYR A;  1EF4 A;  3GVA A;  1ZKG A;  2ZSH B;  3PNV A;  1AHD P;  3AL0 B;  2XV4 S;  1R9T J;  1KGS A;  5DTD A;  1U2W A;  3A01 B;  4N4N B;  4LIU A;  2R7S A;  3KP5 A;  2PJR A;  1VZ0 A;  1MZB A;  2F5V A;  3FBI B;  4IZZ A;  3QPS A;  4E7J A;  2DT6 A;  3OYH A;  4E7L A;  2PMU A;  2RC4 A;  2ZB9 A;  1YJ9 I;  1SD6 A;  4UXN A;  4A3L J;  1MD0 A;  2ELH A;  4RB1 A;  5IP9 J;  5HS8 A;  2A5Y B;  5LLQ A;  1T6S A;  3WU1 B;  3ELK A;  1BC8 C;  2XSD C;  3KEQ A;  2XVC A;  4RS8 A;  3FXQ A;  2XF5 A;  4DIQ A;  2PJP A;  1P7J A;  1FP1 D;  5FJ8 J;  1D0Z A;  1SVM A;  2R5Y A;  1ZG3 A;  4M3F A;  3K2Z A;  3CP2 A;  2ZO4 A;  3D0S A;  2E34 A;  3R0A A;  4B47 A;  3MMY B;  3NAR A;  2XC7 A;  2IA0 A;  2JPB A;  3ABT A;  3M3Y J;  5C4J J;  3MD2 A;  1RC9 A;  4YIR X;  2V1D A;  1JKP C;  4OU0 A;  4BEH B;  2ETH A;  1P4A A;  2FNP A;  3IAM 2;  2GLO A;  1DPR A;  2Z99 A;  3ABU A;  3DCF A;  4CHU A;  2DOF A;  1D8K A;  4XN3 A;  4GO1 A;  2K9M A;  1EV7 A;  3AFH A;  1R1T A;  1WH7 A;  5F0H A;  1ORK A;  1ETQ A;  5BQT A;  1WJA A;  2J5O A;  3M1E A;  3EQL F;  5JHF A;  3QU6 A;  5DM7 F;  4GXO A;  1MJB A;  2OC6 A;  3FMR A;  2V6E A;  5F6F A;  2HNH A;  1KQ8 A;  1FNN A;  4ZDO A;  3O8G A;  5F27 A;  5DEQ A;  5E8I A;  4F92 B;  4CYC A;  1YI2 I;  5FLV A;  1R71 A;  1A6I A;  1IXR C;  3WU2 C;  4ZC3 A;  2R0Q C;  2W57 A;  4ZYH A;  3O8H A;  4EQQ A;  3S8P A;  5HVQ C;  4GYG A;  2BXZ A;  3K0L A;  2O3F A;  4JOM A;  3HRU A;  4CSW A;  4KYW A;  2VC1 A;  3KZZ A;  4M6Y A;  1Z21 A;  2EIK H;  2Y9Y A;  2DA6 A;  2DA1 A;  4DZP A;  3Q3S A;  4XOT A;  3V7R A;  1BN5 A;  4DNC A;  4RDU A;  3A4C A;  4NQW A;  3KEO A;  4EMS A;  5FLX Z;  2VE8 A;  2PLY A;  2WA0 A;  3L2R A;  2CQX A;  3MVP A;  4Z2Y A;  3JSP A;  1YIT I;  2RQP A;  4P96 A;  4L9N A;  2M8E A;  3K1M A;  4F93 B;  4UUV A;  1X1C A;  1ZTR A;  1QZZ A;  3TO6 A;  3BTL A;  4B3A A;  3ASO H;  4I76 A;  4O6J A;  5CVV A;  5EG0 B;  1MH4 A;  3PSI A;  1FSE A;  4BY7 J;  4B3X A;  1TTY A;  1WRJ A;  4I01 A;  3R0J A;  1BW6 A;  3ZN1 A;  5DYM A;  3GFL A;  2JN6 A;  4EV0 A;  1RRJ A;  3J7Y J;  1RUO A;  3ZP5 A;  3EUA A;  4U87 A;  5M5W J;  1A35 A;  2DPD A;  3RZO J;  5ERI A;  2VT3 A;  4EM0 B;  1S7E A;  4HQM A;  4XSX F;  3I55 I;  2EBI A;  2FE3 A;  2IGM A;  3ZMS A;  2LY1 A;  5L3G A;  5M3F J;  4AIJ A;  3OIQ A;  1HCR A;  3KP3 A;  2A61 A;  1KON A;  3LSP A;  4D1Q A;  5IY5 H;  3ZMV A;  1WJB A;  1XSV A;  2LC2 A;  5KK1 A;  2PFB A;  2ZME C;  4A3I J;  1OYW A;  1FMV A;  3OWT A;  4KIC A;  2DJI A;  2KKO A;  4N9H A;  2R92 J;  1B1B A;  1FIA A;  3H3U A;  3K10 A;  2DU9 A;  2H8R A;  4D0P A;  5GAD J;  2VBW A;  1PP8 F;  2G7H A;  3BTI A;  1UHM A;  4V2F A;  1BIB A;  1QVU A;  1SFO J;  3HEF A;  2ZSI B;  1FWZ A;  2FQ3 A;  2KZG A;  5D5W B;  2JUC A;  3K4L A;  5FFZ A;  1YQA A;  2ESN A;  4PSX A;  4BUP A;  2HZT A;  3HOV J;  4BQQ A;  5ILU A;  3CQZ J;  2ZJQ F;  1XMA A;  5E3L A;  2HDC A;  3CD6 I;  2QKM B;  2HWV A;  3CCJ I;  4MQV A;  4M6X A;  2MH2 A;  1QHH D;  2E35 A;  1U8R A;  4V19 K;  3LOC A;  3UR3 C;  1FC3 A;  4QWQ A;  2OV7 A;  1ON1 A;  2O0Y A;  2YSR A;  4M72 A;  1K79 A;  2QQB A;  1ZRF A;  3IWF A;  4MLO A;  3ZMD A;  4HLY A;  5M3M J;  4C2U A;  3KLN A;  3BCB A;  4DYQ A;  2CV1 A;  3ZQI A;  2FMY A;  4ZZL A;  5LFA A;  1FYM A;  3OL4 A;  2DT7 B;  4FE4 A;  4UVB A;  5JR3 A;  3OS1 A;  2JA2 A;  2Y9Z A;  1MBK A;  2LF7 A;  2HTS A;  3A1Y A;  1EH6 A;  1PDN C;  1TNS A;  1ZRD A;  4XKB A;  3MKL A;  2K86 A;  2A68 F;  1SD5 A;  5E1W A;  1FTZ A;  1MBE A;  1IN7 A;  2N8G A;  1HKT A;  3BPX A;  4Q48 A;  2MW8 A;  1WZ2 A;  2R5Y B;  4C9Y A;  3AG3 H;  5CYV A;  1OCO H;  2QCO A;  3RTR A;  4A3E J;  2FJ1 A;  4G12 A;  3RKQ A;  2KZV A;  4XR6 A;  3L2C A;  2M9H A;  4UUS A;  3SDG A;  4ESB A;  3CCU I;  3MEX A;  3WTX C;  3JRA A;  1I1S A;  4AVZ A;  4IHY A;  5M5X J;  3TP0 A;  3OYE A;  4RM3 A;  1LE8 B;  1SD7 A;  2QLZ A;  3SJM A;  3AG4 H;  2DN0 A;  3P5J A;  1S29 A;  2VBY A;  3DEE A;  1T2K A;  4KNY A;  4G7O F;  4X6A J;  1MBJ A;  2IBD A;  2JUG A;  2AXT C;  1VQ4 I;  2OCC H;  3MCZ A;  4JX6 A;  2GOM A;  5ILS A;  2AS5 F;  1A04 A;  4LLN A;  3NWT A;  1X2N A;  2GM4 A;  1ETY A;  5J1Y A;  2OF7 A;  4XN0 A;  3WGG A;  3K1P A;  2ZC2 A;  1ENH A;  2QF7 A;  2EFW A;  2H27 A;  4A6E A;  2L01 A;  3JAM Z;  1BR4 A;  4RBO A;  2ZNY A;  1GUU A;  3H35 A;  1Z6T A;  4YEJ A;  2V9P A;  2CWE A;  3VYR B;  2E7W A;  3OYL A;  1JXS A;  3BJ6 A;  3C2G A;  4E6K G;  2UXN A;  4XKC A;  2JSP A;  2ID3 A;  4CYC B;  1DP3 A;  3DTK A;  2KHM A;  3W3C A;  3IKV A;  2JPC A;  4M9X A;  3D5S C;  3TL4 X;  3OL3 A;  2EV6 A;  3C18 A;  1TWC J;  2WAD A;  4M9S A;  3RQ4 A;  2ID6 A;  3DFG A;  2L7F P;  2DOD A;  3NRV A;  2RV8 A;  2M5W A;  1WJC A;  2DMN A;  2LLK A;  4XLE A;  3S2W A;  4R79 A;  4U7B A;  1DP7 P;  3B73 A;  4CIC A;  4MTD A;  2DTZ A;  4WXC A;  4H0E A;  3CMM A;  5FKO A;  1ODD A;  2CFX A;  2OD5 A;  4P55 A;  4UHT A;  2DTR A;  4RM2 A;  3AAF A;  1D5Y A;  2LP0 A;  3IAS 2;  4IO9 F;  2FRH A;  4PGH A;  3SZT A;  3TO9 A;  1EA3 A;  2V7F A;  2R7V A;  1JTX A;  4RAY A;  4EGY A;  2ESH A;  3DEW A;  3PM1 A;  3HGY A;  4F3Q A;  1XGS A;  2W4S A;  2EA2 A;  5IT3 A;  1E17 A;  4CCO A;  4QTR A;  2LRD A;  1E3H A;  2OBP A;  3FXL A;  3S1R J;  2MYS A;  2X85 A;  1XSD A;  2MC4 A;  1RI7 A;  2DO7 A;  4WWC A;  2JK3 A;  5A2Q K;  1HDD C;  1W7P B;  1BR2 A;  1YRN B;  2GBY A;  5L3B A;  3EPZ A;  3HHH A;  1R23 A;  1TLH B;  4P9F A;  3ULQ B;  1Z05 A;  2X1E A;  2H8W A;  2LVS A;  2D45 A;  3HXL A;  5F1R A;  1VTN C;  3HUG B;  4L0Y B;  1YW8 A;  4B44 A;  4HX4 A;  4ENJ A;  4IF4 A;  5LHI A;  1E3P A;  4D9J A;  2M0C A;  1VQO I;  2MAB A;  4A3G J;  1JKQ C;  2R7O A;  4KIT B;  1JT0 A;  2MD0 A;  3CCS I;  5H20 A;  3I59 B;  3LNQ A;  2Q8K A;  2O7O A;  3V42 A;  2VUM J;  1ZHF A;  2L2O A;  4IRG A;  3GYH X;  1Z7U A;  2L5Q A;  2NS8 A;  3P9I A;  5IT9 K;  4XRS A;  1B59 A;  1ZR4 A;  1I5Z A;  3NEU A;  1IRF A;  4XOP A;  2GAU A;  2NVU B;  3CCE I;  3LA2 A;  4GYI A;  2VJ5 A;  3KX2 A;  3QYB A;  3RCO A;  2P6S A;  5F04 A;  1YFH A;  1X58 A;  3LST A;  4RGX A;  1MW7 A;  2KDO A;  2Q1Z B;  4Y7N J;  1T8I A;  4GDF A;  5ICE A;  1X4P A;  3OV8 A;  2VOP A;  2QSF X;  3B6A A;  4RB0 A;  4ANJ A;  3OSF A;  2WY8 Q;  1EKE A;  3GFJ A;  1TP4 A;  2QKL B;  3C2B A;  3KYC B;  4XIC A;  1XDU A;  3R61 A;  2XB5 A;  2LY9 A;  3FXU A;  5DM6 F;  4XLC A;  3WTT C;  2RNG A;  3R6S A;  1OIS A;  1IN6 A;  5FD5 A;  1WH5 A;  2E5N A;  3DPU A;  4BKX A;  5EEG A;  3WU0 A;  3FXM A;  3TQN A;  1IDZ A;  3DP7 A;  1BI3 A;  5BNG A;  4BGD A;  1ZG1 A;  2HZD A;  2BVM A;  4AIK A;  1XMX A;  2IGO A;  2ZFW A;  4UVA A;  1VQ7 I;  3LSG A;  1WGX A;  2WBM A;  1RET A;  2Q2E A;  2XDV A;  3C7J A;  3QOD A;  5HDG A;  3L2V A;  3RPU D;  1YS7 A;  2RVC A;  3LFK A;  4PUS A;  1J59 A;  4RB3 C;  4LG3 A;  3BR6 A;  4ASN A;  3ML6 A;  2UZK A;  5E1X A;  4E7Z A;  2VJJ A;  3BG3 A;  1HW2 A;  1KYW A;  4ESJ A;  4XKW A;  1VQL I;  2LKP A;  3J7Z I;  1XCB A;  2PMZ A;  3S14 J;  3KP6 A;  3SQN A;  4S05 A;  2EWN A;  1S72 I;  4UB8 C;  2Y2Z A;  5IT9 Z;  2F5C A;  3KPH A;  2RDP A;  1N75 A;  5HDN A;  1LDK B;  2K9Q A;  2JA5 J;  2BHY A;  3KZI C;  4KA4 A;  5IPA A;  4U88 A;  1O3T A;  4AC0 A;  1W36 D;  1KQ9 A;  4CH7 A;  4TV7 A;  3ZMU A;  3EYY A;  1RPW A;  3VSL A;  4HV6 A;  1QZY A;  4G6T B;  2HOT A;  3FXK A;  1NHA A;  2LD5 A;  2EPF A;  3T8T A;  3I4M J;  4A0Z A;  3H92 A;  3IH4 A;  4II2 A;  2RAE A;  2VOD A;  3GZ6 A;  4MEX F;  2DA2 A;  1DDN A;  5K7Z A;  1UMQ A;  3S16 J;  2E5Z A;  1J0R A;  5LRS A;  3K69 A;  2NOG A;  1JTY A;  3F8F A;  2L0K A;  3PSF A;  4M3D A;  2QBY A;  2KIM A;  1MSE C;  3IRR A;  3S17 J;  5EDN A;  1YRN A;  1PVE A;  1FBS A;  2VOO A;  2BY2 A;  3HB9 A;  5GTI C;  1W7P A;  3I0T A;  4UB6 C;  1BI2 A;  1SAU A;  5K5Q A;  1A5J A;  2DFF A;  3GLX A;  1KZH A;  2WAQ A;  1X4O A;  3G1O A;  4D7M A;  4HRI A;  3Q0V A;  2VBZ A;  1TWF J;  4U0W A;  3TW7 A;  3V7C A;  2WY7 Q;  1IRX A;  2BHZ A;  3WTY C;  4I09 A;  1YOV B;  2CUE A;  3CJR B;  3FKI J;  2K40 A;  1WCM J;  3KP7 A;  1K61 A;  1LVA A;  1QU3 A;  4IPA A;  1SFE A;  3H0G J;  3E5U A;  4XOR A;  1S7A A;  3ZXS A;  4FQG A;  2MGQ A;  2DFE A;  4XID A;  2M34 A;  4BE2 A;  5IOZ A;  3S1M J;  3MKZ A;  2IAI A;  3CUO A;  4BEH A;  3HGG A;  1T56 A;  2FEZ A;  2P5L C;  3WOD F;  3N4M A;  1UG2 A;  1S5L C;  3A01 A;  4QPO A;  4XLA A;  4IQJ A;  2X9D A;  4GRI A;  3GTJ J;  4PZJ A;  4RA2 A;  3KZY A;  3WTZ A;  1GXQ A;  1U6G A;  2Y0M A;  3BTJ A;  4EJU A;  3V8K A;  1R49 A;  1QRY A;  2IVM A;  2M0M A;  3SFI A;  1MND A;  3IUO A;  1QHG A;  3RQI A;  4YII A;  5DV5 A;  1OPC A;  2DCE A;  2K85 A;  3ONQ A;  2A3S A;  3FIW A;  3ZQF A;  2CRG A;  3CMA I;  3ZR8 X;  5LBQ A;  3ECO A;  1QGP A;  4M3B A;  4DYR A;  2FUG 2;  3LSR A;  5FLX K;  4IOA F;  4A3B J;  1V4R A;  1NG6 A;  2X1D A;  2LTP A;  5J1U A;  1D3Y A;  3H5R A;  2XHK A;  3L7W A;  4KUM A;  3FWE A;  2J5P A;  3BPV A;  3SDB A;  3F8M A;  1PJR A;  4WXD A;  3TMO A;  1ETO A;  1ZR2 A;  3M7G A;  1FOX A;  3L9F A;  3QOE A;  3CF5 F;  2K3F A;  2WWY A;  2G0E A;  5JVG F;  3HJE A;  1W7P D;  2QQ8 A;  4ITV A;  2FXA A;  3BC8 A;  1ZLK A;  4B43 A;  2OTJ I;  3GFM A;  4IRH A;  3I3L A;  4MEY F;  3DU5 A;  4PJM A;  4BJ6 C;  3J80 Z;  5F64 A;  1NK2 P;  2VPL A;  2V1N A;  4DOZ A;  2A69 F;  3RKY A;  4OAZ A;  3SHF A;  3FZV A;  1S6L A;  3HOT A;  2K7L A;  1STZ A;  1P6R A;  3HPG A;  3KEY A;  1T98 A;  2P7V B;  2STW A;  2X48 A;  3F22 A;  3U1D A;  4PJL A;  3K4N A;  2YS9 A;  1T95 A;  1OCP A;  1IRZ A;  1N78 A;  2MSY A;  2GOX B;  4ZH4 F;  5E1Z B;  3TO7 A;  4BBR J;  2R5Z B;  2ECC A;  3S2D J;  3H9G A;  3PQJ A;  3RJP A;  3FXJ A;  2DMP A;  1FJL A;  2LFB A;  1B4A A;  1XC5 A;  3G4S I;  2CMP A;  2H1L A;  4HDU A;  2K4J A;  4NQW B;  1ERD A;  1FSH A;  2NS7 A;  2E1C A;  1HW5 A;  4IX7 A;  1VI0 A;  1IDY A;  3G1M A;  2D1V A;  2FBI A;  5LEJ A;  3EUH C;  3MN2 A;  4RLF A;  1IZ1 A;  3F6V A;  1V3F A;  3OR1 C;  4FX0 A;  1U78 A;  3F9K A;  2UXX A;  2RKH A;  5HS7 A;  1R36 A;  1YS6 A;  3TED A;  3K70 C;  4JYK A;  5D5U B;  4S04 A;  3BWG A;  4N0B A;  4IHW A;  3F6O A;  1T08 B;  5E20 A;  2W1O A;  2QUF A;  4UUS B;  5J4Y A;  2KP6 A;  4I2O A;  1XSX A;  4Y15 A;  1SEU A;  2DK8 A;  2Z2S B;  3MWM A;  3LSJ A;  4CUG A;  2R4G A;  5J47 A;  4FE7 A;  2P8T A;  2DA4 A;  3ZMT A;  5LD2 C;  3UKG A;  1OYI A;  1K4T A;  5F0F A;  1IW7 F;  4PK4 A;  3OYK A;  3DXJ F;  1X19 A;  2GZW A;  1JUS A;  1YJN I;  2XSJ C;  1UHS A;  5L3E A;  2RGV A;  1BA5 A;  1Y6I A;  1VQN I;  2Y31 A;  5TJJ A;  5KNL A;  4II3 A;  5F08 A;  4FET A;  4B4C A;  5B1A H;  1UB9 A;  4UY8 I;  1T33 A;  3J80 K;  1GHC A;  4K2E A;  3ZGK A;  3HZJ A;  3HSE A;  4M9Z A;  4RAF A;  2CO5 A;  4G9Y A;  4U0Y A;  4FIS A;  4CCL A;  3S1N J;  4M71 A;  2V4J C;  4A5M A;  4ZDL A;  1J75 A;  2L54 A;  2DW4 A;  3JCU C;  1TW3 A;  2VXZ A;  3LFU A;  4RAZ A;  2YX4 A;  1X1B A;  1X1D A;  1U5T A;  4IVN A;  5GP9 A;  3VFZ A;  5K1Y A;  4KMF A;  3D5L A;  5FB2 A;  3E3V A;  1U9N A;  2B63 J;  3F8N A;  4Y4R A;  1UEL B;  4PFP A;  4NC6 A;  1MJA A;  2MC3 A;  2PEX A;  2HOS A;  3BJO A;  1ONV A;  2KIS A;  1JUM A;  1JGS A;  2ZME B;  4RMN A;  2LKX A;  3L00 A;  1BL0 A;  1IN8 A;  2NOJ B;  4MFD A;  3BZK A;  1IJW C;  5CVR A;  2UV1 A;  1UCR A;  3FBN B;  4HZF A;  3OYF A;  3ERE D;  3VPR A;  1GV5 A;  2Y69 H;  3RYP A;  2XB0 X;  5CVI A;  1XX5 A;  4DW6 A;  2W84 A;  2HYF A;  1N25 A;  2M8G X;  3G3Z A;  2GA1 A;  4HA8 A;  4HX7 A;  3WE3 A;  1IGN A;  2AXL A;  3IC7 A;  3RYR A;  2GXG A;  5FKL A;  2CU7 A;  1EH8 A;  1ZAR A;  1F1Z A;  4F52 A;  4KIS A;  5ICG A;  1YJW I;  1BIA A;  2R3S A;  5E18 F;  3B6C A;  3BT9 A;  3WE2 A;  1UG0 A;  2Z5U A;  5DD8 A;  4L9V A;  2XF7 A;  3WTW C;  3JTH A;  4NBQ A;  4HV5 A;  1PYV A;  4AWX B;  5HLH A;  1VQP I;  3V8L A;  1MKM A;  2WC2 A;  2XF6 A;  3ABL H;  3BTC A;  3I4P A;  2L7K A;  3CDL A;  4IQ4 A;  3ZQ7 A;  3OYJ A;  3JRI A;  3CME I;  3H3Z A;  3T8R A;  1TT5 B;  3MZ8 A;  2L4M A;  4LB5 A;  4A3F J;  3S3M A;  4XLF A;  1KU7 A;  1ZG5 A;  1JJ6 C;  5CQE A;  3WTS C;  1BJA A;  2XGE A;  2P0W A;  2ZXW H;  4HOB A;  4H4K C;  5EEH A;  3DPL C;  1DU0 A;  1F36 A;  1UJ8 A;  4LGW A;  4OWR B;  5HDK A;  5BS6 A;  4I0B A;  2HYG D;  1JKR C;  5IP6 A;  4JK1 X;  5D6E A;  4P5O A;  3LA3 A;  5EGO B;  3LL7 A;  1SAN A;  3MQ0 A;  3KFW X;  1U3E M;  3GTO J;  2O6G E;  1VFC A;  1IG7 A;  1LKX A;  2XGC A;  2XPU A;  3DQV C;  2V26 A;  2BE5 F;  4FT8 A;  4FCY A;  2LDU A;  3FMQ A;  1DUX C;  2PX9 A;  4MQ9 F;  2Y75 A;  1LDJ A;  2RQQ A;  1FPQ A;  2KRF A;  3Q9V A;  1RES A;  2EZK A;  3A0H C;  4XSZ F;  1H89 C;  1POG A;  2XRL A;  3EYI A;  3TGN A;  1I39 A;  4L9J A;  3KYD B;  1IF1 A;  1VQ8 I;  3BG6 A;  3DEU A;  2KPM A;  3PO2 J;  3QPL A;  4BHC A;  3ZQQ A;  1GVJ A;  4EAT A;  4CA0 A;  3JRF A;  1L0O C;  1GT0 C;  3KE2 A;  1MIJ A;  2CW0 F;  2LY2 A;  2F6C A;  3RKX A;  5AON A;  1X3U A;  1OR7 C;  4BH9 A;  4DQ2 A;  4EM2 A;  2HI3 A;  5K7F A;  3G73 A;  2W25 A;  2ZXH A;  2JVG A;  3CP8 A;  2UUZ A;  4EJW A;  2IP2 A;  1XDS A;  4CCN A;  2CQN A;  4YIF A;  3E5X A;  5C44 J;  1D8J A;  4CCJ A;  4I98 B;  3F3X A;  4FAS D;  5JLX A;  2NNY A;  5DD4 A;  1QPM A;  4C2M J;  1LEB A;  3SEQ A;  3ZMZ A;  2VKD A;  2ZKZ A;  4CCM A;  3K4C A;  2LKS A;  2EQR A;  5HLI A;  3HRM A;  4BQA A;  2D2W A;  2OPT A;  1OCZ H;  1KYZ A;  1Y8Q B;  2QWW A;  4AU7 A;  4QSH A;  1TC3 C;  5E3M A;  4Y3O A;  1YHQ I;  1FBQ A;  1TQP A;  1K7A A;  2HQR A;  3BG9 A;  3TP3 A;  3GBG A;  1DGW Y;  5HOD A;  1WI3 A;  2DMT A;  2MD5 A;  1G59 A;  1G2H A;  2GXA A;  2KIU A;  3VEP A;  1TBX A;  4LD5 A;  1J5Y A;  1G6N A;  1U9O A;  3A03 A;  1DU6 A;  1FTT A;  1Z7L A;  4MIM A;  4D5F A;  3H9J A;  4A3M J;  5D4R A;  5AIP A;  4ZTF A;  1OCC H;  2QM3 A;  2M7A A;  3RSN A;  3KP4 A;  1OYY A;  2DYR H;  2M3A A;  2LH9 A;  1Y0N A;  3B02 A;  4F7Z A;  2VQL A;  4F55 A;  6PAX A;  3GXO A;  3FK7 A;  1XTA A;  5D5V B;  1TW2 A;  2IEK A;  4HAM A;  2ELJ A;  1G4D A;  5E79 C;  4XRS G;  2OAZ A;  2QSG X;  2CW8 A;  4AD9 A;  2R5Z A;  3E97 A;  3H3V K;  2WV1 A;  3JAM K;  2DA7 A;  3E6D A;  2XKP A;  2PBI A;  4JP0 A;  2FNA A;  1FOK A;  3ABM H;  4IXA A;  2VC0 A;  4OMZ A;  3ZN0 A;  4BJT A;  4QLC U;  2DDA A;  4I02 A;  2MA3 A;  1S7O A;  2VT2 A;  1YE9 A;  1P9Q C;  3PFI A;  3WHC A;  1U5T C;  1ON2 A;  2FU4 A;  4I7H A;  3GEZ A;  2HTJ A;  2Y0S N;  2A05 A;  3CUQ A;  1ZAO A;  3QP6 A;  5HS9 A;  5JI6 A;  1Z67 A;  2DT5 A;  4XL9 A;  3R4K A;  3HRS A;  2I8D A;  2NVY J;  4LFU A;  4HQE A;  3A02 A;  1LFP A;  3HOS A;  2TCT A;  3MKY B;  1HSJ A;  4XKV A;  5B1B H;  3HOZ J;  1IC8 A;  1SVL A;  2VB6 A;  1HOM A;  1G3S A;  1J09 A;  4LMY A;  1Z91 A;  1HDP A;  3GZN B;  3HDD A;  4L0Z B;  3HRT A;  1I3Q J;  1WPK A;  2XPW A;  1MBG A;  1W0U A;  3LMM A;  1WWX A;  4ZYA A;  2ISZ A;  3MKW B;  2O61 A;  3E6M A;  3BZC A;  3W6V A;  2R93 J;  5GAE J;  1BJZ A;  1LNW A;  4KN4 X;  4CYD A;  2VPR A;  3BP8 A;  3JRG A;  3PJR A;  4LG0 A;  5J1R A;  4M74 A;  5FKM A;  1FYK A;  4PCQ A;  3MAJ A;  4E7K A;  2X0L A;  5EGO A;  2IXS A;  2O8K A;  2DFH A;  4ZYG A;  1SFK A;  2DA3 A;  2PG4 A;  1QO0 D;  4CCK A;  2CQK A;  3WGH A;  1HA8 A;  3V7S A;  1JHF A;  2QYO A;  4MO7 A;  2IS6 A;  4BAY A;  1H9T A;  2KT0 A;  4CXF A;  2QQA A;  1W5T A;  3ZOB A;  2LMD A;  3OIO A;  1R1U A;  3TOB A;  3M8F A;  4BJ5 C;  2DYS H;  3ASN H;  5DDG A;  3PIP F;  1IXS B;  1RR7 A;  3M9A A;  2WAF A;  2P5K A;  3P9C A;  1MSF C;  4A3K J;  3K9T A;  2V1U A;  1WJD A;  4LK1 F;  1LE8 A;  4BNC A;  3RZD J;  2EH3 A;  3CMY A;  4WX9 A;  2K3P A;  3CJT B;  3CCV I;  1NG7 A;  1WVR A;  4BBS J;  4X0G A;  1K78 B;  1F5T A;  1D1C A;  1S3J A;  2ZXJ A;  4PDK A;  4ZDP A;  2OUM A;  2ICW G;  2WAE A;  4M3E A;  4HNU A;  5LGT A;  4IOC F;  1O3Q A;  2X4H A;  3U2R A;  3KYL A;  1ZGW A;  2LSO A;  1E3O C;  5E3N A;  2WTE A;  2K9L A;  3UNG C;  3SZG A;  4IL6 C;  3HOW J;  1BC7 C;  3HYI A;  1FOW A;  2JZY A;  3NQO A;  2JQ7 A;  2R7R A;  4LOC A;  5D5X B;  3S3N A;  2DQL A;  2IS2 A;  3ZRG A;  2XKO A;  4KT6 A;  5FO5 A;  5DUI A;  3K2A A;  3OYA A;  3REO A;  2W7N A;  3TBI A;  5ED4 A;  3G71 I;  4WK8 F;  1JJ8 C;  4EM1 A;  3CUQ C;  1WJE A;  3VDX A;  2I5U A;  1S8N A;  2HXI A;  2NVQ J;  1W5C C;  4C3I J;  5C3E J;  4HDV A;  3BR0 A;  3P9K A;  4I0A A;  4MGR A;  1JUP A;  3DKY A;  3BZ6 A;  3IP4 B;  1YX5 A;  2GIZ A;  2WV0 A;  4OAY A;  5B3S H;  3JRE A;  1SFX A;  1B6A A;  2M4G A;  5DS9 A;  4R1H A;  3WG9 A;  3TDZ C;  3PNY A;  4Y13 A;  1TNT A;  1HW1 A;  2JRM A;  2OCE A;  5GAH J;  2LF8 A;  1Z77 A;  2HXO A;  3V4G A;  4ESF A;  3JSO A;  4ON0 A;  2JJ7 A;  3I9V 2;  4YFN F;  1MBH A;  4CZC A;  2LR8 A;  2M87 A;  2KIQ A;  3JRD A;  1R6R A;  2L02 A;  2MLG A;  3GTM J;  4C30 A;  2QEX I;  2K5C A;  2CFO A;  4L5E A;  1Y0U A;  1E2X A;  2XPV A;  5HLT A;  3DF8 A;  2JMW A;  5IYC J;  2HQA A;  1ZRE A;  5EG0 A;  2DAO A;  3LSH A;  1GLN A;  2RN7 A;  2W24 A;  3DBL B;  3WTU C;  3BQZ A;  1FZP B;  3HC7 A;  4Q4Z F;  3LSI A;  2ZFU A;  2F4O B;  5FKK A;  1ZEL A;  2IW5 A;  3CCQ I;  3GTG J;  4KIF A;  4P1W A;  3PL8 A;  2VKH A;  2FBH A;  3BJA A;  3RKW A;  2AQF A;  4E7S A;  1OLT A;  3K4J A;  2PJR B;  2LG4 A;  4W97 A;  5L3F A;  3OR2 C;  1LPQ A;  1U0J A;  4F91 B;  1XN7 A;  2QQ9 A;  2F2E A;  1SMY F;  4BY1 J;  3DU6 A;  4LLL A;  4I6Z A;  4OIP F;  3CLQ A;  1K6O A;  4A2U A;  1OJL A;  1W5S A;  2Y30 A;  4M3G A;  1JKO C;  2M2E A;  4AYB A;  1AWC A;  3PQK A;  4RAG A;  1J2X A;  1M1E B;  2E2H J;  4CO8 A;  4PFO A;  5BPD A;  4XBF A;  1B72 B;  1WKM A;  2XRO A;  1AU7 A;  1WQ2 A;  4Z6Y A;  2VJ4 A;  2JVH A;  3W6K B;  1I1G A;  5B66 C;  3D1N I;  1IRG A;  2HQ5 A;  2VXD A;  3HOU J;  3H5A A;  4BXF A;  3H9Q A;  5ILV A;  4I99 C;  1O3R A;  3T5X A;  2HQN A;  2DFI A;  4D7N A;  2K9S A;  3DKX A;  2A07 F;  4A3J J;  2TRT A;  5A2Q Z;  1JGG A;  1UST A;  5LEK A;  4IRI A;  1FT9 A;  3CJN A;  4U0V A;  3TKY A;  4OIO F;  1GV2 A;  1P2F A;  2E2I J;  2EZI A;  3HSF A;  2EZL A;  1F4K A;  2XAG A;  3Q0U A;  3TOA A;  1FYL A;  1SC7 A;  2K02 A;  1YO5 C;  4NNJ A;  3EUK L;  3SFZ A;  4YFK F;  3DTE A;  1FIP A;  1G8X A;  1VQ6 I;  2M1B A;  4YEL A;  2XGD A;  2E1O A;  5K5O A;  2XAS A;  2VIX A;  1R1V A;  3J81 Z;  3J7A Y;  5J40 A;  3IWZ A;  4BU2 A;  2KJB A;  2L9S A;  4XQF A;  1Z3Y A;  4BXX J;  2OZU A;  4NHJ A;  1ZRC A;  1T0F A;  3LQR A;  2E1M C;  5ICC A;  4KMU X;  4BL0 B;  2JA7 J;  2FBK A;  2M7B A;  2VAS A;  2HYJ A;  1Z3X A;  3FXR A;  3S1Q J;  3CC2 I;  4LJZ F;  2EV0 A;  2OQR A;  2DPU A;  2JWT A;  3PUF A;  3ZQL A;  2DMU A;  1B9M A;  2ZNZ A;  2XAH A;  2VL8 A;  2P6T A;  3WHB A;  2NNN A;  4HF0 A;  2R7X A;  2R7F A;  3I71 A;  1YX3 A;  2BY1 A;  3OSG A;  3NAU A;  2E60 A;  2IPQ X;  5LRR A;  5FD6 A;  5KAF C;  1W36 C;  1JHH A;  4NUB A;  4A3D J;  1WJ5 A;  4U7D A;  2CJJ A;  3BDD A;  2ELK A;  2W00 A;  2EIN H;  2LK2 A;  3CCL I;  3FF5 A;  2VQG A;  5BPI A;  3AKZ A;  1ZQ3 P;  2IT0 A;  1OCT C;  3CDH A;  4X1E A;  2YU3 A;  5HLG A;  3MFK A;  4WF2 A;  4AVP A;  2HDW A;  3HL2 A;  3L1P A;  3OIP A;  1FY7 A;  5FRO A;  1V5G A;  3SEZ A;  3QPT A;  3OOU A;  1SAX A;  2ZCW A;  4EJO A;  3S3O A;  4BXU A;  2CYY A;  4YRV A;  4LK0 F;  1ZGA A;  3Q0W A;  1MDM A;  1MMG A;  3A2K A;  2QGU A;  3X2Q H;  1AKH A;  1TL8 A;  3S15 J;  1DQU A;  3F8C A;  3I53 A;  1XS9 A;  4LB6 B;  5H2F C;  2D5V A;  3BRO A;  2A6E F;  2OA4 A;  2RRE A;  2IA1 A;  4BHB A;  1W4M A;  3QP5 A;  2X6W A;  1T38 A;  4Y52 J;  4RGR A;  4HG2 A;  2IGK A;  3RIR A;  5FKN A;  5LHG A;  2V79 A;  2P7C B;  2L9N A;  3DLL F;  3GTQ J;  2LNB A;  3PO3 J;  3ECH A;  2IS1 A;  2F5F A;  2NAZ A;  1ZH5 A;  3HM5 A;  1APL C;  1JI8 A;  2VBX A;  2HS5 A;  1BBY A;  3GTK J;  2HPI A;  5LHH A;  5DCM B;  3DBH B;  1HST A;  3FM5 A;  2PMZ N;  4G8X A;  2XGX A;  5EZH A;  1UAA A;  1LJ9 A;  3CZ6 A;  2ZJR F;  1WJF A;  4HF1 A;  1DPU A;  4R8H A;  1YW7 A;  1ETK A;  2VLA A;  1IAW A;  5IYD J;  2BVL A;  2E1M B;  1HXD A;  4RGS A;  2XRN A;  3FK6 A;  3KCC A;  1YLF A;  1P92 A;  4PGG A;  3MZY A;  1RZ4 A;  5L3D A;  2LYC A;  1SFU A;  1GXP A;  1LB2 A;  1T39 A;  2M4K A;  4XLH A;  2HVR A;  2ZJ2 A;  3DPT A;  3G1L A;  3M8E A;  1XB4 A;  4GGG A;  2OJE D;  3HSR A;  4L5J A;  4B48 A;  2O5R A;  4UV8 A;  1B72 A;  3GF2 A;  3FIS A;  3K4B A;  1C0W A;  1HKS A;  3DLA A;  3PUB A;  2A6T A;  2CUF A;  2QVO A;  2KMU A;  3BLY A;  3BR3 A;  2FSW A;  3HBL A;  4M6V A;  3D5R C;  3N97 A;  3CDI A;  4DZJ A;  3M1C A;  4CDG A;  1HLV A;  2HOE A;  2MG4 A;  4AIH A;  2QA4 I;  4BQO A;  2DXI A;  4HEA 2;  2HKX A;  1GVD A;  2EV5 A;  2FML A;  1XGM A;  3AG1 H;  1EJ9 A;  3LSK A;  5J3L A;  2X6O A;  4IEJ A;  2BBY A;  4QIW N;  1ETW A;  5BOX A;  1FLI A;  3O2P E;  5HNF A;  3CCY A;  1H88 C;  2VI6 A;  4D5C A;  1PUF A;  5HOO A;  1VQK I;  2ISY A;  4UNO A;  1Y56 A;  1LFU P;  2DDB A;  2EFQ A;  2ZME A;  4BS9 A;  5J4V A;  1SVO A;  3JRH A;  2QSH X;  1L3L A;  1SD4 A;  2Z16 A;  2Z3Y A;  3O6B B;  1I3A A;  2VJI A;  3LWF A;  4KJZ A;  3T1B A;  4B8X A;  5IOY A;  4WCG A;  4J19 A;  1IUF A;  2O9L A;  5L3C A;  2C6Y A;  3F23 A;  1BW5 A;  1JT6 A;  4PJJ A;  1VF9 A;  2PMH A;  3I64 A;  1D1B A;  1XMK A;  2EFO A;  3V8J A;  3E1S A;  3CO6 C;  2CUJ A;  2BY3 A;  2CH0 A;  5FRN A;  1Q1H A;  1Q1V A;  1RNL A;  1TWA J;  3EET A;  3IH2 A;  1QA6 A;  4AYB N;  3EUH A;  2B7E A;  2GIV A;  2Y48 A;  4HSR A;  3TW6 A;  2B0L A;  2E19 A;  3DV8 A;  4N9I A;  1TQI A;  2EIL H;  3OYG A;  2COM A;  4CZZ A;  4ENK A;  1G3T A;  3U1K A;  4BYY A;  2P4W A;  2ACJ A;  1Y1V J;  3OOP A;  1BI1 A;  3DTI A;  1O4X A;  3E5Q A;  5J6X A;  3FHZ A;  1Z1D A;  3RDI A;  3W6J B;  4C2T A;  4EGZ A;  2FF4 A;  2JT1 A;  2EB7 A;  3GWZ A;  4AM3 A;  1D0Y A;  2L9V A;  2FA5 A;  3W2W A;  4EVI A;  5CJ9 A;  3BY6 A;  3K70 D;  1CGP A;  1V55 H;  2WAQ N;  5K5R A;  1XD7 A;  3L09 A;  3OMY A;  3OY9 A;  3GME A;  1Z6R A;  1MMS A;  5GPA A;  2EIJ H;  4XRF A;  2GXB A;  1FEX A;  5ICF A;  1CF7 B;  1B9N A;  2EJR A;  2W48 A;  3IKT A;  1OQY A;  4UV9 A;  3S93 A;  3OYD A;  3HTS B;  1ITY A;  2FOW A;  1TZL A;  1B8I A;  2DBB A;  4E7I A;  4XLP F;  2AQE A;  3C2H A;  3E6B A;  4BDY A;  2JSC A;  4C3H J;  4KN7 X;  1IN4 A;  2R7Z J;  3JRC A;  3OYM A;  1TQM A;  1ACI A;  3PFY A;  3IV5 A;  4AID A;  2XAQ A;  4A0X A;  1A6Q A;  1D0X A;  1O57 A;  5TGT A;  2R7T A;  1K4S A;  1YG2 A;  4FHT A;  2JA8 J;  2MBF A;  3T0Y A;  3IRQ A;  1H9G A;  4HX8 A;  1AKH B;  4KT5 C;  2CV2 A;  1WFX A;  2ME0 A;  1MDM B;  5LGU A;  1XGN A;  3Q5F A;  1NK3 P;  3HKZ A;  3CTA A;  3I54 A;  3BCA A;  1MNM C;  1I27 A;  2KLO A;  3I58 A;  4EEF G;  2HVQ A;  1XGO A;  4A5N A;  3DBR B;  2E2J J;  3KIO A;  4HYE A;  2BY0 A;  2X6Y A;  1R5I D;  2BW3 B;  3VOE A;  1HQC A;  2QZ8 A;  4OIQ F;  1KU2 A;  3IH3 A;  1R4M B;  2MH9 A;  4JX5 A;  2X1C A;  3BG7 A;  4G94 A;  3LAP A;  1ZN2 A;  4MNU A;  3GW2 A;  2DMQ A;  2CSO A;  2HKO A;  2YR2 A;  3QU3 A;  2L7M P;  2ZXI A;  2YPR A;  1TWH J;  3H5N A;  1R00 A;  4HPQ A;  1PUF B;  2HVS A;  1RKT A;  3PIO F;  4BE0 A;  1MNE A;  2KQR A;  4G7H F;  4LG0 B;  2FX0 A;  4GFB A;  4KIB A;  2BXY A;  1U8B A;  5CPR B;  1P7I A;  2LRE A;  2L7Z A;  2H6C A;  3ISP A;  2G7U A;  2OU2 A;  1YW9 A;  5E3O A;  1D1A A;  3JTG A;  4MTE A;  5E8G A;  1NH3 A;  1J7K A;  4HLX A;  2R7D A;  4G7Z F;  1WI9 A;  2XUB A;  2BV6 A;  3GX4 X;  4JQF A;  1QZE A;  2BGC A;  1R58 A;  2VKE A;  2DOA A;  2IS4 A;  2O8X A;  1R22 A;  4ENM A;  2EIM H;  4JX4 A;  3W2A A;  2B9S A;  3VB2 A;  2QBY B;  2OQG A;  2E1N A;  3OYN A;  1TT0 A;  2K27 A;  1RIO H;  4PJ0 C;  4PSW A;  5IP7 J;  4C3J J;  1LEA A;  2MFZ A;  4EJV A;  2ADU A;  1GDT A;  2KDZ A;  4A3C J;  4HW0 A;  3S32 A;  1D5V A;  3ZQH A;  4XRM A;  4OIN F;  2R7Q A;  4QPQ A;  2VON A;  4HNT A;  2HEO A;  2F4I A;  1Z0X A;  1BOB A;  4XK4 A;  1MMN A;  5H6Q A;  3CO7 C;  3CCR I;  2STT A;  1ZLJ A;  3PNT A;  1RKW A;  3QYF A;  2HU9 A;  3CLO A;  5DCF A;  2YU9 J;  4KFC A;  4KDP A;  4IHV A;  1T0F C;  2G9W A;  4Q5S F;  1QQI A;  3I5U A;  1J9I A;  3BR5 A;  2NRA C;  3WG7 H;  1I50 J;  5GAG J;  4IHX A;  4G6D A;  1H0M A;  2CQQ A;  3CES A;  2O03 A;  3ROU A;  1REP C;  4HST A;  5JFR A;  2XAF A;  1LDD A;  1G3Y A;  1ETX A;  5FGM A;  4W1U A;  3U9G A;  4MHG A;  2H1K A;  1X1A A;  4CGZ A;  4PJN A;  1OKR A;  2MLK A;  1K83 J;  3QYE A;  1QBJ A;  3L2Q A;  1CF7 A;  3LAJ A;  2F48 A;  5KHD A;  2D1H A;  1W0T A;  1LUJ B;  3KLO A;  4L5I A;  4Y17 A;  2HR3 A;  4RLQ A;  1V5F A;  2X51 A;  3E7L A;  5F0C A;  1H8A C;  1HKQ A;  1O7L A;  2KRC A;  2IJL A;  4YG2 F;  4IHT A;  3FM3 A;  1JE8 A;  2F4M B;  3QAH A;  3OYC A;  2BEO A;  2CS3 A;  1I6H J;  5F1J A;  2VKV A;  4ENN A;  2LOO A;  2K9N A;  3HTU A;  3BR2 A;  1X1P A;  2KFD A;  3BQY A;  5FLM J;  1ZK8 A;  2V9K A;  2P5V A;  2ZBK A;  1HBX G;  4GCV A;  2VN2 A;  2A5W A;  1WHU A;  3CUQ B;  1IXC A;  3HG9 A;  1KA8 A;  5TIS C;  3CCM I;  2AO9 A;  1Y39 A;  4OMY A;  3CJQ B;  2FOK A;  3LA7 A;  3I56 I;  1YIJ I;  4YFX F;  5H6R A;  5JLW A;  2CUZ A;  2EA4 A;  3LSM A;  3GCM A;  2P81 A;  2RNJ A;  3TDU C;  2XAJ A;  4DJA A;  1O7F A;  1MGT A;  5B5E C;  1ZGJ A;  2V1X A;  3FMS A;  5M5Y J;  5D8L B;  4ZJZ A;  5EF6 A;  2KL4 A;  2CGP A;  9ANT A;  3GZ5 A;  1USS A;  4A69 C;  2HFH A;  1WSU A;  2YX7 A;  3KET A;  2IRF G;  1OR7 A;  2NS0 A;  2VQC A;  5DUK A;  1BM9 A;  4NC8 A;  4IKF A;  1UZC A;  3N05 A;  2VE9 A;  2WB1 A;  2PQ8 A;  2L3D A;  3BR1 A;  1VND A;  3ZCO A;  1SMT A;  2DOE A;  4JBA A;  2IGN A;  5AIQ A;  4B1R A;  3GTP J;  2W85 A;  4HNV A;  2HOA A;  1ETV A;  3GFI A;  1G3W A;  2F5D A;  1IO2 A;  5GPC A;  3RI4 A;  2KIF A;  1RR8 C;  2Q0O A;  1V5E A;  3J7A O;  3HHG A;  5TRD A;  1I6X A;  1LFB A;  3IL2 A;  3H0D A;  1BI0 A;  2NVX J;  1BOA A;  3JR9 A;  2BYV E;  2COB A;  2H09 A;  3VYU B;  1FOY A;  3O3K A;  2NXN B;  5CVJ A;  3VYS B;  4J00 A;  5FRM A;  2UWM A;  3QPH A;  3DKW A;  1QNT A;  3FDY A;  4ZTJ A;  4DBR A;  2CW7 A;  5FFX A;  3VWB A;  4DGW B;  2V6C A;  1X3W B;  3GTL J;  3I4N J;  3C1D A;  2AHQ A;  2A6H F;  4B09 A;  1Y1W J;  4NC7 A;  4DYC A;  1IV6 A;  2GWR A;  5LGN A;  1R4N B;  1XG1 A;  2JTV A;  4M73 A;  3SYT A;  1YIO A;  5J8C A;  1VQM I;  2E71 A;  5BMZ A;  1OMI A;  1PUE E;  2HDD A;  5J8F A;  1E0E A;  3K4K A;  5DCM A;  1B8I B;  1XCV A;  4L18 B;  1O3S A;  3HUG A;  2YUS A;  4E70 A;  3DWL E;  1V54 H;  3HIF A;  3M8J A;  2ME6 A;  1UHW A;  2LBF B;  4S0H B;  1U5T B;  1R5H A;  2JA6 J;  3S2H J;  1HC8 A;  4O3M A;  3VOD A;  4A6D A;  3HOX J;  3CC7 I;  2DA5 A;  3K7A J;  5D6F A;  5KVR A;  3BOQ A;  3JRB A;  2WB1 N;  3ZPL A;  3GUD A;  4A93 J;  4G6Q A;  2W82 A;  3I59 A;  4HBL A;  5JVT A;  3MZH A;  1KU3 A;  1FX7 A;  3W2V A;  3C3W A;  2H94 A;  3R60 A;  3ABK H;  1IV8 A;  3E0J B;  1A36 A;  2CG4 A;  3QQA A;  2R7U A;  2DQR A;  3M07 A;  4KIG A;  1UFM A;  1X2M A;  5JHU A;  3RPQ A;  2FD5 A;  4WXH A;  3JW4 A;  2Z1D A;  3HKZ N;  4UUT A;  4ZYE A;  5HNH A;  1MBF A;  2F5E A;  3AL0 C;  1BR1 A;  3F21 A;  4RB2 C;  1W1W E;  1R7J A;  1DGR M;  2K4B A;  4OOI A;  1S9H A;  3ZQG A;  3G2B A;  3HPH A;  3RPU A;  2CQ7 A;  3F8B A;  2HPM A;  1MJ9 A;  1MMD A;  4E4H A;  2L4A A;  4MFE A;  4V2G A;  3FKJ A;  3OYI A;  1OCR H;  4XMY A;  3GLL A;  2Z9O A;  3OYB A;  5CQG A;  4FTH A;  4L9T A;  1FP2 A;  3BG5 A;  4Y33 A;  3K6G A;  3ESW B;  1F9N A;  2Q2E B;  1AA7 A;  1FBU A;  3A0B C;  5CVU A;  4AUX A;  4NDL A;  1PP7 U;  3EDP A;  4IHS A;  3LQQ A;  1Y8R B;  1QPI A;  3Q9S A;  3ZQC A;  1IN5 A;  1A31 A;  2PN6 A;  1MMA A;  1FMW A;  2I10 A;  2L9R A;  2BW3 A;  3OS0 A;  2M45 A;  3U21 A;  4BDZ A;  3SXY A;  3FHN A;  1IUY A;  4A12 A;  2EFP A;  2LBF A;  1P4X A;  4N4O B;  4LIV A;  2CV0 A;  1TWG J;  1R5G A;  3OS2 A;  2FQ4 A;  1YTY A;  4RGU A;  1VQ5 I;  2M30 A;  2TDX A;  2V9V A;  3VYT B;  1VQ9 I;  4BAC A;  2XIG A;  1AOY A;  3M4O J;  4XM3 A;  3WTV C;  4FX4 A;  3NWS A;  5EJC A;  5CKT A;  5D4S A;  3GO5 A;  4BHP A;  4ZZD A;  2BOL A;  1K6Y A;  4NB5 A;  1OFC X;  3FX3 A;  3CF2 A;  2DJN A;  4E7H A;  3QRF F;  1MH3 A;  2Y0S A;  2GA2 A;  2E36 A;  4IJA A;  1P4W A;  3K1N A;  4LIT A;  5E17 F;  1KU9 A;  1EH7 A;  2DI3 A;  4BE1 A;  2H6B A;  3F72 A;  1LVK A;  4LLG F;  4XLN F;  2R7W A;  3H36 A;  5KAI C;  2NYX A;  3IHU A;  1X3Z B;  4EJT A;  4HF2 A;  2KJC A;  4O5V A;  2VQH A;  4OIR F;  1Z9C A;  1RUN A;  2Z33 A;  2XAU A;  2E7X A;  4ETS A;  2ZJP F;  2GQQ A;  3SZP A;  3COA C;  4DBQ A;  1XPX A;  3HOY J;  1KQ0 A;  2PI0 A;  3L2W A;  3H1C A;  3QWL A;  3G6E I;  3CC4 I;  1QVT A;  3P7N A;  1F43 A;  5EZG A;  2DLL A;  1NTC A;  4XON A; 
#chains in the Genus database with same CATH homology
 2OZ6 A;  4ZYD A;  3QOP A;  3WGI A;  2EK5 A;  2QEN A;  1LQ1 A;  4P9U A;  3KP2 A;  2HGC A;  1ULY A;  4Q47 A;  1K78 A;  5D8K B;  4A0Y A;  1YYV A;  3E6C C;  2IA2 A;  3J81 K;  2JRT A;  2EFN A;  5CLS A;  1ZYR F;  2DK5 A;  4UVC A;  3GVA A;  2XV4 S;  1KGS A;  1U2W A;  3KP5 A;  1MZB A;  2PMU A;  2RC4 A;  1SD6 A;  4UXN A;  1MD0 A;  2ELH A;  4RB1 A;  5HS8 A;  2A5Y B;  5LLQ A;  1T6S A;  3WU1 B;  3ELK A;  1BC8 C;  3KEQ A;  2XVC A;  4RS8 A;  3FXQ A;  2PJP A;  1FP1 D;  1ZG3 A;  3K2Z A;  2ZO4 A;  3D0S A;  3R0A A;  2IA0 A;  2JPB A;  3ABT A;  2V1D A;  4OU0 A;  2ETH A;  1P4A A;  2FNP A;  1DPR A;  2Z99 A;  3ABU A;  4CHU A;  1D8K A;  4GO1 A;  1EV7 A;  1R1T A;  5BQT A;  2J5O A;  3M1E A;  3EQL F;  3QU6 A;  4GXO A;  1MJB A;  3FMR A;  5F6F A;  1KQ8 A;  1FNN A;  5E8I A;  5DEQ A;  1IXR C;  2W57 A;  4ZYH A;  4EQQ A;  5HVQ C;  4GYG A;  3K0L A;  2O3F A;  3HRU A;  4KYW A;  2VC1 A;  3KZZ A;  4M6Y A;  3V7R A;  1BN5 A;  4DNC A;  4NQW A;  3KEO A;  4EMS A;  5FLX Z;  2VE8 A;  2PLY A;  4Z2Y A;  3JSP A;  2RQP A;  4P96 A;  4L9N A;  2M8E A;  3K1M A;  4UUV A;  1QZZ A;  3TO6 A;  5CVV A;  4O6J A;  1FSE A;  1TTY A;  1WRJ A;  4I01 A;  3R0J A;  3ZN1 A;  5DYM A;  3GFL A;  4EV0 A;  1RUO A;  3ZP5 A;  2DPD A;  5ERI A;  2VT3 A;  4EM0 B;  4HQM A;  4XSX F;  2FE3 A;  3ZMS A;  5L3G A;  4AIJ A;  3KP3 A;  2A61 A;  3ZMV A;  1XSV A;  5KK1 A;  2PFB A;  1OYW A;  4KIC A;  2KKO A;  4N9H A;  1B1B A;  3H3U A;  2DU9 A;  4D0P A;  2VBW A;  1PP8 F;  2G7H A;  1UHM A;  1BIB A;  1FWZ A;  2FQ3 A;  5D5W B;  5FFZ A;  1YQA A;  2ESN A;  2HZT A;  5ILU A;  1XMA A;  2HDC A;  2HWV A;  4MQV A;  4M6X A;  2MH2 A;  1U8R A;  1FC3 A;  4QWQ A;  1ON1 A;  2O0Y A;  2YSR A;  4M72 A;  1K79 A;  2QQB A;  1ZRF A;  3IWF A;  3ZMD A;  4HLY A;  3KLN A;  2FMY A;  4ZZL A;  1FYM A;  4UVB A;  5JR3 A;  2LF7 A;  2HTS A;  1EH6 A;  1PDN C;  1TNS A;  1ZRD A;  2K86 A;  2A68 F;  1SD5 A;  5E1W A;  1IN7 A;  1HKT A;  3BPX A;  4Q48 A;  5CYV A;  3RTR A;  3L2C A;  4ESB A;  3MEX A;  3WTX C;  1I1S A;  1SD7 A;  2QLZ A;  1S29 A;  2VBY A;  1T2K A;  4KNY A;  4G7O F;  3MCZ A;  5ILS A;  2AS5 F;  1A04 A;  4LLN A;  3WGG A;  3K1P A;  2EFW A;  2H27 A;  4A6E A;  2L01 A;  3JAM Z;  2ZNY A;  1Z6T A;  2CWE A;  2E7W A;  1JXS A;  3BJ6 A;  2UXN A;  3IKV A;  2JPC A;  4M9X A;  2EV6 A;  3C18 A;  4M9S A;  3DFG A;  3NRV A;  2RV8 A;  2M5W A;  4R79 A;  4U7B A;  3S2W A;  1DP7 P;  3B73 A;  4CIC A;  4MTD A;  4WXC A;  4H0E A;  1ODD A;  2CFX A;  2OD5 A;  4P55 A;  4UHT A;  2DTR A;  3AAF A;  2FRH A;  4PGH A;  3SZT A;  3TO9 A;  4EGY A;  4RAY A;  2ESH A;  1XGS A;  2EA2 A;  5IT3 A;  1E17 A;  2OBP A;  1XSD A;  1RI7 A;  2DO7 A;  4WWC A;  5A2Q K;  1W7P B;  5L3B A;  3HHH A;  1R23 A;  1TLH B;  4P9F A;  3ULQ B;  1Z05 A;  2D45 A;  5F1R A;  1VTN C;  4L0Y B;  1YW8 A;  4HX4 A;  4ENJ A;  4IF4 A;  5LHI A;  5H20 A;  3I59 B;  2Q8K A;  1ZHF A;  4IRG A;  3GYH X;  1Z7U A;  3P9I A;  5IT9 K;  1B59 A;  1I5Z A;  3NEU A;  1IRF A;  2GAU A;  3LA2 A;  4GYI A;  2P6S A;  1YFH A;  3LST A;  4RGX A;  5ICE A;  3OV8 A;  2VOP A;  4RB0 A;  3GFJ A;  1XDU A;  3R61 A;  3FXU A;  3WTT C;  3R6S A;  1IN6 A;  5FD5 A;  5EEG A;  3WU0 A;  3TQN A;  3DP7 A;  1BI3 A;  1ZG1 A;  4AIK A;  2ZFW A;  4UVA A;  2Q2E A;  3C7J A;  5HDG A;  1YS7 A;  2RVC A;  3LFK A;  1J59 A;  4RB3 C;  4ASN A;  3ML6 A;  2UZK A;  5E1X A;  1HW2 A;  1KYW A;  4ESJ A;  2LKP A;  1XCB A;  3KP6 A;  3SQN A;  4S05 A;  2EWN A;  5IT9 Z;  2F5C A;  2RDP A;  5HDN A;  1LDK B;  4KA4 A;  4U88 A;  1O3T A;  1KQ9 A;  4TV7 A;  3ZMU A;  3EYY A;  4HV6 A;  1QZY A;  1NHA A;  3T8T A;  4A0Z A;  3H92 A;  2VOD A;  3GZ6 A;  4MEX F;  1DDN A;  1J0R A;  5LRS A;  3K69 A;  3F8F A;  2QBY A;  2KIM A;  3IRR A;  1FBS A;  2VOO A;  1W7P A;  3I0T A;  1BI2 A;  5K5Q A;  3GLX A;  2VBZ A;  4U0W A;  3V7C A;  3WTY C;  4I09 A;  3KP7 A;  1LVA A;  4IPA A;  1SFE A;  3E5U A;  1S7A A;  3CUO A;  2FEZ A;  2P5L C;  3WOD F;  3N4M A;  4PZJ A;  3WTZ A;  3KZY A;  1GXQ A;  1U6G A;  2Y0M A;  4EJU A;  3V8K A;  2IVM A;  4YII A;  5DV5 A;  1OPC A;  2A3S A;  5LBQ A;  3ECO A;  1QGP A;  5FLX K;  1V4R A;  1D3Y A;  2XHK A;  3L7W A;  4KUM A;  3FWE A;  2J5P A;  3BPV A;  3F8M A;  4WXD A;  3M7G A;  3L9F A;  2WWY A;  1W7P D;  2FXA A;  1ZLK A;  3GFM A;  4IRH A;  3J80 Z;  4MEY F;  5F64 A;  2A69 F;  3RKY A;  3SHF A;  3FZV A;  1S6L A;  3HOT A;  2K7L A;  1STZ A;  1P6R A;  2STW A;  1T98 A;  2P7V B;  3F22 A;  3U1D A;  4ZH4 F;  5E1Z B;  3TO7 A;  3PQJ A;  3RJP A;  1B4A A;  4HDU A;  2K4J A;  1FSH A;  2E1C A;  1HW5 A;  2D1V A;  2FBI A;  5LEJ A;  1IZ1 A;  3F6V A;  1V3F A;  4FX0 A;  1U78 A;  2UXX A;  2RKH A;  5HS7 A;  1R36 A;  1YS6 A;  5D5U B;  4S04 A;  3BWG A;  4N0B A;  3F6O A;  5E20 A;  2QUF A;  4I2O A;  1XSX A;  4Y15 A;  2DK8 A;  3MWM A;  2P8T A;  3ZMT A;  1OYI A;  1IW7 F;  3DXJ F;  2GZW A;  5L3E A;  2RGV A;  5TJJ A;  1UB9 A;  3J80 K;  1GHC A;  4K2E A;  3HSE A;  4M9Z A;  2CO5 A;  4G9Y A;  4U0Y A;  4M71 A;  4A5M A;  1J75 A;  2L54 A;  2DW4 A;  1TW3 A;  2VXZ A;  4RAZ A;  2YX4 A;  1U5T A;  4IVN A;  3VFZ A;  5K1Y A;  4KMF A;  3D5L A;  5FB2 A;  3E3V A;  3F8N A;  1MJA A;  2MC3 A;  2PEX A;  3BJO A;  1ONV A;  1JGS A;  2ZME B;  3L00 A;  1IN8 A;  5CVR A;  1UCR A;  4HZF A;  3ERE D;  3RYP A;  5CVI A;  2W84 A;  2HYF A;  3G3Z A;  2GA1 A;  4HA8 A;  4HX7 A;  3WE3 A;  2AXL A;  3IC7 A;  3RYR A;  2GXG A;  1EH8 A;  1ZAR A;  1F1Z A;  5ICG A;  1BIA A;  2R3S A;  5E18 F;  3WE2 A;  2Z5U A;  5DD8 A;  4L9V A;  3WTW C;  3JTH A;  4HV5 A;  4AWX B;  5HLH A;  3V8L A;  1MKM A;  2WC2 A;  3I4P A;  3ZQ7 A;  3H3Z A;  3T8R A;  2L4M A;  4LB5 A;  1KU7 A;  1ZG5 A;  3WTS C;  1BJA A;  4HOB A;  5EEH A;  3DPL C;  4LGW A;  5HDK A;  5BS6 A;  4I0B A;  2HYG D;  4JK1 X;  5D6E A;  4P5O A;  3LA3 A;  3MQ0 A;  3KFW X;  1U3E M;  2O6G E;  3DQV C;  2BE5 F;  4FT8 A;  2LDU A;  3FMQ A;  1DUX C;  4MQ9 F;  2Y75 A;  1LDJ A;  1FPQ A;  2KRF A;  3Q9V A;  4XSZ F;  3EYI A;  3TGN A;  4L9J A;  1IF1 A;  3DEU A;  4BHC A;  1GVJ A;  1L0O C;  3KE2 A;  2CW0 F;  3RKX A;  5AON A;  1X3U A;  4BH9 A;  4DQ2 A;  4EM2 A;  3G73 A;  2W25 A;  4EJW A;  2IP2 A;  1XDS A;  4YIF A;  3E5X A;  1D8J A;  4I98 B;  3F3X A;  2NNY A;  5DD4 A;  1QPM A;  1LEB A;  3ZMZ A;  2ZKZ A;  5HLI A;  3HRM A;  4BQA A;  2D2W A;  1KYZ A;  2QWW A;  1FBQ A;  1TQP A;  1K7A A;  2HQR A;  2MD5 A;  2KIU A;  3VEP A;  1TBX A;  4LD5 A;  1J5Y A;  1G6N A;  5D4R A;  5AIP A;  2QM3 A;  3KP4 A;  1OYY A;  3B02 A;  4F7Z A;  6PAX A;  3GXO A;  5D5V B;  1TW2 A;  4HAM A;  1G4D A;  2OAZ A;  4AD9 A;  3E97 A;  3JAM K;  3E6D A;  2XKP A;  2PBI A;  2FNA A;  1FOK A;  4IXA A;  2VC0 A;  4OMZ A;  3ZN0 A;  4QLC U;  4I02 A;  2MA3 A;  1S7O A;  2VT2 A;  3PFI A;  1U5T C;  1ON2 A;  2FU4 A;  4I7H A;  3GEZ A;  2HTJ A;  3CUQ A;  1ZAO A;  3QP6 A;  5HS9 A;  5JI6 A;  2DT5 A;  3R4K A;  3HRS A;  4LFU A;  4HQE A;  3HOS A;  1HSJ A;  1G3S A;  4LMY A;  1Z91 A;  4L0Z B;  3HRT A;  1WWX A;  2ISZ A;  2O61 A;  3E6M A;  4KN4 X;  1LNW A;  4CYD A;  3BP8 A;  4LG0 A;  4M74 A;  1FYK A;  4PCQ A;  3MAJ A;  2X0L A;  4ZYG A;  2PG4 A;  1QO0 D;  2CQK A;  3WGH A;  3V7S A;  1JHF A;  2QYO A;  4BAY A;  1H9T A;  4CXF A;  2QQA A;  1W5T A;  1R1U A;  3TOB A;  3M8F A;  5DDG A;  1IXS B;  3M9A A;  2P5K A;  3P9C A;  2V1U A;  3K9T A;  4BNC A;  4LK1 F;  4WX9 A;  1K78 B;  1F5T A;  1S3J A;  2ZXJ A;  4PDK A;  1O3Q A;  5LGT A;  2X4H A;  3U2R A;  2LSO A;  2WTE A;  1BC7 C;  3HYI A;  3NQO A;  2JZY A;  5D5X B;  2DQL A;  2XKO A;  5FO5 A;  5DUI A;  3REO A;  5ED4 A;  4WK8 F;  4EM1 A;  3CUQ C;  1S8N A;  4HDV A;  3P9K A;  4I0A A;  4MGR A;  3BZ6 A;  2WV0 A;  1SFX A;  1B6A A;  4R1H A;  3WG9 A;  3TDZ C;  4Y13 A;  1TNT A;  1HW1 A;  2LF8 A;  3V4G A;  4ESF A;  3JSO A;  4ON0 A;  4YFN F;  2M87 A;  2L02 A;  2MLG A;  1Y0U A;  1E2X A;  3DF8 A;  1ZRE A;  2DAO A;  2RN7 A;  2W24 A;  3WTU C;  1FZP B;  4Q4Z F;  2IW5 A;  4KIF A;  2FBH A;  3BJA A;  3RKW A;  5L3F A;  1XN7 A;  2QQ9 A;  2F2E A;  1SMY F;  4LLL A;  4OIP F;  1K6O A;  4A2U A;  1W5S A;  1AWC A;  3PQK A;  1J2X A;  4CO8 A;  5BPD A;  4XBF A;  1WKM A;  2XRO A;  1WQ2 A;  3W6K B;  1I1G A;  1IRG A;  5ILV A;  1O3R A;  3T5X A;  2HQN A;  2DFI A;  2A07 F;  4IRI A;  5A2Q Z;  1UST A;  5LEK A;  1FT9 A;  3CJN A;  4U0V A;  3TKY A;  4OIO F;  1P2F A;  3HSF A;  1F4K A;  2XAG A;  3TOA A;  1FYL A;  2K02 A;  1YO5 C;  3SFZ A;  4YFK F;  2M1B A;  5K5O A;  2XAS A;  3J81 Z;  1R1V A;  3IWZ A;  2KJB A;  2OZU A;  4NHJ A;  1ZRC A;  1T0F A;  3LQR A;  5ICC A;  4KMU X;  2FBK A;  3FXR A;  4LJZ F;  2EV0 A;  2OQR A;  2DPU A;  1B9M A;  2ZNZ A;  2XAH A;  2P6T A;  2NNN A;  4HF0 A;  2R7F A;  3I71 A;  2IPQ X;  5LRR A;  5FD6 A;  1JHH A;  4U7D A;  3BDD A;  3FF5 A;  5BPI A;  2IT0 A;  3CDH A;  2YU3 A;  5HLG A;  3MFK A;  4WF2 A;  4AVP A;  1FY7 A;  3QPT A;  1SAX A;  2ZCW A;  4EJO A;  4BXU A;  2CYY A;  4LK0 F;  1ZGA A;  1MDM A;  3F8C A;  3I53 A;  4LB6 B;  3BRO A;  2A6E F;  2OA4 A;  2IA1 A;  4BHB A;  1W4M A;  3QP5 A;  1T38 A;  4RGR A;  3RIR A;  5LHG A;  2V79 A;  2P7C B;  2LNB A;  3ECH A;  2F5F A;  2NAZ A;  1ZH5 A;  2VBX A;  2HS5 A;  1BBY A;  5LHH A;  5DCM B;  1HST A;  3FM5 A;  4G8X A;  2XGX A;  1LJ9 A;  1DPU A;  4HF1 A;  4R8H A;  1YW7 A;  1IAW A;  1HXD A;  4RGS A;  2XRN A;  3KCC A;  1YLF A;  1P92 A;  4PGG A;  3MZY A;  1RZ4 A;  5L3D A;  1SFU A;  1GXP A;  1LB2 A;  1T39 A;  2ZJ2 A;  3DPT A;  3M8E A;  1XB4 A;  4GGG A;  3HSR A;  4L5J A;  4UV8 A;  3GF2 A;  1C0W A;  1HKS A;  2QVO A;  2FSW A;  3N97 A;  4CDG A;  2HOE A;  4AIH A;  2FML A;  2HKX A;  2EV5 A;  1XGM A;  2BBY A;  5BOX A;  1FLI A;  3O2P E;  5HOO A;  2ISY A;  4UNO A;  2EFQ A;  2ZME A;  1L3L A;  1SD4 A;  2Z3Y A;  3O6B B;  3LWF A;  3T1B A;  4B8X A;  4WCG A;  5L3C A;  2C6Y A;  3F23 A;  2PMH A;  3I64 A;  1XMK A;  2EFO A;  3V8J A;  3CO6 C;  1Q1H A;  1RNL A;  3EET A;  3EUH A;  2GIV A;  2Y48 A;  2B0L A;  3DV8 A;  4N9I A;  1TQI A;  2COM A;  4CZZ A;  4ENK A;  1G3T A;  4BYY A;  2P4W A;  2ACJ A;  3OOP A;  1BI1 A;  3E5Q A;  5J6X A;  3FHZ A;  1Z1D A;  3RDI A;  3W6J B;  4EGZ A;  2FF4 A;  2JT1 A;  2EB7 A;  3GWZ A;  2FA5 A;  4EVI A;  5CJ9 A;  3BY6 A;  1CGP A;  5K5R A;  1XD7 A;  3L09 A;  1Z6R A;  4XRF A;  2GXB A;  5ICF A;  1CF7 B;  1B9N A;  2EJR A;  3IKT A;  4UV9 A;  3HTS B;  2DBB A;  4XLP F;  3E6B A;  2JSC A;  4KN7 X;  1IN4 A;  1TQM A;  2XAQ A;  4A0X A;  1O57 A;  1YG2 A;  4FHT A;  2MBF A;  3T0Y A;  3IRQ A;  1H9G A;  4HX8 A;  4KT5 C;  1MDM B;  5LGU A;  1XGN A;  3Q5F A;  3CTA A;  3I54 A;  1I27 A;  3I58 A;  4A5N A;  1XGO A;  4HYE A;  3VOE A;  1HQC A;  2QZ8 A;  4OIQ F;  1KU2 A;  2MH9 A;  4G94 A;  3LAP A;  1ZN2 A;  4MNU A;  3GW2 A;  2CSO A;  2HKO A;  2YR2 A;  3QU3 A;  2YPR A;  1R00 A;  4G7H F;  4LG0 B;  4KIB A;  3ISP A;  2H6C A;  2G7U A;  2OU2 A;  1YW9 A;  3JTG A;  4MTE A;  5E8G A;  1J7K A;  4HLX A;  4G7Z F;  2R7D A;  1WI9 A;  2XUB A;  2BV6 A;  3GX4 X;  4JQF A;  2BGC A;  1R58 A;  2O8X A;  1R22 A;  4ENM A;  3VB2 A;  2QBY B;  2OQG A;  2E1N A;  2K27 A;  1RIO H;  1LEA A;  4EJV A;  2ADU A;  4HW0 A;  1D5V A;  4OIN F;  2VON A;  2HEO A;  5H6Q A;  3CO7 C;  2STT A;  1ZLJ A;  3CLO A;  5DCF A;  4KFC A;  4KDP A;  2G9W A;  4Q5S F;  1QQI A;  3I5U A;  1J9I A;  2NRA C;  4G6D A;  1H0M A;  2O03 A;  3ROU A;  1REP C;  5JFR A;  2XAF A;  1LDD A;  1G3Y A;  5FGM A;  3U9G A;  4MHG A;  4CGZ A;  1OKR A;  2MLK A;  1QBJ A;  1CF7 A;  3LAJ A;  2D1H A;  3KLO A;  4L5I A;  4Y17 A;  2HR3 A;  1HKQ A;  1O7L A;  2IJL A;  4YG2 F;  4IHT A;  3FM3 A;  1JE8 A;  3QAH A;  2BEO A;  4ENN A;  3HTU A;  2P5V A;  2ZBK A;  1HBX G;  4GCV A;  2VN2 A;  3CUQ B;  1IXC A;  1KA8 A;  4OMY A;  2FOK A;  3LA7 A;  4YFX F;  5H6R A;  2EA4 A;  2RNJ A;  3TDU C;  2XAJ A;  1O7F A;  1MGT A;  1ZGJ A;  2V1X A;  3FMS A;  5D8L B;  2CGP A;  3GZ5 A;  1USS A;  2HFH A;  1WSU A;  2YX7 A;  3KET A;  2IRF G;  1OR7 A;  2NS0 A;  5DUK A;  1BM9 A;  2VE9 A;  2PQ8 A;  2L3D A;  1SMT A;  4JBA A;  5AIQ A;  2W85 A;  3GFI A;  1G3W A;  2F5D A;  3RI4 A;  2KIF A;  2Q0O A;  3J7A O;  3HHG A;  5TRD A;  1I6X A;  3IL2 A;  1BI0 A;  1BOA A;  2BYV E;  2H09 A;  3O3K A;  5CVJ A;  2UWM A;  3QPH A;  3DKW A;  1QNT A;  5FFX A;  2V6C A;  3C1D A;  2A6H F;  4B09 A;  2GWR A;  5LGN A;  4M73 A;  2JTV A;  1YIO A;  5J8C A;  5BMZ A;  1OMI A;  1PUE E;  5J8F A;  5DCM A;  4L18 B;  1XCV A;  1O3S A;  3HUG A;  4E70 A;  3HIF A;  1UHW A;  1U5T B;  1R5H A;  4O3M A;  3VOD A;  4A6D A;  3ZPL A;  5D6F A;  3BOQ A;  5KVR A;  3GUD A;  4G6Q A;  4HBL A;  3I59 A;  5JVT A;  3MZH A;  1KU3 A;  1FX7 A;  3C3W A;  2H94 A;  3R60 A;  2CG4 A;  2DQR A;  4KIG A;  5JHU A;  1UFM A;  3RPQ A;  4WXH A;  3JW4 A;  4ZYE A;  2F5E A;  3F21 A;  4RB2 C;  1R7J A;  2K4B A;  4OOI A;  3RPU A;  3F8B A;  1MJ9 A;  2L4A A;  2Z9O A;  4L9T A;  1FP2 A;  1F9N A;  1FBU A;  5CVU A;  1PP7 U;  3EDP A;  4IHS A;  3LQQ A;  3Q9S A;  1IN5 A;  2PN6 A;  2M45 A;  1IUY A;  3SXY A;  4A12 A;  2EFP A;  1P4X A;  1R5G A;  1YTY A;  4RGU A;  2M30 A;  2TDX A;  2V9V A;  2XIG A;  1AOY A;  3WTV C;  4FX4 A;  5D4S A;  3GO5 A;  4BHP A;  4ZZD A;  4NB5 A;  3FX3 A;  3QRF F;  2GA2 A;  4IJA A;  1P4W A;  3K1N A;  5E17 F;  1KU9 A;  1EH7 A;  2DI3 A;  2H6B A;  3F72 A;  4LLG F;  4XLN F;  2NYX A;  3IHU A;  4EJT A;  4HF2 A;  2KJC A;  4O5V A;  4OIR F;  1Z9C A;  1RUN A;  2Z33 A;  4ETS A;  2E7X A;  2GQQ A;  3SZP A;  3COA C;  1KQ0 A;  2PI0 A;  3P7N A;  2DLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...