3F3YA

Crystal structure of human cytosolic sulfotransferase sult2a1 in complex with pap and lithocholic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
282
structure length
282
Chain Sequence
DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title rystal structure of human cytosolic sulfotransferase SULT2A1 in complex with PAP and lithocholic acid
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Bile salt sulfotransferase
total genus 101
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3f3yA00
4DLTA 2ZSFA 3FTQA 3CRVA 2OAP1 3QENA 4I1SA 4FMCB 3IEVA 3KTAB 3BFXA 4NU0A 2GBLA 3RRZA 1VDZA 1WMSA 3N2EA 4F92B 3EC2A 3ND9A 3U3KA 3SHFA 3X1XA 4FIDA 5EE0A 4B2PA 2WWIA 3WYFA 1W7AA 1D2NA 1TF7A 2OG2A 5H70A 1RE0A 3KFVA 3TSOA 4JVMA 3MG9A 4Q4AB 2QT1A 4ZPXA 1AS0A 3AUYA 5M04A 2FMXA 4XWKA 1Z2AA 2FDCA 2R2AA 3HR7A 4LJYA 1VPLA 2H18A 2XNDD 1EFTA 3HU3A 4E07A 3TQCA 2HDNB 1OSNA 2QUZA 1T3HA 3QI2A 3GJ8A 4LHYA 4IFBA 2ANCA 3CF6R 5JS7A 2GK6A 3OIWA 2A5JA 3IBYA 2WJIA 2OV2A 4LK2A 1CJMA 3A1WA 1JXOA 1XJ0A 3Q7QA 3NTUA 4M1YA 1A2BA 1U81A 4B35A 4GT1A 3FDIA 3K0AA 1GG2A 1X3SA 3MLEA 4I1OA 5B64A 2IHBA 3QKSB 4UJ5A 3FVQA 2DWOA 3LXXA 2AXNA 4IJMA 4LZZA 5LD2C 4R71A 4LC1A 3K0EA 4LJ8A 4WOPA 4DBLC 4UKDA 3U4QB 3OEED 5DI9A 2ZR7A 2XTMA 1F3OA 4B3DA 2RGXA 2ZJOA 4YXWD 2RB4A 4AG5A 2N1BA 4PAOA 4UNPA 5DYIA 1YQTA 5UKDA 1W5SA 4A82A 5DYGA 2R6DA 1XEWX 2O0JA 4AD8A 2WSSD 1MABB 1VHTA 1YJ5A 4AKIA 2OLJA 1YU9A 4IXNA 3OAAA 4Y0AA 4CVNA 2ZANA 4M1MA 1V43A 5CYPA 4JSYA 1N5LA 5JI3E 3NHBA 2TMKA 3K0FB 2ZPTX 4QNMA 2VYFA 4D82A 1E9SA 5JJKA 2JLWA 3PG5A 4ILEA 2GEVA 1QZXA 2GZAA 3QPVA 1AK2A 2RKOA 3CH5A 4PPFA 4RZUA 4DXAA 1W46A 5CM8B 2KJQA 4MGZR 5J4KA 4B71A 4N1AA 1GFIA 3UG7A 4BFXA 2GK7A 1XCGB 4KFSA 1SVWA 1G6HA 3KUDA 3UMFA 4XOIA 2ZI5A 5G53C 2P65A 2A5GA 1AKYA 3KJEA 3QNUA 1OH7A 2GJKA 1GTVA 2QMOA 1NJFA 4DEYA 1OFTA 1QBKC 1UBFA 3EA0A 2MSCB 1RJ9B 1LS1A 4UJ3A 5IK2A 2F3RA 1NLYA 4D0NA 2R6CA 1E2PA 4OHYA 1II0A 1XD2B 3L0PA 4G5SA 3C15C 4TMXA 5KDLA 3FFBA 1ZJ6A 4F7WA 4NHOA 2ZROA 3RWMB 1GM5A 1XTQA 4Z51A 1YZNA 4EKDA 1QVAA 5CB8A 2J1LA 4HB3A 1F2UB 2WOOA 1SKYB 2A9KA 1Q22A 1HQYE 1KO5A 1NN3A 1YZTA 3BB4A 3FFAA 3QEOA 4M8NE 1RPZA 2FU5C 2HXYA 4LCBA 2BHRA 4JZKA 2LCFA 4DSOA 3LX8A 2CJWA 1P72A 2BDTA 4BZXA 4JIMA 1W4AA 3E70C 1U8ZA 3CRRA 3LXRA 4OJQA 2JLYA 2OM2A 1JR6A 1PV4A 2BV3A 3KB1A 2YOHA 1UKZA 1TU4A 3AVTA 1NG9A 3GJ7A 3O8RA 4PAQA 5HPYB 3C4JA 1OIWA 1RRFA 4AIIA 4NYMQ 1XXHE 3MD0A 4BRWA 1AGRA 4BFWA 3DOEA 1I2MA 2C9YA 5AJWA 1U0JA 4G5QA 2OUKA 1WBDA 1Z6TA 1G7TA 2EFHB 3L0IB 1GNPA 4D2IA 2GVDC 3GLFA 1RYHA 2ZI4A 1SVKA 4KYUA 4MRPA 4WZBE 1NVVQ 1MOZA 4B6FA 2PZFA 2GETA 1T5LA 2H92A 3AKYA 4IOLA 4CRWB 3BAFA 4LSGA 2E1RA 4US2R 2GJ8A 3BFKA 2V6JA 2ZRAA 1EFUA 3M4YA 1ZCAA 4ZKDA 2OE2A 3NKVA 4HUQA 2KB0A 2GCOB 2XSZA 3W8NA 2F1RA 3K9NA 4CEHA 4TMVA 1KI8A 4DEXA 2CCKA 1W48A 4GI7A 4OHZA 3GLHB 2PEYA 1E9DA 4ZI3A 3QEJA 2OXCA 3HU2A 5BQ5A 1GSIA 1G7CA 1WDTA 3FMPB 3VKWA 2H7VA 2I1QA 2C5LA 2GZDA 3GFPA 1KO1A 3SHWA 1KI3A 1PLJA 2JCSA 1DAMA 1KOFA 2FFBA 2WJHA 3FPAA 3MJHA 4JMPA 3CW2A 4IFEA 4O0MA 1E9AA 4XJXA 2VLIA 3NEJA 2GEDA 3B8HA 3U6KA 1KAGA 5CM9C 4F91B 4Q9HA 5CDFA 3K70C 1FP6A 3UG6A 1IXSB 4KSCA 4G3XA 5CLLA 1T5IA 4NYIQ 4FMCF 4DDUA 1GP2A 2C78A 5JWHA 3EARA 3R9WA 2X19A 1FTNA 1Z06A 2JJ2A 2PMDA 3BS4A 4MQBA 5J40A 1TEVA 2QBYB 3G0HA 4JT4A 1FUUA 1E99A 2HCJB 3P27A 1Z3IX 4DIEA 5BXQC 5HCNA 2BCGY 4NYJQ 4WXPA 2XX3A 1GIAA 4EUNA 1ZUIA 2WJJA 4WZAE 3ADBA 5FPHA 4DLRA 4QBFA 3ETLA 3A4MA 4UXJA 3KJIA 1P3JA 3EIHA 3REGA 3CX8A 1NRJB 3GLFB 5FL7A 4YMWA 4FCVA 3KKMA 5TY0A 1SGWA 3THOA 2ZSAA 4ZDWA 4D4KA 1VCIA 2WPDD 2WZQA 3FGNA 4LV5B 2ORWA 4U5XA 5E7JA 2CK3D 3I4LA 1ZRHA 1OIXA 1LF0A 1ZU5A 4WBSA 1MKYA 3WXMA 3CR8A 1LS6A 1DELA 2A7QA 2BVNA 1KY3A 2QAJA 2QE7D 4N3NA 3CBQA 1XTSA 2YHSA 2ZVQX 2XAUA 2WJGA 1N3BA 1XBTA 4DVGA 1RIFA 2UZIR 3ASZA 5LPNA 1U9IC 3GLGA 2ZETA 4TQ9A 2QEQA 2KI5A 2JATA 3VR5A 2WTUA 4D25A 5CJPA 1RRCA 4B3FX 2I4IA 1ZU4A 4D6PA 3TIFA 5GJWC 1ZM9A 2VHQA 2VQSA 4Q7KA 3CZQA 4MRVA 4IHQA 1FTSA 2IEZA 1RC8A 5TARA 1JR3A 2WWGA 3LH5A 1Q1ZA 2G83A 3O8BA 2IYZA 4Q9KA 2WAYA 4C2TA 2QM8A 4CEIB 1HYQA 1TEXA 2ZRBA 4LJAA 5CIWA 4Q00A 2D62A 2B6HA 2IYXA 1E1RD 4ZCIA 5LBIA 2YC2C 1XCMA 4E09A 4EPXA 4BASA 1ELOA 2A5FA 4G0NA 4Q9JA 3RAPR 3DVLA 3CH4B 3EX7C 2H17A 1XMSA 3I32A 4P4SB 4F38A 3KQNA 4DIDA 4O2RA 1D9XA 3O8CA 3AB3A 1MRSA 4POAA 2W2XA 2QMEA 1OHHD 3QE0A 1N6NA 4HEJA 4C7OA 121PA 2G0TA 2QPTA 3GQBA 3OF5A 1CP2A 2QGZA 4HZUA 2QQEA 3B9PA 1XEWY 1QRAA 2CL6X 4BFSA 4M1KA 1OKKA 4V0MA 1Q44A 3LLMA 1VMAA 1JJ7A 3Q7PA 4IXMA 721PA 3U7EB 3WP1B 2EVWX 3AKCA 4DLXA 3U3JA 4IDQA 4HB2A 2HYIC 4KAXA 2OSBA 2LKDA 2GDJA 3IPYA 2D3WA 2QMHA 5EUQB 4JYCA 1W2GA 3FKSD 4RSGA 3D31A 3SOPA 5FTMA 4Q4JA 3SEAA 4S35A 3U3RA 3U60B 4TYYA 1W4RA 2DWPA 3AGPA 3P26A 1UDXA 1FMLA 4BUJA 2RGEA 1ZD8A 1SXJB 2ZRKA 1X8JA 5JJLA 2ZJBA 3B7GA 4GBMA 4Q7MB 1UEIA 1KAOA 3JZAA 1HUQA 3AF4A 2ZE7A 1SZPA 3VR4A 1I4LD 2BEKA 5EXSA 4D81A 3VHXA 3A1TA 1M2OB 1KJYA 1IN6A 3F5FA 1SVOA 3NBYC 3GEHA 4JSTA 4V0LA 4D80A 1GZSA 1EX6A 2ZJ5A 1XNJA 2OEPA 5F9HA 3VU9B 4ZDKA 4UQOA 1KIMA 2FPMA 3GJ6A 4TT3A 2CHQA 1W44A 2J7PD 2D7DA 2ZS7A 2EW1A 3WHLA 1M74A 2RGBA 4GDFA 2EU8A 3UMRA 3U4QA 2HUPA 3A4LA 1Y63A 2RGDA 4HAUA 3W8RA 4G01B 1A2KC 3NHAA 1IN4A 421PA 2F1HA 3SNHA 1Q1QA 3TQFA 3LW8A 4GFDA 4OK5A 4TQAA 4ZIRA 3NWJA 2JJ8A 4IDHA 2G9NA 3ZQ6A 3I92A 3KDSE 2C77A 1QVRA 1XMVA 2IT1A 4RCYA 5AJXA 4DT1B 1XD8A 1GRRA 2RHMA 1KMHB 4BECA 4LYJA 1BH2A 1DTSA 5DH9A 2JLSA 3I61A 2FX3A 3WNBA 2Z43A 4A4DA 3SI7A 1WB9A 3A8TA 3PVSA 3AP3A 4MGIR 4Q9IA 1IY1A 1OE0A 2W0MA 3NVAA 4QHYA 4LBWA 2AD1A 4B33A 3EPJA 5IK2D 4C2UA 2FN4A 1F60A 3TKLA 1G64A 4PX9A 2NQ2C 2OCBA 1AS2A 4JYBA 2FSHA 5D3MB 3BB3A 3TRFA 1UBEA 2VHCA 5FI0B 3ADKA 1NG1A 4QXAA 2YWHA 4AG6A 3EG5A 4EPVA 3H2YA 2GXQA 1E98A 5FUYA 4QGGA 1N2CE 1GL7A 1KDPA 2W6JD 2PX0A 1I4TD 3BB1A 1HEIA 4JKIA 3BFVA 5HZKA 1FL9A 5BYJA 1XDBA 5H8WA 1X1RA 1J8MF 1CR0A 3LQQA 4HSEA 4NBSA 5IT5A 1WXQA 3CIOA 5HE9A 2E87A 1KI2A 3SBDA 5HKKD 3LRPA 1Z6AA 1Z0DA 2V6IA 4V0NA 2BKEA 4R9UC 4MYHA 2XB4A 4Z54A 3TH5A 5B30A 4AI6A 3W5IA 2O8DB 5TV2A 4DB4A 4FD2A 3W6NA 1TAGA 1G7RA 5FTLA 3EW9A 1E4YA 1T3SA 4IEEA 4KHZA 2PMKA 3T1VA 4L15A 3PEWA 2P0EA 2OFXA 1Z2CA 3I8SA 5DIFA 3ZH9B 1WBBA 4G5GA 1VHLA 1R5OA 1VCNA 4B34A 1JEDA 5JFGA 2RGCA 3SS8A 3RS4A 1OW3B 2JIZA 1KSFX 4HAXA 3U7HB 1E9EA 2ZAMA 4CZ2A 2HXSA 1ZW6A 3RS3A 3BC1A 2BMDA 4JLKA 2WMOB 3THYB 2ZU0C 2ERYA 3QBVA 4HB0A 2ASEA 1IONA 5FL3A 4XWAA 2ZSBA 2OXRA 2EFDB 1II9A 1DBSA 3BOSA 1F48A 3BD9A 1QHHA 2PEZA 4M1TA 4M0LA 1G18A 2HEIA 1ZD9A 3IGFA 1GDDA 1ZCBA 4Q1AA 2VL7A 3NEYA 2PX3A 3I62A 2QENA 1TQ6A 3QF4B 2ZSEA 1NN5A 5HKKA 5JRJA 4TYWA 3ZZUA 2W58A 2O0KA 1WE2A 4HLUC 4M9SA 1S96A 4OHXA 3GLHA 4FMDF 4A2WA 4TYPA 2QA5A 3C5CA 2CL7X 5K8TA 4MGYR 4QL3A 2R44A 1YR9A 3C41J 4CEJB 1R7RA 2W0SA 5GVRA 5J4LA 4Q18A 1FQJA 2VF8A 1YZLA 3RANA 4GMXA 2P5TB 2WIBA 2ZR9A 1J99A 3K09C 4W5JA 1X8KA 3B1ZA 5SZJA 4RFVA 4ZDJA 2FPLA 5FOSA 1E69A 2O0HA 2D74A 3FE2A 2O8CB 5E7IA 4HLDA 3U7GA 3RABA 3CR7A 3X2SA 2FFHA 4DSNA 4LPKA 1MH1A 3KKQA 3SYKA 2PLRA 1G291 2AWNA 4TWZA 4DDTA 1P2VA 3RLFA 2JJ2D 1CF4A 3A1VA 4OQMA 3R7WA 4QC2A 1ZBDA 2CLCX 2FFAA 3W6PA 4EIWA 3I8XA 5EE3A 1R0YA 2O8BB 2ZE5A 3IPXA 4MITA 4HATA 3ZDQA 4Q48A 4WIAA 1GUAA 4X8MA 4H1VA 2B8TA 1DS6A 4LBVA 4NKRA 3GFOA 3MMPA 4FCWA 4AKHA 1VECA 4TYQA 2YYZA 2L0XA 3AKDA 3N2IA 2WV9A 4O2LA 4GOJA 4URYR 4V0OA 1OPXA 5BN3A 5FPSA 1DO0A 2ZREA 5AR1A 4F4JA 3ASYA 3ZVLA 2RCNA 3QQ5A 1OFUX 4TLCA 3K70D 4LUCA 5L8VA 1E96A 4O3MA 1SXJE 4DLSA 3HPRA 1RJ9A 2G1JA 2BM0A 1TPZA 5JEDA 2VSOA 2XNDA 1ANKA 4P4SA 3H4MA 4DWJA 2K5UA 3K0CA 1XEXA 3AP2A 1E2GA 1ZM4A 1MO6A 4MDEA 4WVFA 4GOKA 4ASUD 4YC7A 2WJVA 2BBSA 4ASUA 5P21A 5JLJA 4XD7D 3DM9B 4M9QA 3PITA 4PPNA 4IVQA 1AIPA 1QDEA 2J5XA 2CDNA 5DN6A 3N70A 3EWAA 4X8OA 1AQYA 3PV0A 4MRSA 1OKKD 5J4YA 3U3OA 3FMIA 5JCPA 2D7CA 2YJTD 1BYUA 3K0FA 4FMBB 5AWFC 3CONA 4LJ9A 4DSTA 3U3MA 1HT1E 2VRWA 3S1AB 3E5HA 1NJGA 2Q6TA 3TUIC 2B21A 4IEIA 3BGWA 5D3MA 3WMGA 3ECCA 2IEYA 4EFLA 4BLSA 4ABYA 4H9GA 4EDHA 4URZR 3GLGE 3K8YA 4DCSA 5IF9A 5J4HA 1XFAA 2JLXA 1GKYA 1OHHA 1VCMA 1NY5A 3DDCA 5F3WB 3IILA 5JZVA 3RRMA 4MKIA 3L0SA 1KMQA 2J9RA 3AVOA 4RFSA 4BPBA 2V1XA 3GD7A 3T1QA 1N6OA 3CNOA 5H68A 2FG5A 1GAJA 3GLIB 3CO5A 2NTYC 1SULA 3NDBB 5G3ZA 2VO1A 5FUWA 5FTKA 4LPSA 3KL4A 1HY3A 2GBLC 5F98A 4JKYA 4XTRA 1P60A 5CLQA 2BEJA 3B5JA 5KSZA 2VSFA 1KI7A 2PCJA 1CULC 1Q1EA 2CVFA 2OCAA 3PQCA 1DEKA 5EJEA 2XNSA 2GAAA 3NH6A 5FBWB 1YE8A 2ZJ8A 1IY0A 1D2MA 1ZAKA 1HE1C 3K1JA 1TUIA 2NZJA 3KXKA 3VMFA 5KDOA 3QSYA 1UF9A 4PO1A 1GRNA 3CPJB 2YV5A 1N5JA 4OJKA 1E1QD 3TW4A 3ZD6A 2OBLA 4QFMA 2QG6A 4IVPA 1Z08A 1UEJA 1P2TA 2DYKA 4Z1MD 4KSBA 1Q1BA 4GNKA 3KQLA 1VYUA 1TMKA 4XWOA 3U6BA 1NBMD 4GL2A 1BS1A 4UXIA 3EASA 1NBMA 5FI1B 1W1WA 2XOKA 1NBME 3EPLA 5G41A 1G4UR 1COWA 2ZJYA 4RKEA 2C04A 4PC1A 3WNCA 1S9DA 2J7KA 2KBFA 3DMNA 1ZNXA 3KX2A 1DG1G 1DOAA 3NH9A 2YNMA 4Q1BA 4LRWA 4CEJA 3MCAA 2GXSA 1OLOA 821PA 1YZUA 1QHGA 3VR6A 2F55A 1C4OA 2ZRNA 4UNNA 2ZYTX 2RAPA 4ACBA 5BYKA 1FW6A 3EXAA 3BH7A 4YMVA 1ZYUA 2B7BA 4ZKEA 1KNXA 5AJVB 1XB2A 4JVLA 1II8A 2Y8EA 3ND8A 4D0GA 1N6PA 3QKRA 3ZVRA 4BQSA 2IF2A 2QTVB 1EGAA 4V02A 2PT5A 2ZU6A 4QG7A 1Q3TA 1O3YA 3THWB 1PUJA 5JI2E 2OAQ1 2AR7A 2XTZA 2X2EA 1Z0AA 1P62B 3NDPA 3PEUA 2X2FA 1X8LA 2OBNA 5FOTA 3TVTA 1BMFA 5AUQA 4IDPA 3QOFA 2P2LA 4TMZA 2EYUA 3DOFA 2VBCA 5C2JB 1YHNA 5BW8A 3GEEA 4YMUA 2Q9BA 4DZZA 2OT3B 1KY2A 3IIMA 2DFNA 1R2QA 2G6BA 3AUXA 1AKEA 5EE5B 5KHOC 4L5BA 4TT3D 1MO5A 3T15A 3TLXA 3L43A 4HZIA 4FW9A 4PZLA 1S3SA 1JR3E 1Z83A 3UIEA 1DADA 1VG9B 3T1OA 1XD9A 3JZMA 1KDTA 4Q4HA 1J7KA 3CX6A 1KMHA 3BH6A 1JBKA 2F9LA 2AXPA 1JI0A 1ZNYA 4L9SA 4LHVA 1E2QA 2QY9A 3TBKA 3AF1A 3NC1C 5EP1A 1CEEA 3FKQA 2MSEB 1US8B 2ZQ5A 2NPIA 3CNNA 1TL7C 4B6EA 1U90A 4HUTA 2J0UB 2BM1A 3QXXA 1VIAA 1TQDA 1R8SA 4WZ6A 2KE5A 2ONKA 1KK2A 2J3EA 1W2HA 1KGDA 1GITA 4IRUB 3WY9A 2DFLA 1DVRA 4EQ6A 2Z4SA 2CE7A 1H8HD 1Z5ZA 4NYIR 3UPUA 2D06A 4C4PA 1TQ4A 2DR3A 5GVSA 1E79A 2UVQA 1JR3D 3QG1A 2FSGA 2XOKD 1Q57A 1OV4A 5KU1A 1FP7A 4JLAA 1XTJA 1NKTA 1YKSA 4M21A 3SZRA 4I99A 4B73A 3EPKA 5IHPA 4LHWA 1OT3A 4LBYA 1ZM3A 3LW7A 2WWHA 2ZJZA 1K5GA 3OE7A 2V54A 4KVAA 4G5RA 2GEUA 1N6IA 1Q21A 1Z28A 1KZGB 1ZM7A 1E0JA 1TU3A 3OIYA 5CB6A 1NLZA 1G19A 4NCJA 1Z29A 4TMKA 2W6ID 3IIKA 4K46A 4KU4A 2AFIE 2XB2A 4IW3B 4PHGA 2GKSA 4HB4A 4FWTA 3FHCB 2QZ4A 5HCIA 4QHSA 4B3XA 3WBKA 4R2HA 3OHMA 3CF2A 5LB4A 1UBGA 2ZE6A 1AQUA 3I73A 5EE1A 2ZTSA 1A5TA 3IUYA 3TSZA 1IN7A 4KFRA 1HT2E 1OF1A 2DBYA 2GJAA 1E2MA 2WMNB 2FZ4A 1S2MA 3AP1A 2LWIA 2WSMA 5J47A 4PC7A 4RD4A 4DLUA 4QGFA 2BJWA 4Q21A 3QIAA 3VU9A 4A6PA 4FCTA 3D3QA 1I4DD 2J0UA 3M0EA 4J0QA 3WYAA 3EIEA 4HDOB 3RS0A 3HWSA 3X1DA 3M6AA 5C1BA 3KXIA 5L3SA 3B78A 4LJ6A 2V3CC 3G82C 1QHNA 2NO1A 1HTWA 3B1VA 2NPFA 1P75A 2QNRA 4TZ6A 1OH5A 2IA5A 4Q9LA 2VIIA 2QE7A 2Q9CA 4Q01A 1N5KA 3LX5A 2C03A 1TQ2A 1W0JA 4DC9A 1E0KA 2G88A 2YKGA 3U7FB 1W0JD 4E5UA 1FQKA 3DEFA 4B3BA 1DE0A 4IOKA 3PUVA 3WBJA 1VIYA 1E2HA 1VG1A 2EYQA 1Z6XA 2QTFA 3G5UA 2CLDX 2CBZA 2WSSA 1IN5A 2D2EA 4LV6A 3WRXC 1OYWA 1G3QA 5DE3A 3RRYA 3IO5A 5JMTA 2WM9B 1EFCA 5HR5A 2QPAA 2FEMA 1F2UA 4M1OA 4MKFA 2FJUA 3X1YA 4B74A 3PFIA 5BN5A 2ZRCA 4KFUA 3GEIA 4D4LA 4OI2A 3TVDA 4YQFA 5JSZA 4MYTA 2C8VA 2D4HA 4CGZA 5AUOB 4JLDA 1SKQA 4EPWA 2HLDA 3IBGA 1NVUQ 2V8OA 5B58C 2B92A 1K8RA 2R6AA 2ZVPX 3LBNA 1P9NA 1BKDR 3CRQA 2GHIA 2YVUA 2MMGA 4CYMA 1N5IA 3ZS8A 1KSHA 1KI9A 1II8B 3Q5EA 4NONA 4S2EA 4BFTA 4DUGD 2WBLC 3W9YA 1QHYA 3ICQB 2QP3A 3IHLA 1KK0A 3ZYCA 3MWKA 2IYRA 1FZQA 1TX4B 2C9OA 2CHGA 3N5CA 1OFIA 5JBQA 1ZUHA 1NMXA 4RY2A 4JLMA 4DDWA 3O47A 4B76A 3EA5A 2AWOA 4TSFD 1LB1B 2IWRA 3RDPA 2ZI7A 4WAUA 1H8ED 1PJRA 4PPGA 5FOXA 1C1YA 3WP0A 1SVLA 2W6JA 5EE9A 2F43B 1HH4A 3UXMA 4U00A 2SHKA 1U8AA 3OIUA 2V1UA 3Q72A 1E79D 2IUUA 1DAIA 5FBQB 3C14C 4M9XA 3SJBA 4QKQA 3ZIAD 3P4XA 4ON9A 3I72A 4QBGB 3U5ZB 2IS1A 2JLUA 1KJWA 2ANBA 2ODNA 5BWMA 4GMDA 4LYAA 3C7KA 5CIQA 1IXZA 3EAQA 5J5CA 2DFTA 4A8JB 1G41A 4KITB 4V03A 1S8FA 1KI6A 4QJ3A 3V4RA 2FGJA 4HAZA 5FUVA 4OHVA 3CUEF 3OFND 4FXPA 4XVUA 3DKVA 2WWXA 4V0KA 3UK6A 2BKUA 2GXUA 3OZXA 2QROA 5K8UA 5L3QA 2FV8A 2QRZA 2X77A 2VP0A 1P73A 1DAHA 3W6OA 2IS6A 1N6RA 3ZZ0A 4BLRA 3B13B 1RRPA 1EK0A 4K81B 4TLDA 1R5NA 4NP6A 2VF7A 1SXJA 2YINC 3LFUA 2ZRMA 1OXUA 2ZS8A 2BBOA 5FTJA 2NGRA 1JAIA 1GRQA 3FB4A 1VKJA 2ZYUX 3ZZTA 4DCVA 3KQUA 1X86B 4XVRA 1P2UA 2J46A 4MRRA 4XH9B 1EFRD 3QF7A 4QNRA 4Z8YA 4DLYA 1ODFA 4TQUS 1N25A 2NZ8A 1R0XA 2ZRHA 3QKUA 5JCZA 1IAQA 1N6LA 3CZPA 1XZQA 2DPXA 2NO6A 2OILA 3AF3A 4DB2A 5TDHA 2IYQA 1EG7A 2BIFA 1U8YA 4FMDB 1NI3A 4JJZA 1XEXB 1Z6GA 4OQXA 2PL3A 2ZJ2A 1CTQA 4PSAA 1XTRA 1G8YA 2VP4A 4WW0A 4NDZA 1P61B 3IKJA 3ZIAA 2HYDA 2RH5A 5EZ5A 1JJVA 1ESNA 4GSYA 4C0SA 4Q4JB 1EESA 2QT0A 1M7HA 1VYTA 2JJ1A 4NTZA 4K8OA 2GA8A 1QHHB 1PZNA 1RRGA 521PA 1SQ5A 1ZIPA 5EUMA 3RWOA 3AH8A 1AM4D 1E6CA 4AWXA 2NIPA 3CWZA 3QUSA 1KO8A 4Q19A 2GAOA 5EXPA 3VQTA 1Q0UA 3BRWD 1AN0A 2F1IA 5AUPB 2GXAA 2JLZA 1E2KA 4IKEA 2JJ1D 1DAKA 3FMFA 2H1LA 3LBHA 2GRJA 3PUXA 4QJ4A 3H1TA 2OESA 3ZLJA 2CNWD 3F8TA 1EFHA 2ZJAA 3W3AA 4JLVA 2XXAB 3T5GA 1G8PA 4B44A 2J59A 4Q03A 5A4JA 2PZEA 3V9PA 4NPHA 3LBIA 1CJTC 3I5XA 3MWYW 1XXHA 3F3YA 1EX7A 2CHVA 2G0NA 2ZM5A 2ERXA 4KODA 3EZ9A 3QG5A 1Z8FA 4M2LA 3T34A 5EP3A 5A0FA 4AYTA 4ZV4A 2WICA 1QF9A 3GJ3A 1NSTA 1Z47A 2IS4A 1JB1A 1RZ3A 1OIVA 4MA4A 2W00A 2A30A 3EZFA 3ADDA 2IHYA 3J81k 2O8BA 1ZMXA 1E1RA 3PJRA 4PTLA 1UPTA 5KUTA 3KQHA 2NO9A 2WWYA 1PLLA 2V9PA 2XJ9A 3BXZA 4JLBA 4YDHB 1W4CA 5TB5A 1Z0FA 4W5WA 1XPUA 2KWIA 2CCJA 1KO4A 1M7BA 5A5GA 2N46A 2RGNA 5CK4A 1GL6A 4Q4HB 3W90A 4Z8XA 5FBVB 2VHTA 3AF2A 3MWLA 1CJVC 4F4CA 1WP9A 1Z63A 1P4SA 1E9RA 2P5SA 3DKPA 2RGAA 1GOTA 2Z0MA 1FX0A 1ZC4A 3MJRA 1JXMA 4BLPA 4PO8A 3X1ZA 1TADA 1L4YA 1W36D 1IJFA 3CB4A 4JVSB 4HDCA 5C46F 4ACAA 3WHKA 4GOXA 1FOEB 2FNAA 1IHUA 2JA1A 2QBYA 1G8GA 2WIAA 3OEHD 5EXTA 2WOJA 4KYIB 1ZD1A 3OAAD 2PJRA 4PAMA 1M1YE 1T4GA 2PT7A 2QORA 2WWWA 1KJZA 2ZR0A 4GZLA 3TUJC 1U0LA 4ZCLA 4ERNA 5FOUA 3R8FA 2NO7A 3QKSA 5FFMA 3QF4A 2OZEA 2W2VA 1ETUA 3RRNA 2QN6A 2R6GA 3UANA 2J0SA 3VHLB 5EP2A 3L0OA 4LWZA 3A6PC 1UJ2A 2F9MA 3GMTA 4NYMR 5FPTA 1G17A 4TYNA 3A4NA 2YZ2A 1E0AA 4A0GA 2BOVA 3IIJA 4P32A 4XVQA 4ZCMA 2PCLA 1EWRA 4GP7A 1P9WA 4QM6A 3A37A 4QOSA 4B3GA 3PCRB 4DLVA 3AQ4A 3M1IA 1G21E 1TF2A 4RZXA 3REFA 5HZHA 1UFQA 3LDAA 2NO0A 2GNOA 3BJIC 4TN1A 4URVR 5DI3A 3U44B 4TL8A 1JEEA 2VP5A 4EPTA 2QM7A 5J4VA 3HU1A 4TTRA 4XIGS 4BFVA 2V7QD 2NMVA 4DCTA 2GCNA 4BE7B 4TTPA 4MKGA 4URWR 1M34E 2X8AA 4KI0A 2P3SA 1DO2A 1ZNWA 1DG3A 2IYWA 2R9VA 3GJ4A 4C30A 3KB2A 5FH9A 4N0DA 2V7QA 2ZYWX 3UKDA 4Q47A 2ZRGA 1YR8A 5KOYA 2IYYA 1CBUA 4UNQA 4JLPA 4PHHA 4G1UC 1NN0A 4IDOA 4U7DA 3GCGA 4JLOA 4TZ0A 2OCYC 2QI9C 3S1AA 1CJUC 1YR6A 4I4LA 4A2PA 2QP9X 4A92A 1G3MA 1X1SA 3T1TA 3GJ5A 1S0UA 1QHIA 3NBFA 4C0AC 5KNDA 4GRAA 4AY2A 1D5CA 1YRAA 1CJKC 4JBXA 4CEHB 4KV9A 1XPRA 2IYTA 3L8ZA 5B57C 2FE4A 3DZDA 1NSFA 3CNLA 4PSVA 3TUZC 1LNZA 2ATVA 2Q3HA 1AZSC 3SE0A 1E2IA 4TMTA 3OEHA 1MABA 1XTKA 2VSXA 4KCGA 3U61B 4PQFA 3VKHA 3SU8A 1T0JB 2Z83A 5C4GB 1E2FA 2GESA 1G5RA 2RGNC 3QXJA 3GLIE 2IUSA 4MDFA 1OFHA 3CPEA 1UKYA 1LV7A 3L82B 4C0BA 4QGAA 3PR1A 5SZKB 1UM8A 4RVCA 1LFDB 1VG8A 2WKPA 3R20A 3W5JA 1JQJC 1KDOA 2A2ZA 3IO3A 2XGJA 5KTYA 1L4UA 4HAVA 4QM7A 4JT2A 5JECA 4L16A 1XWIA 1VYVA 3VR2A 2QSYA 4LHZA 1AS3A 2FPKA 1CIPA 5JWOA 1W5TA 2AN9A 1GNRA 2C99A 3RVBA 1UBCA 2X1VA 4O25A 2FWRA 3TR0A 3EPHA 2BBTA 3KZ1E 3HYRA 3AM1A 2REXB 3QJYA 2QQ0A 5FL7D 3AVQA 4HYYA 1NIPA 3B6EA 1QHSA 1KHTA 4LYHA 1SHZA 1P7CA 1DARA 5KPDA 1W49A 4JLJA 2WKQA 4OK6A 5HTKA 2J0VA 3RSOA 2XZLA 3VTKA 1AJEA 3PIRA 3VNUA 3SQWA 1KDRA 3OE7D 2ZI9A 2WAXA 4TLAA 1FNMA 4X8LA 1BOFA 3BE4A 4R7ZA 1NLFA 3BIFA 2JEOA 3WNDA 2XXAA 2JDIA 4NYJR 2REOA 3K53A 5KNBA 2HV8A 1E4VA 1RVDA 4LBZA 3SYNA 1TF5A 3QPUA 1JECA 1W36C 3U2QA 3PENA 2FZLA 1US8A 2ZRJA 2JLQA 1H8HA 1D9ZA 2IK8A 5JEEA 1SVMA 1DAGA 2CK3A 2O8DA 3AKEA 3B1XA 4XD7A 5KNCA 4WA7A 2FGKA 1A7JA 3JVUA 3SYLA 3T61A 2CL0X 2Z6VA 2GTPA 3CWQA 3SJZA 4HAYA 2OHFA 3BORA 1PVOA 4ESVA 4PXAA 1MO3A 5E7MA 4JL8A 2Q3FA 1N0VC 2HCBA 5AK0A 5DHAA 5GJCA 4CDGA 1UDWA 1E94E 4HUQB 1T9HA 1U2RA 4PSKA 4BLTA 3K70B 1CRPA 2HF8A 2XSZD 3LQRA 2QP4A 3R7WB 4C7OB 3FMOB 3TW8B 1E9CA 3THYA 2KBEA 3DMDA 2ECKA 2R6FA 4QBIA 4OI1A 2FSFA 3KJHA 3RC3A 5JSZB 5JHGB 1T91A 4OKSA 4XSHA 2F6RA 3CLVA 5EQTA 3ZGXA 2ZI6A 2VP2A 2IYUA 1R6BX 1HV8A 3EZ7A 2BMEA 1JAHA 4D4JA 4BFZA 2CCGA 3NIBA 3QVUA 4I1UA 4RD6A 4TSFA 4AURA 4ZO4A 4D0LB 2HT1A 1T3LA 4B47A 3EIQA 1ONBA 1CXZA 1F2TB 2IWHA 4A8JA 4EFMA 5JRZA 4PZYA 3PUZA 5FBLB 3RC8A 4ESHA 1BMFD 4A0FA 4M1WA 4URUR 3AVPA 4PQRA 4C0QC 3MGCA 2R62A 1G8FA 4PHTA 4TL7A 5TMPA 1G3IA 2OFWA 4JLNA 3TR5A 4A15A 2JLRA 2JGNA 2XEXA 1S1CA 4MYCA 3KXLA 4URXR 1E9FA 3VFDA 1GL9B 2IYSA 3DM5A 5EXXA 1T8TA 4AC9A 2YOGA 3AV0B 3BWDD 3HDTA 3PUWA 3TAHA 1E2EA 3UATA 4AKGA 2J7PA 1KYIA 4NZYA 3RSLA 2V55B 3QVVA 3FKSA 1A82A 2J45A 1ZP6A 2EWVA 621PA 4WXRA 5HE8A 2CE2X 1RFLA 5FR1A 4KLNA 1R8QA 4BWYA 2HT6A 1B23P 1E2DA 2I3BA 5JHHB 4DSUA 3ZS9A 1ZNZA 2GWHA 1MR3F 2J0QA 1E2JA 1UADA 1XTIA 1C9KA 3LD9A 4LX0A 2IYLD 2XITA 3NC0C 4HZUB 1FNNA 4ITRC 4M22A 4NE2A 3SJCA 3THWA 2OBMA 1KK1A 4C0KA 3WRYC 1SXJC 4A1FA 1P2SA 3Q3JB 3SFZA 1PUIA 1Z0IA 2IXGA 3CRMA 5L3VA 1KSJA 5AUNB 4LGMA 2IF0A 1SVSA 1YZQA 5LD2B 3LWNA 1E2NA 3P32A 1J90A 2D2FA 2GILA 2P6NA 1CLUA 4EJSA 1Y3AA 3R9IA 3VR3A 4YONB 1H8EA 2UKDA 5AJZA 4DT1A 2VHJA 4MUAA 1XU4A 4PQYA 3GPLA 4I1VA 2VP6A 2H5EA 1S3GA 3DO6A 3TGPA 2VPPA 3LO5A 1G16A 1XZPA 2AFHE 2IC5A 4TLEA 1HA3A 2N42A 3TJZA 1XEFA 1S1MA 1U0HC 3SC3A 5LB2A 3GJXC 3ONWA 1NL3A 1CRQA 5EZ6B 1TUEA 2ZYVX 4QBHA 4C0JA 4F93B 1XCPA 2E9SA 3LY5A 2AK3A 1T6NA 2XZOA 1F5NA 1L2TA 1R5BA 3PEVA 4PPQA 1S4QA 4GP6A 1Q12A 4A2QA 2BCJQ 2ZRLA 5CYOA 4B32A 3GLGB 2ZS9A 1T8UA 2B8WA 2IUTA 4ZI2A 4NCKA 3W34A 4D26A 2PJZA 1NVXQ 3B85A 3Q85A 3EZ2A 2QAGB 4Q1EA 1U94A 1CS4C 2GZHA 4TL6A 5JJIA 1IY2A 2O8FA 3WMEA 1XJCA 2CVHA 3K9GA 1YZKA 4KBGA 1R0WA 4LYFA 3QXSA 4TTQA 4AYWA 2ZXUA 4JS0A 4DLZA 2ZEJA 2GJ9A 4JVNA 3SJAA 4DRZA 3L2OB 4EJSC 4P0TA 4BZPA 1FFHA 5JS8A 3TSWA 2PZGA 4V0ME 4IVRA 1F2TA 1UAAA 2EFCB 4Y0VA 4Z1MA 4KVGA 4DHEA 4FWIB 2CJWB 3AEZA 3CPHA 4C0HA 4E03A 1DPFA 2ZIAA 6Q21A 5IRCD 3GP8A 1GILA 2NG1A 4M1SA 4PANA 2HF9A 4Q02A 5L3QB 3T06B 5L3SB 3TAUA 221PA 1G4AE 3OEEA 1NF3A 1ZM2A 4B48A 2ZI3A 1E32A 1KI6B 3KQKA 4I81A 3R8CA 1AGPA 1A4RA 4II7A 1CU1A 2GF0A 3QXHA 4HLCA 5K8LA 3I5YA 1YVDA 3MFYA 2FH5B 4DCNA 1G20E 1EXMA 1FPMA 1WF3A 2RMKA 3EWSA 3QY0A 4Q4AA 1QG4A 4KO8A 3SDZA 4EQ6B 5DSZA 3VX4A 2O8FB 2KSQA 3E2IA 4B43A 3LNCA 3TE6A 3AGQA 2J87A 4US1R 4C9BA 3C8UA 4B3CA 2ZRIA 1SKYE 3HR8A 4LJ7A 3PEYA 2AKYA 4EFNA 4M9ZA 3IHWA 3VX3A 5FPYA 1DAEA 1RKBA 1XD2A 5FOVA 1BIFA 4HAWA 1RW4A 3A1UA 1SXJD 4XTCS 4IOJA 1WRBA 2ZRFA 3ZJYA 2O8CA 2ONJA 1KO7A 3CM0A 4R2IA 5ANRB 2FF7A 2HJGA 3C5HA 4QJ5A 1LTQA 2I1VB 4QGHA 4KXFB 3H0KA 3H86A 3NXSA 2JASA 4MKHA 5FOWA 3JVVA 2NOAA 4NCNA 2ODEA 3FHTA 1Q3HA 1OH6A 2BBWA 2WKRA 4BEBA 4ZDIA 4RFSB 1XP8A 5JWRA 4RJLA 3B1YA 3AVUA 3BK7A 4KLZA 1HQCA 2A3RA 3NG1A 4MGKR 4RD2A 3FOZA 4PC3A 2QSZA 3SFVA 2ZAOA 2REBA 1WQ1R 5FPKA 2FA9A 3MRSA 3D6TB 1ZUNB 4BRUA 1NIJA 2H8KA 2IW3A 2LKCA 1AA9A 3LVQE 1JPJA 1M6NA 1P5ZB 4NCHA 2C96A 1BYIA 2O5VA 3SQXA 5L3RA 3B82A 4PHFA 5E4FA 4KFTA 3UWOA 1E3MA 3MUFA 1YR7A 1M7GA 2QRNA 1JQLB 1G3UA 1Z0KA 2ZITA 5AJYA 2JLVA 5F9FA 2EFEB 3HP1A 3OESA 3GLIA 2AL7A 2WVJA 3A36A 3K0SA 2GCOA 4HLUA 3NBZC 2IX3A 4FINA 5DHFA 2YWGA 1FMJA 3DL0A 3THXB 2JIZD 2ORIA 1FX0B 5B2ZA 3SN6A 2VP9A 2YWEA 1IXRC 1NKSA 4B2LA 1ZINA 4XSGA 2JDID 3LA6A 4Q5IA 4BLQA 1KZ7B 4DCUA 2IS2A 3K0AB 4LY6A 2RHDA 1JPNA 2HLDD 2G3YA 5EP4A 2DHRA 3RYTC 4JBWA 4B75A 1E0SA 4LV8B 2W2TA 5D3QA 3KTAA 4BZQA 1EWQA 4YDSA 3T5DA 3A58B 4GZMA 4MH0R 1G6OA 2BC9A 2WWFA 2ZUBA 3IDQA 2Z5FA 4DDVA 1XMIA 2A78A 2O8EB 2XJ4A 4A9AA 2QTHA 1U98A 1N6KA 3I1FA 1D2EA 1OJLA 2C98A 3ZD7A 4MRNA 1NN1A 1QG2A 4RD3A 5FR2A 4D4MA 1KK3A 4YMSA 3QKTA 2DWQA 4AK9A 3KKPA 1IQPA 4A36A 4RZ3A 4HLQB 3LVRE 5KDDA 4TL9A 3P20A 1IN8A 3LAWA 5CITA 2ZSDA 4YMTA 1G1MA 2CLSA 5K8IA 4FN5A 4LJ5A 5BN4A 4NH0A 4JJKA 2Q9AA 2CXXA 1KSGA 3KKOA 3AVXA 4RCZA 4W5HA 1B0UA 1Z22A 3QPWA 1VTKA 1PLKA 4A6XA 5ELXA 4GPTA 2IXFA 1TNDA 3LV8A 4NMMA 1G8HA 1XJQA 1XF9A 5DI3B 3VAAA 3U44A 4W9MC 4BGDA 5G40A 2Z4RA 4A0HA 4Q7JB 3L8YA 2IXEA 2H57A 3BBPA 3K0CC 3QBTA 3EC1A 2V4ZA 4LOAA 1Z6YA 4IOMA 5DISB 4OI0A 5KYKA 2H16A 3UWKA 4AYXA 2AX4A 2DY1A 3Q8XB 4Q1CA 1NP6A 2ZE8A 4OQNA 5TVKA 4CT5A 1NY6A 4E22A 3AVVA 1N6HA 3P1JA 3MAAC 1TTTA 4EPYA 1A1VA 1GKIA 3HPQA 5FTNA 3Q9LA 1F6BA 2ZUDA 1VCOA 2ORVA 3K9LA 3DHWC 2WPDA 3KUCA 4L8GA 4OK3A 3AF0A 4P33A 2GVZC 1SHKA 4YXWA 4F4IA 3ZQJA 1CKEA 2DCUA 3BH0A 3FYHA 5G3YA 3E1SA 1UKVY 4M53A 2F1JA 4FI3C 2GJSA 4OBEA 4PFSA 4YLGA 1OB2A 1W0KD 3X1WA 4PZZA 3W3ZB 3DPUA 1IBRA 5FUXA 4CW7A 5E3HA 1VG0B 1P9RA 4OQLA 5DNYB 1YRBA 5GJVC 3BERA 2FOLA 1HE8B 2F7SA 2J41A 2OLKA 1NNEA 8OHMA 3PUYA 4JL6A 4L4UA 3SBEA 3Q5DA 1OB5A 4OYHA 1K5DA 3K9HA 5GJBA 4TLBA 1ZIOA 2IYVA 1K6MA 1V5WA 1XRJA 2VEDA 3HJNA 3B1WA 1IJEA 1XMJA 2ODBA 1H65A 3VKGA 1NMZA 2YOFA 3H84A 5E95A 2OCPA 2R8RA 4H1UA 1N0WA 5DN6D 1X6VA 2Q3MA 1GKUB 1AZTA 1R10A 3VR1A 3RS7A 3LLUA 3ICEA 2C9CA 2FEOA 4CT4B 1XPOA 1KTVA 1NVWQ 2VH5R 4AKEA 1S9HA 2IL1A 1W4BA 3D8BA 3DZ8A 3O8DA 2F3TA 1Z0JA 2FSIA 4RD1A 4HDQB 2O8EA 2PLFA 1G5PA 2FFQA 3CF0A 3P4YA 4BLOA 5KSOA 1IOZA 1G5TA 1LF5A 2P6UA 4EPRA 5CK5A 3HYTA 4A0RA 4LJ4A 3B60A 3WYGA 1MRNA 3GJ0A 2B7CA 3IQWA 1O87A 3SR0A 3TK1A 4C3ZA 4JBYA 1E2LA 4TMWA 2QPOA 5C18A 2O52A 4A8JC 4P4UA 4UNRA 4C0LA 2A5YB 2Q21A 3D7MA 1QHXA 1T0HB 1YZGA 2XZPA 4R98A 1G9XA 2C2HA 4EAQA 2ZUCA 5KSPA 3ADCA 4OHWA 2AD5A 2BMFA 4LI0A 4Q66C 1W0KA 2YWFA 2EFGA 4US0R 3MWJA 1J2JA 1J8YF 4QRHA 1M8PA 2GF9A 2UZ3A 2QAGC 4L9WA 2C95A 3FHOA 3WMFA 1OXTA 1OYYA 2MMCA 5KO2A 5DGXA 3OIVA 2MSDB 4DUGA 4ARZA 3ZVNA 1KI4A 2AHOA 3CX7A 4QHTA 1DAFA 2ZRDA 4PC2A 5SZIA 4CEIA 1ZVQA 2QMUA 1Q20A 1KI1A 2EWWA 1OXVA 2WHXA 4RKFA 4EJSB 1RYFA 4P31A 2BMJA 2DFKB 2QU8A 3KJGA 4W7SA 1MV5A 2CNWA 1G3RA 1CR2A 1MO4A 4RD0A 3T35A 2VA8A 3FWYA 4BFYA 5TXGA 1IM2A 2YC4C 5GADl 3F0TA 4IDNA 1ZC3A 2OFOA 5F2EA 4Q7LA 3THXA 1XX6A 2P67A 4HI0E 1R4AA 5SZHB 1GWNA 3RNLA 4PR0A 4MUBA 2VTKA 2IBMA 5DO9A 1COWD 4U02A 1D8TA 2ODWA 4OQFA 4LC0A 2GCPA 4UXHA 3T12A 4KBFA 3I3SR 1J70A 1E1QA 1GVNB 4BFUA 1U9IA 4G5OA 3CRW1 5FBRB 4RZ2A 1Z07A 1JALA 1MT0A 3R9XA 4Q1FA 5H1YA 1LVGA 2XTNA 2OO7A 3RHFA 4BEJA 4ZIRB 3EZ6A 2QL6A 4PC6A 3UMSA 3V4FA 3MSXA 3PXGA 4DLWA 1L7VC 2QAGA 1LW7A 1OXXK 1UKEA 4JL5A 5DLQC 4X8HA 5C4MA 5KSYA 2P6RA 3K09A 3KFXA 2AK2A 1E9BA 4MYUA 1GNQA 3GLFE 4OI4A 1N0UA 1JNYA 4CF7A 2PH1A 3NBXX 1I2DA 2Q0HA 1OH8A 1W36B 5LDDC 2W6IA 3V00A 4Q4LA 5IDVA 3IEUA 2G77B 2ZRPA 3B9QA 2R65A 4DJTA 2ATXA 3B2EA 1SVIA 4N0EA 4M4SA 1D6JA 1FUKA 2PBRA 2BJVA 3AVYA 1G7SA 2JAQA 2QGNA 2VHUA 1BO6A 5KPJA 3GLHE 1KKLA 3AVWA 1ESMA 5CJ2A 2A5DA 3CKLA 1R0ZA 3ZVMA 1P6XA 2CMKA 2HJVA 1U99A 1WA5A 1L8QA 2AKAB 1CR4A 1WCV1 2WJYA 1LY1A 4B2IA 2EQBA 3RS2A 3A1SA 2F43A 1CR1A 1EFRA 2G1KA 4OL0A 4LHXA 2CEAA 4LDJA 3TMKA 2DB3A 3GFTA 2BWJA 4Q1DA 4P3YA 4DKXA 1W47A 3KKNA 4KJZA 1KNQA 1OXSC 3QKRB 3QXCA 2RGGA 4ARZB 5CDFE 4PO9A 3VNVA 1HURA 4P4TA 1KKMA 1NVVR 3RS5A 1XXHB 4NL4H 3C16C 2W83A 4UNSA 4CIDA 4NCIA 3TNFA 3OFNA 1NMYA 3IQXA
chains in the Genus database with same CATH superfamily
3NM4A 1JJAA 1A50B 1U1CA 2D8AA 3CRVA 1ISGA 3PHLA 4MOWA 4ZT2A 3VNSA 9ABPA 4FMCB 4HVTA 1NUSA 2B5WA 3UC9A 3KTAB 3BFXA 1U0RA 3RRZA 2GYYA 5JY1A 5CLGA 3I9KA 4OTZA 3ND9A 3VYSB 3SHFA 3X1XA 2TYSB 3GRVA 1A8QA 4KQCA 2UYHA 3RCBA 3DLCA 5AK5A 5JCOA 4EK9A 1D2NA 2PH5A 2ZUVA 3EMVA 3O4JA 2QT1A 3L4EA 4WCDA 1QX3A 3UW1A 2Q5OA 2X6RA 4G4SO 4QICA 4ND8A 5I4KA 2OCLA 4DNQA 1AK1A 4QODA 2R2AA 3HR7A 3H97A 1XQ9A 2XNDD 6YASA 1EFTA 5T3UA 2VH1A 1V37A 1O2DA 2PIAA 3K5IA 1B6TA 1N0IA 5JDCA 1HNXB 5JS7A 4JUAA 4JK3A 3SXPA 4BNDB 3SS7X 3VAZA 3KTDA 1IMOA 3R0IA 4JWTA 1BTOA 3TL3A 3VTFA 4A5OA 5BW4A 3QNMA 1ULTA 1CJMA 1YZHA 1JXOA 1BC5A 1J9ZA 1A2BA 1U81A 3WS7A 4B35A 3VNQA 4P83A 2JGDA 4HDMB 1RAAA 1VP9A 1E63A 3GP5A 2XA1A 4GT1A 3FDIA 4XRRA 4YY3B 2PJDA 1DC3A 1LRJA 4LZZA 4N6OA 1Z7WA 2ABWA 3WQSB 5D6OA 2PNFA 4WOPA 4IX9A 2B2NA 3OEED 1RKXA 4P93A 1YFLA 1DOHA 2QZPA 4B3DA 5BURA 2PGDA 3TTYA 4BVGA 2BF7A 4MHOA 2RB4A 3W05A 4BNYA 1HPLA 1PZEA 3EDRA 4L5CA 1DRUA 2F1OA 4UNPA 2VTBB 1J20A 2MJLA 3SICE 3MRVA 5IH7A 2QW0X 2Z56A 4Y6LA 5DYIA 4I1PA 2B6NA 4AJ9A 1SQFA 1GHTA 4KYTA 2FHSA 1U7OA 4EY7A 1I3OA 1A72A 5DYGA 2MCFA 4DQ0A 4MEBA 4MIOA 1TK9A 1TK3A 3BDVA 2P6OA 4IIXA 2UUOA 4YI3A 2J9FA 3UCXA 3UG6A 2WSSD 1TUBA 1YJ5A 4X1IB 1UJ6A 1YU9A 4FT4A 13PKA 4RVHA 5DM0A 1KRXA 3ICPA 1SVNA 3DBLB 4RWZA 5P8WA 3URKA 2AC7A 2HJHA 3QU7A 4BNGA 4I50B 4H27A 3ONNA 5FTWA 3QX3A 1ZSVA 4RGQA 2VYFA 1C2YA 4K6OA 2RC5A 1E9SA 1SXIA 3UWDA 4BVBA 3D4IA 2GEVA 3DV0A 1D6NA 1K98A 2YXDA 1VFPA 1XROA 2VPZA 5JNSA 4D3FA 1A71A 1QONA 2WQZA 4GYYA 1U5BA 1TEZA 5CM8B 2Z1NA 3IR7A 5I9LA 2VVTA 2VATA 2Y71A 4TUYF 2RDMA 3MM4A 2YWCA 1HNZB 3PQFA 1P8JA 1GFIA 2OP1A 4MV9A 4D5EA 2FMUA 4XQ0A 2E21A 1XCGB 2Z6UA 3KUDA 1G6HA 2XRFA 1DLIA 3V8QA 3K35A 3TW6A 2P65A 2A5GA 1UMBA 4U3JA 1AOXA 1HYEA 5CT4A 3ZPXA 3EZLA 3KJEA 5FULA 1OH7A 3JTMA 3HCPA 2QMOA 3DLAA 1QBKC 1ZGJA 2AUTA 2CN1A 5TT0A 4DIOA 3EEOA 3P9YA 2HV9A 4PX5A 5CJJA 1SBTA 4UJ3A 5D85A 2F3RA 1NLYA 4M60A 2Q6KA 1II0A 1V5GA 5M5BA 3L0PA 3TCXB 4HMOA 3KKLA 5KDLA 2P91A 1I0IA 1NOKA 1Z4OA 1ZJ6A 4LXUA 2XWQA 4RC9A 5IJAA 2F17A 3WWCA 4BMOB 3SSMA 4WH0A 4ZI7A 3C3AA 2Q5HA 4UBKA 1F2UB 7ABPA 2DERA 1G5FA 3ZR4B 1HQYE 1UPFA 4WN9B 5AKHA 4EA8A 4OXIA 3OWOA 4EB6B 4EHBA 1JIUA 4B6JA 1V7QA 2HXYA 4HR7A 4DANA 3C45A 3OZVA 2AJCA 2NQ8A 4DSOA 3LX8A 3BICA 1FSPA 3RLIA 4BZXA 2X5OA 5DTJA 1VB5A 1U8ZA 3I5UA 2V6BA 1FDVA 3NYRA 4MUXA 2JIOA 3GJQA 3IJEB 4MR7A 5DYTA 1JWLA 3HFRA 4A8HA 2EX0A 2II6A 3GZJA 4NENB 4Y3UA 1UKZA 5IYZA 3AVTA 4L0CA 2YZ7A 2ZZNA 3C4JA 1RRFA 5HJ7A 4TRMA 3AR2A 3W5VA 3MD0A 4M0KA 3MJSA 2H5IA 3ZGVA 2C31A 4R16A 4RF3A 5AJWA 3G0CA 4G5QA 2OUKA 4WZZA 2BRUA 1ORHA 4TKMA 3RBZA 3TM5A 5JBIA 5JYDA 3CVXA 1WBDA 1GNPA 3FI9A 1SD1A 1YB5A 3CCBA 4LOLA 3WICA 5ESXA 4E3ZA 4EARA 5FO0A 1LSUA 4IV5A 5KTOA 4IOLA 5K0BA 2IHUA 4G97A 3WLPA 2YX1A 4LSGA 5DSTA 1XCOA 2DH5A 4OA5A 4KMSA 1LSOA 3N58A 3JQAD 2V6JA 2XRYA 4GE0A 5AXCA 4CI0B 1A5BB 4ZKDA 4HNVA 5K8JB 3AEKB 1QWSA 1QB7A 2XSZA 4H77A 3DB2A 3SXUA 3W8NA 2C0PA 1PNVA 4NEHB 1S2NA 3BF7A 3K9NA 3AVWA 3ZK7A 1I7QB 4TMVA 3LHIA 4DF3A 2PS0A 4IIFA 5DB4A 1Y4ZA 4Q7EA 3HBFA 3S4YA 5B12A 5JAUA 2O2IA 2Q3DA 1KH2A 2X6QA 3EIXA 3FMVA 1ECLA 2WMYA 1AH2A 3D7RA 1JMYA 1QLJA 3VKWA 1GSIA 3U7JA 3U3DA 4A0RA 3DMYA 1J22A 3AIKA 4L75A 2OFFA 3OSZA 3VH2A 1UBOS 2GZDA 4CQNA 4LE0A 1USKA 3U3XA 2PL1A 2FSUA 2JCSA 4Q4AA 4K9PA 1QH0A 4IDCA 4JMPA 2J32A 4O0MA 5T3YA 1IHPA 3RIYA 3ZCRA 3B8HA 4Q05A 2OUIA 1N2SA 1BA3A 1WEKA 4YQEA 1N1DA 4DPMA 1O6ZA 4M8LA 1H2XA 2NM0A 2PSEA 2NPOA 2I4TA 4Q9HA 4JHLA 1ULSA 1IZYA 1Z6QA 1FP6A 2GO7A 3ELWA 4MUHA 4DV4B 1KEZA 1T5IA 4CFYA 4FMCF 5JWHA 4O02B 3EARA 4AF7A 4I66A 5J40A 1HO3A 1TEVA 2QBYB 1NGSA 5DF1A 2DECA 3AFIA 2V5VA 2J9XB 4OV6B 3SZOA 3OZEA 4DIEA 3ADPA 5EYPA 4EUNA 3DT8A 3DVRX 1W4ZA 2A1TS 2X9VA 4WZAE 4E3WA 2BUCA 4KQ1A 5FPHA 3A2MA 4QBFA 3SM3A 3T7SA 2P30A 1AY0A 1DBVO 1PWYE 2IIQA 1FDIA 3A4MA 3DUFB 3FLMA 4CM4A 2E5LB 4V3BA 3CUYA 4HDKB 1MU0A 3CX8A 2G82A 3CLSD 3FFTA 5B1DA 4OGKA 4G1FA 4M1ZA 4OEHA 5TY0A 3WRXA 4QJIA 3THOA 4ZDWA 1VCIA 2XVXA 2WPDD 3CMMA 3E3OA 1HE2A 1YBHA 2WZQA 5TF4A 1ML4A 4X0EA 1VL2A 4C0XA 1C0EA 3FGPA 4MUYA 4U5XA 5E7JA 2GTIA 3VYTB 3I4LA 2WTNA 1HYGA 4MW6A 5F73A 1ZUNA 2FXVA 3IUNA 1BS2A 4A03A 3EFBA 4IQGA 3QU2A 3RT7A 3EXIB 2PT6A 1J07A 1NHGA 4QOGA 2CXNA 1LV8A 4JOBA 3EVEA 5AK4A 3S28A 3VC7A 1LS6A 4L02A 4Q3KA 1CUYA 3ZWKA 3F73A 2IPAB 4M3NA 5ESDA 5ES3A 1K0UA 1NXPA 5CR9A 4BB0A 2QRHA 5LQJA 4NV0A 1T29A 1QNFA 1TYZA 2FRXA 2WJGA 1O95A 5K3FA 3ASZA 3LP6A 4DVGA 2IU0A 2H3HA 2JIBA 3CKMA 3LBFA 4WKPA 1Q6YA 2G25A 2FYTA 3SOZA 5CJPA 2RHLA 1P1CA 3G85A 2V65A 3NRJA 1JHUA 1RRCA 3AYZB 3VNBA 2XUOA 3TIFA 5TEVA 4D6PA 4BCCA 2VHQA 4Q7KA 2V03A 3CZQA 5A5FA 1FTSA 2IXDA 2DTEA 2JD2A 4ZV7A 2WD7B 5C52B 3WLSA 4ZXFA 3SEFA 1GV1A 2WAYA 4ENRA 3GD5A 5K0TA 3WMRA 1IUPA 1SCJA 1TEXA 3GNSA 2XMGA 2ZRBA 3IP7A 4LZLA 4EHNA 4FB5A 2E7ZA 1LH0A 3T99A 4G86A 1U02A 1U1IA 3CZAA 4EPXA 2HU8A 1SG0A 1V39A 4BASA 3F6PA 3QLVA 2IIVA 5BSFA 1OUMA 1QE5A 2WFLA 2YMMA 3L4BA 4G2NA 3KVRA 4H7HA 1L5OA 3B3FA 1EYZA 1GCUA 1PK7A 1ZH8A 3AM5A 3QVXA 1DPGA 4KN6A 5TGTA 3DBIA 1Y82A 3ZI4A 1C7JA 3EXHB 5L4NA 4DIDA 4QPZA 5COBA 1Y6RA 3N2ZB 3QFCA 4LSWA 3AZOA 4M87A 2OHJA 2HW8A 1GY8A 1K7CA 2W2XA 3QE0A 3GA5A 4R84A 4IMRA 1N6NA 4W6QA 4AUEA 121PA 4MINA 4RDIA 4ETWA 5LZ2A 2P40A 1ZZGA 2PIDA 3IODA 2ZXEA 1PS8A 1VFNA 4KN8A 1EVKA 3PZBA 1A2QA 1M2OA 2WYIA 3LUAA 3HB1A 4BFSA 4ER7A 4TV8B 2LXNA 5IN5A 1OKKA 5FJJA 4B4WA 4IXMA 3U7EB 3WP1B 2DQ4A 2EVWX 1VXRA 4NBTA 3ZTYA 1NDUA 5A71A 4JQZA 4F6CA 2HYIC 4ZCPA 5B53A 5CP8A 2OSBA 1BKYA 2M9MA 3DZKA 2QMHA 1T4DA 4I55A 4K6CA 1FB5A 3FKSD 4RSGA 1MJHA 1TW2A 1X7YB 2AGVA 3HJTA 1AV7A 3WHPA 5BT9A 4IJ6A 4S35A 3N53A 4UFNA 3U3RA 4EKIA 5A6VA 4TYYA 4HRVA 5DCWA 3OT4A 1W2WB 2ZRKA 1CNFA 2ZJBA 2AMJA 3D6NB 4Q7MB 1RZRD 3BWEA 2J4DA 1SZPA 2ON6A 4MVJD 1HT0A 1VB3A 2EF0A 4MTCA 4ZK6A 3FHJA 5EMKA 1ODTC 2OVFA 4I9FA 5B55A 1Q15A 1M2OB 5LA6B 1KJYA 1IN6A 3NBYC 1WOMA 4JSTA 1ATIA 3SQLA 3GGPA 5JW6A 4LY9A 5ICMA 4J16C 1H4QA 4HHEA 1JE0A 1R4MB 2WJPA 5LZ7A 1KIMA 5BUQA 3GJ6A 1FQWA 2CHQA 1W44A 4NBRA 4JH0A 3WL3A 4AX8A 2R97A 3NEAA 5CTJA 4FFSA 4Q0MA 1Y4SA 1MP0A 3TWOA 4GDFA 4P22A 3VPDA 2HUPA 4Y2VA 1IN4A 5C7LO 3F49S 1WSDA 4M0UA 4CM5A 1ZVVA 1V8BA 4IPTA 2XUQA 2BYTA 5AM4A 3O5AA 3GPDG 1N2HA 4PQEA 1S7GA 2ATIA 1OY1A 1R6XA 3IE0A 1NUUA 2R1ZA 4TQAA 2JFVA 1IZZA 3JWJA 3FRHA 4NNJA 4IDHA 4ZIRA 2IHKA 3ZQ6A 1ORVA 1E5QA 2IT1A 1YT5A 2HFJA 5AKXA 1LDEA 3OQNA 4DT1B 4BNJA 2H0RA 1MUUA 1GRRA 2RHMA 4FZVA 1QRDA 2A6PA 4BECA 5IZ4A 1BH2A 3E03A 2I2CA 2YMLA 4CQLA 4OHFA 2Z43A 4A4DA 5I9TA 4B87A 3CLRD 2AN5A 1JJBA 2IHVA 3HZZA 3D2BA 4R2KA 5IC4A 4KX3A 4ARBA 1MDFA 2QXUA 1IY1A 1EJ2A 5LQCA 2MR5A 3ON5A 1JMKC 4IH4A 4ZHQB 3NVAA 1GRVA 4B0OA 3JRNA 3BGSA 3IP5A 3P71T 4IS2A 4RTNA 2AD1A 4ZEVA 1XLTC 1GZ7A 1PW5A 3I52A 1Z0SA 3O95A 4CMKA 2R7AA 3EWNA 3ZWWA 1ZL0A 2OCBA 2P9QA 4JYBA 3T3EA 4K6HA 1JAYA 4BCDA 3BB3A 1NXWA 1UBEA 3TRFA 4EDFA 5KVVA 5BSRA 5D5PA 2YTZA 5FI0B 1B8VA 3V8EA 4QXAA 5DHPA 3D9QX 4AG6A 1T4CB 3EG5A 3W8DA 4EPVA 3OI7A 5BMOA 2YIMA 1ENPA 4RNCA 3ZWDA 1VGRA 4MVCA 2UZ1B 4WASA 3PX7A 2X4DA 1GL7A 4XDYA 1C7QA 2FMHA 4E1BA 1I4TD 2DXIA 1N9KA 2A59A 2X86A 1E7YA 3HGQA 1EP3B 1HYHA 1CY2A 2O19A 2JFHA 2QN3A 3AIMA 4NK5A 4W99A 1PDWA 1ISFA 5H8WA 1ZN2A 1X1RA 3T8YA 1FTGA 4ZYYA 4EATA 2C3PA 3WKCA 4F5WA 5IT5A 4KAFA 2AJTA 2XEDA 1WXQA 5CGQB 3CIOA 3FZNA 5HE9A 2XOEA 3H1EA 1ZRSA 2E87A 3NASA 1Z0DA 2GPWA 4TVBA 5EEHA 4ZMSA 1SVUA 3C1OA 4V0NA 3VPAA 2GARA 4MYHA 4Z54A 3TH5A 3G1UA 4PNPA 3TCNA 3W5IA 2B1RA 1YI0A 3Q87B 4O4JF 1Y1LA 1C0PA 4FD2A 2I54A 4WSOA 2YIDA 3W6NA 1VJ5A 1Z75A 5IJ9A 5JSKA 4PX3A 4DL9A 1E6UA 1T3SA 2DG2A 2NUPB 2PMKA 3UMCA 4OX9B 3VGPA 4L15A 2P0EA 2G71A 2OFXA 2RI0A 2QOEA 1EDZA 1R5OA 3IRVA 3GXBA 4B6GA 4RLFA 5F9MA 1V8ZA 3DHEA 4ZEMA 1EVJA 4JQYA 3UF0A 2ZVJA 4PSCA 2RGCA 5IVHA 2X8WA 4HQLA 3RS4A 2JIZA 4AWAA 1AA6A 5I4CA 1TE2A 4BE9A 1V8OA 3FA2A 4D1YA 3HN7A 4MVJH 3TTWA 1IBSA 1PTKA 1QPGA 4LISA 1QV6A 1X39A 1QM5A 2H1WA 1IM5A 1IONA 5FL3A 4L07A 3ISTA 2OXRA 4PLGA 2EFDB 4OB6A 1F48A 2P11A 4H7EA 3BD9A 3I23A 4M1TA 3HCDA 1G18A 2AT1A 1L4BA 2FDXA 3IGFA 3KYDB 4F5EA 1GDDA 1QYVA 3STTA 3VPCA 4ALLA 5HKBA 2PSFA 3NEYA 5C9ZA 4HFNA 4ZAGA 3ZV4A 5JRJA 2ZSEA 4NF2A 4YRKA 1CUDA 1O6GA 2VF4X 4PRZA 2FPOA 4TYWA 1CRWG 5K3EA 4HLUC 2HMSA 5CDHA 3ZDZB 1PBNA 3NAZA 4AO6A 1TCBA 2J9GA 4QL3A 4HQKA 3N2YA 1JB9A 4EEKA 4CTOA 4J7UA 3I0ZA 2W0SA 4KB5A 2EIHA 4R1PA 2FDRA 4JXKA 3NM5A 3UMJA 5J4LA 3L7BA 1B16A 4MP8A 4RGVA 3NANA 1Y3CE 1FQJA 3SYTA 3ZY2A 4ENQA 4S24A 4G41A 4F5ZA 4C89A 2P5TB 1M5RA 1VZ2A 4TTAA 3SQMA 1J99A 3K09C 1TKAA 4W5JA 5SZJA 5JARA 4ZDJA 1P80A 2FPLA 1NSYA 3OUTA 2JHPA 5AT1A 3PPVA 2O0HA 2QKYA 2OXEA 1VSQA 1W9HA 1XTPA 2A9QA 2O8CB 1JHXA 1FY2A 1M1YA 1RXUA 1ZRNA 4G24A 3E5NA 4GPEA 3CR7A 4CM3A 4ZZIA 2FFHA 4DSNA 2G9RA 5I3CA 1YBAA 2B4QA 1PDOA 1V95A 3HDQA 2PLRA 1G291 2IHZA 2O50A 5IM4F 2YMQA 3NWEA 1B8PA 3F3MA 1P2VA 1FEZA 2JIQA 2PPVA 3TTTA 3RGWS 1ZBDA 3GDWA 3QKWA 1R0YA 3GR6A 1X7YA 2OORA 3QVSA 1KMCA 1XDZA 2EZ9A 2ZE5A 5IARA 4D02A 1IK4A 2R66A 3ZDQA 1GFWA 3FUTA 4FYIA 4MVJI 4Q48A 1GUAA 4H1VA 3NHMA 2VJOA 3G2QA 4AJHA 2G5CA 4B7XA 3JD2A 3GFOA 3M70A 3WWOA 1VECA 5JMPA 1FU4A 4NDAA 4CKBA 3N2IA 4DSZA 4GI1A 2VQDA 4GOJA 1JS1X 2Q2WA 4JA0A 4V0OA 4WFIA 4YA6A 4R0MA 4EKEA 3T3OA 5EJ8A 2GEJA 5FPSA 1DLJA 3EVNA 2FCAA 5AR1A 2QXYA 4F4JA 7MHTA 1NVMB 4GZ6A 5LP6B 4TLCA 3OT1A 2AZ4A 2PX6A 5LVAA 3PGA1 2W2NA 2I1WA 1E96A 4E51A 3IULA 4CKEA 3HKBA 3GPIA 1Y42X 5E9AA 1Z6ZA 1EG2A 4LRXA 2CKDA 1YC2A 3A04A 3I42A 1IG0A 3K6SA 1TPZA 2CD7A 5JEDA 1ULAA 1ANKA 1U2QA 2DAPA 3DB1A 3IIEA 3U4CA 3K0CA 2MSNA 3QVGA 1XEXA 4KN9S 4RV5A 3AP2A 1SUPA 1E2GA 2AS0A 4KXVA 1DXOA 5AXDA 3W6ZA 4MDEA 1SUSA 4GOKA 4K9KA 1N1MA 1M0TA 2C1ZA 2BI8A 2V7XA 1BE8A 4MO2A 5INTA 1XKQA 1J2UA 4RQAA 2Q5IA 3PLNA 2BEVB 4PPNA 1XLVA 4IVQA 4HGRA 3R5HA 3L18A 1WV0A 4CMEA 4X8OA 1JZTA 2ZBFA 4FYJA 4NQRA 1ISMA 3U3OA 1GNLA 3O4RA 2D7CA 3BHIA 3ONVA 5D87A 3PRYA 4HEQA 1CE8B 1BYUA 4F72A 1E18A 2WSBA 4X90A 5AWFC 2E85A 5EIEA 5TQVA 1GAEO 4KO1S 4PG7A 1J33A 1ONSA 2BSXA 1ND6A 4UC0A 1JA0A 1Z62A 2DHEA 1KOJA 1W8DA 2PUVA 2GHTA 3LL7A 4WINA 4GWGA 1PNRA 1ACMA 4I55F 4IEIA 1JHRA 3BGWA 5DGHA 3U1VA 3ECCA 1ML3A 2IUEA 3C3BA 1M5TA 1RWXA 2N75A 3ACCA 4BP1A 4EFLA 4EDHA 1GZ6A 1M2HA 4PRKA 2K6GA 1Z0ZA 4DCSA 1W85B 1GKYA 2G9UA 4KGDA 5AVJA 2FE1A 4TUYA 2M6SA 4MUMA 3IILA 3OQ6A 4X6UA 5FYDA 5JZVA 3EDQA 1KMQA 1LQTA 4BPBA 3VPGA 4PYJA 3ZEAA 4ZMRA 3FOWA 4FXOA 3KLBA 4OA8A 5EMMA 1I7DA 4YMHA 1PJAA 1Q2UA 4LOJA 2A86A 1MLDA 2VO1A 4RESA 4BJ5A 2J5BA 4JQOA 4K26A 1HY3A 3A05A 4KE6A 1P60A 2BEJA 2RSLA 5DLYA 3STUA 4REMA 1IBKB 1Y7HA 2NWQA 4XX1A 3SPXA 2DKNA 3NYWA 2ZCJA 1B1AA 1VLHA 2FWMX 2CVFA 1VE5A 4IV8A 5EMNA 3AHFA 3DZIA 4ZMBA 1SN7A 2OGSA 4E70A 5CM2Z 5H81A 5BUZA 1Q5PA 1GCOA 3VVBA 4K28A 1AKNA 3NVMB 1QTRA 2ZJ8A 1B7GO 1ZAKA 2QN8A 4GRIA 4J29A 3K1JA 4GLFA 3ZDCA 5KDOA 3NNNA 4DGSA 4DLBA 1GRNA 2NUBA 2BW0A 2GEFA 2XDQB 1T24A 2ZIWB 4OJKA 5F5XA 3OZGA 5IW8A 1LBSA 4HEHA 2PU7A 4ARAA 1DEOA 3OOSA 1C8KA 2R6JA 2FW6A 5HF5A 3UAWA 1Z15A 4HRXA 4RPGA 4Z1MD 5A3RA 4KK3A 4KSBA 1N36B 1SPXA 1VYUA 2DLCX 4HYTA 4YO7A 1TMKA 4K2HA 2QLBA 3U6BA 1KR5A 1POXA 3O3NB 3OKCA 1DNPA 3JALB 1U9ZA 3DJYA 2JKVA 1W1WA 3JXEA 4QX6A 1NBME 3HJCA 3DE2X 5FI1B 3E18A 4BKPA 2J33A 3TQOA 3EPLA 2QD2A 1K4MA 2BZSA 4BVHA 2WC1A 1U7HA 2ZJYA 4HSGA 3LIPA 4PC1A 2WINI 1S9DA 4HNAA 2D54A 1WUKS 1D2AA 2WT8A 3FI0A 3AERB 5T4BA 1WMBA 4ZANA 3GN1A 1YQDA 1PGOA 2L19A 1YCGA 4V24A 4IL5A 4GP9A 3K9QO 5E7QA 1PTJC 1FPQA 1JYSA 1MFPA 2YNMA 4Q1BA 5BSHA 5IASA 3FLAA 821PA 3UC5A 3RRBA 2OYRA 3WDLA 5DHQA 4E33A 3ZJVA 1H5UA 1C4OA 3L4KA 3UT0A 2VJYA 2ZYTX 2X0JA 4ACBA 5BYKA 2AQHA 3HBAA 3ZXXA 1W88A 3UAOA 2QVYX 3FPHA 4IILA 4RBNA 3UT5A 3G7UA 4YACA 4BNKA 1U8XX 2D5CA 2GCIA 5AJVB 3SBXA 5B4UA 1XB2A 4D0GA 5A02A 3PWKA 4WLUA 4BQSA 1AKWA 1QQTA 1B74A 3NEPX 3HMQA 5KTKA 4JI0B 1EGAA 2QD1A 5K6RA 2PT5A 2JBWA 1Q3TA 2I03A 4FGLA 5KYYB 5LU9A 3THWB 3C3WA 5JI2E 2XTZA 4OQQA 1H1TA 1OLUA 3WRWA 1IQUA 1LZKA 4QDZA 1ABFA 3RG8A 1P62B 3DBOB 1ISIA 2CW5A 2OBNA 5DEIA 4HVLA 2YWDA 4YAGA 3R7SA 1HNNA 4FIZA 1GADO 4C6SA 1N2XA 2B4AA 3TX2A 1GA1A 2ZTVA 4KIGA 1S02A 1SQGA 3KM0A 3N07A 1JDJA 4R4JA 3DOFA 2VBCA 4PGGA 3HI4A 1YHNA 5BW8A 3WIUA 5EMJA 1IB6A 1LSJA 1ZK1A 2IP4A 1YK0A 5KU7A 3IIMA 2DFNA 1R2QA 4P3NA 1O03A 3QM1A 4PFJA 3W9UA 3AUXA 1AKEA 1GPLA 2EJBA 3LCVB 5AXBA 3UTCA 3H5LA 1KL7A 3P9PA 5JS2A 4BTLA 3IIIA 3F90A 4ECAA 3DZFA 4TT3D 3FF4A 1MO5A 1KGSA 2PUHA 4PZCA 1W5AA 4FW9A 4PZLA 5JZBA 3MUNA 4E5DA 3ANMA 3HBMA 1JR3E 3THRA 5MHTA 1DADA 1RAGA 1ID1A 2RB5A 5DCLA 3NQ41 2IZ6A 3M1YA 3K8OE 3DVAB 4MI9A 4CIVA 1FSFA 4OXYA 4BX0A 1TVKB 2C3YA 4KNWA 4OLFA 3SYMA 2VK1A 3BH6A 4CQMA 5CB4B 3HE3A 2HIHA 1JI0A 3TZBA 3W6UA 3UMMA 1E2QA 4Y1GA 3NC1C 1D04A 2M98A 3A70A 1GPYA 2N3ZA 3FKQA 1H0KA 1US8B 1Z12A 5SYMA 3G23A 4QGSA 3KE8A 3CNNA 1NV8A 3CPSA 4YNBA 2C2ZA 5D7NA 5B1HA 4B6EA 1U90A 5BWLA 2Z8XA 2J0UB 3QXXA 3ZXSA 1KMMA 1R8SA 1AUQA 3KR2A 2KE5A 5BVGA 2ONKA 4LVNA 5HF6A 1UXIA 2HMTA 2YFHA 3FNFA 1ZH2A 4IRUB 3WY9A 3G5LA 4C0WA 3H9BA 3BDIA 2NW6A 2Z4SA 3OTQA 1Z5ZA 4O2AB 4AJPA 2DP4E 4R81A 1Z4NA 4NS1A 1AB5A 1TQ4A 1Y3BE 1YJXA 3JD0A 3N0XA 3NHYA 1XP5A 1JZQA 3RU3A 1E79A 4EX7A 3OHSX 3QG1A 1JR3D 1I80A 1FLAA 1PFUA 5DW3A 3VSDA 4ARUA 4KR7A 2R8ZA 3AJ8A 3WL8A 2FHPA 2P8SA 1NKTA 3EVFA 2XGGA 4LI3X 3MMNA 4XZ3A 2CWWA 4JBGA 3DD5A 3GUVA 4LHWA 2WPNA 2NU7A 3F5DA 3A6GA 3MINA 2ZYGA 3SX0A 2Z9CA 1PN3A 2GASA 1XAIA 1K5GA 3QJ5A 2GEUA 3H5WA 5JTTA 1PJQA 1ZM7A 1ZIYA 3AG5A 1UKBA 1V35A 1E0JA 4V3CA 4X1KB 2QAIA 1TM2A 3RUCA 4XFKA 1VM6A 3RU2A 1Z29A 2DPHA 4MCJA 2WU4A 3QVKA 5J63A 3TKYA 1MG5A 2VJNA 1ZHFA 3GDFA 5KJCA 1JFSA 2FP4B 1MX1A 5GGXA 2ZRQA 3OHMA 1I5RA 3CF2A 3UQZA 3L02A 5FQNA 2PAFA 1NWHA 4P35A 5EE1A 1TEHA 1PR4A 2EC5A 2BLLA 2VAWA 3HL0A 3BHMA 1X0XA 4NJOA 4LWQA 1BGVA 2HWXA 2WVHA 3MTAA 1ZJJA 4KQ2A 4Q9DA 4WWHA 1RQNA 3V55A 16PKA 2W9XA 3IX7A 3NJ8A 4KRXA 1E2MA 3NRBA 3RROA 1C9YA 3BL5A 3FUVA 3GJTA 3JX9A 5DBGA 4MV6A 3G2NA 4GXNA 4RY9A 5PNTA 3VZRA 2B98A 4QGFA 2BJWA 4ML3A 3OFVA 4Q21A 3VDRA 1OZFA 1XZIA 3EQ9A 4A6PA 1IH8A 3D3QA 2AOUB 2ZJ0A 3JYPA 3WGIA 4J0QA 1JDUA 2HPZA 3WWYA 5A9SA 3Q3HA 5C1BA 3M6AA 1YGPA 2IHTA 5L3SA 2JK1A 2X4GA 4YGYA 3HUDA 4LJ6A 2V3CC 3M6LA 4PM4A 3B1VA 5DM70 1XRLA 2BGTA 5L7YA 2JRCA 5HOEA 3MT7A 1NASA 1XWFA 2IX9A 2QE7A 1FSGA 3BULA 3EGIA 4Q01A 4WJKB 1EM8B 2C03A 1TQ2A 1W0JA 2AI3A 3D3JA 3IT3A 3TZEA 1E0KA 3COVA 2C8KA 2QUBA 1XZHA 3N2GB 4OATA 1JNXX 2ECPA 1UBMS 5IAJA 3V1LA 4F6RB 3KT0A 3MGBA 1XC7A 3PUVA 3WBJA 2GM4A 1VIYA 4O59O 3HKCB 1XHEA 1ZD4A 2QTFA 2W11A 3PLAE 3PYMA 1MORA 1HYBA 2PMWB 2WSSA 1CZNA 3DSRA 3C48A 4N4AA 1IN5A 4OSPA 4RABA 4YJ2B 1PR2A 2L42A 3AHIA 2HK8A 1GV0A 1OYWA 3V2HA 1QTIA 1SKUA 2C9ZA 5TSDA 3QITA 1V11B 4RGYA 3RRYA 1KAHA 2OBBA 3ROMA 5BR8B 2Y99A 2FR1A 3HVUA 4QUEA 4BX2A 3DCJA 3NT5A 4L76A 1U63A 2AI2A 2O6HA 4LW8A 2ZRCA 4KFUA 2OVBA 1JDPA 2N9UA 4OI2A 5HF8A 5CH3A 1D2HA 4D4LA 4N76A 1FFYA 1AKRA 2H4XA 3NONA 4CV1A 4L50A 4EPWA 5HQ3B 2F2TA 4RKWA 3E23A 1E7SA 3DLBA 1ZVJA 2B36A 3KTFA 1B2RA 2O57A 5FYQA 3SFTA 4C7VA 4AMBA 4OP3A 3D8UA 4ENPA 2ZVPX 1QHFA 2HMWA 2ZWVA 4ZZ2A 1P9NA 1BKDR 3K9FC 1JDZA 2R7LA 3CRQA 3VI3B 2YVUA 1M6WA 4YCNA 5LLTA 5T8KA 5E8RA 2A1UB 3TQRA 1II8B 1OFVA 4X92A 3AU9A 4XIIA 3SDBA 4PGMA 4O2AA 5F33A 5IN4A 3ICQB 3BXHA 1VZ3A 2NO5A 1KQNA 2IYRA 1TX4B 4BO2A 2C9OA 3M4JA 4TM8A 4PN3A 1JX6A 2CHGA 1H05A 3N5CA 1SCIA 2F64A 5F2OA 3ZV3A 4JLMA 4B76A 3EA5A 2AWOA 3EVBA 1UP7A 4GXTA 4RHCA 3WL7A 4D7AA 3DTYA 2ZI7A 2PZJA 5JASA 3MIIA 4TXJA 5EGNA 1Y1SA 2I87A 1PJRA 4PPGA 5TRTA 4F86A 2FX2A 1SVLA 1CS0A 5EE9A 3GDHA 4I55B 2ETXA 3H9QA 4UU1A 4U00A 2SHKA 1CNEA 4IXDA 3B8EA 5DT9A 2V1UA 1T4CA 3AR8A 1N7JA 2IUUA 1DAIA 3P4XA 3CG0A 3I72A 4ON9A 1CQIA 1WZUA 4QXMA 2VQ3A 2ANBA 5DTRA 1UT8A 5A4DA 5BWMA 4RK1A 2ZSHA 4GMDA 3AY7A 2I4LA 4LYAA 1C3LA 3G59A 4L6AA 3U5TA 4A8JB 2IPOA 1G41A 3UJAA 2EL7A 2DHCA 3P19A 4QWWA 3V4RA 4KZPA 3MTDA 5FBKA 2IVZA 3LUDA 4E30A 4FXPA 4XVUA 3B6KA 2WWXA 3DKVA 4RMNA 3UK6A 1KDZA 3R41A 3PF9A 3WLAA 1BNCA 4DMRA 5H4GA 4X54A 5TGDA 5K8UA 2FV8A 1P81A 2F3UA 4RTRA 1P73A 1DAHA 1WPXA 4J0IA 5EQFA 1IDN1 1C5KA 2VDRB 3BFPA 3PWTA 4GU5A 5TX7A 3OQIB 1WXGA 1VMIA 3F8SA 4C88A 4NP6A 1MBZA 2QN2A 4UTZA 4JJFA 4XASA 2ZRMA 3B6ZA 4WD3A 4Q6WA 5CU7A 2H7YA 1L1EA 3DVSX 1E1LA 1X92A 1SY7A 5AJTA 1N7IA 3G9XA 1GGNA 2ZYUX 3EEQA 1X1AA 3KQUA 4XVRA 2P1RA 4FD3A 1EFRD 2PK3A 2VXCA 4QNRA 2HREA 4YRCA 1RXEA 5DP2A 3DTVB 3O2QB 5EN4A 1N8NA 3QX7A 3WGKA 1NR5A 2NP7A 4JNKA 1EM8A 4YCBA 2DC1A 1CVIA 1KH3A 2ZRHA 3F47A 3KCNA 3QKUA 4OO3A 1DIOB 3NFYA 4NNPA 4CMHA 4K5QA 4DAEA 5ALWA 3MJ4A 4FNGA 4ND7A 1N6LA 1XVVA 3NP7A 3RSSA 4C03A 4UCQA 1RM4A 2FEWB 2IDMA 1U7WA 3C6ZA 1HG1A 2MHCA 2HJRA 2EKZA 2OPBA 1DDOA 3AEYA 3CO0S 1JIIA 1Z45A 2DR0A 4QDKA 5CFOA 4BNVA 1DL5A 5BNTA 1NI3A 2WA1A 1ZEJA 1FA9A 3U81A 3FTDA 1XEXB 2OV4A 3ISJA 2HLNA 3RODA 1V16A 2PL3A 1NW4A 1CTQA 4GPZA 4PSAA 3WGNA 1P9OA 2RE8A 5C1DA 4HYEA 1V5IA 4NDZA 3BWYA 1EE1A 2I7VA 4DPLA 3ZIAA 4X97A 1PR1A 2HYDA 3L7MA 4MTLA 4AZ3B 4GSYA 4ZOLB 3FCOA 1R64A 2QT0A 1NVKA 5D84A 1A5SB 3T52A 4NTZA 2C88A 4ARIA 1PF7E 2CLIB 2GA8A 3PNOA 1QHHB 1PZNA 3H0CA 1RRGA 4RK0A 5KQSA 1ZIPA 1LK5A 4ZREA 5E1BA 2Q5EA 4OCZA 1T34A 4OH1A 1IWBB 2FPUA 4GLOA 4AWXA 3OQPA 1Q0PA 3TRIA 3OFSA 1KO8A 5CXXA 2GAOA 5EXPA 2O7RA 2E4AA 3GIWA 1QORA 4RHUA 4IKEA 4BO7A 2A1UA 1Y5IA 2JJ1D 3VC2A 2UZ4A 4AMGA 2FUG6 3PDJA 1FJXA 1YS1X 1J21A 3VR6H 3RUIA 4QJ4A 4FC6A 2X4LA 1C3OA 3VNAA 3UNXA 1AQJA 1V16B 5EC8A 3CLHA 1WXHA 2Q3CA 1AKUA 5EJ7A 2CNWD 2VSNA 3U16A 2YFKA 1EFHA 3NALA 5FUQA 4LF6B 3GUCA 4G0PA 3RVJA 1LDMA 3W3AA 3REQB 4OYLA 2X6TA 1AVTA 4X41A 2QRVA 4JY7A 3IJRA 2BJHA 4Y67A 4LIPD 1U0SY 4O4HF 2PH3A 2GPAA 4MARA 4YJGB 2PZEA 3C5WP 1IZ7A 3LBIA 1WNTA 3I5XA 1XXHA 2GNPA 4KE9A 3ESAA 2G0NA 2JH9A 3UJPA 1RZUA 2J3LA 1G4HA 4TWBA 1GSAA 4K6GA 4XYGA 5J43A 7GPBA 1Y8ZA 4QECA 1B15A 2XUIA 2WICA 4V0SA 4XQ9A 5A5VA 2YYYA 1KFBB 1NSTA 3A6HA 5B3JC 2JI8A 4AJNA 3D0RA 3RASA 2FPXA 2PWBA 3IVRA 3UHOA 1N75A 4PZDA 2HWWA 2XCOA 3P9IA 3WO0A 5C8YF 2O8BA 1ZMXA 1E1RA 2WLSA 4WFKA 3ED5A 3WSWA 4YJGA 1IWPB 2NO4A 2QD4A 2Z1MA 2OD9A 3BXZA 3CN7A 4J0GA 3M2PA 1NUHA 2IP1A 2Y1LA