3F3XA

Crystal structure of the transcriptional regulator bldr from sulfolobus solfataricus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
139
structure length
139
Chain Sequence
b'MQKIDEKLQLMNTIAKIYRGSIKEFNNRLGKLMNLSYLDFSILKATSEEPRSMVYLANRYFVTQSAITAAVDKLEAKGLVRRIRDSKDRRIVIVEITPKGRQVLLEANEVLRNLVNEMLSDVENVEELLEGLNKILSRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, marR family, putative
publication title Structural analysis of BldR from Sulfolobus solfataricus provides insights into the molecular basis of transcriptional activation in archaea by MarR family proteins.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transcription
total genus 54
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f3xA00
4G6DA 1FYLA 3E6CC 1PUEE 2CFXA 2QVOA 1RNLA 3BDDA 2EFNA 3GFLA 4OU0A 2VONA 2FBHA 2JT1A 1SD5A 5BPDA 1ZG5A 1IUYA 1FNNA 2BGCA 1TBXA 3HOSA 3FHZA 2YX4A 3R6SA 5CYVA 2VXZA 2IRFG 2L01A 3RPQA 5FFXA 3FF5A 5CVVA 1XGSA 3EETA 3J81K 1YW8A 5TRDA 2ADUA 1I1SA 4G7HF 4S04A 4ESJA 2MA3A 1QZZA 2KJCA 5D6FA 3WTTC 5FD6A 3F6OA 1U5TA 4IRIA 1SFUA 3K9TA 4UHTA 4G94A 3I5UA 3RKYA 2FNPA 1XSDA 5CVRA 4TV7A 3F22A 2GA1A 3NQOA 1HQCA 4G7OF 5J8CA 2DAOA 2ZXJA 1TTYA 2FNAA 4RGSA 2A3SA 4GYIA 1R23A 4IPAA 1X3UA 2PN6A 4Y15A 4MHGA 2L02A 3NRVA 3FZVA 3DPTA 4HF1A 2NNYA 5E17F 2VC0A 1PDNC 4KIFA 3T5XA 4KIGA 1DUXC 3BY6A 4NHJA 3WGGA 3AAFA 1BOAA 2BBYA 4EJVA 2E7WA 2RDPA 3HSEA 1LDJA 2P5LC 3KP7A 1LQ1A 3E5XA 1IXSB 1IN5A 4GO1A 3M7GA 1OMIA 2DPDA 1B6AA 4L0ZB 2JTVA 1LDDA 3V4GA 4KMUX 2MD5A 2WTEA 1Q1HA 3L7WA 4AVPA 3WG9A 3GW2A 2P8TA 1HKTA 4HLXA 4LJZF 1P4XA 3I58A 1BI2A 2QYOA 1BIAA 1FC3A 3C3WA 3CO6C 1LEBA 5ERIA 4Q4ZF 4IRHA 1YW7A 1J7KA 3KEQA 3R0AA 3DPLC 2VN2A 2Z99A 3E5UA 2M1BA 3WTYC 1I27A 5LEJA 3L2CA 2ZO4A 3ZP5A 2L54A 1T6SA 1ZARA 1EH6A 2VT2A 1YQAA 3I59B 1BJAA 2K86A 1RUOA 2F5CA 1SD6A 4IJAA 2ZJ2A 4OIPF 2PJPA 1OR7A 5D4SA 3IKVA 2VBZA 1V4RA 5L3BA 4EM0B 2QUFA 2XKOA 4A2UA 4EMSA 3CLOA 1J59A 2FQ3A 2RNJA 5IT3A 5DD8A 4QLCU 3RYRA 2DTRA 3RKWA 2A5YB 2XROA 5DCMB 3IC7A 4R8HA 1U3EM 2OZUA 3R4KA 1UHMA 5ICGA 3RDIA 2MH9A 4HQEA 2F5EA 4PDKA 2GZWA 3RPUA 4JQFA 4HX7A 3KZZA 1W5TA 2XRNA 4LK1F 2PFBA 2A69F 2OZ6A 4MTEA 3HRSA 4M9XA 1R36A 6PAXA 3T1BA 2D1VA 3I71A 3BROA 1XGNA 3CUOA 2F2EA 3V8KA 1QQIA 2MBFA 1JHHA 3F8NA 3V8JA 1K6OA 4OINF 4IHSA 2OA4A 2ZMEA 4JBAA 1J75A 5D8KB 4M6YA 1U2WA 4KUMA 4XSZF 3VOEA 5LRSA 1IRGA 3FXRA 1YIOA 2V9VA 2DI3A 1FX7A 1ULYA 1WWXA 2COMA 4IVNA 5TJJA 1KQ8A 5FD5A 1FT9A 3GEZA 5D5WB 4HV6A 3HRTA 3JTHA 4CGZA 2G9WA 3HTUA 2W57A 3BOQA 1FY7A 5CJ9A 1U78A 4UV9A 4A6DA 4L9NA 2UXNA 3H3UA 1SMYF 5HLGA 4EQQA 3Q9SA 2IA1A 2XASA 4RB0A 1MGTA 5AONA 1XN7A 1XSVA 5A2QK 3C7JA 4MNUA 3QPHA 3GX4X 3BWGA 3DF8A 2E1NA 3FM5A 5DYMA 1XD7A 5CVJA 1OYIA 4WCGA 4ZYGA 1U5TB 2L4MA 1MJBA 2QQAA 3GLXA 4WXHA 5D5XB 1S8NA 4AIKA 4A5MA 2Y48A 3GVAA 1CF7B 5HVQC 2Y75A 1S3JA 2ZKZA 1G3TA 3QOPA 4EVIA 4L5JA 5HS8A 2K4BA 3HOTA 4XSXF 3ECHA 2HR3A 2LF7A 3KP6A 2WWYA 3FMQA 1DPUA 2O03A 2R7FA 5L3GA 4HX4A 3BP8A 2FOKA 2J5PA 2LKPA 2XGXA 3F8FA 3CDHA 2Z5UA 3IRRA 4CHUA 4M9SA 1FP2A 4B09A 3ERED 3KP3A 1Z6RA 5LLQA 3K0LA 2CSOA 3MAJA 3GZ6A 2FMYA 2KJBA 2O61A 3QP5A 2PEXA 4KIBA 3RI4A 2W85A 3I59A 4BAYA 3HYIA 1XSXA 3GFIA 5LEKA 2XHKA 3ECOA 3F6VA 1U8RA 1P2FA 2LDUA 1R5HA 4AIHA 1OPCA 2IW5A 4M71A 4BXUA 4N9IA 1IN4A 4M74A 4RB3C 1XGOA 1BM9A 1ZH5A 1W7PA 1F1ZA 1CGPA 1DP7P 2CQKA 3N4MA 3K1MA 4KYWA 4EV0A 2WV0A 1S29A 1D5VA 4YFNF 1A04A 4EJOA 2XIGA 2FSWA 3WGHA 1ZGAA 3P7NA 3MFKA 2K02A 4WX9A 3U9GA 3JAMZ 3BPXA 3WODF 4I0AA 2HWVA 1JGSA 2TDXA 2H94A 3RKXA 1O57A 2P5KA 3GWZA 5L3CA 1ZLJA 2RN7A 1EV7A 2EFQA 3QAHA 2UZKA 4RB1A 1TQMA 5ICFA 4RGUA 4MQ9F 3EYIA 5E8IA 5BOXA 2K27A 1TLHB 4AIJA 5LGTA 3LQRA 1GXPA 3KCCA 3HHHA 3ML6A 2YPRA 3HIFA 4MGRA 4ETSA 3D5LA 5ICCA 1U5TC 1QO0D 2HFHA 4UUVA 3E97A 1Z91A 3LA3A 1SD7A 2ZCWA 2KKOA 1UHWA 2IJLA 2EA2A 4K2EA 1HKSA 1T98A 3TOAA 2ZMEB 2LSOA 5BMZA 5FO5A 3ZPLA 4HDVA 1YG2A 2KIMA 1IW7F 3EDPA 3ULQB 4ENNA 4G8XA 1IAWA 3COAC 1MJAA 3B73A 5J8FA 1FBUA 3KE2A 2L4AA 4L0YB 1S6LA 4KFCA 4UVCA 3BJOA 5HS7A 1FOKA 1PP7U 1P4AA 2W25A 5CLSA 2CO5A 4EJWA 5EEHA 1MKMA 4Z2YA 1CF7A 2GAUA 4R1HA 2P6TA 3H92A 2V1DA 4ZYHA 2EK5A 3ZQ7A 1F4KA 2FMLA 2GIVA 4YFKF 1YS6A 1ONVA 2XUBA 5ICEA 4N9HA 3N97A 3MCZA 3WTXC 4RAYA 4LGWA 3I0TA 3CJNA 4YG2F 5H6QA 1L0OC 2GQQA 2AS5F 3GZ5A 3R0JA 1J2XA 4GYGA 1D8JA 2J5OA 2OD5A 2F5DA 1AOYA 1YLFA 2Q8KA 1REPC 1LB2A 1O3TA 1RI7A 2H09A 1R5GA 3E3VA 4FT8A 2EV5A 5LBQA 1B9MA 1W7PD 3KETA 4OOIA 5DUKA 3P9IA 3JSPA 5DEQA 2DO7A 4ENMA 1B9NA 2NAZA 4D0PA 1YW9A 3IWFA 3SHFA 5ILVA 4EM2A 2YSRA 4L18B 1WQ2A 1YYVA 1B4AA 3J81Z 1H0MA 3SZTA 1I6XA 1ZYRF 5KVRA 3HHGA 1T38A 2DBBA 3L00A 4FHTA 1BBYA 1XMKA 1FPQA 4A12A 3GXOA 2ISZA 1MZBA 4YIFA 2O0YA 1XB4A 2M30A 4U0VA 3IHUA 1Y0UA 2EA4A 4KDPA 4B8XA 1YO5C 3K2ZA 5KK1A 2RKHA 2HOEA 1BI1A 5E1XA 2HTJA 1OYWA 2CW0F 3TKYA 1PP8F 4KN7X 5HDGA 1W5SA 2HQRA 2IA0A 5LGUA 3KP4A 1F5TA 4ENJA 4DQ2A 2ZFWA 4R79A 3I4PA 3SFZA 4KICA 1S7OA 4GGGA 4U0WA 3QPTA 2ZBKA 5D4RA 2OAZA 2DK8A 5E8GA 3BZ6A 4CXFA 3C18A 2A07F 1W7PB 3F8CA 5HDNA 1SMTA 1KQ0A 3JSOA 3VFZA 3PQKA 4U7BA 4ZZLA 1UFMA 4L9TA 3TGNA 3DXJF 3MZYA 3CTAA 2B0LA 4CO8A 4RS8A 4PGHA 4UVBA 5ED4A 3TOBA 3K1PA 4BHCA 2HKXA 4M73A 5F64A 4YFXF 5F6FA 4ZZDA 4OMZA 1HBXG 2WC2A 1ZRCA 3J80K 3OOPA 4AD9A 4WXCA 2XAFA 3E6MA 2UXXA 3DFGA 4HZFA 2M5WA 5DD4A 4WF2A 3SXYA 1R7JA 2E1CA 2XVCA 1ZHFA 4HX8A 1TNTA 2HDCA 3IKTA 2BEOA 2Q2EA 4P55A 2PLYA 2LF8A 2QWWA 1IRFA 1R22A 5E1ZB 2EFPA 4O5VA 3V8LA 5HDKA 1QNTA 2Z9OA 4BH9A 4AWXB 1IN6A 2YU3A 4ESFA 3KP2A 1YTYA 3RJPA 3P9KA 3TDUC 4A6EA 2ZNYA 4A5NA 1XDSA 2KIFA 2BYVE 5JFRA 4RGXA 4LMYA 1ZRDA 3WTWC 1QBJA 4FX0A 4G9YA 2VBXA 3W6KB 1EH8A 1MJ9A 1BI3A 4A0YA 2G7HA 5AIQA 3M8EA 1V3FA 4RAZA 4P9FA 2XAGA 4MQVA 2EFWA 1H9TA 2JPBA 2DK5A 3MWMA 4OIRF 1SFXA 2EB7A 2FF4A 3S2WA 1JXSA 1TW2A 5L3FA 1FBQA 2D45A 3WGIA 3ZN0A 4PZJA 2VE8A 4M9ZA 4Q48A 2XKPA 2QLZA 4ENKA 3VB2A 3VODA 3LAJA 1HSTA 2PQ8A 4MTDA 2PI0A 3ZMSA 2PMUA 5JVTA 2K4JA 4ON0A 3FMRA 2XV4S 1B59A 2VE9A 4CYDA 3JAMK 1FSEA 5H6RA 1XMAA 2STWA 1ON1A 4MEXF 1TQIA 4I0BA 4P96A 4LG0A 1FBSA 2RGVA 3WTVC 3MZHA 3CUQA 4EGZA 1KU2A 4P5OA 5JI6A 5LGNA 4EGYA 4UXNA 5LRRA 2DQLA 4HA8A 4KN4X 1AWCA 3M8FA 5ILUA 2M45A 3OV8A 2VOPA 2V79A 2VBYA 2QBYA 5EEGA 3LSTA 1GHCA 2NS0A 1EH7A 1LVAA 4I98B 2VODA 2ISYA 3TO9A 2H6BA 4RB2C 5A2QZ 1P6RA 2KRFA 1MDMA 2LNBA 5D5VB 2GXGA 1R1VA 1IXCA 1YFHA 2JZYA 3ZMTA 1XCVA 5FLXZ 4LD5A 2DU9A 4BNCA 2C6YA 2EJRA 3SQNA 3LA2A 4HYEA 3WE3A 4O3MA 3TO6A 2OBPA 1FSHA 2FU4A 3T8TA 2Z33A 5E20A 2DFIA 1RIOH 2IP2A 1DPRA 2ELHA 5IT9Z 1STZA 1ZN2A 4UNOA 3EUHA 2HYFA 2X0LA 2IT0A 2DQRA 2NRAC 3KFWX 4IHTA 1JHFA 1OKRA 4OIOF 1IN8A 2P4WA 2YX7A 1GVJA 3H3ZA 3WTUC 1RUNA 3ZMVA 3O3KA 1O7LA 5D8LB 3GFMA 3V7CA 4NB5A 2HYGD 3HSRA 3HSFA 2HQNA 2GA2A 4L9JA 2NNNA 3L9FA 3GF2A 1SFEA 3QU6A 1I1GA 2HTSA 4PCQA 2VC1A 1XCBA 4U7DA 1E2XA 1O3RA 3DV8A 1TQPA 5CVIA 3E6DA 1DDNA 4PGGA 4HF2A 4Q5SF 1KU3A 1HKQA 5F1RA 1FZPB 1WI9A 3FXUA 5DCFA 2GXBA 4HQMA 3FWEA 1KU9A 3KZYA 2DLLA 1D8KA 1G6NA 3V7RA 4ESBA 4A0XA 4WK8F 2D2WA 4LFUA 1HW2A 3RTRA 2QZ8A 4NQWA 1OYYA 4BYYA 1BN5A 3U2RA 1ZAOA 1K79A 2M8EA 3BPVA 1IXRC 3TDZC 5DUIA 2MLKA 2E7XA 3KEOA 2P7VB 2A61A 2DT5A 3RIRA 3K69A 2QM3A 4HOBA 2FE3A 3F3XA 2P6SA 5AIPA 1S7AA 1ZRFA 3FMSA 3TO7A 3NEUA 4CZZA 3JW4A 2EV0A 3J7AO 3ABUA 2XAQA 4BHPA 1B1BA 2OU2A 3GO5A 1G3YA 1K7AA 1HSJA 3ZN1A 4I2OA 1Z05A 3HTSB 2BV6A 4KT5C 4WWCA 4KMFA 2FEZA 3G3ZA 2MH2A 1BC7C 4Y17A 1KU7A 4ASNA 2V1UA 3LA7A 2M87A 1KYZA 3O2PE 3I53A 3FXQA 3M9AA 2Z3YA 5DDGA 3ZMUA 4FX4A 5HLHA 3ISPA 2NYXA 1HXDA 3BJAA 3QRFF 2W84A 3O6BB 3FX3A 5LHIA 4EJTA 2JPCA 4DNCA 4UV8A 4OMYA 1G3SA 2PBIA 2H6CA 5FFZA 2ETHA 3TQNA 5E18F 4LG0B 3GYHX 2VOOA 3CUQB 1IN7A 3HRUA 4I02A 5BS6A 1P92A 2O6GE 1I5ZA 4HAMA 4CDGA 4M72A 4JK1X 2P7CB 1BI0A 1O3QA 1BIBA 1ZLKA 4LB5A 2P5VA 1USSA 1K78B 1FP1D 4EJUA 1MD0A 3DEUA 3FM3A 2QBYB 2W24A 3F8BA 4Q47A 5DV5A 1J5YA 4KNYA 4I09A 3G73A 4MEYF 1T39A 1ON2A 3GUDA 4S05A 2JSCA 5D6EA 4LLLA 1QPMA 1LDKB 2FBIA 1WRJA 2UWMA 2RVCA 4LLNA 1MDMB 2A68F 2X4HA 2ESHA 4IF4A 4HBLA 5JHUA 1P4WA 5ILSA 1XGMA 1R00A 2QQ9A 2HGCA 2IA2A 3F8MA 2DW4A 2ESNA 5D5UB 1FYKA 3ELKA 4XLNF 1XDUA 3QP6A 2Y0MA 3EQLF 5L3DA 3LAPA 4HDUA 3I64A 3L09A 2PMHA 3ABTA 1SD4A 1O3SA 3WTSC 1U6GA 1Z7UA 4GCVA 4N0BA 5FB2A 4HV5A 1FWZA 2Q0OA 1R1TA 4L9VA 4ZYEA 2CGPA 1WKMA 5BQTA 3LQQA 3HRMA 2EWNA 4HW0A 4H0EA 4CICA 2O8XA 4LB6B 1F9NA 5HS9A 1RZ4A 4XLPF 1GXQA 3T8RA 4HF0A 3U1DA 2YR2A 4G7ZF 3SZPA 4XRFA 1Z9CA 3MEXA 2K7LA 1G3WA 4BQAA 2R7DA 1YS7A 3K1NA 3D0SA 2HKOA 1LEAA 3IWZA 1J9IA 5HLIA 3DQVC 3REOA 1Z6TA 4ZYDA 1J0RA 2RQPA 5K5RA 1ZGJA 3F23A 2V1XA 3WU1B 4RGRA 1Z1DA 3PFIA 3BJ6A 5HOOA 3Q5FA 5H20A 3F72A 2KIUA 3F21A 3ROUA 2HZTA 4A0ZA 3IRQA 4LLGF 2VT3A 3ZMZA 4EM1A 1IF1A 3KLNA 2RC4A 3JTGA 1O7FA 2EV6A 5BPIA 2V6CA 5FLXK 1T0FA 4L5IA 1KYWA 4KA4A 3KLOA 5K5QA 1C0WA 3CUQC 5K1YA 3J80Z 3DP7A 5LHHA 2ACJA 1L3LA 3E5QA 5CVUA 1TW3A 2OQRA 2BE5F 1IZ1A 2MLGA 3V7SA 2H27A 5IT9K 1KA8A 3HUGA 4XBFA 1VTNC 4BHBA 2RV8A 2GWRA 1R1UA 3MQ0A 1NHAA 1ZG3A 3KP5A 4M6XA 1BC8C 4F7ZA 1KGSA 4O6JA 2MC3A 3QU3A 1LJ9A 3ZMDA 2QENA 4LK0F 4QWQA 2CYYA 3T0YA 4OIQF 3WU0A 2CWEA 1WSUA 3CO7C 2FA5A 1K78A 2IVMA 1T2KA 1LNWA 1E17A 3C1DA 3PQJA 1H9GA 2OQGA 1W4MA 2CG4A 3R60A 1ZREA 1R58A 1TNSA 2FBKA 1FLIA 3Q9VA 1USTA 4I01A 3W6JB 2IPQX 4UVAA 1QGPA 4GXOA 3I54A 2F5FA 1QZYA 5K5OA 2STTA 2PG4A 1UB9A 1KQ9A 3EYYA 4G6QA 2QQBA 5J6XA 2EFOA 1HW1A 4Y13A 4IXAA 4U88A 3R61A 2VBWA 3LFKA 3RYPA 1JE8A 3WE2A 3WTZA 4U0YA 5DCMA 5E1WA 3M1EA 2O3FA 3GFJA 2HEOA 2L3DA 2ZNZA 3VEPA 4WXDA 2AXLA 2DPUA 3E6BA 1SAXA 4YIIA 1G4DA 1UCRA 2XAHA 2XAJA 3P9CA 2JRTA 5FGMA 2R3SA 2G7UA 3DKWA 1FYMA 1ODDA 3B02A 5LHGA 2FRHA 2HS5A 1D3YA 1HW5A 1ZG1A 2A6EF 4P9UA 2D1HA 5JR3A 2FXAA 4I7HA 5L3EA 2A6HF 3LWFA 4E70A 4IRGA 4HLYA 4ZH4F 3IL2A
chains in the Genus database with same CATH superfamily
4G6DA 4CSWA 1FYLA 1H8AC 2W48A 3E6CC 1UG0A 1PUEE 2CFXA 4F91B 2R7WA 1ZKGA 2HVRA 2QVOA 1RNLA 3BDDA 2LG4A 3M1CA 2AQFA 2VXDA 1Z7LA 2X6YA 2EFNA 3GFLA 2H1LA 4DOZA 1JJ8C 4OU0A 1OISA 2H8RA 2VONA 3JRIA 2MABA 2FBHA 4IZZA 2JT1A 1SD5A 5FLMJ 1VQ8I 2R5YB 5BPDA 1ZG5A 1BR2A 1IUYA 1FNNA 2BGCA 4BBSJ 1TBXA 3HOSA 3FHZA 4MO7A 2YX4A 3R6SA 3CCVI 3OYIA 5CYVA 2VXZA 2IRFG 2L01A 4XRMA 3RPQA 2M8GX 3DTIA 3ZQHA 4FTHA 1LE8B 2YUSA 5FFXA 4B48A 3FF5A 1XPXA 5CVVA 1XGSA 3BR6A 3EETA 1D0XA 3AG2H 3J81K 3S1MJ 2HOAA 1YW8A 1MMAA 1MH4A 3G71I 5TRDA 2ADUA 1I1SA 4G7HF 2X1DA 4S04A 4XORA 4ESJA 2LH9A 2MA3A 1QZZA 1N78A 3AL0B 3NARA 1Q1VA 1DQUA 3H35A 4XMYA 4B4CA 4UUSB 5M5XJ 2KJCA 5D6FA 3WTTC 5FD6A 3F6OA 1U5TA 4IRIA 1SFUA 2KMUA 3K9TA 4UHTA 4G94A 3I5UA 4I99C 1IUFA 3RKYA 2FNPA 1XSDA 5HLTA 2EBIA 1H88C 5CVRA 4TV7A 3F22A 1ZGWA 2P0WA 2GA1A 3FXKA 2H8WA 3GLLA 3NQOA 3QPLA 4HSRA 4PJJA 3U1KA 4F92B 5B1AH 1HQCA 4G7OF 3L2WA 4BS9A 1FMVA 3OR1C 3CQZJ 5J8CA 2DAOA 3I56I 4XLFA 3PIPF 2ZXJA 1TTYA 2FNAA 1OCZH 1T33A 4RGSA 2R7RA 2A3SA 1O4XA 1JTYA 4GYIA 1R9TJ 1WJAA 1R23A 4IPAA 2WA0A 1X3UA 2M7BA 4Y7NJ 2PN6A 4RBOA 3OYBA 1ENHA 4Y15A 4MHGA 1LFPA 2L02A 3S16J 3NRVA 5H2FC 2VJ4A 3FZVA 5C3EJ 3DPTA 1PUFB 2K9LA 3X2QH 4HF1A 2NNYA 5E17F 3LSKA 1VF9A 1Z21A 2VC0A 3FK6A 1PDNC 4KIFA 3T5XA 4KIGA 3ZXSA 4C3IJ 1DUXC 3BY6A 4HEA2 5TISC 4NHJA 3WGGA 3AAFA 4G12A 1BOAA 4II3A 3E1SA 2BBYA 2Z2SB 2L0KA 4EJVA 4A93J 3BTIA 2E7WA 2RDPA 3HSEA 1LDJA 2P5LC 3D5RC 2JJ7A 3KP7A 1LQ1A 1JKPC 3E5XA 4IO9F 1IC8A 1MNDA 2RAEA 4DJAA 1IXSB 1IN5A 4GO1A 4ZTFA 3M7GA 1OMIA 2DPDA 1B6AA 4L0ZB 3UR3C 2JTVA 1HDPA 1LDDA 2OPTA 4RAFA 3VYTB 3V4GA 4KMUX 1ERDA 2MD5A 2RQQA 2WTEA 1Q1HA 3L7WA 2LK2A 4FE7A 4AVPA 1YJNI 3WG9A 4Y4RA 3JRBA 3GW2A 2P8TA 2ECBA 1HKTA 2WBMA 4HLXA 4LJZF 5FRMA 2VJJA 1LUJB 1QVTA 1P4XA 2Y31A 3AFHA 3I58A 1BI2A 2HNHA 2QYOA 3TL4X 4Y33A 1BIAA 3OSGA 1VQKI 1FC3A 3CMAI 3C3WA 4LIUA 4M3EA 4LITA 4XOPA 1R6RA 3HGGA 4X0GA 2EZHA 2DOAA 4UB8C 3CO6C 4IOAF 1LEBA 5ERIA 5KNLA 4RA2A 1X58A 2R5ZB 4Q4ZF 4IRHA 1PVEA 3VDXA 2XGEA 4RMNA 1VI0A 1J7KA 1YW7A 3GTQJ 3PM1A 3KEQA 1P7JA 3R0AA 3DPLC 2VN2A 4YEJA 1FIPA 5JLXA 2Z99A 2CQNA 3E5UA 2XB5A 2M1BA 3WTYC 1I27A 2NS8A 5IYBJ 2KIQA 3M3YJ 4BDZA 3CDIA 2AXTC 2F6CA 5LEJA 3L2CA 2ZO4A 3ZP5A 2E5NA 4XQFA 4HLYA 3W2VA 2L54A 1T6SA 4H4KC 5KHDA 1SVMA 1ZARA 1EH6A 4B44A 2VT2A 5GADJ 1YQAA 4IKFA 1HA8A 2JRMA 3I59B 1BJAA 1MBEA 2K86A 1RUOA 2F5CA 2Z1DA 1SD6A 2MD0A 4NC7A 3BZKA 1S72I 3S14J 4IJAA 2ZJ2A 2CFOA 2X1EA 4DBQA 4OIPF 2ID3A 2PJPA 2KL4A 2K9SA 2Y30A 1OR7A 3DPUA 4BDYA 1IDYA 5D4SA 3IKVA 2VBZA 1V4RA 5L3BA 4GDFA 4EM0B 2XKOA 2QUFA 3GMEA 1LVKA 3CLOA 4A2UA 2FQ3A 4EMSA 2VKDA 4UY8I 2RNJA 1VQ9I 3EUKL 3CLQA 5IT3A 2IS2A 1APLC 3K4CA 5DD8A 2GM4A 4DYQA 4QLCU 2AO9A 2DA2A 3RYRA 1K4SA 4F93B 2DTRA 3RKWA 2A5YB 2XROA 5DCMB 2XAUA 4B43A 2HOSA 3K4BA 4A3MJ 3IC7A 4R8HA 1U3EM 3LSIA 2OZUA 3R4KA 1UHMA 5ICGA 3RDIA 2MH9A 4HQEA 2KLOA 2F5EA 2PJRB 4PDKA 5BNGA 3M07A 3BR0A 2NVTJ 2GZWA 3VSKA 2R7UA 3RPUA 1D1BA 1VFCA 4JQFA 2KQRA 2LR8A 4HX7A 3KZZA 1JKRC 1JUMA 2W7NA 2JN6A 1W5TA 2XRNA 4LK1F 2PFBA 5LFAA 1U9OA 2A69F 2ECCA 3G6EI 1X1AA 2E2IJ 1SVLA 2W4SA 3VYUB 2OZ6A 4MTEA 2VKHA 3ZGKA 3HRSA 1EJ9A 4M9XA 1YJWI 2A05A 2BY2A 5EG0B 5FLVA 1R36A 6PAXA 3T1BA 2D1VA 3I71A 3BROA 1XGNA 2FX0A 1TT0A 2F2EA 3CUOA 3OYHA 1TWFJ 3V8KA 1LE8A 1QQIA 1OFCX 3HG9A 2EINH 3QWLA 3ZQIA 2MBFA 2PMZN 1JHHA 3F8NA 3V8JA 1JT0A 1K6OA 4OINF 3DLLF 2OA4A 4IHSA 3A0BC 2ZMEA 4JBAA 2O7OA 1J75A 5D8KB 5J1YA 4M6YA 1U2WA 1NK2P 9ANTA 4HNUA 2Y0SN 2HU9A 4KUMA 3JR9A 2JA5J 4XSZF 3VOEA 5LRSA 1IRGA 3FXRA 1YIOA 2V9VA 2TCTA 2DI3A 3FKJA 1FX7A 1ULYA 1WWXA 2COMA 3CESA 4IVNA 4PFOA 2CV2A 3BQZA 5TJJA 3GTPJ 1KQ8A 5FD5A 4DYRA 4ABZA 4UUSA 1AKHA 1FT9A 3ABKH 3GEZA 5D5WB 4HV6A 2QF7A 3HRTA 3JTHA 1B72A 4CGZA 2G9WA 3HTUA 4N4OB 2W57A 2M34A 3BOQA 1FY7A 2W1OA 3ZQQA 2JA6J 5CJ9A 3BTJA 2CMPA 2R7OA 4UV9A 4XN0A 4A6DA 1U78A 1N77A 4L9NA 3I4MJ 3S1QJ 1M1EB 3HEFA 2EPFA 2XF6A 2UXNA 3H3UA 2JSPA 1SMYF 1IGNA 5HLGA 4EQQA 5GPAA 1T0FC 5EGOA 3Q9SA 2IA1A 2WB1N 2XASA 4XN3A 4RB0A 2ZXWH 1JT6A 4D7MA 1MGTA 4IQJA 1OCPA 2FD5A 2RREA 1XN7A 5AONA 3GTJJ 1XSVA 5A2QK 2BY0A 2E35A 2BZTA 3C7JA 4MNUA 3QPHA 3GX4X 3UKGA 3BWGA 3DF8A 2JVGA 2E1NA 5DYMA 2OTJI 1XD7A 3H9JA 1PUFA 5CVJA 4DGWB 2EIMH 1OYIA 4WCGA 4A3CJ 4ZYGA 4PJMA 1U5TB 2R4GA 2F48A 2LC2A 3HOVJ 2L4MA 4XLCA 4BY1J 2KHMA 1MJBA 2QQAA 4ZC3A 4BQQA 2VL8A 3GLXA 4WXHA 5D5XB 1S8NA 4AIKA 4A5MA 2Y48A 3CCSI 2QQ8A 4QPOA 1MNEA 3CP8A 4AU7A 3GVAA 3K6GA 5DM7F 1CF7B 1HLVA 5HVQC 2Y75A 3HJEA 4C3JJ 1S3JA 3ZQCA 1NG7A 3IH4A 2ZKZA 1MBJA 3H36A 1VZ0A 1G3TA 3QOPA 4EVIA 1WHUA 4L5JA 5HS8A 2K4BA 5J3LA 4W1UA 3C2GA 3HOUJ 3PO2J 3HOTA 4A3IJ 4B1RA 4XSXF 3H5RA 3ECHA 2HR3A 1VQNI 3QYBA 3C2BA 2Y9ZA 3DEEA 2LF7A 3HBLA 2LOOA 4BJ6C 3KP6A 2WWYA 5EEAA 3FMQA 1DPUA 2PMZA 2WAQN 5F1JA 3S1RJ 2O03A 2R7FA 3IH3A 2VJIA 1E3OC 5L3GA 5FKLA 1MBKA 4HX4A 5C44J 1YRNA 3BP8A 2KRHA 1QVUA 2FOKA 2QSFX 4PJLA 4DIQA 4E6KG 1F36A 2J5PA 2LKPA 2PX9A 5IYDJ 2XGXA 4HRIA 3F8FA 3CDHA 3CF5F 2Z5UA 4L5EA 4I76A 1R5ID 2IGMA 3HXLA 3PL8A 3JRHA 3IRRA 4CHUA 3E0JB 2CJJA 2L9VA 1U8BA 4M9SA 1FP2A 4B09A 3K4JA 3JREA 3A0HC 3KP3A 3ERED 1WJCA 2FUG2 1Z6RA 5LLQA 1V55H 1N25A 4PSXA 3K0LA 4A3FJ 2CSOA 2JA2A 2CH0A 3MAJA 3GZ6A 3BZCA 4XONA 2DJIA 4B3AA 3KYDB 2CUZA 2FMYA 2XPWA 2BW3A 3TW6A 4CCMA 2KJBA 5EZHA 3RPUD 3QP5A 4A3DJ 2O61A 3HM5A 3ESWB 2PEXA 2E71A 5CQEA 2M4GA 4KIBA 3RI4A 2W85A 3TW7A 3I59A 3LFUA 3VWBA 3I4NJ 3HYIA 1XSXA 1E3PA 3MKZA 3GFIA 2HZDA 4B3XA 5LEKA 3IAM2 3KX2A 4YIRX 2XHKA 3ECOA 2OJED 3GTOJ 3HOZJ 3JRDA 2JVHA 1MMDA 4D1QA 3F6VA 1U8RA 1P2FA 2LDUA 5FJ8J 5FKOA 1R5HA 4AIHA 1OPCA 2IW5A 5F04A 4M71A 1RR7A 4BXUA 3FKIJ 4N9IA 5CPRB 4CCOA 1IN4A 4M74A 4RB3C 1XGOA 1BM9A 1ZH5A 1SAUA 1LPQA 1X1PA 1W7PA 1F1ZA 2ZJRF 2OCCH 3EPZA 1QZEA 4UUTA 2XRLA 3AG3H 1CGPA 3JCUC 1DP7P 2CQKA 3N4MA 4RDUA 3K1MA 2HVQA 4KYWA 1XG1A 4EV0A 2WV0A 1S29A 4E7LA 1HOMA 1D5VA 4YFNF 4IHXA 3OMYA 2BY1A 1ZELA 3SEQA 3HPGA 1A04A 1BL0A 4EJOA 3FIWA 2XIGA 2V9PA 1N75A 2FSWA 1XTAA 1Y0NA 1JJ6C 3ABMH 4CZCA 3WGHA 1S7EA 2GOXB 2FQ4A 2IAIA 1ZGAA 3P7NA 3MFKA 2K02A 3Q0VA 3U9GA 4WX9A 2CQ7A 3JAMZ 3LSPA 3BPXA 3WODF 1X1CA 2HWVA 4I0AA 5EG0A 1JGSA 1G8XA 2TDXA 1OLTA 1FJLA 4YRVA 1MMGA 1D0ZA 2H94A 2WAFA 3I55I 3PUFA 3RKXA 1O57A 2YS9A 1WJBA 2NXNB 2LY1A 2BHYA 2MSYA 2P5KA 3GBGA 3GWZA 5L3CA 3CF2A 3GTKJ 1ZLJA 1XS9A 3OYJA 2BY3A 2RN7A 1VQ4I 1EV7A 2XPVA 4E7ZA 2EFQA 2Q1ZB 3QAHA 2UZKA 4RB1A 2R0QC 4BE2A 1TQMA 4XKWA 3W2WA 3RCOA 2KRCA 5ICFA 3OWTA 4RGUA 2IBDA 4MQ9F 3EYIA 4GFBA 5E8IA 2K9MA 5BOXA 2VASA 4A3KJ 4A3GJ 2IGOA 3CZ6A 4XOTA 2K27A 1TLHB 3FHNA 5LGTA 3LQRA 4AIJA 1GXPA 3KCCA 3HHHA 3ML6A 2YPRA 1ZR2A 3DKXA 3HIFA 4MGRA 4ETSA 3D5LA 2V9KA 2KDOA 5ICCA 1U5TC 1QO0D 2L9SA 2HFHA 4J01A 4UUVA 4F52A 2DTZA 1YOVB 3E97A 1Z91A 3LA3A 2IGNA 1SD7A 2ZCWA 3QYFA 4CCJA 3G1MA 2KKOA 1UHWA 2IJLA 2EA2A 2DMTA 3WHCA 4K2EA 1HKSA 1T98A 2KISA 1D1CA 2LKXA 2IS4A 2ELJA 3TOAA 2ZMEB 3BG6A 1TC3C 5GAGJ 2LSOA 4CCLA 3H0DA 1HF0A 4BJ5C 5BMZA 3IH2A 5FO5A 1OCRH 3ZPLA 4HDVA 3OYFA 1YG2A 2KIMA 1IW7F 2ME6A 3EDPA 3ULQB 2KDZA 4ENNA 4G8XA 1D1AA 1IAWA 3COAC 2LD5A 1MJAA 1AKHB 3B73A 2L7ZA 2DOEA 5J8FA 1FBUA 4IHYA 3KE2A 2L4AA 4L0YB 4W97A 4BL0B 1S6LA 2LP0A 1B72B 4D5FA 2R7SA 4E7SA 5C4JJ 4KFCA 3QPSA 2K3FA 4UVCA 5HNHA 2JA7J 2HXIA 3SFIA 3BJOA 3H9GA 3H1CA 3CDLA 4V2GA 5HS7A 3OYMA 1UG2A 1FOKA 1PP7U 2NVXJ 1P4AA 3HDDA 4YELA 2W25A 1YHQI 1WH7A 5CLSA 2CO5A 4EJWA 5EEHA 1MKMA 4Z2YA 1CF7A 2GAUA 4FE4A 1JI8A 4II2A 4R1HA 5EGOB 2R7VA 2MYSA 1ZR4A 2P6TA 3H92A 1T95A 2V1DA 3BTCA 1TWCJ 4ZYHA 5B5EC 2EK5A 1BW6A 3ZQ7A 2DYSH 1F4KA 3DTKA 2FMLA 1VQ6I 2GIVA 4BJTA 4YFKF 1YS6A 3DU6A 2L7KA 2N8GA 4BY7J 3S93A 1ONVA 1WGXA 2XUBA 1R71A 1IRZA 5ICEA 2DA4A 2ELKA 1OCOH 4N9HA 3N97A 3MCZA 3B6AA 3WTXC 5EZGA 4RAYA 2LRDA 4LGWA 2VKVA 3OIOA 3I0TA 5E3LA 3CJNA 4YG2F 3PSFA 1MW7A 5H6QA 1L0OC 5IPAA 2HI3A 1T8IA 2GQQA 3K4KA 2AS5F 3GZ5A 1WI3A 1J2XA 3OIQA 3R0JA 2E19A 4GYGA 2J5OA 1ZK8A 3K7AJ 1D8JA 2OD5A 2F5DA 1AOYA 1YLFA 5E3MA 1X3ZB 3LSJA 2Q8KA 1REPC 3LMMA 1LB2A 1FOYA 1O3TA 3BLYA 1RI7A 2LBFA 2H09A 1R5GA 1GV2A 2COBA 3OYNA 3E3VA 4FT8A 2EV5A 5LBQA 3MD2A 1NTCA 2MW8A 4BKXA 2GXAA 4E7KA 1B9MA 1W7PD 3KETA 5IP9J 4OOIA 2M3AA 5DUKA 3P9IA 3JSPA 5DEQA 3KYCB 2DO7A 4ENMA 1B9NA 5E3NA 2NAZA 1Y8QB 4D0PA 5IOYA 5J1RA 1YW9A 3IWFA 1Y6IA 2LYCA 1UELB 3SJMA 3SHFA 1SFKA 4Z6YA 2QCOA 3EUAA 5ILVA 1EKEA 4EM2A 1NH3A 2YSRA 4L18B 1NG6A 1YRNB 1GLNA 1WQ2A 1YYVA 1K6YA 1B4AA 3J81Z 1H0MA 2EQRA 3CCYA 3SZTA 1FOWA 1I6XA 3WG7H 1ZYRF 5KVRA 3HHGA 4D7NA 4AYBN 3WU2C 2VQCA 2DBBA 3L00A 1T38A 2H1KA 4FHTA 3W6VA 1FOXA 4S0HB 4BQOA 1BBYA 1ORKA 1XMKA 1FPQA 3J7YJ 1OR7C 1IDZA 3HZJA 1J59A 1EA3A 4A12A 2NOGA 3GXOA 5F27A 3OIPA 1RKTA 3FK7A 2ISZA 3GTMJ 3TP0A 2OV7A 1MZBA 4YIFA 2O0YA 2BW3B 2XSJC 1XB4A 2DDBA 2VQHA 2M30A 4U0VA 3IHUA 1Y0UA 4C3HJ 2EA4A 3LSMA 4KDPA 4B8XA 4HNTA 1YO5C 3K2ZA 2D5VA 5KK1A 3CCRI 2RKHA 2HOEA 1BI1A 4PK4A 5E1XA 2HTJA 4U87A 3S32A 1OYWA 2CW0F 2W82A 5M3MJ 3TKYA 3DTEA 1FMWA 5HODA 4ZDLA 1PP8F 4KN7X 2DFFA 5B3SH 5HDGA 1W5SA 2HQRA 1MBHA 2IA0A 3KP4A 5LGUA 1F5TA 4ENJA 3A2KA 5GAHJ 4DQ2A 2ZFWA 4R79A 4RM2A 3I4PA 3SFZA 2ZC2A 4KICA 1UAAA 2VUMJ 1S7OA 4ANJA 4GGGA 4U0WA 3QPTA 1J09A 4IHWA 4KJZA 1A31A 1XX5A 2JQ7A 2ZBKA 4FETA 4ZYAA 5D4RA 2OAZA 3LNQA 2DK8A 5JVGF 5E8GA 3OR2C 3BZ6A 1MBGA 4BE0A 1GDTA 4CXFA 3ZQLA 3C18A 2A07F 2VQGA 1W7PB 3F8CA 5HDNA 1SMTA 1KQ0A 2M7AA 3JSOA 3PNVA 4M6VA 3VFZA 1GUUA 3PQKA 4U7BA 2V6EA 4ZZLA 1UFMA 3SDBA 4L9TA 3FISA 3TGNA 3DXJF 4AC0A 2XC7A 1VQ7I 3MZYA 3HGYA 3CTAA 2B0LA 3B6CA 3PSIA 4CO8A 1Y1WJ 5E3OA 3OOUA 5B66C 2R7ZJ 2ZMEC 4RS8A 4PGHA 4UVBA 1UZCA 3TOBA 5ED4A 2M0MA 3J7ZI 3A02A 3K1PA 4BHCA 1WZ2A 3AL0C 3FXJA 3DU5A 2V4JC 2HVSA 2HKXA 1YJ9I 2E60A 4M73A 5F64A 4YFXF 3PIOF 5F6FA 4ZZDA 4OMZA 1HBXG 3L2QA 2WC2A 1ZRCA 3Q0UA 1ETWA 1V5EA 4HSTA 2X6WA 3J80K 3KIOA 1ZQ3P 2EIKH 1X4OA 3OOPA 4AD9A 3BR5A 2K5CA 4WXCA 4C9YA 2XAFA 2R7XA 3E6MA 2HPIA 2UXXA 2CUFA 2Y69H 1K83J 3DFGA 1YIJI 2MC4A 4QSHA 4HZFA 3U21A 3HB9A 1HC8A 2M5WA 4AYBA 1JKOC 5M3FJ 5DD4A 4WF2A 3SXYA 1R7JA 3OYDA 2E1CA 2M2EA 2XVCA 1ZHFA 4HX8A 1QA6A 1TNTA 2HDCA 3BG5A 2DFEA 2BEOA 2K40A 2V7FA 3IKTA 4BXXJ 2Q2EA 4P55A 3WHBA 2PLYA 2HXOA 2LF8A 2XPUA 3CMYA 2QWWA 1IRFA 1R22A 3QODA 5E1ZB 2EFPA 5F0HA 4O5VA 1IG7A 3V8LA 3BC8A 5HDKA 2YU9J 1QNTA 4XIDA 2Z9OA 1OQYA 2JMWA 1WPKA 4BH9A 2DODA 1ETVA 5FKKA 4AWXB 2K85A 1IN6A 2OUMA 2YU3A 4ESFA 5JLWA 3KP2A 2OF7A 2JUGA 3CC2I 1YTYA 1YITI 3RJPA 3PJRA 4CCNA 3V42A 3CCEI 1BA5A 3BG3A 3FXOA 3P9KA 2K9QA 3TDUC 4NNJA 4BE1A 4A6EA 1P9QC 1WJFA 2ZNYA 2ZXIA 4A5NA 4MIMA 5GAEJ 1XDSA 1QHGA 2KIFA 3F0CA 2BYVE 5JFRA 4RGXA 2IS1A 3CCQI 3JRCA 4LMYA 1ZRDA 2K3PA 4NC8A 3WTWC 1QBJA 4FX0A 4G9YA 2EZLA 1VQOI 2VB6A 2VBXA 3W6KB 1EH8A 1F43A 4G6TB 1MJ9A 1BI3A 4A0YA 3HOYJ 2G7HA 4RAGA 5AIQA 3M8EA 2L7MP 3HC7A 1VQLI 1V3FA 2E1OA 4RAZA 4P9FA 2XAGA 1LFBA 4RM3A 2VQLA 4MQVA 2EFWA 1DU6A 1R4NB 2EIJH 1H9TA 2JPBA 2DK5A 3S1NJ 3MWMA 3VYRB 4OIRF 4BXFA 1SFXA 3H3VK 1QHHD 2EB7A 2FF4A 3S2WA 3S2DJ 1JXSA 1TW2A 1A6QA 5L3FA 4XICA 4X6AJ 1FBQA 1QU3A 1TT5B 2XDVA 2ZJQF 3J7AY 5GTIC 2CV1A 5KCMA 4EATA 2DA7A 2X6OA 2D45A 3WGIA 2EZKA 3ZN0A 1ACIA 1D5YA 3VYSB 1VQMI 3S8PA 4PZJA 2VE8A 1TZLA 4E7JA 4M9ZA 4Q48A 2XKPA 2QLZA 4BUPA 4DZJA 5J47A 4ENKA 3VB2A 4BEHA 2LLKA 3VODA 3LAJA 2L9NA 1HSTA 2PQ8A 2DDAA 4HPQA 4MTDA 2PI0A 1SVOA 2BXZA 2BVMA 3ZMSA 2PMUA 5JVTA 2K4JA 4ON0A 3FMRA 2R7QA 2XV4S 1B59A 2VE9A 2Y0SA 4CYDA 3JAMK 1FSEA 2CRGA 2XSDC 5H6RA 1XMAA 2STWA 1ON1A 4PFPA 4MEXF 4LG3A 2LBFB 3BCAA 1RR8C 1TQIA 4I0BA 4P96A 2CU7A 1FEXA 4F55A 4LG0A 1FBSA 4RLFA 2RGVA 3WTVC 3MZHA 3CUQA 4EGZA 1KU2A 2E2JJ 3OL3A 2G0EA 4P5OA 3QOEA 5JI6A 5LGNA 3KYLA 4EGYA 4UXNA 5LRRA 3IAS2 1RKWA 2DQLA 5B1BH 1TWHJ 2E36A 4HA8A 3K70D 4KN4X 2VIXA 2DJNA 1AWCA 1ETQA 3M8FA 4IX7A 5EYRA 2V26A 1X4PA 4M3DA 5DS9A 5EDNA 5ILUA 1X1DA 4A3BJ 2M45A 3OV8A 2A6TA 2VOPA 2V79A 2VBYA 3MZ8A 2DMNA 3LSTA 4XL9A 5EEGA 5HNFA 3IV5A 2QBYA 1GHCA 2NS0A 2WB1A 1EH7A 4EEFG 4UB6C 1LVAA 4I98B 4M3FA 3AG1H 2ISYA 2VODA 4ZTJA 3TO9A 2H6BA 3ZQGA 4RB2C 1X3WB 5A2QZ 1P6RA 2DA6A 2KRFA 2RNGA 3ZQFA 3RKQA 3DBHB 1MDMA 2LNBA 5D5VB 3H5AA 1Y56A 1MMSA 4IOCF 5J1UA 2VPLA 5FRNA 2GXGA 4IHVA 4J19A 1R1VA 2GIZA 1IXCA 3ONQA 1YFHA 1B8IA 2BVLA 1UHSA 4XKBA 2GLOA 2JZYA 3K4LA 3ZMTA 2QSGX 1XCVA 5FLXZ 3CCLI 2DCEA 3I9V2 2OTLI 4LD5A 1SFOJ 2DU9A 3MVPA 2VI6A 1MIJA 2QKLB 2QEXI 1YX5A 2EJRA 3SQNA 2C6YA 4BNCA 3LA2A 4HYEA 3WE3A 4O3MA 3MKYB 3TO6A 4IQ4A 2E1MB 2OBPA 1HDDC 3RQ4A 2LFBA 3SDGA 1TWAJ 5GPCA 2FU4A 3T8TA 2Z33A 5E20A 1FSHA 1VNDA 1ETOA 2DFIA 2HQAA 1RIOH 1PYVA 3MN2A 3QQAA 2IP2A 1DPRA 3CP2A 1WJEA 3DKYA 2ICWG 2ELHA 3NWSA 3HOWJ 4XLAA 3OYCA 5IT9Z 1STZA 1ZN2A 1GT0C 4UNOA 3FDYA 2DMUA 3EUHA 2HYFA 2X0LA 2IT0A 5F0CA 2DQRA 2NRAC 3KFWX 4IHTA 3GTLJ 1JHFA 5K7ZA 1OKRA 3G1OA 1WVRA 2R7TA 2WAQA 4OIOF 1IN8A 1DGRM 2P4WA 2YX7A 3MMYB 1GVJA 3H3ZA 4BU2A 2F5VA 1BOBA 3WTUC 1RUNA 3O8HA 3ASOH 4E7HA 3LOCA 3ZMVA 1Y1VJ 3O3KA 2W00A 1O7LA 3OYKA 5D8LB 4MFDA 2F4IA 3GFMA 3O8GA 3K10A 3TBIA 5DTDA 1K4TA 5IOZA 1I3AA 3V7CA 4NB5A 2HYGD 3HSRA 3HSFA 2HQNA 2GA2A 3GTGJ 4BGDA 4L9JA 2NNNA 3L9FA 1V54H 3GF2A 5DM6F 3LSRA 1SFEA 3QU6A 1I1GA 2HTSA 5J4VA 4PCQA 2HDDA 1RETA 1AHDP 2VC1A 2ZB9A 1XCBA 4U7DA 1E2XA 5IP6A 3DV8A 1O3RA 1TQPA 5CVIA 3E6DA 4XKCA 4DBRA 4XRSG 4PGGA 3ZCOA 1R49A 1DDNA 4HF2A 4Q5SF 1PJRA 2DT7B 1KU3A 1Z3YA 3BG7A 1HKQA 5F1RA 1H89C 1G59A 3N05A 1FZPB 1XC5A 3L1PA 3FXLA 1WI9A 1W0UA 2XGDA 5J4YA 3FXUA 4PUSA 5DCFA 5EF6A 2GXBA 3E7LA 2HYJA 4HQMA 3FWEA 1KU9A 3KZYA 2DLLA 1D8KA 1G6NA 2Q2EB 1I50J 3V7RA 1OCCH 2B7EA 3FBIB 1IV8A 4ESBA 4A0XA 4WK8F 1U0JA 2D2WA 3SYTA 4LFUA 2E5ZA 1HW2A 3K4MA 3RTRA 2CV0A 2QZ8A 1W1WE 4X1EA 1U9NA 1YE9A 4NQWA 2L7FP 4HNVA 1OYYA 4BYYA 4KISA 4XRSA 1BN5A 4CYCA 3U2RA 1TL8A 1ZAOA 2EH3A 3D5SC 1K79A 2M8EA 2X48A 3K4NA 3BPVA 1POGA 1IXRC 3TDZC 5DUIA 2KZVA 2MLKA 1A35A 2E7XA 1FTZA 3KEOA 2P7VB 2NVYJ 2A61A 2DT5A 2GBYA 3S3NA 3RSNA 3AG4H 3DBLB 3RIRA 4BACA 3K69A 1LKXA 5K7FA 3TP3A 2QM3A 4HOBA 4JX4A 2FE3A 3F3XA 3FBNB 3OS1A 1A5JA 2O9LA 3AKZA 2P6SA 3BQYA 3C2HA 5AIPA 1S7AA 5C4XJ 1ZRFA 3UNGC 2DOFA 1BR1A 3FMSA 3TO7A 2HQ5A 3NEUA 1DP3A 4CZZA 3OS2A 1YI2I 2ZXHA 3OYAA 3JW4A 2EV0A 3J7AO 2LY2A 5TGTA 4ITVA 1D0YA 3ABUA 3OYEA 2XAQA 4BHPA 5KAFC 1GV5A 1B1BA 2E2HJ 2OU2A 2CW7A 3GO5A 3QYEA 4P1WA 2JA8J 1G3YA 1X19A 1K7AA 1HSJA 3ZN1A 4I2OA 2L2OA 3G4SI 1Z05A 5FROA 1AU7A 3HTSB 2A5WA 2BV6A 3IUOA 4IL6C 4KT5C 4WWCA 3S3OA 3VPRA 4KMFA 4ZDPA 1IJWC 2FEZA 3G3ZA 4JX6A 3S15J 3TEDA 2MH2A 1Y39A 1BC7C 4Y17A 1WJ5A 3SEZA 1W0TA 1KU7A 4ASNA 2X6XA 2CUJA 4AM3A 2V1UA 3LA7A 4FCYA 3CC4I 3OY9A 2M87A 1KYZA 4CCKA 3O2PE 3I53A 3FXQA 1FIAA 3M9AA 2Z3YA 1W36D 4BEHB 5DDGA 4XK4A 3ZMUA 4FX4A 2I5UA 5HLHA 3ISPA 1G2HA 3G2BA 2NYXA 1HXDA 3BJAA 3QRFF 2W84A 3O6BB 4MFEA 4N4NB 3FX3A 2XGCA 5LHIA 4EJTA 5M5YJ 2JPCA 3HUGB 1QPIA 3DWLE 4DNCA 1E3HA 4UV8A 1VQPI 4OMYA 1G3SA 2IEKA 2PBIA 3H0GJ 1FTTA 5IYCJ 1TWGJ 2H6CA 3S17J 1VQ5I 2WAEA 2E1MC 1Z3XA 5FFZA 2ETHA 3P5JA 4PSWA 2CS3A 3TQNA 1E0EA 5E18F 4LG0B 1QRYA 3GYHX 2VOOA 3S3MA 3CUQB 1IN7A 4LOCA 3HRUA 4I02A 4V19K 5BS6A 1P92A 1RC9A 5M5WJ 2O6GE 1I5ZA 4HAMA 5CKTA 2LVSA 3A01B 4CDGA 4M72A 1WH5A 4JK1X 2P7CB 4OAZA 1BI0A 1T56A 1RESA 1SANA 1O3QA 3K2AA 1BIBA 1ZLKA 4LB5A 1MSEC 2P5VA 1USSA 1GVDA 5LD2C 2DT6A 1K78B 1FP1D 4EJUA 1MD0A 1OCTC 1WFXA 1JKQC 3DEUA 3FM3A 2QBYB 3ZOBA 2W24A 3RQIA 3F8BA 4Q47A 5DV5A 1J5YA 4KNYA 4I09A 5CQGA 4MEYF 4XM3A 3G73A 2DFHA 1T39A 1ON2A 3GUDA 4S05A 2JSCA 5GP9A 4GRIA 5D6EA 2O8KA 4LLLA 1OJLA 3K70C 1QPMA 1LDKB 2FBIA 1WRJA 3KEYA 2UWMA 2RVCA 3L2VA 4LLNA 1DGWY 1MDMB 4QPQA 4XNFA 2A68F 2X4HA 2ESHA 3DCFA 4IF4A 4HBLA 5JHUA 1ETXA 1P4WA 5ILSA 2R92J 2QKMB 4F3QA 2WADA 1B8IB 1XGMA 4RLQA 1R00A 2QQ9A 2HGCA 2IA2A 3F8MA 5E79C 3PNTA 3GZNB 2DA1A 2DW4A 4NBQA 3PNYA 2ESNA 1JTXA 5D5UB 3ELKA 1FYKA 1X1BA 4XLNF 3PO3J 1XDUA 3QP6A 4ZDOA 2Y0MA 3GCMA 3EQLF 5L3DA 4QIWN 5K7HA 1JGGA 2LMDA 1IO2A 3LAPA 5GTHC 4HDUA 2JUCA 4JYKA 5F08A 4QTRA 3I64A 3L09A 4OWRB 2EZIA 2PMHA 1UJ8A 2NOJB 2HDWA 3DBRB 3ABTA 1SD4A 1O3SA 4AVZA 2XF5A 1SEUA 4I6ZA 2CQQA 3I3LA 5J40A 3WTSC 1U6GA 4DZPA 3F9KA 1Z7UA 4GCVA 4JP0A 1Y8RB 3BT9A 4N0BA 2GOMA 5FB2A 4HV5A 1FWZA 2Q0OA 1MNMC 1R1TA 4L9VA 4ZYEA 4FASD 2CGPA 2K9NA 1WKMA 3ABLH 5BQTA 4PJ0C 3LQQA 1BJZA 3RZDJ 3HRMA 2EWNA 4HW0A 1RPWA 4H0EA 4CICA 2O8XA 1XMXA 1F9NA 4LB6B 3ZR8X 5HS9A 2ID6A 1RZ4A 4XLPF 1GXQA 3T8RA 2BHZA 2HPMA 4HF0A 4NC6A 4D5CA 4M3GA 2UV1A 2R5YA 3U1DA 4A3LJ 2YR2A 3H5NA 1S5LC 4OAYA 3SZGA 5EJCA 3HL2A 2FJ1A 4G7ZF 3SZPA 4XRFA 3PFYA 3L2RA 3MEXA 1Z9CA 2K7LA 3IP4B 2VJ5A 1G3WA 4BQAA 1EF4A 2X85A 2R7DA 1YS7A 3K1NA 3D0SA 2OCEA 2VPRA 2HKOA 4PJNA 3ZRGA 1LEAA 4MLOA 3IWZA 4CA0A 4C2UA 3TMOA 1HCRA 2BOLA 3OL4A 2R93J 3CMEI 1J9IA 3CJTB 1Z77A 3Q0WA 2LREA 5HLIA 1ETYA 3DQVC 3REOA 1RRJA 4V2FA 1I39A 2DMPA 2JWTA 2WV1A 1Z6TA 4NDLA 2QSHX 2CW8A 2JK3A 2NVQJ 4C30A 1W5CC 3ASNH 1WCMJ 5KAIC 3JRFA 4ZYDA 3HKZN 3BTLA 1J0RA 1Z0XA 1V5FA 2RQPA 5K5RA 1ZGJA 3MKLA 4LIVA 2KT0A 3F23A 1I3QJ 2V1XA 3WU1B 5JHFA 1A6IA 4RGRA 1Z1DA 3A03A 4JOMA 4XLEA 3PFIA 4XKVA 3VSLA 3BJ6A 5HOOA 4J00A 4CH7A 3Q5FA 4ZJZA 5H20A 2BXYA 2M9HA 2B63J 1NK3P 2LTPA 3JRAA 2WY7Q 3F72A 4NQWB 4NUBA 3CCJI 1V5GA 2KIUA 3HOXJ 3F21A 3W2AA 3OS0A 3G1LA 3BCBA 3ROUA 2ME0A 2HZTA 4E4HA 4A0ZA 4CYCB 3IRQA 4LLGF 4A3EJ 2VT3A 3ZMZA 2M4KA 1BR4A 4EM1A 2I8DA 2LY9A 1IF1A 3KLNA 2OC6A 2ZSHB 2RC4A 2NS7A 4CUGA 2CQXA 3JTGA 3KPHA 1MH3A 1O7FA 2EV6A 5BPIA 2V6CA 5FLXK 5IY5H 1WJDA 3W3CA 3A1YA 4AIDA 1KZHA 1T0FA 2Y9YA 2DN0A 2XF7A 2ZJPF 2KP6A 4L5IA 1KYWA 4KA4A 2MG4A 3KLOA 5K5QA 1C0WA 3CUQC 5K1YA 3J80Z 3DP7A 5F0FA 5LHHA 1CQTA 2KFDA 2ACJA 4C2MJ 1Z67A 1AA7A 1L3LA 3E5QA 4KT6A 5CVUA 2QA4I 1TW3A 4KITB 2F4OB 2OQRA 2BE5F 1P7IA 2L9RA 1IZ1A 2MLGA 3V7SA 2H27A 3CD6I 2F4MB 5IT9K 1ITYA 1KA8A 3HUGA 4XBFA 2KPMA 4FQGA 1VTNC 1BW5A 2LKSA 4BHBA 3RZOJ 3HPHA 2RV8A 2AHQA 2GWRA 1KONA 1MBFA 3OYGA 1ZTRA 1R1UA 3MQ0A 1NHAA 1ZG3A 3KP5A 4XLHA 3A4CA 2KZGA 3BG9A 4M6XA 1BC8C 4D9JA 4F7ZA 5IP7J 3M8JA 1I6HJ 1KGSA 3PUBA 2DXIA 2IS6A 4O6JA 2X9DA 1IRXA 2MC3A 1LJ9A 3QU3A 3ZMDA 4B47A 2QENA 4LK0F 4QWQA 4BQNA 3A01A 1LFUP 1T08B 4A69C 2CYYA 3OYLA 3T0YA 4OIQF 3WU0A 3OSFA 3CMMA 2DA5A 3LL7A 2CWEA 1WSUA 3CO7C 2FA5A 1K78A 2EILH 4BBRJ 2QGUA 2R5ZA 2Y2ZA 1X2NA 3S2HJ 3LSGA 2IVMA 2MFZA 1T2KA 1LNWA 3IL2A 1E17A 3C1DA 3PQJA 3MKWB 4C2TA 3HKZA 1H9GA 2ZSIB 2DA3A 1DU0A 2IXSA 2OQGA 2VLAA 1R4MB 1SC7A 3DLAA 4Y3OA 4DYCA 3M4OJ 1W4MA 2CG4A 4JX5A 1W36C 3R60A 1ZREA 1R58A 1TNSA 4FISA 2FBKA 1FLIA 3Q9VA 1USTA 4I01A 4DW6A 3W6JB 1ETKA 1X2MA 2IPQX 2P81A 4UVAA 3D1NI 4E7IA 3LSHA 3NWTA 3CCUI 1QGPA 1A36A 4M3BA 4GXOA 3EUHC 5FKNA 3I54A 2F5FA 2AQEA 1QZYA 5K5OA 2STTA 2PG4A 1MSFC 1UB9A 1KQ9A 3EYYA 2MGQA 4G6QA 1JUPA 2IGKA 2QQBA 3ERMA 3H9QA 5J6XA 3JRGA 2EFOA 1JUSA 2CUEA 2ZFUA 1HW1A 4IXAA 3Q3SA 4U88A 4Y13A 3R61A 2O5RA 2B9SA 2VBWA 3LFKA 3RYPA 1JE8A 3CJQB 3WE2A 3WTZA 1K61A 4IEJA 3BR2A 3L2UA 4U0YA 3KZIC 5DCMA 5E1WA 2I10A 2V1NA 2O3FA 2X51A 3GFJA 2L3DA 3M1EA 2HEOA 2ZNZA 3VEPA 2DYRH 4WXDA 2AXLA 2DPUA 3BR3A 3E6BA 2WY8Q 1SAXA 3NAUA 2PJRA 5FKMA 4YIIA 1G4DA 1YX3A 2VKEA 1UCRA 4A3JJ 1MMNA 2TRTA 2XAHA 3CJRB 4XR6A 2XAJA 3P9CA 2UUZA 2L5QA 1UMQA 2JRTA 5FGMA 2R3SA 2G7UA 3FXMA 3DKWA 1FYMA 1ODDA 3B02A 5LHGA 2XB0X 3DEWA 3BR1A 2FRHA 3CCMI 4HG2A 2HS5A 2FOWA 1D3YA 4AUXA 1HW5A 1ZG1A 2E34A 2A6EF 2M0CA 4P9UA 2D1HA 5JR3A 2FXAA 4I7HA 5L3EA 2A6HF 2HOTA 3CC7I 2DMQA 1S9HA 3LWFA 2Z16A 1TP4A 4E70A 4Y52J 1IV6A 4IRGA 2NVUB 2X1CA 3FM5A 4ZH4F 4BAYA
chains in the Genus database with same CATH topology
4G6DA 1FYLA 3E6CC 1PUEE 2CFXA 2QVOA 1RNLA 3BDDA 2EFNA 3GFLA 4OU0A 2VONA 2FBHA 2JT1A 1SD5A 5BPDA 1ZG5A 1IUYA 1FNNA 2BGCA 1TBXA 3HOSA 3FHZA 2YX4A 3R6SA 5CYVA 2VXZA 2IRFG 2L01A 3RPQA 5FFXA 3FF5A 5CVVA 1XGSA 3EETA 3J81K 1YW8A 5TRDA 2ADUA 1I1SA 4G7HF 4S04A 4ESJA 2MA3A 1QZZA 2KJCA 5D6FA 3WTTC 5FD6A 3F6OA 1U5TA 4IRIA 1SFUA 3K9TA 4UHTA 4G94A 3I5UA 3RKYA 2FNPA 1XSDA 5CVRA 4TV7A 3F22A 2GA1A 3NQOA 1HQCA 4G7OF 5J8CA 2DAOA 2ZXJA 1TTYA 2FNAA 4RGSA 2A3SA 4GYIA 1R23A 4IPAA 1X3UA 2PN6A 4Y15A 4MHGA 2L02A 3NRVA 3FZVA 3DPTA 4HF1A 2NNYA 5E17F 2VC0A 1PDNC 4KIFA 3T5XA 4KIGA 1DUXC 3BY6A 4NHJA 3WGGA 3AAFA 1BOAA 2BBYA 4EJVA 2E7WA 2RDPA 3HSEA 1LDJA 2P5LC 3KP7A 1LQ1A 3E5XA 1IXSB 1IN5A 4GO1A 3M7GA 1OMIA 2DPDA 1B6AA 4L0ZB 2JTVA 1LDDA 3V4GA 4KMUX 2MD5A 2WTEA 1Q1HA 3L7WA 4AVPA 3WG9A 3GW2A 2P8TA 1HKTA 4HLXA 4LJZF 1P4XA 3I58A 1BI2A 2QYOA 1BIAA 1FC3A 3C3WA 3CO6C 1LEBA 5ERIA 4Q4ZF 4IRHA 1YW7A 1J7KA 3KEQA 3R0AA 3DPLC 2VN2A 2Z99A 3E5UA 2M1BA 3WTYC 1I27A 5LEJA 3L2CA 2ZO4A 3ZP5A 2L54A 1T6SA 1ZARA 1EH6A 2VT2A 1YQAA 3I59B 1BJAA 2K86A 1RUOA 2F5CA 1SD6A 4IJAA 2ZJ2A 4OIPF 2PJPA 1OR7A 5D4SA 3IKVA 2VBZA 1V4RA 5L3BA 4EM0B 2QUFA 2XKOA 4A2UA 4EMSA 3CLOA 1J59A 2FQ3A 2RNJA 5IT3A 5DD8A 4QLCU 3RYRA 2DTRA 3RKWA 2A5YB 2XROA 5DCMB 3IC7A 4R8HA 1U3EM 2OZUA 3R4KA 1UHMA 5ICGA 3RDIA 2MH9A 4HQEA 2F5EA 4PDKA 2GZWA 3RPUA 4JQFA 4HX7A 3KZZA 1W5TA 2XRNA 4LK1F 2PFBA 2A69F 2OZ6A 4MTEA 3HRSA 4M9XA 1R36A 6PAXA 3T1BA 2D1VA 3I71A 3BROA 1XGNA 3CUOA 2F2EA 3V8KA 1QQIA 2MBFA 1JHHA 3F8NA 3V8JA 1K6OA 4OINF 4IHSA 2OA4A 2ZMEA 4JBAA 1J75A 5D8KB 4M6YA 1U2WA 4KUMA 4XSZF 3VOEA 5LRSA 1IRGA 3FXRA 1YIOA 2V9VA 2DI3A 1FX7A 1ULYA 1WWXA 2COMA 4IVNA 5TJJA 1KQ8A 5FD5A 1FT9A 3GEZA 5D5WB 4HV6A 3HRTA 3JTHA 4CGZA 2G9WA 3HTUA 2W57A 3BOQA 1FY7A 5CJ9A 1U78A 4UV9A 4A6DA 4L9NA 2UXNA 3H3UA 1SMYF 5HLGA 4EQQA 3Q9SA 2IA1A 2XASA 4RB0A 1MGTA 5AONA 1XN7A 1XSVA 5A2QK 3C7JA 4MNUA 3QPHA 3GX4X 3BWGA 3DF8A 2E1NA 3FM5A 5DYMA 1XD7A 5CVJA 1OYIA 4WCGA 4ZYGA 1U5TB 2L4MA 1MJBA 2QQAA 3GLXA 4WXHA 5D5XB 1S8NA 4AIKA 4A5MA 2Y48A 3GVAA 1CF7B 5HVQC 2Y75A 1S3JA 2ZKZA 1G3TA 3QOPA 4EVIA 4L5JA 5HS8A 2K4BA 3HOTA 4XSXF 3ECHA 2HR3A 2LF7A 3KP6A 2WWYA 3FMQA 1DPUA 2O03A 2R7FA 5L3GA 4HX4A 3BP8A 2FOKA 2J5PA 2LKPA 2XGXA 3F8FA 3CDHA 2Z5UA 3IRRA 4CHUA 4M9SA 1FP2A 4B09A 3ERED 3KP3A 1Z6RA 5LLQA 3K0LA 2CSOA 3MAJA 3GZ6A 2FMYA 2KJBA 2O61A 3QP5A 2PEXA 4KIBA 3RI4A 2W85A 3I59A 4BAYA 3HYIA 1XSXA 3GFIA 5LEKA 2XHKA 3ECOA 3F6VA 1U8RA 1P2FA 2LDUA 1R5HA 4AIHA 1OPCA 2IW5A 4M71A 4BXUA 4N9IA 1IN4A 4M74A 4RB3C 1XGOA 1BM9A 1ZH5A 1W7PA 1F1ZA 1CGPA 1DP7P 2CQKA 3N4MA 3K1MA 4KYWA 4EV0A 2WV0A 1S29A 1D5VA 4YFNF 1A04A 4EJOA 2XIGA 2FSWA 3WGHA 1ZGAA 3P7NA 3MFKA 2K02A 4WX9A 3U9GA 3JAMZ 3BPXA 3WODF 4I0AA 2HWVA 1JGSA 2TDXA 2H94A 3RKXA 1O57A 2P5KA 3GWZA 5L3CA 1ZLJA 2RN7A 1EV7A 2EFQA 3QAHA 2UZKA 4RB1A 1TQMA 5ICFA 4RGUA 4MQ9F 3EYIA 5E8IA 5BOXA 2K27A 1TLHB 4AIJA 5LGTA 3LQRA 1GXPA 3KCCA 3HHHA 3ML6A 2YPRA 3HIFA 4MGRA 4ETSA 3D5LA 5ICCA 1U5TC 1QO0D 2HFHA 4UUVA 3E97A 1Z91A 3LA3A 1SD7A 2ZCWA 2KKOA 1UHWA 2IJLA 2EA2A 4K2EA 1HKSA 1T98A 3TOAA 2ZMEB 2LSOA 5BMZA 5FO5A 3ZPLA 4HDVA 1YG2A 2KIMA 1IW7F 3EDPA 3ULQB 4ENNA 4G8XA 1IAWA 3COAC 1MJAA 3B73A 5J8FA 1FBUA 3KE2A 2L4AA 4L0YB 1S6LA 4KFCA 4UVCA 3BJOA 5HS7A 1FOKA 1PP7U 1P4AA 2W25A 5CLSA 2CO5A 4EJWA 5EEHA 1MKMA 4Z2YA 1CF7A 2GAUA 4R1HA 2P6TA 3H92A 2V1DA 4ZYHA 2EK5A 3ZQ7A 1F4KA 2FMLA 2GIVA 4YFKF 1YS6A 1ONVA 2XUBA 5ICEA 4N9HA 3N97A 3MCZA 3WTXC 4RAYA 4LGWA 3I0TA 3CJNA 4YG2F 5H6QA 1L0OC 2GQQA 2AS5F 3GZ5A 3R0JA 1J2XA 4GYGA 1D8JA 2J5OA 2OD5A 2F5DA 1AOYA 1YLFA 2Q8KA 1REPC 1LB2A 1O3TA 1RI7A 2H09A 1R5GA 3E3VA 4FT8A 2EV5A 5LBQA 1B9MA 1W7PD 3KETA 4OOIA 5DUKA 3P9IA 3JSPA 5DEQA 2DO7A 4ENMA 1B9NA 2NAZA 4D0PA 1YW9A 3IWFA 3SHFA 5ILVA 4EM2A 2YSRA 4L18B 1WQ2A 1YYVA 1B4AA 3J81Z 1H0MA 3SZTA 1I6XA 1ZYRF 5KVRA 3HHGA 1T38A 2DBBA 3L00A 4FHTA 1BBYA 1XMKA 1FPQA 4A12A 3GXOA 2ISZA 1MZBA 4YIFA 2O0YA 1XB4A 2M30A 4U0VA 3IHUA 1Y0UA 2EA4A 4KDPA 4B8XA 1YO5C 3K2ZA 5KK1A 2RKHA 2HOEA 1BI1A 5E1XA 2HTJA 1OYWA 2CW0F 3TKYA 1PP8F 4KN7X 5HDGA 1W5SA 2HQRA 2IA0A 5LGUA 3KP4A 1F5TA 4ENJA 4DQ2A 2ZFWA 4R79A 3I4PA 3SFZA 4KICA 1S7OA 4GGGA 4U0WA 3QPTA 2ZBKA 5D4RA 2OAZA 2DK8A 5E8GA 3BZ6A 4CXFA 3C18A 2A07F 1W7PB 3F8CA 5HDNA 1SMTA 1KQ0A 3JSOA 3VFZA 3PQKA 4U7BA 4ZZLA 1UFMA 4L9TA 3TGNA 3DXJF 3MZYA 3CTAA 2B0LA 4CO8A 4RS8A 4PGHA 4UVBA 5ED4A 3TOBA 3K1PA 4BHCA 2HKXA 4M73A 5F64A 4YFXF 5F6FA 4ZZDA 4OMZA 1HBXG 2WC2A 1ZRCA 3J80K 3OOPA 4AD9A 4WXCA 2XAFA 3E6MA 2UXXA 3DFGA 4HZFA 2M5WA 5DD4A 4WF2A 3SXYA 1R7JA 2E1CA 2XVCA 1ZHFA 4HX8A 1TNTA 2HDCA 3IKTA 2BEOA 2Q2EA 4P55A 2PLYA 2LF8A 2QWWA 1IRFA 1R22A 5E1ZB 2EFPA 4O5VA 3V8LA 5HDKA 1QNTA 2Z9OA 4BH9A 4AWXB 1IN6A 2YU3A 4ESFA 3KP2A 1YTYA 3RJPA 3P9KA 3TDUC 4A6EA 2ZNYA 4A5NA 1XDSA 2KIFA 2BYVE 5JFRA 4RGXA 4LMYA 1ZRDA 3WTWC 1QBJA 4FX0A 4G9YA 2VBXA 3W6KB 1EH8A 1MJ9A 1BI3A 4A0YA 2G7HA 5AIQA 3M8EA 1V3FA 4RAZA 4P9FA 2XAGA 4MQVA 2EFWA 1H9TA 2JPBA 2DK5A 3MWMA 4OIRF 1SFXA 2EB7A 2FF4A 3S2WA 1JXSA 1TW2A 5L3FA 1FBQA 2D45A 3WGIA 3ZN0A 4PZJA 2VE8A 4M9ZA 4Q48A 2XKPA 2QLZA 4ENKA 3VB2A 3VODA 3LAJA 1HSTA 2PQ8A 4MTDA 2PI0A 3ZMSA 2PMUA 5JVTA 2K4JA 4ON0A 3FMRA 2XV4S 1B59A 2VE9A 4CYDA 3JAMK 1FSEA 5H6RA 1XMAA 2STWA 1ON1A 4MEXF 1TQIA 4I0BA 4P96A 4LG0A 1FBSA 2RGVA 3WTVC 3MZHA 3CUQA 4EGZA 1KU2A 4P5OA 5JI6A 5LGNA 4EGYA 4UXNA 5LRRA 2DQLA 4HA8A 4KN4X 1AWCA 3M8FA 5ILUA 2M45A 3OV8A 2VOPA 2V79A 2VBYA 2QBYA 5EEGA 3LSTA 1GHCA 2NS0A 1EH7A 1LVAA 4I98B 2VODA 2ISYA 3TO9A 2H6BA 4RB2C 5A2QZ 1P6RA 2KRFA 1MDMA 2LNBA 5D5VB 2GXGA 1R1VA 1IXCA 1YFHA 2JZYA 3ZMTA 1XCVA 5FLXZ 4LD5A 2DU9A 4BNCA 2C6YA 2EJRA 3SQNA 3LA2A 4HYEA 3WE3A 4O3MA 3TO6A 2OBPA 1FSHA 2FU4A 3T8TA 2Z33A 5E20A 2DFIA 1RIOH 2IP2A 1DPRA 2ELHA 5IT9Z 1STZA 1ZN2A 4UNOA 3EUHA 2HYFA 2X0LA 2IT0A 2DQRA 2NRAC 3KFWX 4IHTA 1JHFA 1OKRA 4OIOF 1IN8A 2P4WA 2YX7A 1GVJA 3H3ZA 3WTUC 1RUNA 3ZMVA 3O3KA 1O7LA 5D8LB 3GFMA 3V7CA 4NB5A 2HYGD 3HSRA 3HSFA 2HQNA 2GA2A 4L9JA 2NNNA 3L9FA 3GF2A 1SFEA 3QU6A 1I1GA 2HTSA 4PCQA 2VC1A 1XCBA 4U7DA 1E2XA 1O3RA 3DV8A 1TQPA 5CVIA 3E6DA 1DDNA 4PGGA 4HF2A 4Q5SF 1KU3A 1HKQA 5F1RA 1FZPB 1WI9A 3FXUA 5DCFA 2GXBA 4HQMA 3FWEA 1KU9A 3KZYA 2DLLA 1D8KA 1G6NA 3V7RA 4ESBA 4A0XA 4WK8F 2D2WA 4LFUA 1HW2A 3RTRA 2QZ8A 4NQWA 1OYYA 4BYYA 1BN5A 3U2RA 1ZAOA 1K79A 2M8EA 3BPVA 1IXRC 3TDZC 5DUIA 2MLKA 2E7XA 3KEOA 2P7VB 2A61A 2DT5A 3RIRA 3K69A 2QM3A 4HOBA 2FE3A 3F3XA 2P6SA 5AIPA 1S7AA 1ZRFA 3FMSA 3TO7A 3NEUA 4CZZA 3JW4A 2EV0A 3J7AO 3ABUA 2XAQA 4BHPA 1B1BA 2OU2A 3GO5A 1G3YA 1K7AA 1HSJA 3ZN1A 4I2OA 1Z05A 3HTSB 2BV6A 4KT5C 4WWCA 4KMFA 2FEZA 3G3ZA 2MH2A 1BC7C 4Y17A 1KU7A 4ASNA 2V1UA 3LA7A 2M87A 1KYZA 3O2PE 3I53A 3FXQA 3M9AA 2Z3YA 5DDGA 3ZMUA 4FX4A 5HLHA 3ISPA 2NYXA 1HXDA 3BJAA 3QRFF 2W84A 3O6BB 3FX3A 5LHIA 4EJTA 2JPCA 4DNCA 4UV8A 4OMYA 1G3SA 2PBIA 2H6CA 5FFZA 2ETHA 3TQNA 5E18F 4LG0B 3GYHX 2VOOA 3CUQB 1IN7A 3HRUA 4I02A 5BS6A 1P92A 2O6GE 1I5ZA 4HAMA 4CDGA 4M72A 4JK1X 2P7CB 1BI0A 1O3QA 1BIBA 1ZLKA 4LB5A 2P5VA 1USSA 1K78B 1FP1D 4EJUA 1MD0A 3DEUA 3FM3A 2QBYB 2W24A 3F8BA 4Q47A 5DV5A 1J5YA 4KNYA 4I09A 3G73A 4MEYF 1T39A 1ON2A 3GUDA 4S05A 2JSCA 5D6EA 4LLLA 1QPMA 1LDKB 2FBIA 1WRJA 2UWMA 2RVCA 4LLNA 1MDMB 2A68F 2X4HA 2ESHA 4IF4A 4HBLA 5JHUA 1P4WA 5ILSA 1XGMA 1R00A 2QQ9A 2HGCA 2IA2A 3F8MA 2DW4A 2ESNA 5D5UB 1FYKA 3ELKA 4XLNF 1XDUA 3QP6A 2Y0MA 3EQLF 5L3DA 3LAPA 4HDUA 3I64A 3L09A 2PMHA 3ABTA 1SD4A 1O3SA 3WTSC 1U6GA 1Z7UA 4GCVA 4N0BA 5FB2A 4HV5A 1FWZA 2Q0OA 1R1TA 4L9VA 4ZYEA 2CGPA 1WKMA 5BQTA 3LQQA 3HRMA 2EWNA 4HW0A 4H0EA 4CICA 2O8XA 4LB6B 1F9NA 5HS9A 1RZ4A 4XLPF 1GXQA 3T8RA 4HF0A 3U1DA 2YR2A 4G7ZF 3SZPA 4XRFA 1Z9CA 3MEXA 2K7LA 1G3WA 4BQAA 2R7DA 1YS7A 3K1NA 3D0SA 2HKOA 1LEAA 3IWZA 1J9IA 5HLIA 3DQVC 3REOA 1Z6TA 4ZYDA 1J0RA 2RQPA 5K5RA 1ZGJA 3F23A 2V1XA 3WU1B 4RGRA 1Z1DA 3PFIA 3BJ6A 5HOOA 3Q5FA 5H20A 3F72A 2KIUA 3F21A 3ROUA 2HZTA 4A0ZA 3IRQA 4LLGF 2VT3A 3ZMZA 4EM1A 1IF1A 3KLNA 2RC4A 3JTGA 1O7FA 2EV6A 5BPIA 2V6CA 5FLXK 1T0FA 4L5IA 1KYWA 4KA4A 3KLOA 5K5QA 1C0WA 3CUQC 5K1YA 3J80Z 3DP7A 5LHHA 2ACJA 1L3LA 3E5QA 5CVUA 1TW3A 2OQRA 2BE5F 1IZ1A 2MLGA 3V7SA 2H27A 5IT9K 1KA8A 3HUGA 4XBFA 1VTNC 4BHBA 2RV8A 2GWRA 1R1UA 3MQ0A 1NHAA 1ZG3A 3KP5A 4M6XA 1BC8C 4F7ZA 1KGSA 4O6JA 2MC3A 3QU3A 1LJ9A 3ZMDA 2QENA 4LK0F 4QWQA 2CYYA 3T0YA 4OIQF 3WU0A 2CWEA 1WSUA 3CO7C 2FA5A 1K78A 2IVMA 1T2KA 1LNWA 1E17A 3C1DA 3PQJA 1H9GA 2OQGA 1W4MA 2CG4A 3R60A 1ZREA 1R58A 1TNSA 2FBKA 1FLIA 3Q9VA 1USTA 4I01A 3W6JB 2IPQX 4UVAA 1QGPA 4GXOA 3I54A 2F5FA 1QZYA 5K5OA 2STTA 2PG4A 1UB9A 1KQ9A 3EYYA 4G6QA 2QQBA 5J6XA 2EFOA 1HW1A 4Y13A 4IXAA 4U88A 3R61A 2VBWA 3LFKA 3RYPA 1JE8A 3WE2A 3WTZA 4U0YA 5DCMA 5E1WA 3M1EA 2O3FA 3GFJA 2HEOA 2L3DA 2ZNZA 3VEPA 4WXDA 2AXLA 2DPUA 3E6BA 1SAXA 4YIIA 1G4DA 1UCRA 2XAHA 2XAJA 3P9CA 2JRTA 5FGMA 2R3SA 2G7UA 3DKWA 1FYMA 1ODDA 3B02A 5LHGA 2FRHA 2HS5A 1D3YA 1HW5A 1ZG1A 2A6EF 4P9UA 2D1HA 5JR3A 2FXAA 4I7HA 5L3EA 2A6HF 3LWFA 4E70A 4IRGA 4HLYA 4ZH4F 3IL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G6D A;  1FYL A;  3E6C C;  1PUE E;  2CFX A;  2QVO A;  1RNL A;  3BDD A;  2EFN A;  3GFL A;  4OU0 A;  2VON A;  2FBH A;  2JT1 A;  1SD5 A;  5BPD A;  1ZG5 A;  1IUY A;  1FNN A;  2BGC A;  1TBX A;  3HOS A;  3FHZ A;  2YX4 A;  3R6S A;  5CYV A;  2VXZ A;  2IRF G;  2L01 A;  3RPQ A;  5FFX A;  3FF5 A;  5CVV A;  1XGS A;  3EET A;  3J81 K;  1YW8 A;  5TRD A;  2ADU A;  1I1S A;  4G7H F;  4S04 A;  4ESJ A;  2MA3 A;  1QZZ A;  2KJC A;  5D6F A;  3WTT C;  5FD6 A;  3F6O A;  1U5T A;  4IRI A;  1SFU A;  3K9T A;  4UHT A;  4G94 A;  3I5U A;  3RKY A;  2FNP A;  1XSD A;  5CVR A;  4TV7 A;  3F22 A;  2GA1 A;  3NQO A;  1HQC A;  4G7O F;  5J8C A;  2DAO A;  2ZXJ A;  1TTY A;  2FNA A;  4RGS A;  2A3S A;  4GYI A;  1R23 A;  4IPA A;  1X3U A;  2PN6 A;  4Y15 A;  4MHG A;  2L02 A;  3NRV A;  3FZV A;  3DPT A;  4HF1 A;  2NNY A;  5E17 F;  2VC0 A;  1PDN C;  4KIF A;  3T5X A;  4KIG A;  1DUX C;  3BY6 A;  4NHJ A;  3WGG A;  3AAF A;  1BOA A;  2BBY A;  4EJV A;  2E7W A;  2RDP A;  3HSE A;  1LDJ A;  2P5L C;  3KP7 A;  1LQ1 A;  3E5X A;  1IXS B;  1IN5 A;  4GO1 A;  3M7G A;  1OMI A;  2DPD A;  1B6A A;  4L0Z B;  2JTV A;  1LDD A;  3V4G A;  4KMU X;  2MD5 A;  2WTE A;  1Q1H A;  3L7W A;  4AVP A;  3WG9 A;  3GW2 A;  2P8T A;  1HKT A;  4HLX A;  4LJZ F;  1P4X A;  3I58 A;  1BI2 A;  2QYO A;  1BIA A;  1FC3 A;  3C3W A;  3CO6 C;  1LEB A;  5ERI A;  4Q4Z F;  4IRH A;  1YW7 A;  1J7K A;  3KEQ A;  3R0A A;  3DPL C;  2VN2 A;  2Z99 A;  3E5U A;  2M1B A;  3WTY C;  1I27 A;  5LEJ A;  3L2C A;  2ZO4 A;  3ZP5 A;  2L54 A;  1T6S A;  1ZAR A;  1EH6 A;  2VT2 A;  1YQA A;  3I59 B;  1BJA A;  2K86 A;  1RUO A;  2F5C A;  1SD6 A;  4IJA A;  2ZJ2 A;  4OIP F;  2PJP A;  1OR7 A;  5D4S A;  3IKV A;  2VBZ A;  1V4R A;  5L3B A;  4EM0 B;  2QUF A;  2XKO A;  4A2U A;  4EMS A;  3CLO A;  1J59 A;  2FQ3 A;  2RNJ A;  5IT3 A;  5DD8 A;  4QLC U;  3RYR A;  2DTR A;  3RKW A;  2A5Y B;  2XRO A;  5DCM B;  3IC7 A;  4R8H A;  1U3E M;  2OZU A;  3R4K A;  1UHM A;  5ICG A;  3RDI A;  2MH9 A;  4HQE A;  2F5E A;  4PDK A;  2GZW A;  3RPU A;  4JQF A;  4HX7 A;  3KZZ A;  1W5T A;  2XRN A;  4LK1 F;  2PFB A;  2A69 F;  2OZ6 A;  4MTE A;  3HRS A;  4M9X A;  1R36 A;  6PAX A;  3T1B A;  2D1V A;  3I71 A;  3BRO A;  1XGN A;  3CUO A;  2F2E A;  3V8K A;  1QQI A;  2MBF A;  1JHH A;  3F8N A;  3V8J A;  1K6O A;  4OIN F;  4IHS A;  2OA4 A;  2ZME A;  4JBA A;  1J75 A;  5D8K B;  4M6Y A;  1U2W A;  4KUM A;  4XSZ F;  3VOE A;  5LRS A;  1IRG A;  3FXR A;  1YIO A;  2V9V A;  2DI3 A;  1FX7 A;  1ULY A;  1WWX A;  2COM A;  4IVN A;  5TJJ A;  1KQ8 A;  5FD5 A;  1FT9 A;  3GEZ A;  5D5W B;  4HV6 A;  3HRT A;  3JTH A;  4CGZ A;  2G9W A;  3HTU A;  2W57 A;  3BOQ A;  1FY7 A;  5CJ9 A;  1U78 A;  4UV9 A;  4A6D A;  4L9N A;  2UXN A;  3H3U A;  1SMY F;  5HLG A;  4EQQ A;  3Q9S A;  2IA1 A;  2XAS A;  4RB0 A;  1MGT A;  5AON A;  1XN7 A;  1XSV A;  5A2Q K;  3C7J A;  4MNU A;  3QPH A;  3GX4 X;  3BWG A;  3DF8 A;  2E1N A;  3FM5 A;  5DYM A;  1XD7 A;  5CVJ A;  1OYI A;  4WCG A;  4ZYG A;  1U5T B;  2L4M A;  1MJB A;  2QQA A;  3GLX A;  4WXH A;  5D5X B;  1S8N A;  4AIK A;  4A5M A;  2Y48 A;  3GVA A;  1CF7 B;  5HVQ C;  2Y75 A;  1S3J A;  2ZKZ A;  1G3T A;  3QOP A;  4EVI A;  4L5J A;  5HS8 A;  2K4B A;  3HOT A;  4XSX F;  3ECH A;  2HR3 A;  2LF7 A;  3KP6 A;  2WWY A;  3FMQ A;  1DPU A;  2O03 A;  2R7F A;  5L3G A;  4HX4 A;  3BP8 A;  2FOK A;  2J5P A;  2LKP A;  2XGX A;  3F8F A;  3CDH A;  2Z5U A;  3IRR A;  4CHU A;  4M9S A;  1FP2 A;  4B09 A;  3ERE D;  3KP3 A;  1Z6R A;  5LLQ A;  3K0L A;  2CSO A;  3MAJ A;  3GZ6 A;  2FMY A;  2KJB A;  2O61 A;  3QP5 A;  2PEX A;  4KIB A;  3RI4 A;  2W85 A;  3I59 A;  4BAY A;  3HYI A;  1XSX A;  3GFI A;  5LEK A;  2XHK A;  3ECO A;  3F6V A;  1U8R A;  1P2F A;  2LDU A;  1R5H A;  4AIH A;  1OPC A;  2IW5 A;  4M71 A;  4BXU A;  4N9I A;  1IN4 A;  4M74 A;  4RB3 C;  1XGO A;  1BM9 A;  1ZH5 A;  1W7P A;  1F1Z A;  1CGP A;  1DP7 P;  2CQK A;  3N4M A;  3K1M A;  4KYW A;  4EV0 A;  2WV0 A;  1S29 A;  1D5V A;  4YFN F;  1A04 A;  4EJO A;  2XIG A;  2FSW A;  3WGH A;  1ZGA A;  3P7N A;  3MFK A;  2K02 A;  4WX9 A;  3U9G A;  3JAM Z;  3BPX A;  3WOD F;  4I0A A;  2HWV A;  1JGS A;  2TDX A;  2H94 A;  3RKX A;  1O57 A;  2P5K A;  3GWZ A;  5L3C A;  1ZLJ A;  2RN7 A;  1EV7 A;  2EFQ A;  3QAH A;  2UZK A;  4RB1 A;  1TQM A;  5ICF A;  4RGU A;  4MQ9 F;  3EYI A;  5E8I A;  5BOX A;  2K27 A;  1TLH B;  4AIJ A;  5LGT A;  3LQR A;  1GXP A;  3KCC A;  3HHH A;  3ML6 A;  2YPR A;  3HIF A;  4MGR A;  4ETS A;  3D5L A;  5ICC A;  1U5T C;  1QO0 D;  2HFH A;  4UUV A;  3E97 A;  1Z91 A;  3LA3 A;  1SD7 A;  2ZCW A;  2KKO A;  1UHW A;  2IJL A;  2EA2 A;  4K2E A;  1HKS A;  1T98 A;  3TOA A;  2ZME B;  2LSO A;  5BMZ A;  5FO5 A;  3ZPL A;  4HDV A;  1YG2 A;  2KIM A;  1IW7 F;  3EDP A;  3ULQ B;  4ENN A;  4G8X A;  1IAW A;  3COA C;  1MJA A;  3B73 A;  5J8F A;  1FBU A;  3KE2 A;  2L4A A;  4L0Y B;  1S6L A;  4KFC A;  4UVC A;  3BJO A;  5HS7 A;  1FOK A;  1PP7 U;  1P4A A;  2W25 A;  5CLS A;  2CO5 A;  4EJW A;  5EEH A;  1MKM A;  4Z2Y A;  1CF7 A;  2GAU A;  4R1H A;  2P6T A;  3H92 A;  2V1D A;  4ZYH A;  2EK5 A;  3ZQ7 A;  1F4K A;  2FML A;  2GIV A;  4YFK F;  1YS6 A;  1ONV A;  2XUB A;  5ICE A;  4N9H A;  3N97 A;  3MCZ A;  3WTX C;  4RAY A;  4LGW A;  3I0T A;  3CJN A;  4YG2 F;  5H6Q A;  1L0O C;  2GQQ A;  2AS5 F;  3GZ5 A;  3R0J A;  1J2X A;  4GYG A;  1D8J A;  2J5O A;  2OD5 A;  2F5D A;  1AOY A;  1YLF A;  2Q8K A;  1REP C;  1LB2 A;  1O3T A;  1RI7 A;  2H09 A;  1R5G A;  3E3V A;  4FT8 A;  2EV5 A;  5LBQ A;  1B9M A;  1W7P D;  3KET A;  4OOI A;  5DUK A;  3P9I A;  3JSP A;  5DEQ A;  2DO7 A;  4ENM A;  1B9N A;  2NAZ A;  4D0P A;  1YW9 A;  3IWF A;  3SHF A;  5ILV A;  4EM2 A;  2YSR A;  4L18 B;  1WQ2 A;  1YYV A;  1B4A A;  3J81 Z;  1H0M A;  3SZT A;  1I6X A;  1ZYR F;  5KVR A;  3HHG A;  1T38 A;  2DBB A;  3L00 A;  4FHT A;  1BBY A;  1XMK A;  1FPQ A;  4A12 A;  3GXO A;  2ISZ A;  1MZB A;  4YIF A;  2O0Y A;  1XB4 A;  2M30 A;  4U0V A;  3IHU A;  1Y0U A;  2EA4 A;  4KDP A;  4B8X A;  1YO5 C;  3K2Z A;  5KK1 A;  2RKH A;  2HOE A;  1BI1 A;  5E1X A;  2HTJ A;  1OYW A;  2CW0 F;  3TKY A;  1PP8 F;  4KN7 X;  5HDG A;  1W5S A;  2HQR A;  2IA0 A;  5LGU A;  3KP4 A;  1F5T A;  4ENJ A;  4DQ2 A;  2ZFW A;  4R79 A;  3I4P A;  3SFZ A;  4KIC A;  1S7O A;  4GGG A;  4U0W A;  3QPT A;  2ZBK A;  5D4R A;  2OAZ A;  2DK8 A;  5E8G A;  3BZ6 A;  4CXF A;  3C18 A;  2A07 F;  1W7P B;  3F8C A;  5HDN A;  1SMT A;  1KQ0 A;  3JSO A;  3VFZ A;  3PQK A;  4U7B A;  4ZZL A;  1UFM A;  4L9T A;  3TGN A;  3DXJ F;  3MZY A;  3CTA A;  2B0L A;  4CO8 A;  4RS8 A;  4PGH A;  4UVB A;  5ED4 A;  3TOB A;  3K1P A;  4BHC A;  2HKX A;  4M73 A;  5F64 A;  4YFX F;  5F6F A;  4ZZD A;  4OMZ A;  1HBX G;  2WC2 A;  1ZRC A;  3J80 K;  3OOP A;  4AD9 A;  4WXC A;  2XAF A;  3E6M A;  2UXX A;  3DFG A;  4HZF A;  2M5W A;  5DD4 A;  4WF2 A;  3SXY A;  1R7J A;  2E1C A;  2XVC A;  1ZHF A;  4HX8 A;  1TNT A;  2HDC A;  3IKT A;  2BEO A;  2Q2E A;  4P55 A;  2PLY A;  2LF8 A;  2QWW A;  1IRF A;  1R22 A;  5E1Z B;  2EFP A;  4O5V A;  3V8L A;  5HDK A;  1QNT A;  2Z9O A;  4BH9 A;  4AWX B;  1IN6 A;  2YU3 A;  4ESF A;  3KP2 A;  1YTY A;  3RJP A;  3P9K A;  3TDU C;  4A6E A;  2ZNY A;  4A5N A;  1XDS A;  2KIF A;  2BYV E;  5JFR A;  4RGX A;  4LMY A;  1ZRD A;  3WTW C;  1QBJ A;  4FX0 A;  4G9Y A;  2VBX A;  3W6K B;  1EH8 A;  1MJ9 A;  1BI3 A;  4A0Y A;  2G7H A;  5AIQ A;  3M8E A;  1V3F A;  4RAZ A;  4P9F A;  2XAG A;  4MQV A;  2EFW A;  1H9T A;  2JPB A;  2DK5 A;  3MWM A;  4OIR F;  1SFX A;  2EB7 A;  2FF4 A;  3S2W A;  1JXS A;  1TW2 A;  5L3F A;  1FBQ A;  2D45 A;  3WGI A;  3ZN0 A;  4PZJ A;  2VE8 A;  4M9Z A;  4Q48 A;  2XKP A;  2QLZ A;  4ENK A;  3VB2 A;  3VOD A;  3LAJ A;  1HST A;  2PQ8 A;  4MTD A;  2PI0 A;  3ZMS A;  2PMU A;  5JVT A;  2K4J A;  4ON0 A;  3FMR A;  2XV4 S;  1B59 A;  2VE9 A;  4CYD A;  3JAM K;  1FSE A;  5H6R A;  1XMA A;  2STW A;  1ON1 A;  4MEX F;  1TQI A;  4I0B A;  4P96 A;  4LG0 A;  1FBS A;  2RGV A;  3WTV C;  3MZH A;  3CUQ A;  4EGZ A;  1KU2 A;  4P5O A;  5JI6 A;  5LGN A;  4EGY A;  4UXN A;  5LRR A;  2DQL A;  4HA8 A;  4KN4 X;  1AWC A;  3M8F A;  5ILU A;  2M45 A;  3OV8 A;  2VOP A;  2V79 A;  2VBY A;  2QBY A;  5EEG A;  3LST A;  1GHC A;  2NS0 A;  1EH7 A;  1LVA A;  4I98 B;  2VOD A;  2ISY A;  3TO9 A;  2H6B A;  4RB2 C;  5A2Q Z;  1P6R A;  2KRF A;  1MDM A;  2LNB A;  5D5V B;  2GXG A;  1R1V A;  1IXC A;  1YFH A;  2JZY A;  3ZMT A;  1XCV A;  5FLX Z;  4LD5 A;  2DU9 A;  4BNC A;  2C6Y A;  2EJR A;  3SQN A;  3LA2 A;  4HYE A;  3WE3 A;  4O3M A;  3TO6 A;  2OBP A;  1FSH A;  2FU4 A;  3T8T A;  2Z33 A;  5E20 A;  2DFI A;  1RIO H;  2IP2 A;  1DPR A;  2ELH A;  5IT9 Z;  1STZ A;  1ZN2 A;  4UNO A;  3EUH A;  2HYF A;  2X0L A;  2IT0 A;  2DQR A;  2NRA C;  3KFW X;  4IHT A;  1JHF A;  1OKR A;  4OIO F;  1IN8 A;  2P4W A;  2YX7 A;  1GVJ A;  3H3Z A;  3WTU C;  1RUN A;  3ZMV A;  3O3K A;  1O7L A;  5D8L B;  3GFM A;  3V7C A;  4NB5 A;  2HYG D;  3HSR A;  3HSF A;  2HQN A;  2GA2 A;  4L9J A;  2NNN A;  3L9F A;  3GF2 A;  1SFE A;  3QU6 A;  1I1G A;  2HTS A;  4PCQ A;  2VC1 A;  1XCB A;  4U7D A;  1E2X A;  1O3R A;  3DV8 A;  1TQP A;  5CVI A;  3E6D A;  1DDN A;  4PGG A;  4HF2 A;  4Q5S F;  1KU3 A;  1HKQ A;  5F1R A;  1FZP B;  1WI9 A;  3FXU A;  5DCF A;  2GXB A;  4HQM A;  3FWE A;  1KU9 A;  3KZY A;  2DLL A;  1D8K A;  1G6N A;  3V7R A;  4ESB A;  4A0X A;  4WK8 F;  2D2W A;  4LFU A;  1HW2 A;  3RTR A;  2QZ8 A;  4NQW A;  1OYY A;  4BYY A;  1BN5 A;  3U2R A;  1ZAO A;  1K79 A;  2M8E A;  3BPV A;  1IXR C;  3TDZ C;  5DUI A;  2MLK A;  2E7X A;  3KEO A;  2P7V B;  2A61 A;  2DT5 A;  3RIR A;  3K69 A;  2QM3 A;  4HOB A;  2FE3 A;  3F3X A;  2P6S A;  5AIP A;  1S7A A;  1ZRF A;  3FMS A;  3TO7 A;  3NEU A;  4CZZ A;  3JW4 A;  2EV0 A;  3J7A O;  3ABU A;  2XAQ A;  4BHP A;  1B1B A;  2OU2 A;  3GO5 A;  1G3Y A;  1K7A A;  1HSJ A;  3ZN1 A;  4I2O A;  1Z05 A;  3HTS B;  2BV6 A;  4KT5 C;  4WWC A;  4KMF A;  2FEZ A;  3G3Z A;  2MH2 A;  1BC7 C;  4Y17 A;  1KU7 A;  4ASN A;  2V1U A;  3LA7 A;  2M87 A;  1KYZ A;  3O2P E;  3I53 A;  3FXQ A;  3M9A A;  2Z3Y A;  5DDG A;  3ZMU A;  4FX4 A;  5HLH A;  3ISP A;  2NYX A;  1HXD A;  3BJA A;  3QRF F;  2W84 A;  3O6B B;  3FX3 A;  5LHI A;  4EJT A;  2JPC A;  4DNC A;  4UV8 A;  4OMY A;  1G3S A;  2PBI A;  2H6C A;  5FFZ A;  2ETH A;  3TQN A;  5E18 F;  4LG0 B;  3GYH X;  2VOO A;  3CUQ B;  1IN7 A;  3HRU A;  4I02 A;  5BS6 A;  1P92 A;  2O6G E;  1I5Z A;  4HAM A;  4CDG A;  4M72 A;  4JK1 X;  2P7C B;  1BI0 A;  1O3Q A;  1BIB A;  1ZLK A;  4LB5 A;  2P5V A;  1USS A;  1K78 B;  1FP1 D;  4EJU A;  1MD0 A;  3DEU A;  3FM3 A;  2QBY B;  2W24 A;  3F8B A;  4Q47 A;  5DV5 A;  1J5Y A;  4KNY A;  4I09 A;  3G73 A;  4MEY F;  1T39 A;  1ON2 A;  3GUD A;  4S05 A;  2JSC A;  5D6E A;  4LLL A;  1QPM A;  1LDK B;  2FBI A;  1WRJ A;  2UWM A;  2RVC A;  4LLN A;  1MDM B;  2A68 F;  2X4H A;  2ESH A;  4IF4 A;  4HBL A;  5JHU A;  1P4W A;  5ILS A;  1XGM A;  1R00 A;  2QQ9 A;  2HGC A;  2IA2 A;  3F8M A;  2DW4 A;  2ESN A;  5D5U B;  1FYK A;  3ELK A;  4XLN F;  1XDU A;  3QP6 A;  2Y0M A;  3EQL F;  5L3D A;  3LAP A;  4HDU A;  3I64 A;  3L09 A;  2PMH A;  3ABT A;  1SD4 A;  1O3S A;  3WTS C;  1U6G A;  1Z7U A;  4GCV A;  4N0B A;  5FB2 A;  4HV5 A;  1FWZ A;  2Q0O A;  1R1T A;  4L9V A;  4ZYE A;  2CGP A;  1WKM A;  5BQT A;  3LQQ A;  3HRM A;  2EWN A;  4HW0 A;  4H0E A;  4CIC A;  2O8X A;  4LB6 B;  1F9N A;  5HS9 A;  1RZ4 A;  4XLP F;  1GXQ A;  3T8R A;  4HF0 A;  3U1D A;  2YR2 A;  4G7Z F;  3SZP A;  4XRF A;  1Z9C A;  3MEX A;  2K7L A;  1G3W A;  4BQA A;  2R7D A;  1YS7 A;  3K1N A;  3D0S A;  2HKO A;  1LEA A;  3IWZ A;  1J9I A;  5HLI A;  3DQV C;  3REO A;  1Z6T A;  4ZYD A;  1J0R A;  2RQP A;  5K5R A;  1ZGJ A;  3F23 A;  2V1X A;  3WU1 B;  4RGR A;  1Z1D A;  3PFI A;  3BJ6 A;  5HOO A;  3Q5F A;  5H20 A;  3F72 A;  2KIU A;  3F21 A;  3ROU A;  2HZT A;  4A0Z A;  3IRQ A;  4LLG F;  2VT3 A;  3ZMZ A;  4EM1 A;  1IF1 A;  3KLN A;  2RC4 A;  3JTG A;  1O7F A;  2EV6 A;  5BPI A;  2V6C A;  5FLX K;  1T0F A;  4L5I A;  1KYW A;  4KA4 A;  3KLO A;  5K5Q A;  1C0W A;  3CUQ C;  5K1Y A;  3J80 Z;  3DP7 A;  5LHH A;  2ACJ A;  1L3L A;  3E5Q A;  5CVU A;  1TW3 A;  2OQR A;  2BE5 F;  1IZ1 A;  2MLG A;  3V7S A;  2H27 A;  5IT9 K;  1KA8 A;  3HUG A;  4XBF A;  1VTN C;  4BHB A;  2RV8 A;  2GWR A;  1R1U A;  3MQ0 A;  1NHA A;  1ZG3 A;  3KP5 A;  4M6X A;  1BC8 C;  4F7Z A;  1KGS A;  4O6J A;  2MC3 A;  3QU3 A;  1LJ9 A;  3ZMD A;  2QEN A;  4LK0 F;  4QWQ A;  2CYY A;  3T0Y A;  4OIQ F;  3WU0 A;  2CWE A;  1WSU A;  3CO7 C;  2FA5 A;  1K78 A;  2IVM A;  1T2K A;  1LNW A;  1E17 A;  3C1D A;  3PQJ A;  1H9G A;  2OQG A;  1W4M A;  2CG4 A;  3R60 A;  1ZRE A;  1R58 A;  1TNS A;  2FBK A;  1FLI A;  3Q9V A;  1UST A;  4I01 A;  3W6J B;  2IPQ X;  4UVA A;  1QGP A;  4GXO A;  3I54 A;  2F5F A;  1QZY A;  5K5O A;  2STT A;  2PG4 A;  1UB9 A;  1KQ9 A;  3EYY A;  4G6Q A;  2QQB A;  5J6X A;  2EFO A;  1HW1 A;  4Y13 A;  4IXA A;  4U88 A;  3R61 A;  2VBW A;  3LFK A;  3RYP A;  1JE8 A;  3WE2 A;  3WTZ A;  4U0Y A;  5DCM A;  5E1W A;  3M1E A;  2O3F A;  3GFJ A;  2HEO A;  2L3D A;  2ZNZ A;  3VEP A;  4WXD A;  2AXL A;  2DPU A;  3E6B A;  1SAX A;  4YII A;  1G4D A;  1UCR A;  2XAH A;  2XAJ A;  3P9C A;  2JRT A;  5FGM A;  2R3S A;  2G7U A;  3DKW A;  1FYM A;  1ODD A;  3B02 A;  5LHG A;  2FRH A;  2HS5 A;  1D3Y A;  1HW5 A;  1ZG1 A;  2A6E F;  4P9U A;  2D1H A;  5JR3 A;  2FXA A;  4I7H A;  5L3E A;  2A6H F;  3LWF A;  4E70 A;  4IRG A;  4HLY A;  4ZH4 F;  3IL2 A; 
#chains in the Genus database with same CATH topology
 4G6D A;  4CSW A;  1FYL A;  1H8A C;  2W48 A;  3E6C C;  1UG0 A;  1PUE E;  2CFX A;  4F91 B;  2R7W A;  1ZKG A;  2HVR A;  2QVO A;  1RNL A;  3BDD A;  2LG4 A;  3M1C A;  2AQF A;  2VXD A;  1Z7L A;  2X6Y A;  2EFN A;  3GFL A;  2H1L A;  4DOZ A;  1JJ8 C;  4OU0 A;  1OIS A;  2H8R A;  2VON A;  3JRI A;  2MAB A;  2FBH A;  4IZZ A;  2JT1 A;  1SD5 A;  5FLM J;  1VQ8 I;  2R5Y B;  5BPD A;  1ZG5 A;  1BR2 A;  1IUY A;  1FNN A;  2BGC A;  4BBS J;  1TBX A;  3HOS A;  3FHZ A;  4MO7 A;  2YX4 A;  3R6S A;  3CCV I;  3OYI A;  5CYV A;  2VXZ A;  2IRF G;  2L01 A;  4XRM A;  3RPQ A;  2M8G X;  3DTI A;  3ZQH A;  4FTH A;  1LE8 B;  2YUS A;  5FFX A;  4B48 A;  3FF5 A;  1XPX A;  5CVV A;  1XGS A;  3BR6 A;  3EET A;  1D0X A;  3AG2 H;  3J81 K;  3S1M J;  2HOA A;  1YW8 A;  1MMA A;  1MH4 A;  3G71 I;  5TRD A;  2ADU A;  1I1S A;  4G7H F;  2X1D A;  4S04 A;  4XOR A;  4ESJ A;  2LH9 A;  2MA3 A;  1QZZ A;  1N78 A;  3AL0 B;  3NAR A;  1Q1V A;  1DQU A;  3H35 A;  4XMY A;  4B4C A;  4UUS B;  5M5X J;  2KJC A;  5D6F A;  3WTT C;  5FD6 A;  3F6O A;  1U5T A;  4IRI A;  1SFU A;  2KMU A;  3K9T A;  4UHT A;  4G94 A;  3I5U A;  4I99 C;  1IUF A;  3RKY A;  2FNP A;  1XSD A;  5HLT A;  2EBI A;  1H88 C;  5CVR A;  4TV7 A;  3F22 A;  1ZGW A;  2P0W A;  2GA1 A;  3FXK A;  2H8W A;  3GLL A;  3NQO A;  3QPL A;  4HSR A;  4PJJ A;  3U1K A;  4F92 B;  5B1A H;  1HQC A;  4G7O F;  3L2W A;  4BS9 A;  1FMV A;  3OR1 C;  3CQZ J;  5J8C A;  2DAO A;  3I56 I;  4XLF A;  3PIP F;  2ZXJ A;  1TTY A;  2FNA A;  1OCZ H;  1T33 A;  4RGS A;  2R7R A;  2A3S A;  1O4X A;  1JTY A;  4GYI A;  1R9T J;  1WJA A;  1R23 A;  4IPA A;  2WA0 A;  1X3U A;  2M7B A;  4Y7N J;  2PN6 A;  4RBO A;  3OYB A;  1ENH A;  4Y15 A;  4MHG A;  1LFP A;  2L02 A;  3S16 J;  3NRV A;  5H2F C;  2VJ4 A;  3FZV A;  5C3E J;  3DPT A;  1PUF B;  2K9L A;  3X2Q H;  4HF1 A;  2NNY A;  5E17 F;  3LSK A;  1VF9 A;  1Z21 A;  2VC0 A;  3FK6 A;  1PDN C;  4KIF A;  3T5X A;  4KIG A;  3ZXS A;  4C3I J;  1DUX C;  3BY6 A;  4HEA 2;  5TIS C;  4NHJ A;  3WGG A;  3AAF A;  4G12 A;  1BOA A;  4II3 A;  3E1S A;  2BBY A;  2Z2S B;  2L0K A;  4EJV A;  4A93 J;  3BTI A;  2E7W A;  2RDP A;  3HSE A;  1LDJ A;  2P5L C;  3D5R C;  2JJ7 A;  3KP7 A;  1LQ1 A;  1JKP C;  3E5X A;  4IO9 F;  1IC8 A;  1MND A;  2RAE A;  4DJA A;  1IXS B;  1IN5 A;  4GO1 A;  4ZTF A;  3M7G A;  1OMI A;  2DPD A;  1B6A A;  4L0Z B;  3UR3 C;  2JTV A;  1HDP A;  1LDD A;  2OPT A;  4RAF A;  3VYT B;  3V4G A;  4KMU X;  1ERD A;  2MD5 A;  2RQQ A;  2WTE A;  1Q1H A;  3L7W A;  2LK2 A;  4FE7 A;  4AVP A;  1YJN I;  3WG9 A;  4Y4R A;  3JRB A;  3GW2 A;  2P8T A;  2ECB A;  1HKT A;  2WBM A;  4HLX A;  4LJZ F;  5FRM A;  2VJJ A;  1LUJ B;  1QVT A;  1P4X A;  2Y31 A;  3AFH A;  3I58 A;  1BI2 A;  2HNH A;  2QYO A;  3TL4 X;  4Y33 A;  1BIA A;  3OSG A;  1VQK I;  1FC3 A;  3CMA I;  3C3W A;  4LIU A;  4M3E A;  4LIT A;  4XOP A;  1R6R A;  3HGG A;  4X0G A;  2EZH A;  2DOA A;  4UB8 C;  3CO6 C;  4IOA F;  1LEB A;  5ERI A;  5KNL A;  4RA2 A;  1X58 A;  2R5Z B;  4Q4Z F;  4IRH A;  1PVE A;  3VDX A;  2XGE A;  4RMN A;  1VI0 A;  1J7K A;  1YW7 A;  3GTQ J;  3PM1 A;  3KEQ A;  1P7J A;  3R0A A;  3DPL C;  2VN2 A;  4YEJ A;  1FIP A;  5JLX A;  2Z99 A;  2CQN A;  3E5U A;  2XB5 A;  2M1B A;  3WTY C;  1I27 A;  2NS8 A;  5IYB J;  2KIQ A;  3M3Y J;  4BDZ A;  3CDI A;  2AXT C;  2F6C A;  5LEJ A;  3L2C A;  2ZO4 A;  3ZP5 A;  2E5N A;  4XQF A;  4HLY A;  3W2V A;  2L54 A;  1T6S A;  4H4K C;  5KHD A;  1SVM A;  1ZAR A;  1EH6 A;  4B44 A;  2VT2 A;  5GAD J;  1YQA A;  4IKF A;  1HA8 A;  2JRM A;  3I59 B;  1BJA A;  1MBE A;  2K86 A;  1RUO A;  2F5C A;  2Z1D A;  1SD6 A;  2MD0 A;  4NC7 A;  3BZK A;  1S72 I;  3S14 J;  4IJA A;  2ZJ2 A;  2CFO A;  2X1E A;  4DBQ A;  4OIP F;  2ID3 A;  2PJP A;  2KL4 A;  2K9S A;  2Y30 A;  1OR7 A;  3DPU A;  4BDY A;  1IDY A;  5D4S A;  3IKV A;  2VBZ A;  1V4R A;  5L3B A;  4GDF A;  4EM0 B;  2XKO A;  2QUF A;  3GME A;  1LVK A;  3CLO A;  4A2U A;  2FQ3 A;  4EMS A;  2VKD A;  4UY8 I;  2RNJ A;  1VQ9 I;  3EUK L;  3CLQ A;  5IT3 A;  2IS2 A;  1APL C;  3K4C A;  5DD8 A;  2GM4 A;  4DYQ A;  4QLC U;  2AO9 A;  2DA2 A;  3RYR A;  1K4S A;  4F93 B;  2DTR A;  3RKW A;  2A5Y B;  2XRO A;  5DCM B;  2XAU A;  4B43 A;  2HOS A;  3K4B A;  4A3M J;  3IC7 A;  4R8H A;  1U3E M;  3LSI A;  2OZU A;  3R4K A;  1UHM A;  5ICG A;  3RDI A;  2MH9 A;  4HQE A;  2KLO A;  2F5E A;  2PJR B;  4PDK A;  5BNG A;  3M07 A;  3BR0 A;  2NVT J;  2GZW A;  3VSK A;  2R7U A;  3RPU A;  1D1B A;  1VFC A;  4JQF A;  2KQR A;  2LR8 A;  4HX7 A;  3KZZ A;  1JKR C;  1JUM A;  2W7N A;  2JN6 A;  1W5T A;  2XRN A;  4LK1 F;  2PFB A;  5LFA A;  1U9O A;  2A69 F;  2ECC A;  3G6E I;  1X1A A;  2E2I J;  1SVL A;  2W4S A;  3VYU B;  2OZ6 A;  4MTE A;  2VKH A;  3ZGK A;  3HRS A;  1EJ9 A;  4M9X A;  1YJW I;  2A05 A;  2BY2 A;  5EG0 B;  5FLV A;  1R36 A;  6PAX A;  3T1B A;  2D1V A;  3I71 A;  3BRO A;  1XGN A;  2FX0 A;  1TT0 A;  2F2E A;  3CUO A;  3OYH A;  1TWF J;  3V8K A;  1LE8 A;  1QQI A;  1OFC X;  3HG9 A;  2EIN H;  3QWL A;  3ZQI A;  2MBF A;  2PMZ N;  1JHH A;  3F8N A;  3V8J A;  1JT0 A;  1K6O A;  4OIN F;  3DLL F;  2OA4 A;  4IHS A;  3A0B C;  2ZME A;  4JBA A;  2O7O A;  1J75 A;  5D8K B;  5J1Y A;  4M6Y A;  1U2W A;  1NK2 P;  9ANT A;  4HNU A;  2Y0S N;  2HU9 A;  4KUM A;  3JR9 A;  2JA5 J;  4XSZ F;  3VOE A;  5LRS A;  1IRG A;  3FXR A;  1YIO A;  2V9V A;  2TCT A;  2DI3 A;  3FKJ A;  1FX7 A;  1ULY A;  1WWX A;  2COM A;  3CES A;  4IVN A;  4PFO A;  2CV2 A;  3BQZ A;  5TJJ A;  3GTP J;  1KQ8 A;  5FD5 A;  4DYR A;  4ABZ A;  4UUS A;  1AKH A;  1FT9 A;  3ABK H;  3GEZ A;  5D5W B;  4HV6 A;  2QF7 A;  3HRT A;  3JTH A;  1B72 A;  4CGZ A;  2G9W A;  3HTU A;  4N4O B;  2W57 A;  2M34 A;  3BOQ A;  1FY7 A;  2W1O A;  3ZQQ A;  2JA6 J;  5CJ9 A;  3BTJ A;  2CMP A;  2R7O A;  4UV9 A;  4XN0 A;  4A6D A;  1U78 A;  1N77 A;  4L9N A;  3I4M J;  3S1Q J;  1M1E B;  3HEF A;  2EPF A;  2XF6 A;  2UXN A;  3H3U A;  2JSP A;  1SMY F;  1IGN A;  5HLG A;  4EQQ A;  5GPA A;  1T0F C;  5EGO A;  3Q9S A;  2IA1 A;  2WB1 N;  2XAS A;  4XN3 A;  4RB0 A;  2ZXW H;  1JT6 A;  4D7M A;  1MGT A;  4IQJ A;  1OCP A;  2FD5 A;  2RRE A;  1XN7 A;  5AON A;  3GTJ J;  1XSV A;  5A2Q K;  2BY0 A;  2E35 A;  2BZT A;  3C7J A;  4MNU A;  3QPH A;  3GX4 X;  3UKG A;  3BWG A;  3DF8 A;  2JVG A;  2E1N A;  5DYM A;  2OTJ I;  1XD7 A;  3H9J A;  1PUF A;  5CVJ A;  4DGW B;  2EIM H;  1OYI A;  4WCG A;  4A3C J;  4ZYG A;  4PJM A;  1U5T B;  2R4G A;  2F48 A;  2LC2 A;  3HOV J;  2L4M A;  4XLC A;  4BY1 J;  2KHM A;  1MJB A;  2QQA A;  4ZC3 A;  4BQQ A;  2VL8 A;  3GLX A;  4WXH A;  5D5X B;  1S8N A;  4AIK A;  4A5M A;  2Y48 A;  3CCS I;  2QQ8 A;  4QPO A;  1MNE A;  3CP8 A;  4AU7 A;  3GVA A;  3K6G A;  5DM7 F;  1CF7 B;  1HLV A;  5HVQ C;  2Y75 A;  3HJE A;  4C3J J;  1S3J A;  3ZQC A;  1NG7 A;  3IH4 A;  2ZKZ A;  1MBJ A;  3H36 A;  1VZ0 A;  1G3T A;  3QOP A;  4EVI A;  1WHU A;  4L5J A;  5HS8 A;  2K4B A;  5J3L A;  4W1U A;  3C2G A;  3HOU J;  3PO2 J;  3HOT A;  4A3I J;  4B1R A;  4XSX F;  3H5R A;  3ECH A;  2HR3 A;  1VQN I;  3QYB A;  3C2B A;  2Y9Z A;  3DEE A;  2LF7 A;  3HBL A;  2LOO A;  4BJ6 C;  3KP6 A;  2WWY A;  5EEA A;  3FMQ A;  1DPU A;  2PMZ A;  2WAQ N;  5F1J A;  3S1R J;  2O03 A;  2R7F A;  3IH3 A;  2VJI A;  1E3O C;  5L3G A;  5FKL A;  1MBK A;  4HX4 A;  5C44 J;  1YRN A;  3BP8 A;  2KRH A;  1QVU A;  2FOK A;  2QSF X;  4PJL A;  4DIQ A;  4E6K G;  1F36 A;  2J5P A;  2LKP A;  2PX9 A;  5IYD J;  2XGX A;  4HRI A;  3F8F A;  3CDH A;  3CF5 F;  2Z5U A;  4L5E A;  4I76 A;  1R5I D;  2IGM A;  3HXL A;  3PL8 A;  3JRH A;  3IRR A;  4CHU A;  3E0J B;  2CJJ A;  2L9V A;  1U8B A;  4M9S A;  1FP2 A;  4B09 A;  3K4J A;  3JRE A;  3A0H C;  3KP3 A;  3ERE D;  1WJC A;  2FUG 2;  1Z6R A;  5LLQ A;  1V55 H;  1N25 A;  4PSX A;  3K0L A;  4A3F J;  2CSO A;  2JA2 A;  2CH0 A;  3MAJ A;  3GZ6 A;  3BZC A;  4XON A;  2DJI A;  4B3A A;  3KYD B;  2CUZ A;  2FMY A;  2XPW A;  2BW3 A;  3TW6 A;  4CCM A;  2KJB A;  5EZH A;  3RPU D;  3QP5 A;  4A3D J;  2O61 A;  3HM5 A;  3ESW B;  2PEX A;  2E71 A;  5CQE A;  2M4G A;  4KIB A;  3RI4 A;  2W85 A;  3TW7 A;  3I59 A;  3LFU A;  3VWB A;  3I4N J;  3HYI A;  1XSX A;  1E3P A;  3MKZ A;  3GFI A;  2HZD A;  4B3X A;  5LEK A;  3IAM 2;  3KX2 A;  4YIR X;  2XHK A;  3ECO A;  2OJE D;  3GTO J;  3HOZ J;  3JRD A;  2JVH A;  1MMD A;  4D1Q A;  3F6V A;  1U8R A;  1P2F A;  2LDU A;  5FJ8 J;  5FKO A;  1R5H A;  4AIH A;  1OPC A;  2IW5 A;  5F04 A;  4M71 A;  1RR7 A;  4BXU A;  3FKI J;  4N9I A;  5CPR B;  4CCO A;  1IN4 A;  4M74 A;  4RB3 C;  1XGO A;  1BM9 A;  1ZH5 A;  1SAU A;  1LPQ A;  1X1P A;  1W7P A;  1F1Z A;  2ZJR F;  2OCC H;  3EPZ A;  1QZE A;  4UUT A;  2XRL A;  3AG3 H;  1CGP A;  3JCU C;  1DP7 P;  2CQK A;  3N4M A;  4RDU A;  3K1M A;  2HVQ A;  4KYW A;  1XG1 A;  4EV0 A;  2WV0 A;  1S29 A;  4E7L A;  1HOM A;  1D5V A;  4YFN F;  4IHX A;  3OMY A;  2BY1 A;  1ZEL A;  3SEQ A;  3HPG A;  1A04 A;  1BL0 A;  4EJO A;  3FIW A;  2XIG A;  2V9P A;  1N75 A;  2FSW A;  1XTA A;  1Y0N A;  1JJ6 C;  3ABM H;  4CZC A;  3WGH A;  1S7E A;  2GOX B;  2FQ4 A;  2IAI A;  1ZGA A;  3P7N A;  3MFK A;  2K02 A;  3Q0V A;  3U9G A;  4WX9 A;  2CQ7 A;  3JAM Z;  3LSP A;  3BPX A;  3WOD F;  1X1C A;  2HWV A;  4I0A A;  5EG0 A;  1JGS A;  1G8X A;  2TDX A;  1OLT A;  1FJL A;  4YRV A;  1MMG A;  1D0Z A;  2H94 A;  2WAF A;  3I55 I;  3PUF A;  3RKX A;  1O57 A;  2YS9 A;  1WJB A;  2NXN B;  2LY1 A;  2BHY A;  2MSY A;  2P5K A;  3GBG A;  3GWZ A;  5L3C A;  3CF2 A;  3GTK J;  1ZLJ A;  1XS9 A;  3OYJ A;  2BY3 A;  2RN7 A;  1VQ4 I;  1EV7 A;  2XPV A;  4E7Z A;  2EFQ A;  2Q1Z B;  3QAH A;  2UZK A;  4RB1 A;  2R0Q C;  4BE2 A;  1TQM A;  4XKW A;  3W2W A;  3RCO A;  2KRC A;  5ICF A;  3OWT A;  4RGU A;  2IBD A;  4MQ9 F;  3EYI A;  4GFB A;  5E8I A;  2K9M A;  5BOX A;  2VAS A;  4A3K J;  4A3G J;  2IGO A;  3CZ6 A;  4XOT A;  2K27 A;  1TLH B;  3FHN A;  5LGT A;  3LQR A;  4AIJ A;  1GXP A;  3KCC A;  3HHH A;  3ML6 A;  2YPR A;  1ZR2 A;  3DKX A;  3HIF A;  4MGR A;  4ETS A;  3D5L A;  2V9K A;  2KDO A;  5ICC A;  1U5T C;  1QO0 D;  2L9S A;  2HFH A;  4J01 A;  4UUV A;  4F52 A;  2DTZ A;  1YOV B;  3E97 A;  1Z91 A;  3LA3 A;  2IGN A;  1SD7 A;  2ZCW A;  3QYF A;  4CCJ A;  3G1M A;  2KKO A;  1UHW A;  2IJL A;  2EA2 A;  2DMT A;  3WHC A;  4K2E A;  1HKS A;  1T98 A;  2KIS A;  1D1C A;  2LKX A;  2IS4 A;  2ELJ A;  3TOA A;  2ZME B;  3BG6 A;  1TC3 C;  5GAG J;  2LSO A;  4CCL A;  3H0D A;  1HF0 A;  4BJ5 C;  5BMZ A;  3IH2 A;  5FO5 A;  1OCR H;  3ZPL A;  4HDV A;  3OYF A;  1YG2 A;  2KIM A;  1IW7 F;  2ME6 A;  3EDP A;  3ULQ B;  2KDZ A;  4ENN A;  4G8X A;  1D1A A;  1IAW A;  3COA C;  2LD5 A;  1MJA A;  1AKH B;  3B73 A;  2L7Z A;  2DOE A;  5J8F A;  1FBU A;  4IHY A;  3KE2 A;  2L4A A;  4L0Y B;  4W97 A;  4BL0 B;  1S6L A;  2LP0 A;  1B72 B;  4D5F A;  2R7S A;  4E7S A;  5C4J J;  4KFC A;  3QPS A;  2K3F A;  4UVC A;  5HNH A;  2JA7 J;  2HXI A;  3SFI A;  3BJO A;  3H9G A;  3H1C A;  3CDL A;  4V2G A;  5HS7 A;  3OYM A;  1UG2 A;  1FOK A;  1PP7 U;  2NVX J;  1P4A A;  3HDD A;  4YEL A;  2W25 A;  1YHQ I;  1WH7 A;  5CLS A;  2CO5 A;  4EJW A;  5EEH A;  1MKM A;  4Z2Y A;  1CF7 A;  2GAU A;  4FE4 A;  1JI8 A;  4II2 A;  4R1H A;  5EGO B;  2R7V A;  2MYS A;  1ZR4 A;  2P6T A;  3H92 A;  1T95 A;  2V1D A;  3BTC A;  1TWC J;  4ZYH A;  5B5E C;  2EK5 A;  1BW6 A;  3ZQ7 A;  2DYS H;  1F4K A;  3DTK A;  2FML A;  1VQ6 I;  2GIV A;  4BJT A;  4YFK F;  1YS6 A;  3DU6 A;  2L7K A;  2N8G A;  4BY7 J;  3S93 A;  1ONV A;  1WGX A;  2XUB A;  1R71 A;  1IRZ A;  5ICE A;  2DA4 A;  2ELK A;  1OCO H;  4N9H A;  3N97 A;  3MCZ A;  3B6A A;  3WTX C;  5EZG A;  4RAY A;  2LRD A;  4LGW A;  2VKV A;  3OIO A;  3I0T A;  5E3L A;  3CJN A;  4YG2 F;  3PSF A;  1MW7 A;  5H6Q A;  1L0O C;  5IPA A;  2HI3 A;  1T8I A;  2GQQ A;  3K4K A;  2AS5 F;  3GZ5 A;  1WI3 A;  1J2X A;  3OIQ A;  3R0J A;  2E19 A;  4GYG A;  2J5O A;  1ZK8 A;  3K7A J;  1D8J A;  2OD5 A;  2F5D A;  1AOY A;  1YLF A;  5E3M A;  1X3Z B;  3LSJ A;  2Q8K A;  1REP C;  3LMM A;  1LB2 A;  1FOY A;  1O3T A;  3BLY A;  1RI7 A;  2LBF A;  2H09 A;  1R5G A;  1GV2 A;  2COB A;  3OYN A;  3E3V A;  4FT8 A;  2EV5 A;  5LBQ A;  3MD2 A;  1NTC A;  2MW8 A;  4BKX A;  2GXA A;  4E7K A;  1B9M A;  1W7P D;  3KET A;  5IP9 J;  4OOI A;  2M3A A;  5DUK A;  3P9I A;  3JSP A;  5DEQ A;  3KYC B;  2DO7 A;  4ENM A;  1B9N A;  5E3N A;  2NAZ A;  1Y8Q B;  4D0P A;  5IOY A;  5J1R A;  1YW9 A;  3IWF A;  1Y6I A;  2LYC A;  1UEL B;  3SJM A;  3SHF A;  1SFK A;  4Z6Y A;  2QCO A;  3EUA A;  5ILV A;  1EKE A;  4EM2 A;  1NH3 A;  2YSR A;  4L18 B;  1NG6 A;  1YRN B;  1GLN A;  1WQ2 A;  1YYV A;  1K6Y A;  1B4A A;  3J81 Z;  1H0M A;  2EQR A;  3CCY A;  3SZT A;  1FOW A;  1I6X A;  3WG7 H;  1ZYR F;  5KVR A;  3HHG A;  4D7N A;  4AYB N;  3WU2 C;  2VQC A;  2DBB A;  3L00 A;  1T38 A;  2H1K A;  4FHT A;  3W6V A;  1FOX A;  4S0H B;  4BQO A;  1BBY A;  1ORK A;  1XMK A;  1FPQ A;  3J7Y J;  1OR7 C;  1IDZ A;  3HZJ A;  1J59 A;  1EA3 A;  4A12 A;  2NOG A;  3GXO A;  5F27 A;  3OIP A;  1RKT A;  3FK7 A;  2ISZ A;  3GTM J;  3TP0 A;  2OV7 A;  1MZB A;  4YIF A;  2O0Y A;  2BW3 B;  2XSJ C;  1XB4 A;  2DDB A;  2VQH A;  2M30 A;  4U0V A;  3IHU A;  1Y0U A;  4C3H J;  2EA4 A;  3LSM A;  4KDP A;  4B8X A;  4HNT A;  1YO5 C;  3K2Z A;  2D5V A;  5KK1 A;  3CCR I;  2RKH A;  2HOE A;  1BI1 A;  4PK4 A;  5E1X A;  2HTJ A;  4U87 A;  3S32 A;  1OYW A;  2CW0 F;  2W82 A;  5M3M J;  3TKY A;  3DTE A;  1FMW A;  5HOD A;  4ZDL A;  1PP8 F;  4KN7 X;  2DFF A;  5B3S H;  5HDG A;  1W5S A;  2HQR A;  1MBH A;  2IA0 A;  3KP4 A;  5LGU A;  1F5T A;  4ENJ A;  3A2K A;  5GAH J;  4DQ2 A;  2ZFW A;  4R79 A;  4RM2 A;  3I4P A;  3SFZ A;  2ZC2 A;  4KIC A;  1UAA A;  2VUM J;  1S7O A;  4ANJ A;  4GGG A;  4U0W A;  3QPT A;  1J09 A;  4IHW A;  4KJZ A;  1A31 A;  1XX5 A;  2JQ7 A;  2ZBK A;  4FET A;  4ZYA A;  5D4R A;  2OAZ A;  3LNQ A;  2DK8 A;  5JVG F;  5E8G A;  3OR2 C;  3BZ6 A;  1MBG A;  4BE0 A;  1GDT A;  4CXF A;  3ZQL A;  3C18 A;  2A07 F;  2VQG A;  1W7P B;  3F8C A;  5HDN A;  1SMT A;  1KQ0 A;  2M7A A;  3JSO A;  3PNV A;  4M6V A;  3VFZ A;  1GUU A;  3PQK A;  4U7B A;  2V6E A;  4ZZL A;  1UFM A;  3SDB A;  4L9T A;  3FIS A;  3TGN A;  3DXJ F;  4AC0 A;  2XC7 A;  1VQ7 I;  3MZY A;  3HGY A;  3CTA A;  2B0L A;  3B6C A;  3PSI A;  4CO8 A;  1Y1W J;  5E3O A;  3OOU A;  5B66 C;  2R7Z J;  2ZME C;  4RS8 A;  4PGH A;  4UVB A;  1UZC A;  3TOB A;  5ED4 A;  2M0M A;  3J7Z I;  3A02 A;  3K1P A;  4BHC A;  1WZ2 A;  3AL0 C;  3FXJ A;  3DU5 A;  2V4J C;  2HVS A;  2HKX A;  1YJ9 I;  2E60 A;  4M73 A;  5F64 A;  4YFX F;  3PIO F;  5F6F A;  4ZZD A;  4OMZ A;  1HBX G;  3L2Q A;  2WC2 A;  1ZRC A;  3Q0U A;  1ETW A;  1V5E A;  4HST A;  2X6W A;  3J80 K;  3KIO A;  1ZQ3 P;  2EIK H;  1X4O A;  3OOP A;  4AD9 A;  3BR5 A;  2K5C A;  4WXC A;  4C9Y A;  2XAF A;  2R7X A;  3E6M A;  2HPI A;  2UXX A;  2CUF A;  2Y69 H;  1K83 J;  3DFG A;  1YIJ I;  2MC4 A;  4QSH A;  4HZF A;  3U21 A;  3HB9 A;  1HC8 A;  2M5W A;  4AYB A;  1JKO C;  5M3F J;  5DD4 A;  4WF2 A;  3SXY A;  1R7J A;  3OYD A;  2E1C A;  2M2E A;  2XVC A;  1ZHF A;  4HX8 A;  1QA6 A;  1TNT A;  2HDC A;  3BG5 A;  2DFE A;  2BEO A;  2K40 A;  2V7F A;  3IKT A;  4BXX J;  2Q2E A;  4P55 A;  3WHB A;  2PLY A;  2HXO A;  2LF8 A;  2XPU A;  3CMY A;  2QWW A;  1IRF A;  1R22 A;  3QOD A;  5E1Z B;  2EFP A;  5F0H A;  4O5V A;  1IG7 A;  3V8L A;  3BC8 A;  5HDK A;  2YU9 J;  1QNT A;  4XID A;  2Z9O A;  1OQY A;  2JMW A;  1WPK A;  4BH9 A;  2DOD A;  1ETV A;  5FKK A;  4AWX B;  2K85 A;  1IN6 A;  2OUM A;  2YU3 A;  4ESF A;  5JLW A;  3KP2 A;  2OF7 A;  2JUG A;  3CC2 I;  1YTY A;  1YIT I;  3RJP A;  3PJR A;  4CCN A;  3V42 A;  3CCE I;  1BA5 A;  3BG3 A;  3FXO A;  3P9K A;  2K9Q A;  3TDU C;  4NNJ A;  4BE1 A;  4A6E A;  1P9Q C;  1WJF A;  2ZNY A;  2ZXI A;  4A5N A;  4MIM A;  5GAE J;  1XDS A;  1QHG A;  2KIF A;  3F0C A;  2BYV E;  5JFR A;  4RGX A;  2IS1 A;  3CCQ I;  3JRC A;  4LMY A;  1ZRD A;  2K3P A;  4NC8 A;  3WTW C;  1QBJ A;  4FX0 A;  4G9Y A;  2EZL A;  1VQO I;  2VB6 A;  2VBX A;  3W6K B;  1EH8 A;  1F43 A;  4G6T B;  1MJ9 A;  1BI3 A;  4A0Y A;  3HOY J;  2G7H A;  4RAG A;  5AIQ A;  3M8E A;  2L7M P;  3HC7 A;  1VQL I;  1V3F A;  2E1O A;  4RAZ A;  4P9F A;  2XAG A;  1LFB A;  4RM3 A;  2VQL A;  4MQV A;  2EFW A;  1DU6 A;  1R4N B;  2EIJ H;  1H9T A;  2JPB A;  2DK5 A;  3S1N J;  3MWM A;  3VYR B;  4OIR F;  4BXF A;  1SFX A;  3H3V K;  1QHH D;  2EB7 A;  2FF4 A;  3S2W A;  3S2D J;  1JXS A;  1TW2 A;  1A6Q A;  5L3F A;  4XIC A;  4X6A J;  1FBQ A;  1QU3 A;  1TT5 B;  2XDV A;  2ZJQ F;  3J7A Y;  5GTI C;  2CV1 A;  5KCM A;  4EAT A;  2DA7 A;  2X6O A;  2D45 A;  3WGI A;  2EZK A;  3ZN0 A;  1ACI A;  1D5Y A;  3VYS B;  1VQM I;  3S8P A;  4PZJ A;  2VE8 A;  1TZL A;  4E7J A;  4M9Z A;  4Q48 A;  2XKP A;  2QLZ A;  4BUP A;  4DZJ A;  5J47 A;  4ENK A;  3VB2 A;  4BEH A;  2LLK A;  3VOD A;  3LAJ A;  2L9N A;  1HST A;  2PQ8 A;  2DDA A;  4HPQ A;  4MTD A;  2PI0 A;  1SVO A;  2BXZ A;  2BVM A;  3ZMS A;  2PMU A;  5JVT A;  2K4J A;  4ON0 A;  3FMR A;  2R7Q A;  2XV4 S;  1B59 A;  2VE9 A;  2Y0S A;  4CYD A;  3JAM K;  1FSE A;  2CRG A;  2XSD C;  5H6R A;  1XMA A;  2STW A;  1ON1 A;  4PFP A;  4MEX F;  4LG3 A;  2LBF B;  3BCA A;  1RR8 C;  1TQI A;  4I0B A;  4P96 A;  2CU7 A;  1FEX A;  4F55 A;  4LG0 A;  1FBS A;  4RLF A;  2RGV A;  3WTV C;  3MZH A;  3CUQ A;  4EGZ A;  1KU2 A;  2E2J J;  3OL3 A;  2G0E A;  4P5O A;  3QOE A;  5JI6 A;  5LGN A;  3KYL A;  4EGY A;  4UXN A;  5LRR A;  3IAS 2;  1RKW A;  2DQL A;  5B1B H;  1TWH J;  2E36 A;  4HA8 A;  3K70 D;  4KN4 X;  2VIX A;  2DJN A;  1AWC A;  1ETQ A;  3M8F A;  4IX7 A;  5EYR A;  2V26 A;  1X4P A;  4M3D A;  5DS9 A;  5EDN A;  5ILU A;  1X1D A;  4A3B J;  2M45 A;  3OV8 A;  2A6T A;  2VOP A;  2V79 A;  2VBY A;  3MZ8 A;  2DMN A;  3LST A;  4XL9 A;  5EEG A;  5HNF A;  3IV5 A;  2QBY A;  1GHC A;  2NS0 A;  2WB1 A;  1EH7 A;  4EEF G;  4UB6 C;  1LVA A;  4I98 B;  4M3F A;  3AG1 H;  2ISY A;  2VOD A;  4ZTJ A;  3TO9 A;  2H6B A;  3ZQG A;  4RB2 C;  1X3W B;  5A2Q Z;  1P6R A;  2DA6 A;  2KRF A;  2RNG A;  3ZQF A;  3RKQ A;  3DBH B;  1MDM A;  2LNB A;  5D5V B;  3H5A A;  1Y56 A;  1MMS A;  4IOC F;  5J1U A;  2VPL A;  5FRN A;  2GXG A;  4IHV A;  4J19 A;  1R1V A;  2GIZ A;  1IXC A;  3ONQ A;  1YFH A;  1B8I A;  2BVL A;  1UHS A;  4XKB A;  2GLO A;  2JZY A;  3K4L A;  3ZMT A;  2QSG X;  1XCV A;  5FLX Z;  3CCL I;  2DCE A;  3I9V 2;  2OTL I;  4LD5 A;  1SFO J;  2DU9 A;  3MVP A;  2VI6 A;  1MIJ A;  2QKL B;  2QEX I;  1YX5 A;  2EJR A;  3SQN A;  2C6Y A;  4BNC A;  3LA2 A;  4HYE A;  3WE3 A;  4O3M A;  3MKY B;  3TO6 A;  4IQ4 A;  2E1M B;  2OBP A;  1HDD C;  3RQ4 A;  2LFB A;  3SDG A;  1TWA J;  5GPC A;  2FU4 A;  3T8T A;  2Z33 A;  5E20 A;  1FSH A;  1VND A;  1ETO A;  2DFI A;  2HQA A;  1RIO H;  1PYV A;  3MN2 A;  3QQA A;  2IP2 A;  1DPR A;  3CP2 A;  1WJE A;  3DKY A;  2ICW G;  2ELH A;  3NWS A;  3HOW J;  4XLA A;  3OYC A;  5IT9 Z;  1STZ A;  1ZN2 A;  1GT0 C;  4UNO A;  3FDY A;  2DMU A;  3EUH A;  2HYF A;  2X0L A;  2IT0 A;  5F0C A;  2DQR A;  2NRA C;  3KFW X;  4IHT A;  3GTL J;  1JHF A;  5K7Z A;  1OKR A;  3G1O A;  1WVR A;  2R7T A;  2WAQ A;  4OIO F;  1IN8 A;  1DGR M;  2P4W A;  2YX7 A;  3MMY B;  1GVJ A;  3H3Z A;  4BU2 A;  2F5V A;  1BOB A;  3WTU C;  1RUN A;  3O8H A;  3ASO H;  4E7H A;  3LOC A;  3ZMV A;  1Y1V J;  3O3K A;  2W00 A;  1O7L A;  3OYK A;  5D8L B;  4MFD A;  2F4I A;  3GFM A;  3O8G A;  3K10 A;  3TBI A;  5DTD A;  1K4T A;  5IOZ A;  1I3A A;  3V7C A;  4NB5 A;  2HYG D;  3HSR A;  3HSF A;  2HQN A;  2GA2 A;  3GTG J;  4BGD A;  4L9J A;  2NNN A;  3L9F A;  1V54 H;  3GF2 A;  5DM6 F;  3LSR A;  1SFE A;  3QU6 A;  1I1G A;  2HTS A;  5J4V A;  4PCQ A;  2HDD A;  1RET A;  1AHD P;  2VC1 A;  2ZB9 A;  1XCB A;  4U7D A;  1E2X A;  5IP6 A;  3DV8 A;  1O3R A;  1TQP A;  5CVI A;  3E6D A;  4XKC A;  4DBR A;  4XRS G;  4PGG A;  3ZCO A;  1R49 A;  1DDN A;  4HF2 A;  4Q5S F;  1PJR A;  2DT7 B;  1KU3 A;  1Z3Y A;  3BG7 A;  1HKQ A;  5F1R A;  1H89 C;  1G59 A;  3N05 A;  1FZP B;  1XC5 A;  3L1P A;  3FXL A;  1WI9 A;  1W0U A;  2XGD A;  5J4Y A;  3FXU A;  4PUS A;  5DCF A;  5EF6 A;  2GXB A;  3E7L A;  2HYJ A;  4HQM A;  3FWE A;  1KU9 A;  3KZY A;  2DLL A;  1D8K A;  1G6N A;  2Q2E B;  1I50 J;  3V7R A;  1OCC H;  2B7E A;  3FBI B;  1IV8 A;  4ESB A;  4A0X A;  4WK8 F;  1U0J A;  2D2W A;  3SYT A;  4LFU A;  2E5Z A;  1HW2 A;  3K4M A;  3RTR A;  2CV0 A;  2QZ8 A;  1W1W E;  4X1E A;  1U9N A;  1YE9 A;  4NQW A;  2L7F P;  4HNV A;  1OYY A;  4BYY A;  4KIS A;  4XRS A;  1BN5 A;  4CYC A;  3U2R A;  1TL8 A;  1ZAO A;  2EH3 A;  3D5S C;  1K79 A;  2M8E A;  2X48 A;  3K4N A;  3BPV A;  1POG A;  1IXR C;  3TDZ C;  5DUI A;  2KZV A;  2MLK A;  1A35 A;  2E7X A;  1FTZ A;  3KEO A;  2P7V B;  2NVY J;  2A61 A;  2DT5 A;  2GBY A;  3S3N A;  3RSN A;  3AG4 H;  3DBL B;  3RIR A;  4BAC A;  3K69 A;  1LKX A;  5K7F A;  3TP3 A;  2QM3 A;  4HOB A;  4JX4 A;  2FE3 A;  3F3X A;  3FBN B;  3OS1 A;  1A5J A;  2O9L A;  3AKZ A;  2P6S A;  3BQY A;  3C2H A;  5AIP A;  1S7A A;  5C4X J;  1ZRF A;  3UNG C;  2DOF A;  1BR1 A;  3FMS A;  3TO7 A;  2HQ5 A;  3NEU A;  1DP3 A;  4CZZ A;  3OS2 A;  1YI2 I;  2ZXH A;  3OYA A;  3JW4 A;  2EV0 A;  3J7A O;  2LY2 A;  5TGT A;  4ITV A;  1D0Y A;  3ABU A;  3OYE A;  2XAQ A;  4BHP A;  5KAF C;  1GV5 A;  1B1B A;  2E2H J;  2OU2 A;  2CW7 A;  3GO5 A;  3QYE A;  4P1W A;  2JA8 J;  1G3Y A;  1X19 A;  1K7A A;  1HSJ A;  3ZN1 A;  4I2O A;  2L2O A;  3G4S I;  1Z05 A;  5FRO A;  1AU7 A;  3HTS B;  2A5W A;  2BV6 A;  3IUO A;  4IL6 C;  4KT5 C;  4WWC A;  3S3O A;  3VPR A;  4KMF A;  4ZDP A;  1IJW C;  2FEZ A;  3G3Z A;  4JX6 A;  3S15 J;  3TED A;  2MH2 A;  1Y39 A;  1BC7 C;  4Y17 A;  1WJ5 A;  3SEZ A;  1W0T A;  1KU7 A;  4ASN A;  2X6X A;  2CUJ A;  4AM3 A;  2V1U A;  3LA7 A;  4FCY A;  3CC4 I;  3OY9 A;  2M87 A;  1KYZ A;  4CCK A;  3O2P E;  3I53 A;  3FXQ A;  1FIA A;  3M9A A;  2Z3Y A;  1W36 D;  4BEH B;  5DDG A;  4XK4 A;  3ZMU A;  4FX4 A;  2I5U A;  5HLH A;  3ISP A;  1G2H A;  3G2B A;  2NYX A;  1HXD A;  3BJA A;  3QRF F;  2W84 A;  3O6B B;  4MFE A;  4N4N B;  3FX3 A;  2XGC A;  5LHI A;  4EJT A;  5M5Y J;  2JPC A;  3HUG B;  1QPI A;  3DWL E;  4DNC A;  1E3H A;  4UV8 A;  1VQP I;  4OMY A;  1G3S A;  2IEK A;  2PBI A;  3H0G J;  1FTT A;  5IYC J;  1TWG J;  2H6C A;  3S17 J;  1VQ5 I;  2WAE A;  2E1M C;  1Z3X A;  5FFZ A;  2ETH A;  3P5J A;  4PSW A;  2CS3 A;  3TQN A;  1E0E A;  5E18 F;  4LG0 B;  1QRY A;  3GYH X;  2VOO A;  3S3M A;  3CUQ B;  1IN7 A;  4LOC A;  3HRU A;  4I02 A;  4V19 K;  5BS6 A;  1P92 A;  1RC9 A;  5M5W J;  2O6G E;  1I5Z A;  4HAM A;  5CKT A;  2LVS A;  3A01 B;  4CDG A;  4M72 A;  1WH5 A;  4JK1 X;  2P7C B;  4OAZ A;  1BI0 A;  1T56 A;  1RES A;  1SAN A;  1O3Q A;  3K2A A;  1BIB A;  1ZLK A;  4LB5 A;  1MSE C;  2P5V A;  1USS A;  1GVD A;  5LD2 C;  2DT6 A;  1K78 B;  1FP1 D;  4EJU A;  1MD0 A;  1OCT C;  1WFX A;  1JKQ C;  3DEU A;  3FM3 A;  2QBY B;  3ZOB A;  2W24 A;  3RQI A;  3F8B A;  4Q47 A;  5DV5 A;  1J5Y A;  4KNY A;  4I09 A;  5CQG A;  4MEY F;  4XM3 A;  3G73 A;  2DFH A;  1T39 A;  1ON2 A;  3GUD A;  4S05 A;  2JSC A;  5GP9 A;  4GRI A;  5D6E A;  2O8K A;  4LLL A;  1OJL A;  3K70 C;  1QPM A;  1LDK B;  2FBI A;  1WRJ A;  3KEY A;  2UWM A;  2RVC A;  3L2V A;  4LLN A;  1DGW Y;  1MDM B;  4QPQ A;  4XNF A;  2A68 F;  2X4H A;  2ESH A;  3DCF A;  4IF4 A;  4HBL A;  5JHU A;  1ETX A;  1P4W A;  5ILS A;  2R92 J;  2QKM B;  4F3Q A;  2WAD A;  1B8I B;  1XGM A;  4RLQ A;  1R00 A;  2QQ9 A;  2HGC A;  2IA2 A;  3F8M A;  5E79 C;  3PNT A;  3GZN B;  2DA1 A;  2DW4 A;  4NBQ A;  3PNY A;  2ESN A;  1JTX A;  5D5U B;  3ELK A;  1FYK A;  1X1B A;  4XLN F;  3PO3 J;  1XDU A;  3QP6 A;  4ZDO A;  2Y0M A;  3GCM A;  3EQL F;  5L3D A;  4QIW N;  5K7H A;  1JGG A;  2LMD A;  1IO2 A;  3LAP A;  5GTH C;  4HDU A;  2JUC A;  4JYK A;  5F08 A;  4QTR A;  3I64 A;  3L09 A;  4OWR B;  2EZI A;  2PMH A;  1UJ8 A;  2NOJ B;  2HDW A;  3DBR B;  3ABT A;  1SD4 A;  1O3S A;  4AVZ A;  2XF5 A;  1SEU A;  4I6Z A;  2CQQ A;  3I3L A;  5J40 A;  3WTS C;  1U6G A;  4DZP A;  3F9K A;  1Z7U A;  4GCV A;  4JP0 A;  1Y8R B;  3BT9 A;  4N0B A;  2GOM A;  5FB2 A;  4HV5 A;  1FWZ A;  2Q0O A;  1MNM C;  1R1T A;  4L9V A;  4ZYE A;  4FAS D;  2CGP A;  2K9N A;  1WKM A;  3ABL H;  5BQT A;  4PJ0 C;  3LQQ A;  1BJZ A;  3RZD J;  3HRM A;  2EWN A;  4HW0 A;  1RPW A;  4H0E A;  4CIC A;  2O8X A;  1XMX A;  1F9N A;  4LB6 B;  3ZR8 X;  5HS9 A;  2ID6 A;  1RZ4 A;  4XLP F;  1GXQ A;  3T8R A;  2BHZ A;  2HPM A;  4HF0 A;  4NC6 A;  4D5C A;  4M3G A;  2UV1 A;  2R5Y A;  3U1D A;  4A3L J;  2YR2 A;  3H5N A;  1S5L C;  4OAY A;  3SZG A;  5EJC A;  3HL2 A;  2FJ1 A;  4G7Z F;  3SZP A;  4XRF A;  3PFY A;  3L2R A;  3MEX A;  1Z9C A;  2K7L A;  3IP4 B;  2VJ5 A;  1G3W A;  4BQA A;  1EF4 A;  2X85 A;  2R7D A;  1YS7 A;  3K1N A;  3D0S A;  2OCE A;  2VPR A;  2HKO A;  4PJN A;  3ZRG A;  1LEA A;  4MLO A;  3IWZ A;  4CA0 A;  4C2U A;  3TMO A;  1HCR A;  2BOL A;  3OL4 A;  2R93 J;  3CME I;  1J9I A;  3CJT B;  1Z77 A;  3Q0W A;  2LRE A;  5HLI A;  1ETY A;  3DQV C;  3REO A;  1RRJ A;  4V2F A;  1I39 A;  2DMP A;  2JWT A;  2WV1 A;  1Z6T A;  4NDL A;  2QSH X;  2CW8 A;  2JK3 A;  2NVQ J;  4C30 A;  1W5C C;  3ASN H;  1WCM J;  5KAI C;  3JRF A;  4ZYD A;  3HKZ N;  3BTL A;  1J0R A;  1Z0X A;  1V5F A;  2RQP A;  5K5R A;  1ZGJ A;  3MKL A;  4LIV A;  2KT0 A;  3F23 A;  1I3Q J;  2V1X A;  3WU1 B;  5JHF A;  1A6I A;  4RGR A;  1Z1D A;  3A03 A;  4JOM A;  4XLE A;  3PFI A;  4XKV A;  3VSL A;  3BJ6 A;  5HOO A;  4J00 A;  4CH7 A;  3Q5F A;  4ZJZ A;  5H20 A;  2BXY A;  2M9H A;  2B63 J;  1NK3 P;  2LTP A;  3JRA A;  2WY7 Q;  3F72 A;  4NQW B;  4NUB A;  3CCJ I;  1V5G A;  2KIU A;  3HOX J;  3F21 A;  3W2A A;  3OS0 A;  3G1L A;  3BCB A;  3ROU A;  2ME0 A;  2HZT A;  4E4H A;  4A0Z A;  4CYC B;  3IRQ A;  4LLG F;  4A3E J;  2VT3 A;  3ZMZ A;  2M4K A;  1BR4 A;  4EM1 A;  2I8D A;  2LY9 A;  1IF1 A;  3KLN A;  2OC6 A;  2ZSH B;  2RC4 A;  2NS7 A;  4CUG A;  2CQX A;  3JTG A;  3KPH A;  1MH3 A;  1O7F A;  2EV6 A;  5BPI A;  2V6C A;  5FLX K;  5IY5 H;  1WJD A;  3W3C A;  3A1Y A;  4AID A;  1KZH A;  1T0F A;  2Y9Y A;  2DN0 A;  2XF7 A;  2ZJP F;  2KP6 A;  4L5I A;  1KYW A;  4KA4 A;  2MG4 A;  3KLO A;  5K5Q A;  1C0W A;  3CUQ C;  5K1Y A;  3J80 Z;  3DP7 A;  5F0F A;  5LHH A;  1CQT A;  2KFD A;  2ACJ A;  4C2M J;  1Z67 A;  1AA7 A;  1L3L A;  3E5Q A;  4KT6 A;  5CVU A;  2QA4 I;  1TW3 A;  4KIT B;  2F4O B;  2OQR A;  2BE5 F;  1P7I A;  2L9R A;  1IZ1 A;  2MLG A;  3V7S A;  2H27 A;  3CD6 I;  2F4M B;  5IT9 K;  1ITY A;  1KA8 A;  3HUG A;  4XBF A;  2KPM A;  4FQG A;  1VTN C;  1BW5 A;  2LKS A;  4BHB A;  3RZO J;  3HPH A;  2RV8 A;  2AHQ A;  2GWR A;  1KON A;  1MBF A;  3OYG A;  1ZTR A;  1R1U A;  3MQ0 A;  1NHA A;  1ZG3 A;  3KP5 A;  4XLH A;  3A4C A;  2KZG A;  3BG9 A;  4M6X A;  1BC8 C;  4D9J A;  4F7Z A;  5IP7 J;  3M8J A;  1I6H J;  1KGS A;  3PUB A;  2DXI A;  2IS6 A;  4O6J A;  2X9D A;  1IRX A;  2MC3 A;  1LJ9 A;  3QU3 A;  3ZMD A;  4B47 A;  2QEN A;  4LK0 F;  4QWQ A;  4BQN A;  3A01 A;  1LFU P;  1T08 B;  4A69 C;  2CYY A;  3OYL A;  3T0Y A;  4OIQ F;  3WU0 A;  3OSF A;  3CMM A;  2DA5 A;  3LL7 A;  2CWE A;  1WSU A;  3CO7 C;  2FA5 A;  1K78 A;  2EIL H;  4BBR J;  2QGU A;  2R5Z A;  2Y2Z A;  1X2N A;  3S2H J;  3LSG A;  2IVM A;  2MFZ A;  1T2K A;  1LNW A;  3IL2 A;  1E17 A;  3C1D A;  3PQJ A;  3MKW B;  4C2T A;  3HKZ A;  1H9G A;  2ZSI B;  2DA3 A;  1DU0 A;  2IXS A;  2OQG A;  2VLA A;  1R4M B;  1SC7 A;  3DLA A;  4Y3O A;  4DYC A;  3M4O J;  1W4M A;  2CG4 A;  4JX5 A;  1W36 C;  3R60 A;  1ZRE A;  1R58 A;  1TNS A;  4FIS A;  2FBK A;  1FLI A;  3Q9V A;  1UST A;  4I01 A;  4DW6 A;  3W6J B;  1ETK A;  1X2M A;  2IPQ X;  2P81 A;  4UVA A;  3D1N I;  4E7I A;  3LSH A;  3NWT A;  3CCU I;  1QGP A;  1A36 A;  4M3B A;  4GXO A;  3EUH C;  5FKN A;  3I54 A;  2F5F A;  2AQE A;  1QZY A;  5K5O A;  2STT A;  2PG4 A;  1MSF C;  1UB9 A;  1KQ9 A;  3EYY A;  2MGQ A;  4G6Q A;  1JUP A;  2IGK A;  2QQB A;  3ERM A;  3H9Q A;  5J6X A;  3JRG A;  2EFO A;  1JUS A;  2CUE A;  2ZFU A;  1HW1 A;  4IXA A;  3Q3S A;  4U88 A;  4Y13 A;  3R61 A;  2O5R A;  2B9S A;  2VBW A;  3LFK A;  3RYP A;  1JE8 A;  3CJQ B;  3WE2 A;  3WTZ A;  1K61 A;  4IEJ A;  3BR2 A;  3L2U A;  4U0Y A;  3KZI C;  5DCM A;  5E1W A;  2I10 A;  2V1N A;  2O3F A;  2X51 A;  3GFJ A;  2L3D A;  3M1E A;  2HEO A;  2ZNZ A;  3VEP A;  2DYR H;  4WXD A;  2AXL A;  2DPU A;  3BR3 A;  3E6B A;  2WY8 Q;  1SAX A;  3NAU A;  2PJR A;  5FKM A;  4YII A;  1G4D A;  1YX3 A;  2VKE A;  1UCR A;  4A3J J;  1MMN A;  2TRT A;  2XAH A;  3CJR B;  4XR6 A;  2XAJ A;  3P9C A;  2UUZ A;  2L5Q A;  1UMQ A;  2JRT A;  5FGM A;  2R3S A;  2G7U A;  3FXM A;  3DKW A;  1FYM A;  1ODD A;  3B02 A;  5LHG A;  2XB0 X;  3DEW A;  3BR1 A;  2FRH A;  3CCM I;  4HG2 A;  2HS5 A;  2FOW A;  1D3Y A;  4AUX A;  1HW5 A;  1ZG1 A;  2E34 A;  2A6E F;  2M0C A;  4P9U A;  2D1H A;  5JR3 A;  2FXA A;  4I7H A;  5L3E A;  2A6H F;  2HOT A;  3CC7 I;  2DMQ A;  1S9H A;  3LWF A;  2Z16 A;  1TP4 A;  4E70 A;  4Y52 J;  1IV6 A;  4IRG A;  2NVU B;  2X1C A;  3FM5 A;  4ZH4 F;  4BAY A; 
#chains in the Genus database with same CATH homology
 4G6D A;  1FYL A;  3E6C C;  1PUE E;  2CFX A;  2QVO A;  1RNL A;  3BDD A;  2EFN A;  3GFL A;  4OU0 A;  2VON A;  2FBH A;  2JT1 A;  1SD5 A;  5BPD A;  1ZG5 A;  1IUY A;  1FNN A;  2BGC A;  1TBX A;  3HOS A;  3FHZ A;  2YX4 A;  3R6S A;  5CYV A;  2VXZ A;  2IRF G;  2L01 A;  3RPQ A;  5FFX A;  3FF5 A;  5CVV A;  1XGS A;  3EET A;  3J81 K;  1YW8 A;  5TRD A;  2ADU A;  1I1S A;  4G7H F;  4S04 A;  4ESJ A;  2MA3 A;  1QZZ A;  2KJC A;  5D6F A;  3WTT C;  5FD6 A;  3F6O A;  1U5T A;  4IRI A;  1SFU A;  3K9T A;  4UHT A;  4G94 A;  3I5U A;  3RKY A;  2FNP A;  1XSD A;  5CVR A;  4TV7 A;  3F22 A;  2GA1 A;  3NQO A;  1HQC A;  4G7O F;  5J8C A;  2DAO A;  2ZXJ A;  1TTY A;  2FNA A;  4RGS A;  2A3S A;  4GYI A;  1R23 A;  4IPA A;  1X3U A;  2PN6 A;  4Y15 A;  4MHG A;  2L02 A;  3NRV A;  3FZV A;  3DPT A;  4HF1 A;  2NNY A;  5E17 F;  2VC0 A;  1PDN C;  4KIF A;  3T5X A;  4KIG A;  1DUX C;  3BY6 A;  4NHJ A;  3WGG A;  3AAF A;  1BOA A;  2BBY A;  4EJV A;  2E7W A;  2RDP A;  3HSE A;  1LDJ A;  2P5L C;  3KP7 A;  1LQ1 A;  3E5X A;  1IXS B;  1IN5 A;  4GO1 A;  3M7G A;  1OMI A;  2DPD A;  1B6A A;  4L0Z B;  2JTV A;  1LDD A;  3V4G A;  4KMU X;  2MD5 A;  2WTE A;  1Q1H A;  3L7W A;  4AVP A;  3WG9 A;  3GW2 A;  2P8T A;  1HKT A;  4HLX A;  4LJZ F;  1P4X A;  3I58 A;  1BI2 A;  2QYO A;  1BIA A;  1FC3 A;  3C3W A;  3CO6 C;  1LEB A;  5ERI A;  4Q4Z F;  4IRH A;  1YW7 A;  1J7K A;  3KEQ A;  3R0A A;  3DPL C;  2VN2 A;  2Z99 A;  3E5U A;  2M1B A;  3WTY C;  1I27 A;  5LEJ A;  3L2C A;  2ZO4 A;  3ZP5 A;  2L54 A;  1T6S A;  1ZAR A;  1EH6 A;  2VT2 A;  1YQA A;  3I59 B;  1BJA A;  2K86 A;  1RUO A;  2F5C A;  1SD6 A;  4IJA A;  2ZJ2 A;  4OIP F;  2PJP A;  1OR7 A;  5D4S A;  3IKV A;  2VBZ A;  1V4R A;  5L3B A;  4EM0 B;  2QUF A;  2XKO A;  4A2U A;  4EMS A;  3CLO A;  1J59 A;  2FQ3 A;  2RNJ A;  5IT3 A;  5DD8 A;  4QLC U;  3RYR A;  2DTR A;  3RKW A;  2A5Y B;  2XRO A;  5DCM B;  3IC7 A;  4R8H A;  1U3E M;  2OZU A;  3R4K A;  1UHM A;  5ICG A;  3RDI A;  2MH9 A;  4HQE A;  2F5E A;  4PDK A;  2GZW A;  3RPU A;  4JQF A;  4HX7 A;  3KZZ A;  1W5T A;  2XRN A;  4LK1 F;  2PFB A;  2A69 F;  2OZ6 A;  4MTE A;  3HRS A;  4M9X A;  1R36 A;  6PAX A;  3T1B A;  2D1V A;  3I71 A;  3BRO A;  1XGN A;  3CUO A;  2F2E A;  3V8K A;  1QQI A;  2MBF A;  1JHH A;  3F8N A;  3V8J A;  1K6O A;  4OIN F;  4IHS A;  2OA4 A;  2ZME A;  4JBA A;  1J75 A;  5D8K B;  4M6Y A;  1U2W A;  4KUM A;  4XSZ F;  3VOE A;  5LRS A;  1IRG A;  3FXR A;  1YIO A;  2V9V A;  2DI3 A;  1FX7 A;  1ULY A;  1WWX A;  2COM A;  4IVN A;  5TJJ A;  1KQ8 A;  5FD5 A;  1FT9 A;  3GEZ A;  5D5W B;  4HV6 A;  3HRT A;  3JTH A;  4CGZ A;  2G9W A;  3HTU A;  2W57 A;  3BOQ A;  1FY7 A;  5CJ9 A;  1U78 A;  4UV9 A;  4A6D A;  4L9N A;  2UXN A;  3H3U A;  1SMY F;  5HLG A;  4EQQ A;  3Q9S A;  2IA1 A;  2XAS A;  4RB0 A;  1MGT A;  5AON A;  1XN7 A;  1XSV A;  5A2Q K;  3C7J A;  4MNU A;  3QPH A;  3GX4 X;  3BWG A;  3DF8 A;  2E1N A;  3FM5 A;  5DYM A;  1XD7 A;  5CVJ A;  1OYI A;  4WCG A;  4ZYG A;  1U5T B;  2L4M A;  1MJB A;  2QQA A;  3GLX A;  4WXH A;  5D5X B;  1S8N A;  4AIK A;  4A5M A;  2Y48 A;  3GVA A;  1CF7 B;  5HVQ C;  2Y75 A;  1S3J A;  2ZKZ A;  1G3T A;  3QOP A;  4EVI A;  4L5J A;  5HS8 A;  2K4B A;  3HOT A;  4XSX F;  3ECH A;  2HR3 A;  2LF7 A;  3KP6 A;  2WWY A;  3FMQ A;  1DPU A;  2O03 A;  2R7F A;  5L3G A;  4HX4 A;  3BP8 A;  2FOK A;  2J5P A;  2LKP A;  2XGX A;  3F8F A;  3CDH A;  2Z5U A;  3IRR A;  4CHU A;  4M9S A;  1FP2 A;  4B09 A;  3ERE D;  3KP3 A;  1Z6R A;  5LLQ A;  3K0L A;  2CSO A;  3MAJ A;  3GZ6 A;  2FMY A;  2KJB A;  2O61 A;  3QP5 A;  2PEX A;  4KIB A;  3RI4 A;  2W85 A;  3I59 A;  4BAY A;  3HYI A;  1XSX A;  3GFI A;  5LEK A;  2XHK A;  3ECO A;  3F6V A;  1U8R A;  1P2F A;  2LDU A;  1R5H A;  4AIH A;  1OPC A;  2IW5 A;  4M71 A;  4BXU A;  4N9I A;  1IN4 A;  4M74 A;  4RB3 C;  1XGO A;  1BM9 A;  1ZH5 A;  1W7P A;  1F1Z A;  1CGP A;  1DP7 P;  2CQK A;  3N4M A;  3K1M A;  4KYW A;  4EV0 A;  2WV0 A;  1S29 A;  1D5V A;  4YFN F;  1A04 A;  4EJO A;  2XIG A;  2FSW A;  3WGH A;  1ZGA A;  3P7N A;  3MFK A;  2K02 A;  4WX9 A;  3U9G A;  3JAM Z;  3BPX A;  3WOD F;  4I0A A;  2HWV A;  1JGS A;  2TDX A;  2H94 A;  3RKX A;  1O57 A;  2P5K A;  3GWZ A;  5L3C A;  1ZLJ A;  2RN7 A;  1EV7 A;  2EFQ A;  3QAH A;  2UZK A;  4RB1 A;  1TQM A;  5ICF A;  4RGU A;  4MQ9 F;  3EYI A;  5E8I A;  5BOX A;  2K27 A;  1TLH B;  4AIJ A;  5LGT A;  3LQR A;  1GXP A;  3KCC A;  3HHH A;  3ML6 A;  2YPR A;  3HIF A;  4MGR A;  4ETS A;  3D5L A;  5ICC A;  1U5T C;  1QO0 D;  2HFH A;  4UUV A;  3E97 A;  1Z91 A;  3LA3 A;  1SD7 A;  2ZCW A;  2KKO A;  1UHW A;  2IJL A;  2EA2 A;  4K2E A;  1HKS A;  1T98 A;  3TOA A;  2ZME B;  2LSO A;  5BMZ A;  5FO5 A;  3ZPL A;  4HDV A;  1YG2 A;  2KIM A;  1IW7 F;  3EDP A;  3ULQ B;  4ENN A;  4G8X A;  1IAW A;  3COA C;  1MJA A;  3B73 A;  5J8F A;  1FBU A;  3KE2 A;  2L4A A;  4L0Y B;  1S6L A;  4KFC A;  4UVC A;  3BJO A;  5HS7 A;  1FOK A;  1PP7 U;  1P4A A;  2W25 A;  5CLS A;  2CO5 A;  4EJW A;  5EEH A;  1MKM A;  4Z2Y A;  1CF7 A;  2GAU A;  4R1H A;  2P6T A;  3H92 A;  2V1D A;  4ZYH A;  2EK5 A;  3ZQ7 A;  1F4K A;  2FML A;  2GIV A;  4YFK F;  1YS6 A;  1ONV A;  2XUB A;  5ICE A;  4N9H A;  3N97 A;  3MCZ A;  3WTX C;  4RAY A;  4LGW A;  3I0T A;  3CJN A;  4YG2 F;  5H6Q A;  1L0O C;  2GQQ A;  2AS5 F;  3GZ5 A;  3R0J A;  1J2X A;  4GYG A;  1D8J A;  2J5O A;  2OD5 A;  2F5D A;  1AOY A;  1YLF A;  2Q8K A;  1REP C;  1LB2 A;  1O3T A;  1RI7 A;  2H09 A;  1R5G A;  3E3V A;  4FT8 A;  2EV5 A;  5LBQ A;  1B9M A;  1W7P D;  3KET A;  4OOI A;  5DUK A;  3P9I A;  3JSP A;  5DEQ A;  2DO7 A;  4ENM A;  1B9N A;  2NAZ A;  4D0P A;  1YW9 A;  3IWF A;  3SHF A;  5ILV A;  4EM2 A;  2YSR A;  4L18 B;  1WQ2 A;  1YYV A;  1B4A A;  3J81 Z;  1H0M A;  3SZT A;  1I6X A;  1ZYR F;  5KVR A;  3HHG A;  1T38 A;  2DBB A;  3L00 A;  4FHT A;  1BBY A;  1XMK A;  1FPQ A;  4A12 A;  3GXO A;  2ISZ A;  1MZB A;  4YIF A;  2O0Y A;  1XB4 A;  2M30 A;  4U0V A;  3IHU A;  1Y0U A;  2EA4 A;  4KDP A;  4B8X A;  1YO5 C;  3K2Z A;  5KK1 A;  2RKH A;  2HOE A;  1BI1 A;  5E1X A;  2HTJ A;  1OYW A;  2CW0 F;  3TKY A;  1PP8 F;  4KN7 X;  5HDG A;  1W5S A;  2HQR A;  2IA0 A;  5LGU A;  3KP4 A;  1F5T A;  4ENJ A;  4DQ2 A;  2ZFW A;  4R79 A;  3I4P A;  3SFZ A;  4KIC A;  1S7O A;  4GGG A;  4U0W A;  3QPT A;  2ZBK A;  5D4R A;  2OAZ A;  2DK8 A;  5E8G A;  3BZ6 A;  4CXF A;  3C18 A;  2A07 F;  1W7P B;  3F8C A;  5HDN A;  1SMT A;  1KQ0 A;  3JSO A;  3VFZ A;  3PQK A;  4U7B A;  4ZZL A;  1UFM A;  4L9T A;  3TGN A;  3DXJ F;  3MZY A;  3CTA A;  2B0L A;  4CO8 A;  4RS8 A;  4PGH A;  4UVB A;  5ED4 A;  3TOB A;  3K1P A;  4BHC A;  2HKX A;  4M73 A;  5F64 A;  4YFX F;  5F6F A;  4ZZD A;  4OMZ A;  1HBX G;  2WC2 A;  1ZRC A;  3J80 K;  3OOP A;  4AD9 A;  4WXC A;  2XAF A;  3E6M A;  2UXX A;  3DFG A;  4HZF A;  2M5W A;  5DD4 A;  4WF2 A;  3SXY A;  1R7J A;  2E1C A;  2XVC A;  1ZHF A;  4HX8 A;  1TNT A;  2HDC A;  3IKT A;  2BEO A;  2Q2E A;  4P55 A;  2PLY A;  2LF8 A;  2QWW A;  1IRF A;  1R22 A;  5E1Z B;  2EFP A;  4O5V A;  3V8L A;  5HDK A;  1QNT A;  2Z9O A;  4BH9 A;  4AWX B;  1IN6 A;  2YU3 A;  4ESF A;  3KP2 A;  1YTY A;  3RJP A;  3P9K A;  3TDU C;  4A6E A;  2ZNY A;  4A5N A;  1XDS A;  2KIF A;  2BYV E;  5JFR A;  4RGX A;  4LMY A;  1ZRD A;  3WTW C;  1QBJ A;  4FX0 A;  4G9Y A;  2VBX A;  3W6K B;  1EH8 A;  1MJ9 A;  1BI3 A;  4A0Y A;  2G7H A;  5AIQ A;  3M8E A;  1V3F A;  4RAZ A;  4P9F A;  2XAG A;  4MQV A;  2EFW A;  1H9T A;  2JPB A;  2DK5 A;  3MWM A;  4OIR F;  1SFX A;  2EB7 A;  2FF4 A;  3S2W A;  1JXS A;  1TW2 A;  5L3F A;  1FBQ A;  2D45 A;  3WGI A;  3ZN0 A;  4PZJ A;  2VE8 A;  4M9Z A;  4Q48 A;  2XKP A;  2QLZ A;  4ENK A;  3VB2 A;  3VOD A;  3LAJ A;  1HST A;  2PQ8 A;  4MTD A;  2PI0 A;  3ZMS A;  2PMU A;  5JVT A;  2K4J A;  4ON0 A;  3FMR A;  2XV4 S;  1B59 A;  2VE9 A;  4CYD A;  3JAM K;  1FSE A;  5H6R A;  1XMA A;  2STW A;  1ON1 A;  4MEX F;  1TQI A;  4I0B A;  4P96 A;  4LG0 A;  1FBS A;  2RGV A;  3WTV C;  3MZH A;  3CUQ A;  4EGZ A;  1KU2 A;  4P5O A;  5JI6 A;  5LGN A;  4EGY A;  4UXN A;  5LRR A;  2DQL A;  4HA8 A;  4KN4 X;  1AWC A;  3M8F A;  5ILU A;  2M45 A;  3OV8 A;  2VOP A;  2V79 A;  2VBY A;  2QBY A;  5EEG A;  3LST A;  1GHC A;  2NS0 A;  1EH7 A;  1LVA A;  4I98 B;  2VOD A;  2ISY A;  3TO9 A;  2H6B A;  4RB2 C;  5A2Q Z;  1P6R A;  2KRF A;  1MDM A;  2LNB A;  5D5V B;  2GXG A;  1R1V A;  1IXC A;  1YFH A;  2JZY A;  3ZMT A;  1XCV A;  5FLX Z;  4LD5 A;  2DU9 A;  4BNC A;  2C6Y A;  2EJR A;  3SQN A;  3LA2 A;  4HYE A;  3WE3 A;  4O3M A;  3TO6 A;  2OBP A;  1FSH A;  2FU4 A;  3T8T A;  2Z33 A;  5E20 A;  2DFI A;  1RIO H;  2IP2 A;  1DPR A;  2ELH A;  5IT9 Z;  1STZ A;  1ZN2 A;  4UNO A;  3EUH A;  2HYF A;  2X0L A;  2IT0 A;  2DQR A;  2NRA C;  3KFW X;  4IHT A;  1JHF A;  1OKR A;  4OIO F;  1IN8 A;  2P4W A;  2YX7 A;  1GVJ A;  3H3Z A;  3WTU C;  1RUN A;  3ZMV A;  3O3K A;  1O7L A;  5D8L B;  3GFM A;  3V7C A;  4NB5 A;  2HYG D;  3HSR A;  3HSF A;  2HQN A;  2GA2 A;  4L9J A;  2NNN A;  3L9F A;  3GF2 A;  1SFE A;  3QU6 A;  1I1G A;  2HTS A;  4PCQ A;  2VC1 A;  1XCB A;  4U7D A;  1E2X A;  1O3R A;  3DV8 A;  1TQP A;  5CVI A;  3E6D A;  1DDN A;  4PGG A;  4HF2 A;  4Q5S F;  1KU3 A;  1HKQ A;  5F1R A;  1FZP B;  1WI9 A;  3FXU A;  5DCF A;  2GXB A;  4HQM A;  3FWE A;  1KU9 A;  3KZY A;  2DLL A;  1D8K A;  1G6N A;  3V7R A;  4ESB A;  4A0X A;  4WK8 F;  2D2W A;  4LFU A;  1HW2 A;  3RTR A;  2QZ8 A;  4NQW A;  1OYY A;  4BYY A;  1BN5 A;  3U2R A;  1ZAO A;  1K79 A;  2M8E A;  3BPV A;  1IXR C;  3TDZ C;  5DUI A;  2MLK A;  2E7X A;  3KEO A;  2P7V B;  2A61 A;  2DT5 A;  3RIR A;  3K69 A;  2QM3 A;  4HOB A;  2FE3 A;  3F3X A;  2P6S A;  5AIP A;  1S7A A;  1ZRF A;  3FMS A;  3TO7 A;  3NEU A;  4CZZ A;  3JW4 A;  2EV0 A;  3J7A O;  3ABU A;  2XAQ A;  4BHP A;  1B1B A;  2OU2 A;  3GO5 A;  1G3Y A;  1K7A A;  1HSJ A;  3ZN1 A;  4I2O A;  1Z05 A;  3HTS B;  2BV6 A;  4KT5 C;  4WWC A;  4KMF A;  2FEZ A;  3G3Z A;  2MH2 A;  1BC7 C;  4Y17 A;  1KU7 A;  4ASN A;  2V1U A;  3LA7 A;  2M87 A;  1KYZ A;  3O2P E;  3I53 A;  3FXQ A;  3M9A A;  2Z3Y A;  5DDG A;  3ZMU A;  4FX4 A;  5HLH A;  3ISP A;  2NYX A;  1HXD A;  3BJA A;  3QRF F;  2W84 A;  3O6B B;  3FX3 A;  5LHI A;  4EJT A;  2JPC A;  4DNC A;  4UV8 A;  4OMY A;  1G3S A;  2PBI A;  2H6C A;  5FFZ A;  2ETH A;  3TQN A;  5E18 F;  4LG0 B;  3GYH X;  2VOO A;  3CUQ B;  1IN7 A;  3HRU A;  4I02 A;  5BS6 A;  1P92 A;  2O6G E;  1I5Z A;  4HAM A;  4CDG A;  4M72 A;  4JK1 X;  2P7C B;  1BI0 A;  1O3Q A;  1BIB A;  1ZLK A;  4LB5 A;  2P5V A;  1USS A;  1K78 B;  1FP1 D;  4EJU A;  1MD0 A;  3DEU A;  3FM3 A;  2QBY B;  2W24 A;  3F8B A;  4Q47 A;  5DV5 A;  1J5Y A;  4KNY A;  4I09 A;  3G73 A;  4MEY F;  1T39 A;  1ON2 A;  3GUD A;  4S05 A;  2JSC A;  5D6E A;  4LLL A;  1QPM A;  1LDK B;  2FBI A;  1WRJ A;  2UWM A;  2RVC A;  4LLN A;  1MDM B;  2A68 F;  2X4H A;  2ESH A;  4IF4 A;  4HBL A;  5JHU A;  1P4W A;  5ILS A;  1XGM A;  1R00 A;  2QQ9 A;  2HGC A;  2IA2 A;  3F8M A;  2DW4 A;  2ESN A;  5D5U B;  1FYK A;  3ELK A;  4XLN F;  1XDU A;  3QP6 A;  2Y0M A;  3EQL F;  5L3D A;  3LAP A;  4HDU A;  3I64 A;  3L09 A;  2PMH A;  3ABT A;  1SD4 A;  1O3S A;  3WTS C;  1U6G A;  1Z7U A;  4GCV A;  4N0B A;  5FB2 A;  4HV5 A;  1FWZ A;  2Q0O A;  1R1T A;  4L9V A;  4ZYE A;  2CGP A;  1WKM A;  5BQT A;  3LQQ A;  3HRM A;  2EWN A;  4HW0 A;  4H0E A;  4CIC A;  2O8X A;  4LB6 B;  1F9N A;  5HS9 A;  1RZ4 A;  4XLP F;  1GXQ A;  3T8R A;  4HF0 A;  3U1D A;  2YR2 A;  4G7Z F;  3SZP A;  4XRF A;  1Z9C A;  3MEX A;  2K7L A;  1G3W A;  4BQA A;  2R7D A;  1YS7 A;  3K1N A;  3D0S A;  2HKO A;  1LEA A;  3IWZ A;  1J9I A;  5HLI A;  3DQV C;  3REO A;  1Z6T A;  4ZYD A;  1J0R A;  2RQP A;  5K5R A;  1ZGJ A;  3F23 A;  2V1X A;  3WU1 B;  4RGR A;  1Z1D A;  3PFI A;  3BJ6 A;  5HOO A;  3Q5F A;  5H20 A;  3F72 A;  2KIU A;  3F21 A;  3ROU A;  2HZT A;  4A0Z A;  3IRQ A;  4LLG F;  2VT3 A;  3ZMZ A;  4EM1 A;  1IF1 A;  3KLN A;  2RC4 A;  3JTG A;  1O7F A;  2EV6 A;  5BPI A;  2V6C A;  5FLX K;  1T0F A;  4L5I A;  1KYW A;  4KA4 A;  3KLO A;  5K5Q A;  1C0W A;  3CUQ C;  5K1Y A;  3J80 Z;  3DP7 A;  5LHH A;  2ACJ A;  1L3L A;  3E5Q A;  5CVU A;  1TW3 A;  2OQR A;  2BE5 F;  1IZ1 A;  2MLG A;  3V7S A;  2H27 A;  5IT9 K;  1KA8 A;  3HUG A;  4XBF A;  1VTN C;  4BHB A;  2RV8 A;  2GWR A;  1R1U A;  3MQ0 A;  1NHA A;  1ZG3 A;  3KP5 A;  4M6X A;  1BC8 C;  4F7Z A;  1KGS A;  4O6J A;  2MC3 A;  3QU3 A;  1LJ9 A;  3ZMD A;  2QEN A;  4LK0 F;  4QWQ A;  2CYY A;  3T0Y A;  4OIQ F;  3WU0 A;  2CWE A;  1WSU A;  3CO7 C;  2FA5 A;  1K78 A;  2IVM A;  1T2K A;  1LNW A;  1E17 A;  3C1D A;  3PQJ A;  1H9G A;  2OQG A;  1W4M A;  2CG4 A;  3R60 A;  1ZRE A;  1R58 A;  1TNS A;  2FBK A;  1FLI A;  3Q9V A;  1UST A;  4I01 A;  3W6J B;  2IPQ X;  4UVA A;  1QGP A;  4GXO A;  3I54 A;  2F5F A;  1QZY A;  5K5O A;  2STT A;  2PG4 A;  1UB9 A;  1KQ9 A;  3EYY A;  4G6Q A;  2QQB A;  5J6X A;  2EFO A;  1HW1 A;  4Y13 A;  4IXA A;  4U88 A;  3R61 A;  2VBW A;  3LFK A;  3RYP A;  1JE8 A;  3WE2 A;  3WTZ A;  4U0Y A;  5DCM A;  5E1W A;  3M1E A;  2O3F A;  3GFJ A;  2HEO A;  2L3D A;  2ZNZ A;  3VEP A;  4WXD A;  2AXL A;  2DPU A;  3E6B A;  1SAX A;  4YII A;  1G4D A;  1UCR A;  2XAH A;  2XAJ A;  3P9C A;  2JRT A;  5FGM A;  2R3S A;  2G7U A;  3DKW A;  1FYM A;  1ODD A;  3B02 A;  5LHG A;  2FRH A;  2HS5 A;  1D3Y A;  1HW5 A;  1ZG1 A;  2A6E F;  4P9U A;  2D1H A;  5JR3 A;  2FXA A;  4I7H A;  5L3E A;  2A6H F;  3LWF A;  4E70 A;  4IRG A;  4HLY A;  4ZH4 F;  3IL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...