3F3YA

Crystal structure of human cytosolic sulfotransferase sult2a1 in complex with pap and lithocholic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
282
structure length
282
Chain Sequence
DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title rystal structure of human cytosolic sulfotransferase SULT2A1 in complex with PAP and lithocholic acid
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Bile salt sulfotransferase
total genus 101
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3f3yA00
2EWVA 1C9KA 1QZXA 3JZMA 3ZLJA 4HB3A 4KYUA 3I4LA 1NIPA 1ZIPA 2P5SA 1EWRA 1EFHA 4Q4AB 1Z6GA 1OKKA 4TL9A 5TY0A 1TAGA 1T3HA 2PJRA 3CPEA 4ACBA 4TN1A 4V0ME 5EUMA 4F4IA 2EFCB 4B2PA 2JAQA 4AKGA 3GJ0A 1VG8A 4C3ZA 4DB2A 4LJ9A 1JQLB 121PA 1XWIA 3SBEA 4DSNA 2PLFA 3F8TA 5CDFE 4PO1A 3A1UA 2BJVA 2QA5A 1E98A 5FTJA 4OK6A 3REGA 1KSFX 1SKYE 3QEOA 1M8PA 5CIWA 2FEOA 1ZNZA 2QT0A 3FMPB 3WNBA 3ZD7A 3RAPR 3PJRA 3K9HA 3MCAA 4A8JC 1J8YF 1S8FA 1JR3E 3IHLA 3A37A 2QU8A 3I73A 2J7PD 2NTYC 4BZQA 4QJ3A 2BHRA 4CIDA 1S1CA 1SVKA 1V43A 2P2LA 3I1FA 2ZSDA 1OXXK 4HAVA 4CEJB 1Z8FA 4QHYA 5EE5B 5J4VA 1M7GA 1UAAA 3LRPA 4LJ5A 1E0AA 4W5HA 5FTLA 1SXJB 4IOLA 3RLFA 4X8LA 2CL0X 1JI0A 2YOFA 1CEEA 5HTKA 4M1MA 1TU4A 2WVJA 1H8HD 3U3OA 1Z3IX 3AF1A 1VHTA 1L2TA 3GLIE 2ZE7A 5L3VA 3TKLA 1G5TA 2F43B 1GP2A 2GZHA 2P65A 2HCBA 3CM0A 1Z22A 5FUWA 1Q1ZA 2AFIE 2P6UA 1M6NA 1S96A 4PC2A 2QPOA 2QM7A 1W47A 2WM9B 4JIMA 1E79A 5KDDA 1ESMA 2VHUA 3KXIA 1XXHA 2UZ3A 3EWSA 2A7QA 2H1LA 2IYUA 5H8WA 1UKVY 3QVVA 1Q1QA 2IW3A 3ZD6A 3GJ7A 3KQHA 1MRSA 2QP4A 4KHZA 3HYTA 3FB4A 4PAOA 4PPNA 5FUYA 4GOKA 1EX6A 1CJVC 5LD2B 1F48A 1Z0DA 4F92B 1TADA 4D4JA 3U6KA 4BFWA 1QBKC 4U5XA 4MRSA 2F1RA 1GIAA 2V54A 2WOJA 4DLTA 1JPNA 1E3MA 5FR1A 2ZU0C 3D31A 4PHGA 3GLGB 1Q44A 4N3NA 1U99A 5AUOB 3U60B 2ANCA 1HQYE 3CNOA 3EIQA 3AF3A 3FKSA 5HKKD 2L0XA 3VTKA 3U44A 1N6HA 1ZM2A 4RZ2A 5EP4A 4OJQA 2YOHA 4NMMA 1CXZA 4PZLA 5G3YA 4NYIQ 2YNMA 2V9PA 4HI0E 2RGAA 2I4IA 2FNAA 4E03A 2ZRDA 4QM6A 1BMFA 4RCZA 3VQTA 3QKRA 1PJRA 4TMZA 1HT1E 3LW8A 3BXZA 1M74A 3OAAA 4Q7JB 5K8TA 4L9WA 4MDFA 1FPMA 3QI2A 2H5EA 5DYIA 4OHVA 2XNDA 1E2LA 3RRNA 4U7DA 4V0NA 4YONB 5FPHA 1DG3A 3FFAA 1PVOA 1ZW6A 4BLPA 4DVGA 1DO0A 1EFCA 4F91B 1MR3F 1X8KA 2WWHA 4RFSB 3ZVNA 1XPUA 1W48A 3QVUA 2ZJBA 4YMVA 3KXKA 5HCNA 4QRHA 4KFSA 3E1SA 3BOSA 2IYVA 2J5XA 1WQ1R 3RDPA 3ND8A 5FOUA 1E1RA 4B43A 2QROA 3ZVRA 1IXRC 2O8CB 1J90A 3MG9A 3GEEA 4DLVA 2AKAB 4UNQA 1ELOA 4D4LA 1KK3A 3G5UA 5SZJA 1TF2A 2QT1A 4D0LB 2W58A 4B33A 1B0UA 2IYTA 1E2PA 3TSOA 2X8AA 3U4QB 1KAGA 1W36B 3PUZA 3SJBA 3WMGA 2GCOA 3K0AA 4JLMA 3EIEA 1TPZA 5GJWC 1IY1A 1P9NA 3UG6A 4BFSA 1IJFA 1RYFA 3HPRA 5IK2A 2PEZA 2IS6A 2OT3B 5KPJA 2FMXA 1KI4A 3W5JA 1WBDA 1NKTA 5JRZA 3IQXA 1B23P 1ODFA 1R8SA 1XTJA 4G5GA 2DBYA 1KGDA 3HU1A 5DGXA 3Q5EA 3RRMA 1HTWA 1P9RA 4R7ZA 2HJVA 4F38A 3CRRA 5CM8B 2VQSA 3P27A 3RS0A 1G6HA 4I1VA 2OZEA 4C0AC 3QY0A 1W5SA 3DKPA 3K0FA 1KSJA 2ZUCA 4HDOB 5FPTA 3BGWA 3NTUA 3MWLA 3SYNA 4JBXA 2FPKA 2BV3A 1TNDA 1DS6A 3LO5A 3SU8A 2VP4A 2QMOA 2XJ4A 3ZS9A 4D81A 2OSBA 3CF2A 4PO8A 5DH9A 1OKKD 1LF5A 2F43A 1BIFA 4BRUA 5C1BA 5FR2A 2BBTA 4V0MA 4YQFA 4PPQA 1Y63A 2PJZA 4JLAA 1MKYA 2ZJ5A 4PC7A 1LS1A 4Q4JA 3QF4B 4M1SA 4IRUB 4EDHA 2FSHA 4LBVA 3RRYA 1NMXA 4HATA 1FTNA 1P7CA 3MLEA 4IW3B 1KO8A 3TUIC 2ZUBA 1XXHB 1YZTA 1Z2CA 1AQUA 1EG7A 1N5LA 3VNUA 2EU8A 3TK1A 2BM1A 2HJGA 2BDTA 2IK8A 4CEIB 3UIEA 2HT6A 2CE7A 5G40A 4R2HA 1FTSA 5EXTA 3NHBA 1LB1B 4P4TA 4DKXA 3TMKA 1XD8A 4ZKDA 3GJ5A 1Z63A 2ZJOA 1R0ZA 2W0SA 2VEDA 5CLQA 1TUIA 5JEEA 4XOIA 3BB4A 2O8EA 2P6RA 1Z29A 3NDPA 5L3RA 2J45A 2OHFA 1T3SA 1D9ZA 3K53A 3I3SR 3C14C 4XTCS 3UK6A 4TLBA 1TMKA 3X1DA 1II9A 1KK0A 4B76A 5F3WB 2IHYA 1QHHB 1F60A 2XOKA 1Z0KA 1IXSB 4M1YA 4F7WA 2PCLA 3L43A 3OHMA 4Y0AA 4FWTA 5GADl 1XU4A 3N5CA 2C9YA 3A1WA 5D3MA 1JQJC 4M21A 5BW8A 2QY9A 1E1RD 4B6EA 4NBSA 5IRCD 1N6NA 2AK2A 3OESA 2J41A 4LBZA 3CUEF 1JR6A 1G3IA 3IILA 5TMPA 5EP3A 4TZ6A 3Q5DA 1II8A 5AUNB 1E9DA 2Q3FA 4I1OA 2BWJA 1U90A 2D7CA 3NEJA 4ITRC 2OLJA 4PC3A 4DUGA 3K09A 1GTVA 3I92A 3I5XA 2B7CA 2KE5A 1K5GA 2XNDD 4PC1A 2QRZA 4KSCA 3WY9A 1SGWA 4Q9HA 1VIYA 5FBRB 4C0HA 2VBCA 3OAAD 2CHQA 1LY1A 3WMFA 4I4LA 2FG5A 4A2PA 1W0KA 2BVNA 4P32A 1VKJA 2C5LA 3BS4A 2O8BA 1TF7A 2J87A 3QBTA 2OAQ1 2Z5FA 2NO6A 1AGPA 3FHOA 2ODEA 3F3YA 3K70C 4NPHA 1Z06A 3IIKA 1Z0JA 1ZUHA 4N0EA 3CH4B 3CKLA 2RGEA 3VR2A 3EZ7A 4IDPA 3PG5A 4C30A 3FKSD 5HKKA 4QC2A 1U8ZA 2XSZD 4HB4A 4LC0A 1S0UA 4Q7KA 4QJ5A 4A6PA 2GCOB 2JJ1A 1U0HC 2BBWA 1K5DA 1N5IA 1XEXA 4AG6A 4ZDKA 1KNQA 2EW1A 2Z4SA 2ZI4A 1X8LA 1QF9A 4OQNA 4ARZA 4KCGA 4DSOA 2VP9A 1W4AA 4KV9A 1F2UA 2QNRA 5EP1A 3VMFA 2YKGA 4BLQA 2W6JD 3Q3JB 3UKDA 2QTHA 3GJ3A 4RY2A 4LPSA 4HDCA 2Q9BA 1NMZA 1J99A 1C1YA 4GPTA 1KY3A 1UKZA 1E32A 4PQFA 1WF3A 4QBHA 5CM9C 4ZV4A 3A4LA 1P60A 4Q9LA 1FX0B 3GMTA 3VR3A 3RS4A 4Q9JA 5BYKA 3PEYA 3BH0A 2J0UB 1CF4A 2OESA 3W6OA 2QSZA 3SN6A 4LK2A 3EPHA 4H1UA 3C5HA 3THXA 1FP7A 4A8JB 3UPUA 2IYLD 3SE0A 2ZEJA 2GCPA 4TSFA 3BAFA 1IN7A 2HCJB 2ZRNA 3WYFA 2IS1A 1MABB 3ZDQA 2JLQA 5AJZA 2DY1A 1OH7A 3AVQA 3C41J 3V9PA 3QXSA 1OIXA 2IYRA 3D3QA 4DLSA 2GK7A 1UKYA 1T3LA 2OCPA 3LBIA 5FI1B 1A4RA 3LNCA 5J5CA 1M34E 1D5CA 2IT1A 4FI3C 5JI3E 1E96A 3GLHB 2JLXA 2ONKA 4PQRA 1KY2A 1KK2A 2IXGA 2NMVA 4A2WA 3I8XA 5AUPB 2JIZD 1QRAA 4IFBA 1YZKA 5GJBA 4G5RA 1OH6A 3RS5A 1AZTA 1G8HA 2AN9A 3PITA 3LD9A 2GXSA 1XTSA 4XIGS 2G0TA 2EFGA 3CZPA 3D6TB 2PZFA 3OIWA 2DFKB 1CR0A 1ZNWA 2EFDB 2I1VB 4A4DA 5E3HA 4L5BA 4DRZA 3U7GA 3AVXA 4ZO4A 4MITA 4A0RA 5EZ6B 1G3QA 3LLUA 3V4RA 1E2FA 2PT5A 1KO4A 4TQAA 2ZR9A 1XD2B 2VHJA 1VECA 4HLCA 1TX4B 1CR2A 2XTNA 2HXSA 4IFEA 3A58B 2DFNA 2F1HA 4J0QA 4F93B 2H57A 2ECKA 4B75A 1D9XA 2RGCA 5FTKA 1UBCA 4HUQA 1E79D 4S35A 5DE3A 2XAUA 4KBFA 1E9FA 2NIPA 3NBZC 4EUNA 4D25A 4F4CA 3K9GA 2F1IA 4HLDA 1KI3A 3N2EA 3K70D 4NYMQ 1NSTA 1JXMA 2ZS9A 2QMEA 4ABYA 3QEJA 4MKGA 4OI1A 3C5CA 5KNDA 4DLUA 2CLSA 4PFSA 2DCUA 2ZJAA 3H86A 4DSUA 1E9CA 3P4XA 1VPLA 2JGNA 3WBJA 4TTRA 5DI3B 1G8YA 3CW2A 5TDHA 3QKSB 3GLGE 1Z5ZA 2J7PA 4C0JA 2F55A 1N3BA 1KZGB 2G0NA 2CK3D 4A2QA 3R9IA 1DAMA 3GJ4A 3RNLA 1JNYA 1ZD1A 1VHLA 2PZGA 4JVMA 4MYTA 4MGIR 4CW7A 4US0R 1XNJA 3QOFA 3SI7A 3UANA 4YLGA 1KYIA 4HDQB 2O0KA 1XDBA 4ZI3A 1OXVA 2YINC 2QENA 3KB2A 2B8TA 4JBYA 5HZKA 2O0JA 4M1KA 4N0DA 4URZR 4ARZB 1VCOA 1SXJA 2WSMA 1PV4A 4FINA 2ANBA 1OHHA 1E0JA 1RPZA 4LWZA 5FBQB 3B9PA 4JLJA 3U7HB 3C8UA 4CEHB 2UKDA 4UKDA 1T0HB 2GF9A 1M2OB 1CJTC 2ATVA 1XD9A 1NSFA 2B21A 3SZRA 4FMBB 5L3SB 1UADA 4M4SA 4RD6A 2FOLA 3CH5A 3VFDA 4QNRA 4QGFA 2UVQA 2J0UA 3AUYA 2O8FB 521PA 3EA5A 3THXB 3MWJA 2ZI7A 2ZRMA 1G41A 4DJTA 4R2IA 2XB4A 2C98A 2JLYA 1E2EA 4U02A 4PSKA 1PLLA 1N25A 1OFUX 4ZDWA 1KI2A 4M9QA 3O47A 2ATXA 5CITA 5H68A 2WJVA 5BXQC 1CTQA 5CDFA 1OIVA 2D74A 5DHFA 3AKDA 1G8FA 3AVWA 3AVVA 1TQ6A 4TT3A 1CLUA 2DWOA 1R0WA 3ICEA 2GETA 3L8YA 3T1VA 1E2NA 4P0TA 1E2MA 4KXFB 2FFHA 1XP8A 4RZ3A 3PEVA 1DG1G 5EXSA 4A82A 2N46A 1D6JA 1HH4A 5AWFC 2ZJ2A 4MKFA 3OFNA 2I3BA 5KU1A 1E4YA 3THWB 2R6FA 2V55B 3IBYA 2BJWA 3EC2A 1VTKA 1D2MA 2A5GA 5JLJA 4HAYA 3SS8A 2J59A 4BGDA 3QKRB 3IO5A 3TAHA 3MD0A 2J7KA 2OCBA 4Q7MB 1N5JA 5IDVA 3VKWA 1ZCBA 1Z0IA 1NVVR 3U6BA 1O87A 1WCV1 3LVRE 4TLDA 1A7JA 1RC8A 1DVRA 5BWMA 3J81k 4LZZA 2BBSA 3GLIA 4YMTA 2OE2A 2XNSA 3ASYA 2VF8A 4V0LA 2JA1A 3A4MA 4JBWA 2ZETA 2RGDA 1JECA 4LJ6A 4BLTA 1E1QA 3BK7A 1ZBDA 5B64A 1LS6A 3KUCA 2F7SA 1JEEA 4BFUA 2XTMA 3EG5A 1XFAA 2GTPA 2PLRA 4LV8B 3NBFA 4YMUA 3SJZA 1E9RA 3E2IA 2QGZA 4A1FA 4D6PA 4URXR 1UKEA 1I2MA 3LQRA 2CCGA 2REOA 2Y8EA 3B5JA 1YZUA 4G5QA 3PEUA 2R6GA 3FGNA 4WXPA 4F4JA 3QPUA 3KQUA 3DDCA 3I8SA 4QNMA 3WMEA 5J4LA 2CNWD 2IBMA 1TEVA 3X1YA 3KKNA 3RHFA 3KUDA 2HYDA 1KDRA 1VYUA 4OHXA 2FJUA 3B82A 1T5IA 4CF7A 3TW8B 1KDOA 3QPWA 1Q1BA 2Q3MA 2OBLA 3WHKA 3TUZC 4BLOA 4OHYA 1RJ9B 1U81A 1LNZA 3Q8XB 2CE2X 3DZDA 4B44A 1XTQA 1G16A 2O0HA 5SZIA 4ZCLA 3U2QA 3PENA 2EVWX 2FSIA 4Q1AA 1IN5A 4E22A 1E2IA 1LF0A 2ZRKA 3LLMA 1W4BA 1GWNA 3THYB 3GEIA 2D06A 5J4KA 1Z08A 2J9RA 1YJ5A 3TW4A 2OFXA 2PZEA 4AYTA 2ZE6A 1J2JA 4HUTA 1FL9A 2OCAA 4W9MC 2VHQA 3TR5A 3W3AA 3B60A 2DFTA 3C7KA 2D7DA 2MMCA 3T61A 3FMIA 3A1VA 1S9DA 4Q48A 1ZUIA 2F1JA 3H84A 4B32A 2JDIA 3BERA 1Z2AA 4TMXA 3EZ6A 3QF4A 5L3SA 1OH8A 2LKCA 3O8DA 4LJ8A 4P4UA 3TQCA 4S2EA 2CHVA 4UNNA 1QVAA 3DKVA 4IOJA 3PXGA 1JR3D 1GNQA 2RB4A 1OYWA 1HYQA 1S4QA 2QMHA 1OIWA 3MRSA 4NDZA 4K46A 4A0FA 3U3KA 3AF0A 2W00A 1U98A 4EIWA 1TQDA 1ESNA 4RSGA 1AS3A 3IGFA 1NY5A 1U9IC 2WZQA 4R71A 3U7FB 4DT1A 4I1UA 4TMVA 2EFHB 3B6EA 3BFXA 4B3GA 3QBVA 4OYHA 2QUZA 1NLFA 4P3YA 1BS1A 2QQ0A 3K9LA 4LY6A 2IYXA 2YWEA 3LVQE 3V4FA 1D2EA 2VLIA 2ZRJA 2E9SA 2NO9A 4PQYA 1DAFA 3KJIA 1ZP6A 2FZ4A 2O5VA 2ZRHA 4OI2A 5TV2A 1ZUNB 2PMKA 4DLRA 4JT2A 4PHHA 4LHXA 3DO6A 1KHTA 1G7TA 4DDWA 2OO7A 3DMDA 3E70C 3FMFA 4GFDA 3REFA 3ADCA 3FKQA 4QL3A 2WICA 5CK5A 3K0CC 3NVAA 3PQCA 1DAGA 4POAA 1GKUB 2FPMA 4PXAA 4BASA 2VHCA 4MH0R 3SYLA 4KBGA 1WDTA 1ZM3A 2FGKA 4B34A 3R20A 1XEWY 4FMCB 2A5DA 3BB1A 1X8JA 1OYYA 3IIJA 2IS2A 4MUBA 3S1AB 2CMKA 4JKIA 5EJEA 4GZMA 2D62A 2GBLC 4O2LA 4JLOA 1SQ5A 1WMSA 4NH0A 1TEXA 4KFUA 2ZPTX 3M4YA 5C46F 5CB8A 3W34A 1GM5A 1U8YA 1ZD8A 2WWIA 4TYPA 2WTUA 4ESHA 1JXOA 1N6IA 4LHYA 1AKEA 4TLCA 5LB2A 1RKBA 2CNWA 2QE7A 5HR5A 4B3FX 2O8BB 3KQNA 2E1RA 4IEIA 4D82A 2BEKA 4B2IA 3NH6A 2QTFA 2VIIA 4CYMA 1AZSC 3P1JA 2OXCA 3FHCB 4IOKA 4RVCA 3HP1A 4GNKA 3MUFA 4HZIA 4C7OB 3UMSA 3TIFA 1BYUA 2HYIC 1BOFA 3SYKA 2GCNA 2IUSA 3NXSA 3SEAA 1GRRA 2WKQA 2HDNB 3KJEA 3SQWA 2A5JA 4RKEA 5HE9A 4Q1FA 2FFBA 3QKTA 3W6PA 1XEXB 1Z6AA 4L15A 3WNCA 1EWQA 4L9SA 4Q01A 4A92A 4JKYA 5G41A 1CR1A 1Q12A 4M9XA 3P26A 3GCGA 2C2HA 2QAGC 3LBNA 1GRQA 3GJXC 2KSQA 3L0IB 5H70A 2IF2A 4BFVA 4CGZA 2IS4A 3NBYC 3TRFA 3ZYCA 2BBOA 3CLVA 4LX0A 2GRJA 2H92A 3X1ZA 1TUEA 3GP8A 2QN6A 5JWOA 5FPKA 2G83A 1UDWA 1IJEA 2GXAA 2IA5A 3TNFA 2GK6A 1ZRHA 2RCNA 3UXMA 4QM7A 2GEVA 3K0CA 4RD1A 4ON9A 4H1VA 3EZ9A 2QAGB 3MAAC 2FZLA 2H16A 1LVGA 1Q3TA 2NO1A 4WIAA 2XZLA 4EPWA 1HT2E 1Q0UA 1W46A 5E7MA 1I4LD 3EC1A 1TF5A 4LHWA 4Q02A 4QG7A 1G3UA 5JS7A 1CS4C 2GDJA 5HPYB 2KJQA 3DPUA 1AK2A 4B3BA 1XTKA 1ZVQA 2IYZA 3B2EA 4I99A 3ZQJA 3TJZA 1CULC 2C04A 3JVVA 2W6JA 2ODBA 1A5TA 4ZIRB 3FHTA 2QMUA 3OIUA 5M04A 2XZOA 2YYZA 2ZTSA 1UJ2A 3N2IA 4KYIB 1Q22A 1GFIA 4PANA 1MT0A 1OF1A 3WXMA 2AD1A 5F2EA 3KFVA 2J0QA 2QPAA 4LCBA 1IY0A 2G88A 3ZZ0A 2I1QA 5EZ5A 1DBSA 1JB1A 4KLZA 1XEFA 4GOXA 2B92A 2YWGA 1G3RA 4CDGA 221PA 5K8UA 1FQJA 1W5TA 3TQFA 3F5FA 3LBHA 5TXGA 3EPLA 3EAQA 5JMTA 1ZD9A 4XH9B 1A1VA 2O8DB 2WHXA 1W1WA 4DDVA 4NYJQ 3BH6A 2QBYB 1WA5A 5JRJA 2ZVPX 3UMFA 2ZRAA 2LKDA 2RHMA 4O0MA 3LDAA 1SXJD 1P2VA 3NH9A 3V00A 1Q1EA 5FTMA 4EJSA 2C96A 4FW9A 3MGCA 4MGKR 3WYGA 5F9HA 2ASEA 2QGNA 3A6PC 4MKHA 1NMYA 4TMKA 2G1JA 5C4MA 1J70A 5EE3A 2IWRA 1I4DD 2ZYWX 4CVNA 1IAQA 2WV9A 2O8CA 4G5SA 1YU9A 4WXRA 1G20E 4JJZA 1OB2A 1WBBA 3VU9A 3CRVA 3EX7C 1P5ZB 4MGZR 1X1SA 3T06B 1CP2A 4AYXA 1XCPA 3CPHA 3EASA 3H4MA 4DCUA 4UNPA 4QJ4A 1IOZA 3B1ZA 3LV8A 5KTYA 2C9OA 2QQEA 4Q4HB 1G1MA 2JLVA 4V03A 1RE0A 1KSHA 5AJYA 3GLHE 3B1YA 1G7RA 5EP2A 3CO5A 4B48A 1F6BA 4B6FA 4Z54A 4X8OA 2AR7A 1FNMA 3SDZA 3A36A 1V5WA 2NQ2C 4PR0A 5G3ZA 3IUYA 5HZHA 5KPDA 2FSFA 1KSGA 4B2LA 2JLZA 5F9FA 4TT3D 1CIPA 3IKJA 4MYUA 1IHUA 3X2SA 2V1XA 2GJSA 1KNXA 4IDQA 4OQFA 4QFMA 5EXXA 4LHZA 2OCYC 3AF4A 4C0LA 3P32A 1ZM7A 2BMEA 3BRWD 1IY2A 3WRYC 4ERNA 3CX7A 5DHAA 4M0LA 1SVLA 1G4UR 5JHGB 1HY3A 3VR1A 2HV8A 4IVRA 2FA9A 5KSPA 5BYJA 1GL6A 2NO0A 5AJWA 1HQCA 1G8GA 4NCKA 1MO5A 1OFIA 5KNBA 4Q18A 4JLKA 3KJHA 4W5WA 1MO4A 1NN5A 2F9LA 3EARA 2C9CA 1T6NA 1EK0A 3RYTC 4GOJA 4QXAA 1G18A 4WZ6A 1XZPA 2O52A 4FD2A 1BMFD 1IM2A 2AK3A 3K9NA 3PFIA 1E94E 4N1AA 3GFOA 2XTZA 4LYFA 4QHTA 3R7WA 4Z51A 3CIOA 4PHTA 4JL6A 4OK5A 1MRNA 4OBEA 2VSOA 2WIBA 1FMJA 1KI7A 4Q9IA 2ZI3A 3A1TA 4NZYA 4IVQA 3CWZA 1GNPA 3EIHA 1JALA 1YRAA 2RGNA 5DYGA 4R98A 2OFOA 4URWR 3RSOA 5GJCA 1G64A 3BFKA 1AQYA 2ZSFA 4JYBA 5JFGA 1KOFA 4TQUS 1ZC4A 1GITA 4TYQA 1P2TA 1AA9A 2HLDD 1OSNA 2ZU6A 2O8EB 4MGYR 4D2IA 3FDIA 3AUXA 1G7SA 1E0SA 4XSGA 5DISB 3GPLA 1GILA 3T34A 2D2FA 4DC9A 1G5RA 2ZS7A 5IK2D 1MO3A 1KMHB 1CRPA 4LBYA 4JLNA 4WA7A 1YZGA 5ANRB 2GZAA 1BO6A 3ZZUA 3EXAA 2KBEA 1KJYA 2GEUA 2A5FA 2GESA 4PHFA 3THWA 2IX3A 2IF0A 2G3YA 4FCVA 4RFSA 2ZI6A 2YHSA 4TL7A 2DWQA 5BN3A 1FNNA 1U9IA 2C78A 2VA8A 1U0LA 1QVRA 5FBVB 1U0JA 5FBWB 3AVOA 4LYHA 1KI9A 1E2JA 2MSDB 2RGXA 3D7MA 3TR0A 1LFDB 1SHZA 3HPQA 5BQ5A 3RC8A 4GL2A 1OXUA 5L8VA 4XSHA 4C4PA 2V8OA 4GP6A 3OEED 5DI9A 3W8RA 4TZ0A 1SVIA 1II8B 2QM8A 3HJNA 3C16C 2EFEB 4G3XA 3EW9A 4JS0A 3NWJA 4MRNA 8OHMA 1KI6A 4EPXA 4KVGA 2BEJA 2WWGA 4PAQA 4DLXA 4O25A 3QNUA 4WBSA 4UXHA 1GG2A 4EJSB 1MV5A 2V6IA 4Q4AA 1I4TD 5ELXA 1HURA 1P6XA 5J47A 3H1TA 1CRQA 1X1RA 3P4YA 2WSSA 2YVUA 1KKLA 2WJYA 3KX2A 5KSYA 1VYVA 1AS2A 3TH5A 5EXPA 2P5TB 1GL9B 4LYAA 1P2SA 3DHWC 4RCYA 1Z47A 4PC6A 1E2KA 2GKSA 3OEHD 4DZZA 3VU9B 3IBGA 4RD2A 4GMDA 2OM2A 1Q20A 2FEMA 2WJJA 2SHKA 3F0TA 4G1UC 5TARA 3MSXA 4FCWA 1M7HA 4YMWA 2DPXA 3ND9A 3ZH9B 1FQKA 3L2OB 1VG0B 1XJ0A 1YR7A 2V4ZA 4MRPA 2F9MA 3BWDD 5EE0A 1GVNB 5DO9A 5JJLA 4DCSA 1E9SA 2XJ9A 1GSIA 4KLNA 1NY6A 1QHSA 1UM8A 1XEWX 2F3TA 2BMJA 3VR5A 3QSYA 4EQ6A 5DIFA 1WP9A 2FSGA 1SVWA 4BQSA 2WIAA 4C0SA 4ESVA 1T8UA 3KKPA 4QOSA 1E9EA 3VHXA 3MJHA 1M7BA 3W6NA 2ZR7A 4Q4JB 1KDTA 4HAZA 1K6MA 4EAQA 1VCMA 1Z6YA 4EFLA 5FTNA 3U5ZB 1JPJA 4OI0A 3G0HA 3UMRA 2AXPA 2TMKA 3SFVA 5KO2A 4TMTA 5AR1A 1XCMA 3RRZA 3THYA 2D2EA 4URYR 5KNCA 2RGGA 2AX4A 4CEIA 1JAHA 3B13B 2Z0MA 1QHIA 1NN3A 2IUTA 1F2TA 1R5BA 1T4GA 1A82A 821PA 5KSZA 1R0XA 1DE0A 3I32A 3I62A 2WOOA 2ZJ8A 2R6AA 4YDSA 2CCJA 3CB4A 3GLFE 3KKOA 4DBLC 4AK9A 1AN0A 5A0FA 1OT3A 3KTAB 1GKIA 4HLQB 5KDLA 3QPVA 1R6BX 1GOTA 2CJWB 2DWPA 3AVUA 4CZ2A 1ZU5A 4AD8A 1OXTA 4BUJA 3K0EA 4UJ3A 2CBZA 4AWXA 3PCRB 1DELA 2GNOA 2ZSEA 4DCVA 1X3SA 4BEJA 3I61A 3GQBA 1N6PA 3K0SA 1HE1C 1OPXA 2Q9CA 4GI7A 3R9WA 2ZRFA 2WWWA 4EKDA 3BFVA 3O8RA 1EGAA 4B3DA 4EFNA 1NBME 3GLHA 5D3MB 2XSZA 3HU3A 3SHWA 2LCFA 3RABA 1IN4A 2R2AA 1L8QA 1EFRD 3M1IA 3K1JA 3AKEA 2A78A 3H2YA 1QG4A 4M22A 3AP2A 2CXXA 1NLZA 1QHGA 2NG1A 2QSYA 5CYOA 4EJSC 1N6OA 3W5IA 2EWWA 1KMHA 3SFZA 2ZAOA 2ZE5A 2XXAA 4R9UC 4PZZA 4PZYA 1IQPA 4QGGA 3IO3A 1G7CA 2IEZA 3CX8A 4XVUA 3TGPA 1KIMA 4L4UA 3ONWA 5LD2C 3RWMB 4M1OA 2IYQA 4BEBA 1SKQA 3FMOB 2ZR0A 1SVSA 2YWFA 4NL4H 4LOAA 1SZPA 4DUGD 1JAIA 2JJ8A 1MOZA 4YC7A 3SBDA 1NVUQ 2WKRA 4TYNA 5FPYA 3E5HA 2VYFA 3LQQA 1FFHA 3UWOA 1E69A 2R44A 4NCIA 3SNHA 4AY2A 2RHDA 2NZ8A 4JLDA 1RRPA 3DEFA 2PH1A 3VHLB 5K8IA 3AV0B 1IBRA 3NEYA 2EYQA 4KVAA 2AKYA 5FBLB 1W4CA 1NBMD 4Q9KA 1KI6B 3GJ8A 3PUVA 1E9AA 1KO5A 4GBMA 4LC1A 2ZM5A 2V1UA 1AS0A 2GF0A 2NO7A 1PUIA 3MFYA 3L8ZA 3NBXX 2YOGA 5AJXA 2WKPA 2QP9X 3RS3A 5UKDA 4EPYA 5JJIA 4AKIA 2KWIA 3U7EB 5G53C 1FW6A 1EXMA 3K0AB 3IEUA 1G8PA 2G77B 5DSZA 4A36A 2A9KA 1ZM9A 3CWQA 5LDDC 1S3GA 3ICQB 4FCTA 1F2UB 2ZJZA 4GP7A 2UZIR 2OXRA 4KSBA 5LBIA 5KSOA 4A0HA 3B8HA 5JHHB 4LUCA 1FMLA 2QEQA 1OLOA 2Q0HA 2ERYA 3WBKA 4WVFA 1WRBA 4B71A 1AIPA 4AC9A 1UEIA 1ZINA 2HUPA 2GA8A 1FX0A 2X19A 4WZAE 2IYWA 1TQ2A 2NOAA 5IF9A 5EE1A 2JLSA 2WBLC 2ZIAA 2ZRCA 4Q19A 2CLCX 2WAXA 3CF0A 3K09C 1DOAA 4NTZA 4AIIA 4A8JA 1ZIOA 3LWNA 2KBFA 1FUUA 3QXCA 3JZAA 3EZFA 4AI6A 4KI0A 3PUYA 4RD3A 4JMPA 4M9ZA 2ZVQX 1KK1A 4X8MA 3QG1A 4LJ4A 2AWNA 5JBQA 2MSCB 1R0YA 4IDNA 4C2UA 1EX7A 4B3XA 1W0JA 2Q3HA 4HLUA 3VAAA 3W90A 2GEDA 3LA6A 1N5KA 4KFTA 3BORA 4LGMA 3T5DA 3PIRA 1FOEB 2O8FA 4Q1EA 4RKFA 2VP0A 3AVTA 1PLJA 1DARA 3ASZA 1NVWQ 1EFRA 2OG2A 3T5GA 3DM9B 1YHNA 3LXRA 4BPBA 2VF7A 4FWIB 2WMOB 3CRMA 4IDHA 1ZJ6A 4B73A 3KTAA 1X86B 5HCIA 3KDSE 1XJCA 4PTLA 4TTPA 5C18A 5FFMA 5L3QB 1VCIA 2WSSD 4LI0A 1RRFA 2C03A 2OFWA 4HZUA 5KYKA 2ONJA 2GILA 1GKYA 2ZJYA 2XZPA 4NCNA 2JLUA 4O3MA 3AVYA 1IN6A 5CIQA 3FFBA 2WWYA 4HLUC 1KKMA 1OB5A 2CVFA 3QJYA 2XITA 4LSGA 4PO9A 3ADKA 1T0JB 5D3QA 4NYIR 1H65A 4BLRA 1CR4A 2C99A 3X1XA 3ZJYA 3WHLA 3OEEA 4L16A 4HAUA 2J46A 4NONA 4RZUA 4UXIA 4KAXA 5JEDA 4NKRA 1Q57A 2XXAB 3QENA 5FOXA 4WW0A 2Z83A 3QQ5A 4AKEA 2Q21A 2VP6A 4HUQB 5JWHA 1NKSA 4D4KA 2GXQA 4E5UA 5KDOA 4V0KA 1N6RA 2RGBA 1NJGA 2WWXA 1XTRA 4DLYA 5JSZA 2ERXA 4OQLA 1H8HA 4M1TA 1XJQA 3M6AA 4XWAA 3W9YA 4M9SA 2X1VA 1BH2A 3U4QA 3KQKA 4HB0A 1YKSA 4II7A 3AKCA 1DADA 1OH5A 4GRAA 1R10A 2QG6A 3HDTA 3LFUA 4IOMA 4P4SA 4URVR 4DWJA 4IDOA 5J4HA 1XTIA 2FGJA 1XXHE 4C2TA 2HLDA 3BE4A 1ZC3A 5E7IA 5C2JB 3I72A 2J0VA 3CR7A 3QKSA 1NVXQ 1DO2A 3KJGA 5FUXA 1X6VA 3CBQA 3AF2A 3CNNA 1K8RA 4I81A 1S9HA 2IXEA 2ZRLA 1TL7C 2X2EA 1T9HA 2PMDA 4AURA 3UG7A 4EFMA 1O3YA 3B78A 4ASUD 2JLWA 1N0WA 3UATA 4QHSA 1RFLA 4Q4HA 1FP6A 1R7RA 2ZUDA 4OI4A 2N42A 3OEHA 3WNDA 2IL1A 3K0FB 1HUQA 4M1WA 3MWKA 4FMDB 1IN8A 2VH5R 5AK0A 3QXXA 3TLXA 3FWYA 1QHXA 3A1SA 4OK3A 2BM0A 4AG5A 5JI2E 3T35A 2QE7D 2PBRA 5DN6A 1BKDR 1RVDA 2DR3A 2ZYUX 1YQTA 4Z1MD 2ZAMA 1NJFA 2P67A 2PT7A 1P4SA 4IKEA 2HT1A 2GVZC 4C0KA 3RC3A 2NZJA 2FX3A 4QGAA 5TB5A 3CX6A 3Q85A 1NIJA 3AVPA 2RGNC 4NYMR 2PCJA 1M1YE 5FUVA 4ZDJA 4D0NA 1JBKA 2VP5A 2YWHA 2ZRGA 1KJWA 1VDZA 3W3ZB 3IPXA 1NN0A 1AM4D 1P9WA 4ZCMA 4MDEA 1YR9A 3O8BA 1AKYA 2FV8A 4LBWA 1W2HA 3BC1A 5JCPA 5B58C 5KHOC 4KFRA 1Y3AA 1Z07A 3RSLA 2ZREA 1MABA 2IC5A 2WPDD 2BC9A 1UFQA 1YR8A 4AYWA 3PUXA 1GZSA 2ZI5A 4IXNA 1G21E 4TWZA 3R7WB 2REXB 3IPYA 3T1OA 1AGRA 1KI1A 2IWHA 1RIFA 3KKQA 4OKSA 1L4YA 2OAP1 1N6LA 4BFZA 2F6RA 4IJMA 4PAMA 4A0GA 3PUWA 2BIFA 5GJVC 1G5PA 5JECA 4TMWA 1SXJC 2BOVA 3UWKA 4OHZA 4PPGA 4DT1B 1C4OA 1E1QD 3QE0A 4JVNA 4M2LA 2W2XA 2AXNA 1NLYA 2X2FA 5C4GB 3GJ6A 4LV5B 4NCJA 1BYIA 3ZIAA 3Q72A 1HEIA 2AHOA 1Z0AA 2D4HA 2P6NA 3TUJC 4YMSA 4C0BA 4Q21A 1E4VA 2H18A 3GD7A 1XF9A 1US8A 3LH5A 4KO8A 3D8BA 4HSEA 2CL6X 4EPTA 1P72A 2GJ9A 4UNSA 1DTSA 2IXFA 2W2VA 3ZVMA 4D80A 1P61B 1XD2A 4MKIA 2BMDA 4NCHA 2GJKA 4Q4LA 2IEYA 3SC3A 1IXZA 3TBKA 1KZ7B 3TSZA 1XRJA 1ZM4A 2BKUA 2Q6TA 4NHOA 2FN4A 1R8QA 1RZ3A 1W44A 2OV2A 1S1MA 1E2GA 1YZNA 3SJCA 1T8TA 2RMKA 4ZKEA 5JSZB 3HU2A 2V3CC 2V6JA 1GAJA 2OILA 4DHEA 2QORA 3HWSA 1P75A 4Q66C 1YRBA 1XMSA 1H8ED 1Z83A 2HF8A 2WJIA 3MWYW 4BRWA 2J3EA 2WJHA 1J8MF 2Z43A 3GLFB 1XB2A 2VL7A 4P4SB 1XMJA 4XD7A 2D3WA 4WAUA 2BMFA 2DYKA 5J4YA 5JCZA 4MYHA 4FMCF 1U2RA 1COWA 2CCKA 4LJ7A 3Q9LA 2PL3A 5FPSA 3B85A 1H8EA 4CEJA 3LX8A 2JJ2D 2G9NA 2EYUA 4JL5A 1P62B 2ZE8A 3SHFA 1T91A 1Z28A 1RJ9A 1XPRA 3Q7QA 1EFTA 2VSXA 5EQTA 3T12A 4US2R 2CDNA 1CKEA 2VPPA 2PX0A 3IDQA 2Q9AA 1TU3A 5DLQC 4GDFA 1NI3A 4YXWA 1JJVA 4B47A 3NHAA 4FMDF 1QHNA 4P31A 3IQWA 4GMXA 3TE6A 4Z8YA 2F3RA 5A4JA 3R8FA 1P2UA 3LAWA 4PX9A 3U3RA 4DXAA 4EQ6B 2XB2A 1XPOA 4NE2A 3QIAA 5FH9A 2J0SA 2GJ8A 3VKHA 2R65A 2NGRA 1ZYUA 3WP0A 3DVLA 4CEHA 3NC1C 5SZHB 2R8RA 2GVDC 1ONBA 1W2GA 4RD4A 2XGJA 1UF9A 1OE0A 5CJ2A 5HE8A 1UEJA 5GVRA 1GUAA 2QAGA 4KITB 1VG1A 1UDXA 5IHPA 4K8OA 1NNEA 3OE7A 3B1WA 4RJLA 4MRVA 4XWOA 2R62A 3RVBA 2CK3A 3A8TA 4JJKA 5JS8A 3LY5A 3TVDA 2X77A 1DPFA 4LHVA 4DLZA 4BE7B 1LW7A 4DCNA 3ZQ6A 5EUQB 3O8CA 1VG9B 3LW7A 3QF7A 3OFND 2G6BA 3AB3A 4BWYA 3DM5A 2CJWA 2W6ID 4I1SA 4OQMA 2HXYA 3L0SA 2GHIA 2MMGA 1XCGB 4ZI2A 3ADBA 1HA3A 1OFHA 2ZYTX 2JJ2A 4WZBE 5JZVA 2WPDA 4BZXA 2CHGA 1NG9A 3PVSA 3GFTA 2WJGA 3RS2A 3BJIC 4K81B 3ETLA 5AJVB 3VR6A 4C9BA 2QP3A 4X8HA 1OV4A 5J40A 1E2DA 4DEYA 1ZMXA 2CEAA 4CT4B 4DDUA 2YZ2A 2Z4RA 4ZCIA 2JASA 1NL3A 4JT4A 1OFTA 1XMIA 1XZQA 2A5YB 2RAPA 3AKYA 1CU1A 4PSAA 3W8NA 2VRWA 1GL7A 3KQLA 1OXSC 4MYCA 3A4NA 4URUR 4RZXA 2BCGY 4ACAA 2ZYVX 1R2QA 2FE4A 1NG1A 3S1AA 1W36C 3KKMA 1UPTA 2C77A 4DIEA 4HAWA 3C4JA 4JVLA 4C0QC 2ORIA 3AP3A 4HB2A 4Z1MA 3RS7A 3U3JA 1KMQA 5JWRA 2XEXA 2PX3A 4Q1DA 3KB1A 4GZLA 4IXMA 1U94A 4FN5A 3TAUA 5BN4A 3OF5A 1UBEA 3I5YA 1UBFA 5FOSA 2EQBA 4WOPA 2H8KA 3SJAA 2G1KA 4BFYA 4H9GA 4IVPA 4DB4A 5GVSA 2ODWA 1YVDA 3NDBB 3FPAA 3IEVA 3L0OA 2FH5B 1G6OA 4TL8A 3EA0A 1PZNA 2AWOA 2E87A 3QXJA 4W7SA 1OHHD 1KDPA 1KAOA 3MJRA 3ZIAD 5CK4A 3CRQA 3QG5A 2ZSAA 2KI5A 1YE8A 4E09A 5DI3A 4C7OA 4HYYA 2ZSBA 3C15C 2BCJQ 1RRGA 1ZU4A 1VYTA 1IONA 1VIAA 3NIBA 4JSYA 5CJPA 5P21A 1GRNA 2JCSA 1G19A 1TQ4A 4Q5IA 2V7QA 3GLFA 5FL7D 4A9AA 2LWIA 3JVUA 1XMVA 2J1LA 4MA4A 1E6CA 1KO7A 3GEHA 3LX5A 2H7VA 3HR7A 2HEIA 1DAHA 3FYHA 1SVMA 3WP1B 1XX6A 1ZAKA 4GSYA 3EPKA 1RYHA 3PR1A 4E07A 1VCNA 1YZLA 2JDID 4KU4A 5AUQA 4NU0A 1NN1A 2VSFA 5TVKA 2GXUA 3IHWA 3VX3A 1EESA 1ZCAA 1E0KA 4JL8A 2ZI9A 1SVOA 1GNRA 4L8GA 4Q00A 1S3SA 4V0OA 1DEKA 4ZPXA 5B57C 2WWFA 3M0EA 3KXLA 621PA 2B7BA 3THOA 3L0PA 2NPIA 2OBNA 6Q21A 2VTKA 4XVRA 3AM1A 3OIVA 4TQ9A 3SR0A 2GZDA 3MMPA 2QZ4A 1KI8A 1R5NA 2W0MA 1NP6A 2OUKA 3QXHA 2JLRA 1G9XA 2ORVA 2AD5A 4FXPA 3TVTA 1JJ7A 1L4UA 3AH8A 3EWAA 4OJKA 4PPFA 4B35A 3FVQA 1CBUA 5H1YA 421PA 1OJLA 4LRWA 2GAOA 4EPRA 1DAKA 3AEZA 4V02A 1WXQA 2CLDX 4QKQA 3ZVLA 2OLKA 3IIMA 1SKYB 4CRWB 3N70A 2YV5A 4D0GA 4ZIRA 4G01B 2PEYA 3U61B 4OQXA 1WE2A 2ZS8A 1W4RA 5KOYA 1NF3A 4HEJA 5K8LA 4TL6A 4Q7LA 4XVQA 2BKEA 1R5OA 4KJZA 4Y0VA 4LJYA 5SZKB 1G4AE 4A6XA 4TYWA 4DEXA 3KZ1E 1QHHA 4Q1BA 5CLLA 3CR8A 4XTRA 2ZRBA 2JIZA 4O2RA 1KJZA 1R4AA 4UXJA 5FL7A 4BFTA 2OEPA 1E99A 2C95A 1E2QA 2V7QD 1MO6A 2REBA 4ASUA 2RH5A 5DNYB 1N6KA 5L3QA 2ZITA 1A2BA 2H17A 3OZXA 3VNVA 4BLSA 4LJAA 4MQBA 1T5LA 3BIFA 1S2MA 2W83A 4HZUB 3PV0A 2ZRIA 1G291 1ETUA 2ZRPA 1L7VC 1W0KD 2IYSA 3DOEA 1II0A 2QPTA 4XWKA 3VX4A 1P3JA 4XJXA 2IUUA 4GT1A 4D4MA 1JR3A 1A2KC 2FU5C 3CNLA 2OBMA 1LTQA 2QBYA 1SXJE 3AGQA 5E7JA 4JLPA 5FL3A 3FTQA 1E9BA 3BBPA 5FOVA 3RANA 3GLIB 2JATA 2ZQ5A 4ILEA 5A5GA 2N1BA 2FFQA 4MUAA 4TSFD 2R9VA 1I2DA 2JEOA 3NKVA 5JJKA 4NYJR 5CYPA 1OW3B 3ZGXA 4DLWA 2FF7A 2QI9C 4FIDA 1NVVQ 4PSVA 1N0VC 1W49A 3BB3A 4B74A 4BECA 5B30A 1KTVA 3KL4A 1N0UA 2QRNA 3ADDA 5FI0B 3L82B 1FZQA 3NG1A 3ECCA 2DB3A 2P3SA 4QBIA 1NRJB 3SQXA 4Q03A 3EZ2A 1DAIA 3U3MA 4US1R 3T15A 2Z6VA 5KUTA 2R6CA 1XBTA 1EFUA 1Z6XA 4TYYA 3AGPA 5F98A 4BFXA 2WAYA 2GWHA 3H0KA 3OIYA 1HE8B 3HYRA 4TLAA 3T1QA 3CPJB 1G17A 2B6HA 1AJEA 4EPVA 721PA 3K70B 2ORWA 1PLKA 2DFLA 1SHKA 1RW4A 2ZXUA 3FOZA 1WB9A 1PUJA 2W6IA 4LPKA 4JZKA 1NBMA 2JJ1D 4OHWA 2VHTA 2GAAA 3PEWA 1W36D 3VKGA 3B9QA 4UQOA 3DOFA 2C8VA 3BH7A 1QG2A 2HF9A 2ZANA 3B7GA 2YC4C 3NC0C 4M53A 3RWOA 4RD0A 5FOTA 3DZ8A 2ODNA 3SOPA 3VR4A 4QGHA 4BZPA 3OE7D 5B2ZA 3KFXA 1FUKA 2A2ZA 1N2CE 2P0EA 1JEDA 1HV8A 5E95A 1F5NA 2B8WA 3QUSA 1W0JD 3BD9A 2RKOA 4QBGB 2MSEB 5CB6A 2AL7A 3K8YA 4JYCA 4Q1CA 3DL0A 4DCTA 1P73A 3CRW1 2WMNB 2A3RA 2CVHA 3R8CA 3WRXC 5LPNA 4UNRA 3TSWA 1UBGA 3CONA 1Z6TA 2ZROA 3QKUA 1CJMA 4P33A 1Q3HA 1F3OA 2GJAA 2YJTD 4HAXA 3ZS8A 4RFVA 4LDJA 3LXXA 3X1WA 4ZDIA 3GLGA 2FDCA 4CT5A 3ZZTA 1D8TA 3AP1A 1SULA 2CL7X 2W2TA 4D26A 1F2TB 1Q21A 4Z8XA 2R6DA 2IYYA 4B3CA 4YXWD 3U44B 3R9XA 1MH1A 4JSTA 4LYJA 3P20A 4NP6A 4KODA 4G5OA 4DSTA 1J7KA 4W5JA 1ZNYA 2VP2A 2GBLA 3GFPA 2XX3A 3Q7PA 5BN5A 1W7AA 2AFHE 2DHRA 1ZNXA 2XOKD 4MRRA 1QDEA 5FOWA 1YZQA 1Z0FA 1U8AA 2QL6A 1VMAA 1COWD 2QTVB 3AQ4A 4LV6A 4TLEA 2IHBA 4JLBA 4G0NA 2YC2C 1TTTA 2QAJA 4UJ5A 4AKHA 4Q47A 1CJKC 4XD7D 4OL0A 1QHYA 2K5UA 4QBFA 1RRCA 4DDTA 3WYAA 1ANKA 1KO1A 1GDDA 3B1VA 3CZQA 1E2HA 2NPFA 3T1TA 3DMNA 2A30A 5IT5A 1D2NA 4DIDA 4TTQA 3B1XA 3HR8A 5LB4A 4U00A 4A15A 4JLVA 1CJUC 2FFAA 3G82C 4IEEA 5E4FA 4JVSB 3FE2A 1G3MA 2FPLA 2VO1A 2FWRA 5EE9A 4YDHB 2O8DA 3EPJA 1YR6A 2KB0A 4IHQA 5DN6D 4M8NE 3CF6R 1LV7A 1US8B 1DAEA
chains in the Genus database with same CATH superfamily
1QWOA 1C9KA 1QZXA 2OHXA 2VBFA 4KYUA 4C6TA 4CF5A 3I4LA 1HC7A 1NIPA 1VFPA 1ZIPA 1CZHA 1M66A 3BDIA 4JY7A 4LGYA 3AF5A 1CIVA 2XZDA 3GVXA 1VPDA 1P8AA 3M4ZA 3CJTA 3CPEA 1D7AA 4O4HB 4YALA 4ATNA 3EHEA 3E22A 4AM8A 1QYXA 2EFCB 3PNOA 1A04A 4TXNA 4RTKA 2MYUA 4IDCA 5C9ZA 2YNMD 1JZSA 1HYEA 3OX4A 4DB2A 2JGEA 3KWLA 3ZGOA 3AETB 4DSNA 3A1UA 5B55A 1BCSB 2BJVA 2BI8A 2QA5A 4C6HA 1AC5A 4ZCTA 5K05A 5JQWA 1J0DA 2AA3A 2YIDA 3ETNA 1J0CA 3PJDA 1F12A 4IQ0A 4JP3A 4KDFA 2D3TA 3ZHBA 2UXDB 3QX9A 3I83A 4HEQA 1J25A 1W88B 1WDLA 1S8FA 2QN2A 4YRPA 4MQ5A 3UGQA 4E1BA 1KQNA 3L6RA 3TD2A 1JF8A 5FWYA 4URHA 4CIDA 3NRCA 1HE5A 1D4FA 3I1FA 4HAVA 2P9HA 1OXXK 2VTDA 3VC1A 4Z7OB 1X1DA 4RJTA 2UU9B 1M7GA 1HQDA 3LL7A 3PHIA 2O0MA 4HH4A 2QTZA 4MQUA 4ZPJA 5FCDA 1CEEA 3IDFA 1QIKA 3DBRB 5HTKA 4HNAB 1NM5C 1TU4A 4RHXA 5DX0A 4F4UA 1NF2A 1ITZA 1M6EX 2XUOA 2ZE7A 3TKLA 5F78A 2BTEA 2W6MA 4MS1A 4EG0A 1WJGA 5KYUA 2FW1A 4GBGA 1M6NA 1VA5A 2W8BB 2Q6LA 3NOXA 1YNOA 2QPOA 2QM7A 2WM9B 5DSXA 3QEBZ 3O4VA 4JIMA 1FNSA 1C1XB 1Q0HA 1P4RA 1SAYA 2C4KA 2XV1A 3DSRA 5IH7A 4WNIA 5ECYA 4DV4B 2UZ3A 3S28A 3OTOB 3HJGA 2JGRA 3SP1A 2HA0A 3LU1A 2IYUA 3R7LA 2WW8A 1EP3B 3QVVA 1PKEA 2DP4E 3D1LA 3D6VA 4LDQA 5ALDA 5LQKA 1TLTA 1MRSA 1MF7A 1WXDA 2A57A 2D5AA 3HYTA 4PAOA 3SIRA 4IXWA 4LE1A 2E55A 3WIVA 2IVZA 3WKBA 1U0NA 3PFNA 3TFQA 1EPUA 3DW3X 1I01A 2Z1MA 3JQRA 1D6MA 4KVZA 3W2EA 1DBPA 3I53A 2YHIA 3I39X 1RPTA 3HUTA 3U6KA 1QBKC 1GIAA 1QCZA 3CJRA 4P86A 4QOIA 2E4YA 1T2UA 2PS1A 2ZU0C 3D31A 1FRQA 5FR1A 4LZNA 5AW1A 4R4JA 5I51A 2P78A 1DG9A 1W6UA 3DLAA 3ZHXA 4I8DA 2ANCA 2NADA 2Q5LA 3EIQA 3IEKA 2DERA 5HKKD 3ZG6A 4KXNA 1JSXA 3BSSA 3VTKA 1T2NA 4D4IA 1V8DA 4LE2A 4S0ZA 5EP4A 1V26A 1T9CA 2XCTB 1ACLA 1CXZA 1J07A 4ZC1A 4PZLA 3RUPA 4NYIQ 2XQKA 4WSOA 2VUTA 5LZ9A 1OGYA 2YNMA 4YUVA 1Y1LA 2FUCA 4FHGA 4OQYA 2WILA 3M9LA 2GK3A 5HA5A 1Q0LA 2J5RA 2JGKA 3HJCA 3K1YA 2ZRDA 4BMNA 4QM6A 2ZIXA 3QKRA 3NYWA 4K6OA 3NM6B 4R8MA 2QTVA 2FLVA 3HRKA 2VZ9A 1F3LA 2UVPA 4LDNA 1MCZA 2XNDA 4JR1A 3PDHA 3CY6A 2JCBA 3JCZA 3GFSA 3T4XA 1Z4IA 4JT9A 8LDHA 2R751 4BLPA 4DVGA 1EK1A 4KRGA 5EMMA 4BMYA 3KETA 1QRTA 1XF1A 5HRUA 1P17A 2OB1A 2RH9B 5H82A 1P19A 4RFSB 3TZ6A 2PJUA 2ZJBA 3GRPA 3DFKA 2C7QA 1QOPB 5HCNA 4YVFA 5JMPA 1Z7BA 3LUGA 3BDVA 3H11B 4L5IA 4TVKA 1TD9A 2J5XA 4Y67A 3F2IA 4M37A 3VJKA 3K2EA 3JZDA 3W5SA 4UDNA 2XUJA 4KIFA 2VJOA 3ZVRA 1NR7A 1E20A 3ADOA 2NU6A 1MAUA 3VUEA 4F0JA 5J2UF 2NP6A 4KQMA 3G5UA 5SZJA 2QT1A 3LYLA 2ZKLA 3RYIB 1NXTA 4B33A 2PE5A 2IYTA 1GLNA 5K0BA 2WTEA 3ONEA 2GBCA 2PVSA 4TUYF 2BEUA 3DZBA 4OXQA 1F9AA 1H1LB 4OB8A 4IIJB 1DQYA 4QEDA 4U9IS 5DPMA 3VR4H 3WMGA 2BAGA 4IHJB 1IY1A 2BHTA 3LLSA 2IIVA 2ZYRA 4M0CA 5IM4F 1IJFA 1J8VA 3HPRA 3Q9NA 4RHFA 2V03A 4B82A 2XD4A 4HDKB 3OIGA 4Y6GB 2FMXA 4F60A 1NUAA 5I7WA 5KPJA 3RFUA 4EB8A 4IH1A 1R8SA 1VMDA 2VPWA 1FX1A 3A9CA 1DZIA 3ZLUA 2RB5A 4GMKA 2GCEA 4EG4A 3NAZA 3TLEA 5J1SB 1PZMA 5CW1A 1XCJA 2IW1A 4FBGA 4H6XA 3RVPA 1BVHA 3E2PA 1P9RA 4R7ZA 5DXAA 1QK4A 4EHBA 3NEPX 3OJWA 3RS0A 1RYYA 1YMVA 5ULLA 4I50F 2OZEA 2XGOA 2JS7A 4QBTA 1HLPA 1FLAA 3OP4A 5EGNA 1K06A 3G2IA 4F2GA 3U16A 3GP5A 1DI0A 3OQIA 4WV3A 2PUEA 1V4BA 1PG2A 5KTOA 1G4HA 4F06A 1TTHA 1XA4A 2VRCA 2VVTA 1N9ZA 3V8BA 4ILKA 2BV3A 2QAIA 3ISJA 4WKBA 4GVXA 1DS6A 3TLMA 3LO5A 1JPVA 2RC6A 3MRVA 1JAYA 3BK2A 3E5NA 4NNPA 3SU8A 4D81A 2G7ZA 5KBYA 3LE8A 3CF2A 1UBOS 5DH9A 1V8PA 2H0AA 1USVA 4G5HA 3EYWA 1EE9A 4AZVA 4ETNA 2RBEA 1WCXA 2CUKA 4CM9D 4KR3A 3WLPA 5CFOA 4JLAA 2PJZA 3EH1A 2G4VA 1OGJA 4MB0A 1LS1A 5F4BA 3MTDA 3L1IA 4IRUB 4M1SA 4D98A 2RD2A 1AG9A 1UWKA 2J9ZB 1T13A 4HATA 4WERA 5CGZA 4PGGA 1I13A 1FLNA 4CM4B 2GPSA 3OT5A 4AUMA 1Z2CA 1ZBQA 1PGOA 3EEQA 1XZDA 1N5LA 2HJGA 5AESA 1PYOA 3IDOA 4CEIB 3K7EA 1V6AA 4HO1X 4MVJI 2N9UA 2NTVA 4R6XA 3UIEA 2P27A 2HT6A 2Z8ZA 1L6RA 4MVJP 2ZIZA 1FTSA 3R3UA 2RK6A 2AMFA 3MCTA 4R2HA 3WLNA 3CN9A 2H2GA 1AMUA 1ZVJA 2X9QA 2G0AA 4N9WA 3PE4A 1O03A 5JIBA 1DUSA 4KE7A 2Z57A 2JAOA 4FQ8A 2VEDA 3DFZA 4U39A 1TUIA 3M4JA 3EZYA 4XOIA 4YMGA 3LZDA 1Y3FE 3UFBA 1T3SA 3UK6A 3I3SR 1RQNA 1U1GA 2BR4A 3H3JA 5ENZA 4XJVA 1OVMA 1QIJA 1V35A 4O4JB 4BMDA 1JSZA 4G8DA 4OGGA 1J06A 3BCUA 1V4NA 3SSAA 4B76A 4GZ5A 2PA3A 4MTLA 4AMUA 3PFWO 1SY7A 3N0TA 1GZDA 4MCHA 4EY5A 3DV0B 1NNUA 3E7DA 3KKZA 1VQ1A 4E12A 1KQFA 3ROPA 1U2SA 2NU8B 2HMWA 3N5CA 1A9XB 4B4WA 2C9YA 2BH2A 5D3MA 3P2JA 1J1UA 1YVPA 3OPNA 4PRKA 5BW8A 3KZMA 2CBXA 1E1RD 2R8OA 1B1AA 5IRCD 2ZJ3A 4DEVA 1SBIA 3B2NA 1N6NA 2YL2A 4N5HX 5MDHA 2R7LA 1R3DA 2YIJA 4QSHA 5JZ9A 1E5TA 2FDCA 5ALUA 4IIEA 2G9ZA 4IICA 3SF8B 5CB4A 4YCDA 4OIMA 1GXSB 1GYPA 4V0QA 5HBRA 5HRAA 4N18A 4DIFA 3WV5A 4CGYA 2NU7A 1E1YA 2Q3FA 1A3CA 4I1OA 2BWJA 3M82A 3LVBA 4QDTA 4R84A 4DUGA 4PYMA 3K09A 1NW8A 4FLMA 1YC2A 4DE5A 2JKYA 2IXTA 3WY9A 2JFXA 4KK4A 1SC1A 3N74A 3LTEA 3I6MA 3OAAD 1LY1A 3WMFA 4KPGA 2RHBA 3PEEA 2VOJA 5JY6A 1W0KA 3AERB 3KVRA 4UVHA 4OYYA 1V41E 2WC1A 4AJKA 3ZQ4A 5BV2P 2O8BA 1Y8RB 3MXOA 4MWSA 1JQ5A 5ALGA 4EHLA 1Z0JA 4N0EA 1R9JA 1U7UA 3CKLA 3GRYA 1Y5IA 3GLKA 5FDFA 5CA1A 1TVCA 2FKAA 3KXDA 4KXWA 2XQJA 3FFWA 3GJRA 3EZ7A 3GT7A 4GXRA 4OXRA 4GRIA 3IOEA 4IQ8A 5AKIA 1SN7A 3PG5A 4HXGA 1HLDA 2XW6A 2Z8YA 1BHSA 3SXUB 1Y0BA 2XNCA 3X1KA 1S0UA 4Q7KA 4G1VA 2EZ8A 4A6PA 4KPYA 2Q41A 1JJFA 4R1LA 1H9AA 1UXJA 3TAXA 3WOVA 4AG6A 4ZDKA 3E18A 1KNQA 1KFBB 3AFOA 2PT9A 3PE3A 1J49A 1B0PA 3DC2A 1RJGA 1QGZA 3I04A 3MJCA 1BE1A 4IQGA 4GVLA 2YXLA 3RT9A 3WKCA 2IHJA 2DBRA 4KCGA 4DSOA 1CDDA 4KV9A 2Y0DA 3DE0X 2FEWB 3H13A 2GKOA 3RT7A 3ASVA 3LZCA 3UKDA 1SUBA 4M8KA 1UCFA 3NGLA 3GJ3A 2CYAA 4RY2A 4AO6A 3IP5A 1NFFA 1SKAA 1NMZA 4WXEA 1JFVA 2Q6KA 1C1YA 3JATA 4TKVA 1KY3A 4QBGB 4GMGA 3UV3A 1E32A 1TZ2A 2P3OA 3FRHA 1XJ5A 4PQFA 4QBHA 5A9TA 3CUVA 3VKUA 1EA7A 2YWJA 4P58A 1C8LA 2EP7A 3IAS1 3CKKA 1KZHA 3V2IA 2PPLA 4XYLA 4B8YA 2UYQA 4J6FA 3VR3A 3RS4A 4XYMA 1GNVA 5E3IA 3VH1A 5BYKA 5JBNA 4ER0A 3BH0A 2J0UB 3U4CA 8ADHA 1TK9A 3B6JA 2BZ1A 2D0PB 4A23A 2CL5A 4H1UA 1RJFA 3C5HA 1FP7A 3GEPA 4A8JB 3UPUA 3THXA 3MERA 1A8QA 5BY2A 2X8WA 1SUEA 1QP8A 1GYRA 1QFSA 1TM4E 2C0CA 2IIQA 4FHZA 1Y7LA 4N0QA 3I2GA 1SBQA 3LA8A 5MFZA 3TTUA 1POWA 5F52A 2O57A 2FCAA 2ZRNA 5JJ5A 1MABB 2JLQA 5HIMA 1Z5OA 3L6BA 1VRVA 1NFQA 5FBHA 1OIXA 5F9MA 4A26A 4DLSA 1ZMBA 2AOUA 4HJXA 5AW5A 1L5HB 3BD8A 3LBIA 5KYWA 2EOAA 2HH9A 4KQHA 5J9FA 2DWUA 5DGDA 2C8JA 5AI5A 1WQ4A 1A4RA 1Z45A 1VOTA 2WD8A 2Y27A 3ORFA 2WF5A 1DEOA 4AF8A 5J5CA 4JUIA 3O1IC 1M34E 1ESEA 4PWYA 3PVCA 5D51S 2VR1A 3L07A 4FI3C 5JI3E 3D81A 1E6WA 1E96A 3MPUA 1FDUA 5CD9A 4PQRA 1ZI6A 4V2UA 1MJHA 1QWSA 1L1RA 3C6KA 1AHNA 3DZHA 3DXZA 1TEZA 3T4EA 3L18A 3CB2A 1I3MA 2XADA 2SBTA 1OH6A 2QG9A 3F9IA 3RS5A 1G8HA 1SA0B 1R8JA 1SD1A 2FMIA 4LI3X 1C0LA 2V3VA 2GXSA 4KZKA 4TM7A 2Z8YM 4GKVA 1UOQA 1C50A 4F5DA 4MPTA 1E8MA 2EFGA 4RK0A 4EATA 1K97A 3OIWA 2DFKB 4K9QA 4KW7A 1ZGZA 5E3HA 5KCZA 4L5BA 4FKBA 2BFDB 2RAVA 3Q5GA 5DULA 4BLWA 2GQ0A 4A0RA 1U6IA 2ISQA 2JB9A 3LLUA 1X15A 3IE2A 1X7WA 2ZJFA 3LK6A 3NBQA 3OLXA 3PGXA 5A3RA 2ZR9A 2ZJ6A 3AWDA 1VECA 1Y8QB 3F5DA 3IT2A 4AUEA 2XTNA 2HXSA 3BTOA 4IFEA 3W4JA 1N1EA 2AOTA 1DLJA 3A58B 3HKDB 1UPXA 1XG5A 2F1HA 4MDYA 5IJWA 1EWKA 2AUNA 1TZBA 2FPSA 2O23A 2YWCA 4Q3CA 4JI5B 4B75A 2ZTUA 5CVDA 3NOVA 3ZH2A 3UB2A 1SRRA 4BQEA 5FTKA 1UBCA 4RORA 4N3AA 2FMFA 2CV1A 2NAPA 4UZEA 2A9OA 5L6MB 3PQ4A 3RBXA 4B83A 2EHDA 1AKVA 2QJOA 4EUNA 1YDMA 5KMGB 4D25A 2ZBFA 5DEOA 5MN5A 2R1UA 3K9GA 2QJFA 1EWVA 3N2EA 2H3EA 1YIAA 4MEBA 4B45A 2IQ5A 4QXOA 4C6SA 2OK7A 2E6UX 4TTAA 4FC6A 3C5CA 4YLYA 5KNDA 2NYAA 2PUWA 4DLUA 3DCIA 4FGJA 5IJXA 4B81A 4JQZA 2BEVA 3OY7A 4DSUA 4O5OA 1VPLA 3GROA 1FVOA 1G8YA 1NYLA 1YDFA 4M7PA 5F2NA 4YNBA 3PGMA 3GLGE 2WFMA 2O4CA 1Z38A 2G0NA 1ZD2P 4ROTA 5ELLA 3R9IA 4J0CA 5LVAA 1U7OA 3GJ4A 1VMIA 4JXZA 2OBXA 1N8NA 1KA9H 4CW7A 2H7YA 1Z35A 4KO1S 3WGQA 3QOFA 1U3WA 4FUTA 4ZU6X 3WGKA 1VE7A 4MS4B 1TVMA 4QRDA 4YYEA 1MGOA 1ULZA 3TQSA 5E8JA 3ZW9A 4ZXPA 5K09A 3UYKA 4H7HA 2O0KA 5FWYB 3SR3A 4MCIA 2O2EA 3WDMA 5DT9A 2XQGA 3FX2A 3P8ZA 2WSMA 3WWEA 5D84A 4FINA 4PM4A 1PV4A 2E0IA 2JFVA 1RPZA 1W87A 4FHEA 5LOVB 1JDJA 4LWZA 1L4FA 1EG2A 3B9PA 4NHEA 3C7CB 3M6LA 4X41A 3FDFA 5FRDA 2UKDA 3TG8A 5HMMA 3DF7A 3QLVA 1M2OB 1IPHA 1JQEA 4IX9A 4WBNF 4EUSA 5JASA 4JDPA 4DHWA 3B9BA 3BG5A 3E0XA 5BOSB 4M4SA 4WTOA 4YPOA 2ZBQA 4GUDA 1AGXA 1E9VA 4KPUB 4MI1A 3CH5A 1W6RA 5J4VA 3CV3A 4QNRA 4PYRA 5K3SA 1UJCA 2GEFA 5ENVA 4B6RA 2O8FB 3W7VA 1YJAA 3FNRA 1Q11A 3ZLTA 1M8FA 1QGED 5CBKA 2ZI7A 1G41A 1SZDA 1XZBA 4YGYA 3NIFB 2C98A 1NJ5A 2DU8A 4ZDWA 1YZYA 1N25A 4OOEA 2QRKA 2V98A 1KI2A 4M9QA 5TGTA 5H68A 1KXJA 4J7CA 5EN4A 2AQHA 2EJCA 2YBDA 5EIHA 1OIVA 3R4VA 4KOAA 4LHWA 5EUBA 5DHFA 3AKDA 3N28A 1K7XB 3ORSA 2LCIA 3HV2A 1ISMA 2BFFB 4KIWA 3DTNA 5L7WA 3IUBA 3REQB 3P2MA 1R0WA 1R18A 1XYGA 2GETA 1SUPA 4INPA 2E4WA 5CFPA 4IILA 4P0TA 3JQAD 4M76B 2FFHA 4MI9A 1FFGA 3RC1A 3IJ5A 2P2GA 5F33A 1DG1G 4CL0A 1XQ1A 2A9RA 4A82A 1G9SA 3ENWA 1T5BA 5HS6A 4Z4CA 5ABPA 5H3HA 5LP6A 1HH4A 1FXWF 5AWFC 3W1VA 1ZOPA 3CH6A 3MS2A 4GX2A 4MKFA 3UV7A 5EMKA 2L82A 4XARA 2AN3A 1E4YA 3WIDA 1TJNA 3IBYA 5JVDA 3DPIA 2A9FA 3EC2A 3WDKA 1QKIA 4E5UA 1E4EA 3I28A 1PDOA 4RC9A 5JLJA 1BEZA 3O4HA 3ZEAA 3SS8A 2Q5QA 1JIUA 5KOHA 1ZH2A 4DWWA 5A71A 4JODA 3TAHA 5A4KA 4N48A 2J7KA 3ZHUA 4JT8A 1LBIA 2NUTB 1MZVA 4FFPA 4Q7MB 3N8IA 1EHCA 5IDVA 1Z0IA 1W4ZA 1R9NA 3ETHA 5C53B 4CR6A 3S8YA 6AT1A 1A8SA 5AKYA 1Y34E 1M67A 3DE1X 5LQUA 1KP3A 2BBSA 5I7EA 2XYHA 1IZZA 4K40A 3PQ2A 3AM1A 3OC0A 4YMTA 4RAQA 2PGNA 3ZXYA 2BUCA 2XE4A 1W1IA 2YXPX 1CX9B 3C6ZA 3EY4A 1SCDA 1SIUA 3HXMA 3TMAA 4REMA 4E51A 1DC7A 2AR0A 2JH8A 1ZBDA 4FBLA 4EYEA 4GIBA 4LW8A 1DP4A 3B5EA 3EPRA 1W30A 3V1UA 2C5SA 2FPPB 5G2OA 2YJ5A 4I50B 4KN5A 1Q0RA 5LNK6 3EG5A 3OLZA 2BFBB 2QYHA 4MS3A 3RE1A 1GGNA 1KU0A 1V7CA 2YZKA 3NBFA 4PRZA 5DBFA 4BNNA 4CWAA 4YMUA 1L7BA 3E2IA 4GNRA 2QGZA 4I08A 1TM2A 3W8DA 3VPBA 4FB5A 4URXR 1AQJA 4AQYB 2CCGA 2AOVA 5HW0A 4JENA 4JUBA 5LYJA 2SKDA 4F1WA 3CVYA 4C3VA 3FGNA 2FN7A 4GGOA 3M49A 4F4JA 1CB7A 2PUAA 1VGRA 1UK9A 2P9TA 3EBOA 3I8SA 3OPVA 3WMEA 2VT2A 4HVAA 5J4LA 1SH7A 2P9QA 3X1YA 3MT7A 1MA3A 1OA0A 4IHJF 2PQMA 3M3DA 3TL3A 1JLLB 2WK1A 3MCUA 1VYUA 1ID1A 1Q1GA 2A1TR 1PS0A 2HD4A 3FHLA 3JD3A 4LS3A 3BL5A 4MVJM 5K1ZA 3TW8B 5ER6A 3HU5A 4EUEA 4F12A 2Q3MA 3TUZC 1ZJZA 1GPMA 3ZWKA 5E2AA 1M3SA 5IJ0A 1RJ9B 1U81A 4BO0A 5FNVB 2KHZA 2V7TA 3ILVA 3Q8XB 1MX9A 4PZAA 3OZIA 4HQRA 5ALQA 4IUCS 2RHHA 2ADOA 1IL0A 2HCRA 2XVMA 4EL5A 1VLLA 1PW5A 3H8VA 1RCTE 3FWPA 4X20B 1IN5A 1PEYA 3Q3IA 3E7WA 3KLNA 4YQYA 4D9NA 1MV8A 2ZRKA 4RUKA 3RPEA 3JD0A 3VR6H 4F1KA 1GWNA 1UDBA 3ITKA 1LDMA 2O3RA 1L5WA 3GT3A 2BR5A 2XE8A 2GN6A 2J9RA 5FHQA 4HNTA 1LTHR 2PZEA 1VKZA 2ZE6A 3EG9B 1FUYB 1T9AA 2VHQA 2JFHA 1JFFA 3TR5A 5JCJD 3W3AA 4ZJPA 2BGKA 3B60A 3JD4A 4FZ5A 5U9CA 2D7DA 4HVTA 3D3WA 4RPLA 5JFTA 3T61A 3TLGB 3A1VA 2WSLA 3L05A 4Z4QA 4O1MA 2DUWA 1YI0A 3CF4A 2ZR8A 3QF4A 1WHTB 3ANTA 3VNSA 1V9CA 1T29A 4PGAA 5L3SA 3QYJA 4TOIA 1CQWA 4P4UA 4F11A 3GJTA 1F20A 5KJEA 1E2BA 1WXXA 3AHGA 4X97A 3UAYA 3GJYA 4A8PA 2G04A 4M9UA 4K0RA 5A5FA 1QVAA 1HEUA 3DKVA 4IOJA 3JD1A 3PXGA 1GNQA 1YK1A 2W9XA 3WLAA 2QMHA 1ZK1A 1OIWA 3PQDA 4PG6A 4UTNA 2XKKA 4K46A 3EGEA 4MW6A 1RBYA 2W00A 4E70A 5HUHA 5E2IA 1P1KA 2PMBA 3BJZA 1P1RA 3G02A 3S70A 1F14A 4EIWA 1AHPA 1YB5A 1SXGA 3OZRA 3JD2A 2HMVA 3NP9A 1R0CA 3D6MA 1U9IC 4LG1A 4K6GA 2YFYA 4YI5A 3K4HA 4JX8A 4ECEA 4R71A 5E9JA 4RO0A 1CDZA 1THTA 3LRTA 5B2EA 1WZ2A 4IF4A 4OG2A 2AN4A 2O14A 4YP9A 4FNAA 3TECE 1NLFA 1TYBE 1BS1A 4MUNA 1U80A 2IYXA 1I32A 5HOEA 2C4HA 1VJTA 2WY2D 1W581 2ZJ4A 1W8IA 3DAGA 4ZEWA 1KFCB 2ZRJA 2E9SA 1Z5GA 5J1TB 5M3BA 2NO9A 3UJ3X 1HL7A 2Z1DA 2Z1NA 2J4CA 4PQYA 4QDKA 4TMFA 3DV0A 5BR7A 3B12A 5A4DA 1JQBA 3K5IA 4H16A 4B31A 2PKCA 3PZRA 4JC4A 4DLRA 2VG8A 5JDIC 3SF0A 1WOYA 3DMDA 3E70C 4NVRA 3PUJA 3ADCA 1POXA 3KCQA 3KLOA 4QL3A 2WICA 4ND8A 3GZNB 2PN1A 1DRVA 2IZ0A 3NVAA 4BUZA 1OQAA 4CNQA 4HEHA 1WOMA 1FFBA 1A98A 1ARZA 1C3VA 2GAJA 5AVUA 1WDTA 4UHJA 1YSCA 3R20A 2A5DA 4FGUA 1ISRA 2CGEA 4INAA 1FYWA 3LKBA 2IS2A 5HFJA 5BVGB 3ONVA 3Q7IA 1Z4PX 3MN1A 3T3DA 1H1DA 4L22A 4O2LA 2XCUA 1TEXA 4RL6A 4YWHA 2ZPTX 5FNZA 4NPAA 1SM4A 4KN9S 1NU6A 2O20A 2W42A 3LG2A 2V58A 1HFKA 1UODA 4KGVA 2NUAA 2G4CA 3JQAB 4QO8A 4Y6RA 4IJUA 4QJIA 4TWRA 4ESHA 2IEAA 2YS6A 4LHYA 3TNJA 4D9CA 4EHJA 2CNWA 3PNMA 3DGFC 1GGMA 1E60A 2O8BB 2I6XA 2E1RA 3JQQA 5CM2Z 4OM7A 3ZR4B 5KVSA 5DBEX 2QTFA 3ZCTA 3P1JA 4IOKA 2HA6A 1U9ZA 2DPLA 1EUDA 5F3DA 4DW8A 5LP6C 2VS1A 1BYUA 1FP4B 5AK5A 3KXPA 1JE1A 1Q1AA 1FVHA 1YAJA 2FX5A 3IUNA 2GCNA 4JGBA 3H6HA 2P77A 1SQ6A 2CHFA 3HDGA 3NRJA 4JCOA 4QPDA 2O7RA 2V74B 3EBLA 2A5JA 1JDUA 5HE9A 2G5CA 4Q1FA 3F6BX 5HX7A 3UHFA 2CMHA 1HX7A 1S2IA 3R40A 5I5GA 2Q1XA 3RSSA 4Z2YA 3O9VA 2I55A 4ZVQA 1J5PA 1CR1A 2HFJA 3DEHA 1V5EA 3GCGA 4L2IB 3HB0A 3RF7A 3RSGA 3ET4A 3L0IB 3NHMA 2IF2A 4O0LA 4EHNA 4PXSA 3HUUA 4ZWNA 3M2PA 4J1NA 2ZWOA 3ZYCA 3PRHA 5BR4A 4RV4A 1TKBA 2QD3A 3M9WA 3UAVA 3ZE0B 2NZYA 1O6FA 3BXPA 4N5NA 3A3KA 4PGMA 4MLDA 3FPLA 3V7YA 4MWGA 3GP8A 2FMKA 1NDHA 1RWXA 2G83A 2J30A 3LF1A 3O94A 4NC9A 3D6JA 4ROSA 2HHAA 1JJBA 3FXAA 4P4GA 5DOVA 1SVUA 1UDWA 4HDNA 2VYCA 1W73A 4OH7A 3S29A 2GXAA 5LN1A 1VRWA 1LI7A 2HF7A 3TNFA 4RTOA 4J2OA 3AL2A 2YMPA 3K0CA 2ZSHA 4OIFA 4RD1A 2VSYA 4H1VA 4ALNA 2QAGB 2NQ8A 3E6AA 3NBUA 2NSJA 3T5TA 5GONF 4CMAA 1Z7WA 1BROA 1DX6A 4EW2A 3N2NA 3ZIDA 1ADYA 2OZPA 3UOGA 2ONYA 3FOAA 1I4LD 3EC1A 3WAJA 4IIHA 4PIMA 2CNNA 2A9QA 2GHQA 2NT4A 2QPLA 1AK1A 3DFFA 1G3UA 4JIGA 3EZLA 2WMYA 3DE2X 4RE6A 4AECA 2RJOA 3WWZA 4IAOA 3DPUA 3JZFA 4B3BA 2C58A 5EFZA 4BIMA 3D2CA 5HILA 5DM70 3TJZA 1CULC 1E1DA 2B30A 1T0BA 3OZBA 5FXMA 3IERA 3KTFA 3SMVA 4E2WA 4XQGA 1X14A 3RNOA 3SX4A 2YDYA 1VL1A 1VXOA 2A0KA 2H54A 2HO4A 2ZB4A 3HMQA 1SHLA 1WF6A 1XQVA 3JTMA 2EWMA 1RI2A 2GZSA 1NBOA 4FZJA 4J75A 4LY0A 1RKQA 1L5HA 3FWKA 2ZJ7A 5FLEX 4NOLA 1ODLA 2JPDA 1YCGA 2VCHA 1VLVA 3EGDB 3OZVA 3UZUA 4MVJF 2G07A 5HKLA 3TZQA 3OKPA 4O4JF 3V8VA 5ICSA 1MT0A 2EHJA 3CEHA 3DZIA 5CDGA 3COPA 3OQVA 1ECJA 1M8KA 2E1PA 3I0ZA 5F2EA 1GPBA 2QPAA 1YCHA 3DVAB 1Z0ZA 2G88A 2YVLA 3UCXA 2WYUA 1KP2A 3ZZ0A 4BNDA 1CLEA 3C24A 3GG2A 3E5RA 2R8EA 1XEFA 3GFFA 5JDCA 1Y6RA 5EKTA 1J2UA 4ZQCB 3D5TA 1B6RA 1YASA 4M0PA 4WADA 1KDYA 4ZTBA 1RWKA 1Y4ZA 4BIIA 1YVUA 3LBHA 5K20A 3UAWA 4IWXA 5TXGA 1OTYA 1CUWA 1CZRA 1G2IA 1NT4A 4DV0B 1ZD9A 2ZPUA 4XH9B 1NQUA 2ODPA 2WT4A 4YUYA 4EKGA 5BUQA 1A1VA 1M2NA 4OXNA 1WA5A 2DFVA 4KL8S 1KH2A 2PM8A 4N0MA 3MJTA 2WP8J 3CNBA 1SUCA 1XFDA 2GK4A 4FYHA 4O0MA 4PYNA 3UKJA 4BRWA 1RVV1 1KWGA 1XVAA 2LXNA 1JH9A 1TUBB 1YA8A 3NH9A 1HBJA 5BVHB 1Q1EA 4V1CI 1MW8X 4CMEC 5REQB 4FW9A 2QN7A 5A9SB 2E5LB 3Q87B 5JBIA 4HGYA 2AOTB 3HKDA 4DR1B 2GPJA 2J5BA 3OE5A 4DZRA 1HDIA 5FWNA 1LFAA 4GLBA 2G1JA 3NHSA 3FA2A 1J70A 5E6RA 3K1AB 1FFAA 5LQCA 1I4DD 4CM3A 4FTWA 1IAQA 1VLHA 2WV9A 4FDVA 3UGKA 1G20E 2I6UA 1YKFA 4U2BA 3FZNA 2DQKA 2PG3A 1MQSA 3CWCA 5EKXA 3TI7A 3TRIA 3UJCA 1X1SA 1XCPA 2QMYA 3EASA 3STUA 4DCUA 5AHOA 5KKCA 3B1ZA 4DANA 3AQIA 1Z8DA 1GRVA 1K0UA 2POCA 5KTYA 3KOOA 2C9OA 2QQEA 3CINA 3PS9A 4JDUA 5BW6B 1J0AA 4XCXA 2CEKA 5LUBA 2JLAA 1NMQA 5CX4A 2IDMA 5AJYA 1NNI1 4DA0A 3UWMA 4CE6A 4FOLA 5EP2A 3CO5A 1WABA 1F6BA 1EUCA 1NR5A 4X8OA 3HJAA 3S2UA 4OB6A 2PKEA 3RUHA 1PL6A 4L3OA 4YJ3B 4H4CA 3COWA 5G3ZA 5LMCA 1LTKA 4AZSA 5KPDA 1UOPA 4IS3A 3EDQA 4KAAA 4WCVA 5K0CA 4ZYXA 3IKJA 1DEXA 3SS7X 2BFEA 4G5YA 2G1PA 1L4MA 2OY0A 1C1HA 3W2FA 1QLWA 1MAWA 4RYLA 2HQ1A 3E9CA 3JRXA 1CZLA 4LHZA 1TO2E 3F1KA 4M8IA 3OOWA 1GGVA 4AJ9A 5CXUA 1DHRA 2VKQA 4I4IA 1TMGE 3WRYC 4YRFA 1EX9A 3CX7A 3SR4A 5DHAA 1JA1A 4FDUA 4M0LA 1IBCA 2HA7A 3IV6A 4N5MA 4L75A 4MGHA 1JT9A 4NENB 4IG4A 1JS1X 1SCQA 3UJNA 4IX1A 1BKYA 4TRMA 4PG8A 2NO0A 1VBMA 5AJWA 1OLUB 1MO5A 2BZGA 3RTCA 4IIVA 1K8XB 4PY2A 2QRHA 3CT6A 2BP7B 1NXSA 3HN7A 4JHLA 4W5WA 3WGTA 4ZCRA 4NEGA 1W5FA 2RHWA 3FFTA 3OTWA 3QWIA 5DASA 4C4SA 3C85A 4JOBA 2WLTA 4Q9AA 4CLRB 5JC8A 4BX3A 3PFHA 1T6NA 2QN1A 4I3GA 1EK0A 1F8GA 3RYTC 4GOJA 2NSDA 2RC5A 4WZ6A 1A69A 4PXYA 2O52A 3F5MA 3KT3A 4HWOA 1PFUA 3VDQA 2ATEA 3K9NA 3PFIA 1E94E 3GFOA 4CKXA 1MX3A 4QHTA 5A0TA 2WJ6A 4TTSA 5K5EA 1N9GB 4U6SA 1VSUA 2VSOA 4YMLA 1ZLXA 1ZO8A 1QK5A 3G2LA 1EA5A 1W85A 1KI7A 3KBBA 1L4NA 1JMYA 5CHEA 4S04A 1LPOA 1EVJA 4NZYA 1EM8B 5LQRA 3ET5A 1G20B 4EGCB 3FG9A 3HSYA 1GNPA 4YAOA 3R5SA 2RGNA 2AV6A 2XYVA 3QKIA 2DHDA 4UM7A 3ROZA 1AQYA 4JYBA 5AIBA 1SOAA 4P9NA 1KEUA 1KOFA 1TA9A 5JFGA 5J2TB 1D4AA 1PR9A 1Z17A 3RUFA 1AA9A 2BFFA 1OSNA 1VYHA 4I9UA 4JBLA 3DE3X 2QY6A 4TWIA 5D5QA 3W5VA 3G0DA 2WFAA 5CVVA 1E0SA 5DISB 3DTVA 2DH5A 1GILA 3K8QA 4PFKA 3TL2A 3ELWA 1G5RA 3UQYS 3P5SA 3HO8A 3GI1A 3HCBA 3ZBTA 1O96A 1TK3A 4C89A 3TDNA 1WXWA 5I8WA 1BCRA 3KZOA 4WA7A 2CXPA 1UPUA 1RBMA 3BCSA 2YRXA 4OXYA 5FLKA 3T41A 3DZFA 3FPCA 3ZZUA 5JXJA 1QR2A 2WFLA 4QJBA 2G63A 1V1RB 2VHEA 2A5FA 2PXXA 2YJ3A 4PHFA 1ODTC 4EY6A 3THWA 2IF0A 1MQ8B 3BILA 1RTKA 2DWQA 5BN3A 1FNNA 1NV8A 2C78A 4UBJA 2JGMA 5FBVB 1X38A 5H4HA 1PT9A 3OUTA 1SIWA 4LYHA 2BH9A 2Z98A 1VKHA 2JK1A 1HZZC 1E7RA 2RGXA 3HPQA 4OF4A 3TLAA 4CQMA 4YT8A 1OXUA 1U7WA 3GRFA 4CIBA 5EMLA 2R1TA 4GBED 2JAHA 2NXCA 1GTZA 1N2CB 4FU0A 5HCUA 2AW5A 5IJ9B 3EUWA 1PQYA 5A6SA 1SVIA 1X1TA 3PD1A 3HJNA 4IZHA 4DDMA 2GGSA 3DHNA 1SCUB 3C16C 3QUBA 3Q8LA 5IX8A 2P41A 4LDZA 1N2SA 3QYFA 4MRNA 5KOIA 8OHMA 1YULA 1YS9A 1GZUA 2BEJA 2NZ2A 2Q2OA 2R84A 4O25A 4HNRA 4PAQA 5BSMA 2JI7A 3SSMA 4Y3UA 4AY5A 3U17A 1MV5A 3KT8A 4K9LA 1RQLA 3RADC 5KZMB 1I4TD 1QH8A 1P6XA 2B7LA 2R2GA 2X4GA 4LOLA 1IZ9A 2EARA 1CRQA 3E22B 3GA0A 1NP7A 4E2ZA 5JQGA 4X71A 2WSSA 4MQMA 1DTWA 3IP3A 2WJYA 3KX2A 4KUGA 4JI7B 4LZJA 4DYHA 5EXPA 3AYXB 2P5TB 2XUPA 4YJGB 3VC7A 1P5JA 1ZZEA 4QELA 3RKSA 3TR6A 3RVDA 1KORA 1L6IA 3KEFA 3NEAA 1YL7A 1KVUA 3O9ZA 4RD2A 5EIBD 1WUKS 2V7EA 2X5OA 4FFWA 2LV8A 4F8JA 1OU4A 4MLZA 5TARA 4G1UC 3ETCA 2QZZA 2NO4A 1U1FA 4WZBA 5TGZA 1M7HA 3IBTA 3OOEA 4G97A 3RKRA 2DFPA 3D02A 3ND9A 3RG8A 1W88A 3WKDA 3GUVA 1YR7A 4IDEA 2V4ZA 3ENZA 5EE0A 2G09A 3FR8A 1P5FA 4D8VA 1AV6A 1E9SA 4KLNA 1AZLA 5EMHA 5KNDH 2VWQA 1UM8A 1U04A 2BMJA 1KYVA 4M55A 4EQ6A 3QSYA 4J4BA 4BQSA 1NE2A 3KVYA 1NF9A 5COAA 5DW0A 3ZNPA 4QOSA 3IQEA 4JYZA 1PFVA 2HRZA 3NOOA 3BIWA