3F44A

Crystal structure of putative monooxygenase (yp_193413.1) from lactobacillus acidophilus ncfm at 1.55 a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
217
structure length
210
Chain Sequence
ETPIFKIKKLTIAENDRSEYIRYAEKNMHDSIPAEEGTLLIGSGHDDAHGEDNYEIEVFRNKGAEDLHIAGSHADDFVETVNKIATKQKVIDLHPEVITTKAQDNFVMRLIKVEVKDADAEKFSHAVKKEMTTSMASEPGMEIMMSGTNIDNPNEWYFIEVYANDEAYDIHVKTPHYKEYIEETDGMVKSRDVKTLVRDTLATQGAIVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative monooxygenase
publication title Crystal structure of putative monooxygenase (YP_193413.1) from Lactobacillus acidophilus NCFM at 1.55 A resolution
rcsb
source organism Lactobacillus acidophilus ncfm
molecule tags Oxidoreductase
total genus 59
structure length 210
sequence length 217
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3f44A00
1OQ6A 1OQ3A 1VQSA 2K2PA 4NPOA 5IXUA 3BDEA 2IYIA 5B0GA 4OJHA 4YDXA 1X8DA 5T7LB 2QIFA 4A46A 3K7RA 4FNHA 4OJ1A 1S6OA 3LGNA 4HI2A 2QLXA 2OD6A 4A47A 2N4DA 1Y3KA 2OKQA 1JWWA 2ROPA 2RMLA 3BN7A 2OFGX 1IUJA 1K0VA 1N5TA 1Q8BA 2AJ0A 1CC7A 3E8OA 2HIQA 2FB0A 2HLTA 1X0PA 2RU9A 3VTIA 1KVIA 1XBWA 3HHLD 1FVSA 1S6UA 5B0DA 1TZ0A 1YJRA 3HF5A 1Y3JA 2W4DA 2PD1A 1YJTA 2EW9A 3KG0A 3LGMA 1JK9B 2GV1A 1TL5A 2IFXA 1N5SA 3FRYA 4HI1A 3IWLA 1AFIA 3MCSA 2N4CA 1SQEA 2XMTA 3GZ7A 5B09A 5A6PA 1TR0A 5KAKA 1Y9OA 3FGVA 5B0CA 1N5QA 3QMQA 3CJKB 2G9OA 2L3MA 2XMUA 4Q2LA 2RSQA 1MWYA 5A6WA 2GO8A 3BF4A 4OJGA 5B0AA 2K1RA 2ACYA 1X7VA 2OMOA 1CPZA 2CRLA 1YJUA 4Q2MA 1FEEA 1VQYA 1FE4A 4OJ3A 3BM7A 4Y2MA 3T9NA 1SB6A 2JDJA 4ZOSA 2PGCA 2XMWA 4Y2IA 2GGPA 2Q3PA 1CC8A 1MWZA 2HFOA 2QYCA 3HDSA 4YEAA 3DCAA 1ULRA 4ZA1A 4HH1A 2KYZA 3HFKA 3UDCA 1LQ9A 4NL5A 5B0BA 2XMKA 2OP5A 3MZIA 2HLUA 3BGUA 2HFNA 4DL0C 3TRGA 2W4CA 2AJ1A 3HHLA 5F0UA 3I9ZA 3QGPA 1P6TA 2ASYA 3FMBA 3KG1A 4A4JA 1APSA 3HHLC 2RILA 3TOQA 5T7LA 1N5VA 2ROEA 4QOTA 2ROGA 2BYCA 1Q53A 1RJJA 5B08A 1FESA 5B0EA 2AP6A 3IWXA 2KT3A 2OFHX 3LO3A 1U7LA 5K9FA 2KT2A 2ZDOA 2W4PA 4U9RA 2AW0A 2LXFA 1FVQA 1KVJA 2LQ9A 4FNIA 2K7JA 1Q4RA 2N7YA 2XMJA 1OPZA 1Q8LA 2IYGA 1GXUA 4HH0A 2KKHA 1YRXA 3TNVA 2BJDA 2K1RB 2XMMA 2FHMA 1P8GA 1V3ZA 4Y2KA 3F44A 1OSDA 1YJVA 2FIUA 2LQBA 5F0WA 1Y0HA 2HQIA 2LDIA 1YG0A 1AFJA 2BUNA 2ZDPA 4HL9A 1W2IA 4OIXA 3BR8A 3HX9A 4DN9A 1R6YA 1TL4A 2OD4A 2XMVA 3KKFA 1KQKA 2GGPB 2BBEA 2GFFA 2VH7A 4DPOA 4EFAC 1AW0A 1FD8A 1GXTA 1URRA 2BJEA 2GA7A 5B0FA 3CJKA 3DXSX 2K7KA 3KNGA 4A48A 1FE0A 4F67A 2FTRA 1SI9A 1QUPA 2QLWA 3BB5A 3WDOA 2GCFA 3HHLB 2VV5A 1TUVA 1WD6A 2OAUA
chains in the Genus database with same CATH superfamily
5CCLA 2PMHA 2D3UA 1U6FA 3D6MB 3JQMA 1T05A 1QUVA 4ED5A 1HNWJ 2NREA 5KAKA 1ZM3A 4F2SA 4OHXA 2IM3A 3HO1A 3QJLA 5F9LA 5K8MA 1RACB 4KGXB 3OVBA 1X9MA 3IA0A 5DLFA 2M8HA 3HULA 4FKXA 2XS7A 4PPDA 3GYGA 1SVDA 1I94J 5AXNA 3M2RB 1NSPA 1RWKB 2W2QP 1R8HA 1ZETA 2NUUG 3IS9A 3W9IA 4EZ9A 3MUTP 2H65B 5AXMA 2FIUA 4Z7YA 4DPUA 2U1AA 4Y34A 4NLSA 1SJRA 2KVIA 3Q24A 2BJEA 5ETPA 3EZ5A 1ZA1B 2CQHA 3TZWA 3W5XA 4HKQA 1NK5A 2HRTA 3UDVA 5E33A 3KHLA 4IDKB 3CWJA 5J2MB 5DG7A 1CJUA 1AA1B 1M5VC 1S12A 2CADA 2J7KA 4RR5A 2N4CA 1KQGB 2YNFA 4UQTA 2DNGA 2AYGA 4EWTA 3DLEB 1QAXA 2FZKB 3Q22A 4IO1A 4OZJA 1IBKF 5A8WA 4NE9C 1WC1A 2VFRA 2QFJA 2R2SA 2XYHB 2KRBA 1VJWA 1SJ1A 2QC3A 3W60A 2HQCA 1KOOA 3PIOQ 2IHR1 4IR9A 1IQTA 3MAHA 5U47A 1RTIA 4RNMA 1BY9A 4DL4A 3NY0A 4JYAF 4O0NA 2RVJA 2M5YA 3O6QA 4ES2A 2J0QD 1U1PA 4Y3CA 3BB5A 2DO0A 2P6TA 5IXUA 4OJHA 3RB6A 4DR7F 2CNNB 1XWLA 2RRNA 3IS9B 1M5PC 1XK8A 4DV0J 4DPYA 3MPVA 3KG0A 1SXLA 4FF1A 1NK8A 4DR1F 1YQHA 2KL8A 1UAWA 5HANA 2B56A 3QT5A 4P52A 3EYZA 2DNKA 2X1GA 4GKJJ 5E3RA 5G4DA 3AQOA 4DCPB 2NXJA 2NYIA 1K1QA 3ZFVA 3OL7A 1S9GA 5L39A 3A3OB 2IDEA 1CJUB 3AJ2A 4IYQA 2M4MA 2JSXA 2DEIA 2OO4A 5F8LA 3MHYA 4OI1A 1G2EA 2ALYB 2XQCA 1QVGR 5KFYA 4ED0A 3VAKA 3VCDA 1Q95G 2E9ZA 5KFRA 1TL4A 1XMOJ 5CZVA 5IWAJ 5A8WB 1X60A 1MSWD 4DQRA 4C3KA 1PBUA 4LBHA 4KGKA 2Q6BA 4NYZA 4UOCA 3C8YA 2B8QA 1RTIB 5E3QA 4ED1A 1ELOA 3QGIA 2Q1LA 2XSJA 4C7QA 3QWPA 3K17A 1N36J 2F63A 3L7UA 1X7VA 2KVQE 2B4UA 1QSLA 3U1LA 2VPYB 5FJ4A 3BO2A 4IFVA 3MFIA 3OFFA 2CVIA 4CLLA 4KR0B 3M8SA 2HEKA 2HFNA 1B0PA 4ID8A 4DPWA 3PYGA 1Q53A 3K59A 1WOOA 3WX4A 2VICA 4EBCA 3TX0A 2XMJA 4ZJOA 2RQ4A 1Y7PA 2IJRA 2HHVA 4GO7X 3QRQA 1YJVA 4WZQA 4CLKA 3S6EA 1AW0A 3CJKA 1S9GB 4J9MA 4F67A 4PG4A 1NDLA 3M8QA 3ZZYA 1FRHA 2WBMA 2K2PA 4NI2A 5H1SV 1X4FA 3V5RA 2CZ9A 1N5TA 2FJDB 2AYMA 2DT9A 2XZWA 1WTBA 1GEHA 2ALZA 1VQKS 3EM1A 3M8YA 4WFNQ 2FPHX 3J7Z5 2OPRA 5CHCB 1C0TA 3SDEA 3IR6B 5A6WA 2OMOA 2VFTA 3N9UC 3VQTA 1FEEA 2JFKA 4O3NA 2KO1A 2JDJA 2QA4S 3DM2A 1U2CA 1N0UA 4PABA 1YBUA 1GMVA 3IM9A 4UOHA 4F04B 4QWCA 3QT7A 6FDRA 2E5HA 5HVHA 2IM1A 3SQGA 2XSJB 1X4EA 4B17A 4R8UA 1L3UA 1S59A 2B0GA 2CQGA 2ZWPA 2ZJRQ 4WYLA 2CJXB 4IFVB 3T1AA 3K5NA 3W62A 3ZZ0A 4C6AA 5ETRA 2Q6CA 2DRBA 1WD6A 1XJWB 2IVYA 3NWGA 3BZQA 2FZGB 3BJYA 1N48A 3FSXA 2YTCA 1Q8BA 4PRFA 1HQ2A 2JEIA 1RISA 5DO2A 1L3SA 2GV1A 3W5YA 4X4QA 1RAEB 4DUYF 5B09A 2LEBA 5B0CA 3CJKB 3M8QB 4YS2A 2RRBA 1X4DA 4H54A 4NI2B 2F4FA 4ZOSA 2CNLB 2COLA 1S4FA 3LAMA 4I0WA 5FD1A 2YQ3A 1KLNA 1P1TA 1RT4A 2OPRB 3KDOA 5SUHA 1C0TB 3SDEB 1SC6A 1NRKA 1SJ3P 4HH0A 5KG1A 1FRKA 5KFMA 1EQ0A 4USTA 1HD0A 2V34A 2V4JA 3RRGA 2WB1D 1N88A 4ZN1A 2OELA 1M1HA 1SC4B 1U24A 5EUHA 1R31A 1VK8A 5HMWA 2W7PA 3NS6A 1TVRA 2UXCJ 2C3YA 4R8UB 1UPMB 3FDSA 2EFOA 3MFHA 4PR6A 3D1HA 4NZ6A 3AY0A 2XMTA 5A2QY 1RAOA 2DRAA 3K57A 1TP7A 2PMZD 1R43A 3EWGA 1CPZA 2AYEA 5DZ6A 5IV3A 4DSIA 5GAHU 1VDHA 1VYAA 5H9EK 2XMWA 3DLGA 4HDGA 3TA1A 4IUFA 3CCWA 3FMBA 5AJ3F 3CJQA 1ZPWX 1WTFA 4P74A 3C14A 1YJWS 1FJCA 4XAKA 2OI2A 5ETVA 3PACA 3OW2R 1MN9A 5T14A 3CJ3A 2UUCJ 2NLWA 1OYDA 1WHXA 2M3DA 3GCWP 3L09A 1TUVA 3HZEA 3OV7A 1KWMA 2KG0A 2NQPA 1RT4B 2UUBF 1CC7A 2HIQA 4C3LA 5BYRA 5ITHA 2UU9F 2CAJA 1PJ7A 1NZAA 4CH0S 2V4JB 3DOKB 4TLQA 4CLWA 1EKRA 3Q8YA 5KFAA 1UL3A 4NEZA 3TYTA 4GVBB 3BQ2A 1MW7A 4DPXA 1RTZA 3M32A 1TVRB 1CJVA 1XN9A 4QIWD 2M0GB 7AT1B 5D6GA 5D77A 4UY8T 2AJ1A 2C2NA 3K58A 3HZGA 3BPSP 4ZLNA 4B3RJ 4ERDA 2G2ZA 4MIWA 4DV4J 2IYGA 5IT9U 3D1QA 3K8VA 1X5SA 3NGTA 3V6JA 4B9VA 1XNQJ 5LL6d 2CQ0A 4Y28C 4OYMA 2R2RA 2DR8A 3PEHA 1KQSR 3DLGB 4EK2A 4B3TJ 1M1KT 4DBQA 3MPDA 3NGRA 4CZCA 1DQ8A 3IGVA 2SXLA 1JWWA 5GAHI 3C14B 2QZ8A 2J5AA 2ADCA 1QAJA 4CLSA 2P8IA 2GJ2A 2YWWA 2IDLA 3F56A 3GP9A 2IBOA 3OT9A 1Y9OA 3MPYA 1JMTA 4NX9A 2K1RA 1JNZB 2G1DA 2B43A 4ZKAA 3MMAA 4KAIA 1H3DA 1R8PA 1BWVA 2MLYA 3OLBA 1UVKA 2ROEA 1NNDA 3I82A 1GNKA 2HGMA 4NCAA 3OTBA 4E8UA 2LXIA 2O66A 3UVJA 4I6YA 3TZZA 2R8IA 1V3ZA 1FD2A 2CJ9A 5L1KA 2HVZA 3M32B 3RBZA 2FLOA 2FVQA 1Q86T 3DNCA 4CLPA 1WF2A 5ETMA 1CJVB 1B64A 2NZCA 2QGFB 4CLZA 3QPIA 2BOPA 4X62F 1YZ7A 2W7OA 2D9PA 4KPCA 5D8HB 4MTPA 4OHYA 1D8YA 2PEHA 2OEKA 1TAQA 2EK6A 4NA2A 2FVSA 2H1YA 4JI6F 1ZM4A 1S72S 2EC0A 4HTJA 4H4MA 2Z2YB 1IVZA 4U95A 1NSAA 5I3PA 3K0JA 2P6SA 1IQZA 1ULRA 5E5NA 4KQZA 1LQ9A 2BMBA 3KLHB 3JTNA 4C8OA 1RCOB 3QIPA 3JQJA 1ZPVA 1CG2A 4ED7A 3GR1A 5HN0A 2WSCC 2A2DA 3C46A 1WF0A 2DB1A 2LQ9A 2C2OB 2K1RB 4YDDB 1IR1A 2AJQA 4WFYA 3BSCA 2DNZA 5IM0A 1HNWF 3MMAB 2EXUA 2OD4A 2DGOA 4U7UK 4PG8A 3EZUA 4NLPA 5IS2A 1PAUB 4DFPA 3BYPA 4H4KA 4OJ1A 2VPXB 1WF1A 4NCGA 3QATA 3UVJB 2CIMA 1L3VA 2OEJA 1S6UA 1I94F 2PD1A 2ZC3A 3PHEA 3J81U 2QLFB 3EJMA 3ZTPA 4ZPVR 1N5QA 1HBNA 3CDAA 1UETA 3GFHA 4RLEA 1F1BB 4FKYA 4DOZA 1R8AA 2JH3A 3ILLA 4EO8A 1SB6A 4OHWA 3KUEA 5KFLA 1PGZA 3AT1B 4DFKA 3HDSA 2DNOA 4QJVA 4ECWA 1WOPA 3R9LA 1U1RA 2ASYA 1C1BA 1WC0A 2XHCA 4XDDA 4PXBA 1YRTA 3D3BJ 2AMCB 2Z4PA 2IM2A 3PW5A 2VPWB 4H4MB 2AGQA 4USJC 4JBCA 1Z2LA 5E0OA 3PW2A 3QT8A 2DGTA 2ZJQQ 4WU2A 4NLGA 3Q89A 1MU2A 2QLWA 1PC4A 4B3SJ 1OQ6A 3VAHA 1QSYA 3I56S 3QIPB 4OYOA 4L76A 2XEXA 2BQ3A 4ILMA 4K2JA 5JJBA 3ITHA 1UCNA 3BH7B 1S1TB 5J2NA 2MB0B 4LVOP 2ZH3A 5IM0B 1HI8A 2R7TA 3DLLQ 1FRMA 2Z56B 2L41A 1BQXA 1FNXH 1GT8A 3QMQA 2XO7A 4G3IA 4UZBA 4HDHA 3I55S 3W2WA 2EBGA 4GMKA 2MDAA 4ED2A 5H9EJ 1UVMA 3P49B 3FSIA 4NCGB 2OP5A 5KFFA 1HBUA 3OSPA 3BEGB 4I68A 1JJHA 4OI2A 1S6QA 2HRUA 4M5MA 1M5SA 4ZVTB 4ZVHA 1U2FA 1HBNB 2AD9A 5KFEA 4DV0F 4FVCA 4MYTA 4EU0A 4ICLA 2E5IA 2I0XA 3GYXB 1VBZA 4OYBA 3KOAA 2FHJA 1OS5A 4GKJF 4U6PA 4ZJLA 3ZZPA 4X66J 1A7GE 4OX7A 1C1BB 5AXKA 1E6VA 1S6OA 3H7HB 4X4UA 1DY3A 2VC1A 3BS9A 1GXLA 2BJ7A 1HPZA 9ATCB 3LQVA 3E01A 1N52B 3TWZA 2BANA 5L9XA 2VBXA 2KZMA 1T02A 3CJRA 3N28A 1MU2B 1UW4A 3RB3A 1VQOS 1XMOF 1TELA 2M7SA 1X4CA 5IWAF 4P73A 3UFCX 2ZUAA 2QL7B 2EFQA 4N5SA 1QD1A 3ITHB 3D3CJ 4LIRA 4C0BA 4LFBF 2QX0A 3GQCA 1HLWA 4I64A 5J2NB 2LU2A 4I4BA 5IC4B 4FZVA 3VV2B 1WSVA 1HNIA 2UUWA 2KFZA 2DCUB 3QNWB 1A6LA 3BR9A 1JKHA 4ITSA 3W2WB 3N5FA 3PIPQ 1LV5A 2VKRA 2ZFHA 4OIXA 2HHTA 3G8TA 1RQ0A 2IC3A 1UFLA 3VGSA 5ETNA 1HBUB 3CCTA 4DCOB 1TK8A 2D69A 3SCIE 4ELVA 1WOSA 5KFKA 1WDTA 4A47A 1PKUA 1S6QB 3OBIA 3M30A 2DITA 2YPYA 1IM6A 4LF7F 2XGQA 1PG5B 5C5JA 3FBCA 4KGZB 4M5LA 4ICLB 1NDCA 3VQSA 5HAOA 3GTYX 1T8EA 2YH0A 1X4HA 1HNXF 1FNMA 2F1FA 4P2MA 4QBUA 4NLYA 5KFIA 3I4PA 4NMLA 1EAYC 2RIJA 2O5DA 4KJIA 3US5A 4KSEB 2YKNA 1LXNA 1D1UA 1NH7A 2A2CA 1ZA2B 3MAAA 2RILA 1HPZB 2VA2A 1MMLA 2DKOB 3E01B 2BANB 3PTWA 3N5BA 1U7LA 3JQKA 1N56A 3C66A 4IRKA 5CZXA 2W01A 4ZCKA 1XTZA 1OSDA 4YB7A 4K0KJ 4FYXB 2DH7A 4TY8A 3CCZA 1RAJA 2CQ1A 3KXDA 1J5EJ 3LALA 3C2PA 4PYAA 5D3GA 3RW6A 4PAAA 5D78A 1RUSA 1YBTA 4NOHA 1HNIB 1XR7A 3I5CA 1QAIA 4A8XA 3T1YF 1JJ2R 5C7PA 2CPEA 1JKHB 5A8RA 3DDNA 4Q8FA 1Y3JA 5HJXA 1NKEA 1B0TA 3EDQB 3CJTA 4QIFA 3ADAC 4OX8A 3EUNA 3RW7A 4CO5A 2HNZB 2IMWP 2VG6A 5KFBA 2MHNA 5FDLB 3IN5A 2Z2MA 3BBBA 4JI4J 3M30B 3PW7A 3BH6B 2OGUA 4MKBA 2R2UA 3DOLA 4LQ9A 2GAHC 3CIZA 3MMJA 2PC6A 4GO5X 1P9YA 2PE8A 3ENVA 3MI7X 1F3FA 2JVOA 4IG3A 4P75A 3M2UA 2R9LA 1UZDA 5MAOA 4NEYA 3I6PA 3IWNC 1VLOA 2YKNB 4HT7A 2KHCA 4OI6A 4PXDA 3MAAB 4ZVGA 3ULHA 1MROA 1U2RA 3I0RB 3A3PB 4RU2A 4WIQA 5KG5A 3I31A 4F3QA 4L72B 4TY8B 5KFWA 3D6TB 2FDNA 3M6WA 2DNNA 3SIPB 1LXJA 5D3GB 4LRFA 4NZ7A 4OZ3A 2FLNA 4OZ0A 2VQEJ 4LF5J 4Y6IA 2E5GA 1K73T 1SJQA 3S8SA 1V5IB 2X7IA 1S76D 5A8RB 1NZ8A 4K4TA 4LFAJ 2UXCF 4PCQA 1I3OB 3BBFA 1UZHA 2CJBA 5KFCA 1RWXB 4G1QA 2AV5A 3BKTA 2VODA 5LMNJ 4Y2KA 2VG6B 2D9OA 2V2QA 4ER8A 4YB1P 4ILRA 1S7HA 4DU8A 3CCES 3DOMA 4ZDNA 1MNEA 3DOLB 2HHHJ 2L48A 1AUSL 3MMCA 3T5JA 2OJ3A 1CJKA 3B6BA 5JUMA 1XR5A 3U1NA 2ZM6J 2OPQB 4EZ6A 3AXMA 3NLCA 4BCAA 3CCVS 4IG3B 4FPIA 4NZ0A 3MCSA 2DH9A 2ZUGA 1U4BA 3D0GE 4DUTA 2ZJPQ 4ECTA 2N3LA 5HLFA 1CULA 4D3GA 4LSLA 4P2XA 3EGNA 1MROB 5HI7A 4CTAA 4EI2A 3EGVA 3R5AA 2OPSA 2PEBA 1RWNB 2B7BB 2HLUA 2M52A 1LW2A 3QAEA 3BGRA 1KHWA 3FJ2A 4TYBA 2F8MA 3G87A 1FO1A 1J5OB 2KG1A 4ZJQA 4RL1A 2H5EA 4JV1A 3HI9A 5J1EA 2WRMA 2LQBA 3SSSA 4GC6A 4OYZA 1RHKB 2CQCA 1R6YA 4NRUA 1NO8A 3M8PA 4QW9A 4EBDA 4DI6A 4IQMA 1HWJA 2EI5A 3VHQA 2KB2A 2LKZA 2XI2A 1U1KA 2QIFA 2CDQA 2ZBRA 4QWDA 4A8FA 2OD6A 2N4DA 3N6MA 1IUJA 4NWBA 5KFZA 2FD2A 4G1QB 1YVFA 3HSZA 4JB8B 2V8VA 1RBLA 1UFKA 4DSKA 4CT8A 2PA8D 2MMYA 4DV4F 2A0FB 1VQLS 4IOBA 3DOMB 1H2TZ 3IBCB 3KUGA 4O3OA 1XNQF 1T0TV 1RHMB 3BGOP 2VA3A 3MMCB 3G6VA 2H4YB 4NA3A 4IQXA 4B3TF 4C0HA 1CJKB 2LQJA 3A8IA 2DNRA 3MZIA 4G1PA 2M2BA 1H7XA 1NDPA 4FDFA 3LAKA 3QSYB 3GR0A 3IWXA 1Q5YA 1V6HA 4M63A 4X64J 4FNIA 3J7AN 3DRYA 4Q7AA 4WTYA 3AOAA 3ENWA 1T9VA 5HLFB 3NOGA 2WVBA 2IM0A 1CULB 2YPZA 4AT1B 2QSWA 5HATA 1Z4UA 1OY8A 3W9HA 2GFFA 4OZ1A 4Z37A 2E7XA 2OPSB 5KT4A 2DK2A 4MKYA 3PYFA 1LFPA 1LW2B 3BGRB 4OI3A 3ZC4A 2RMLA 3ZZZA 1PIEA 5DM6Q 4B9TA 3QZ8A 1NMEB 5HMYA 1UA1A 4QIEA 5IT4A 4L74A 2RE1A 5J1EB 3TUPA 1YJTA 2AEFA 4F4YA 4FXWA 2FVRA 1K8AT 3FK4A 4PXCA 5HL7Q 1AROP 1YDLA 4M1KA 4DV1J 1PJ6A 2AJ4A 1WKLA 1RT6A 4FYVB 4LF2A 2BQRA 4USVA 4F4XA 2R2TA 1SH2A 2ZWOA 2BJ1A 1KOHA 1U8WA 2QYGA 2C1EB 3GCXP 4XK8C 2LXUA 4LBPA 2KKHA 4ZIVA 3L7OA 4U67Q 2BXJA 2NPIA 2V8HA 1WG5A 2YNHA 5KFPA 2DH8A 3DGVA 3T5LA 2C2EA 1T9XA 1FJ7A 3G8SA 2DY9A 2R8KA 1SCJB 4M5KA 3TZYA 4NPOA 3TZXA 2EKYA 2FJAB 3SCLE 2MZRA 2X1AA 2OTLS 4Y2CA 1BQMA 2UUAJ 3OL9A 3SI8A 5HP1A 1LWFA 2H3EB 2DD8S 4O0IA 3W8GA 2QA2A 4LF4F 1KTVA 2EFPA 2BW7A 2J7WA 2M8DB 4H4OA 2RF2A 5DRKA 4RBVA 5J2PA 3BQ1A 2WBRA 1W26A 4X65J 3B4MA 4N47A 2ZOMA 3NKYA 4WFXA 1SIZA 3DDIA 1PYSB 2M88A 2CWXA 5KT7A 1VISA 3ICLA 2OLWA 5E7OB 3MECA 3GWCA 4DSFA 4CLUA 2J0XA 1YZ6A 2B8PA 2HAIA 4YQWA 4WP9A 2H5JB 2CQ2A 3RR7A 3FRZA 3GFXA 4OFZA 1RT6B 2MXYA 3NNCA 1NJIT 1CLFA 4ZP8A 2PIIA 4P6QA 5M2UA 4YHHJ 3G9CA 1NM2A 3POTA 2I8EA 1UKUA 3DN9A 2KH9A 3IAM9 2FGCA 5CYQA 1GTEA 1FDAA 5DETA 1D9FA 2IVFB 5IT0A 2YNHB 2Z57B 3H2VE 4DLEA 2HQGA 4K4SA 1JLCA 1VFJA 2CPYA 2JLFA 2FY1A 1WEZA 1XC9A 4GKKJ 3OUYA 3EICA 2B9EA 4Y2MA 2JOQA 2CJQA 3JB9k 3CT9A 3A8JA 2DISA 2YKPA 4BBYA 1BQMB 3HM9A 1WNEA 3BGUA 4RNOA 4B3SF 1REGX 3OTOF 1UEVA 5HP1B 1LWFB 1O6XA 2EFGA 3U27A 4NLXA 4W98A 4Z2XA 1B7FA 1JLEA 3NP5A 2RDJA 3OJSA 1CQNA 3THTA 2PFDA 3N01A 2VOOA 4H4OB 3EZOA 2RF2B 2F4VJ 1PYOB 2EPIA 1S4EA 2DNMA 2QMUB 2VUGA 1Y0HA 5J2PB 3AOCA 1RT1A 5A76A 4CLFA 3D0HE 1RBOB 3DHXA 4G1IA 3IRXA 1RXOB 1Z1ZA 2H51B 3GIJA 3OLAA 4X4SA 3MECB 4W90B 1G7CB 2VD3A 3KHHA 2IVMA 4OL8A 4GRSA 2C2MB 1JIHA 3CTRA 5EWGA 1TZ0A 5I4MA 2I5JB 4BDPA 3R2CJ 2ZH2A 1RWVB 3KJFB 4P2SA 3CB4A 3GZ7A 3TAMA 2YVSA 3OD2A 3BREA 2ZH9A 4USUA 5F3TA 1KRPA 4JI2J 4URGA 1T3NA 3M6XA 1UVNA 5E3PA 2O3DA 3POTB 4WXOA 4O3RA 1ZAWA 1U48A 5D15A 5HVFA 4NA1A 5CYQB 3TVKA 4J9NA 5HMZA 4X66F 2CVEA 3KG1A 3D4JA 1KBRA 1BGXT 4NYPA 3RAMA 4AYBD 2WSEC 2X1BA 1JLCB 3R6GB 5HJYA 4X4VA 4DL7A 3MUVP 3I5BA 5M2RA 5LJ5Y 1HWKA 3KJNB 3P6YC 3OUYB 3Q8RB 1JJCB 4ZCLA 3GSDA 1W2IA 2BE2A 3BQ0A 4OZNA 2KXNB 4URSA 3NEKA 1PAEX 1D0EA 1SUQA 2DHXA 2AF6A 2GCFA 1WELA 2RHSB 3J7YU 3OXGA 2ZH7A 3PJWA 3T6BA 1JLEB 1U26A 5KT3A 1GTHA 2AGOA 2QJ3A 1UA0A 4PWWA 3G4SS 2BDPA 2IFXA 1RT1B 3MD1A 5HK4A 1B99A 2WTFA 3GIRA 3D5MA 4CM0A 1JNRB 3IRXB 2FHOB 3PJXA 3N6LA 1RWUA 4UQGA 2P9EA 1TKZA 3A13A 4XTTA 2GQQA 1HHQA 3J80U 4R0JA 2HRYA 4JUZA 4UOGA 1RADB 1KNZA 1R0CB 2AP6A 3TAMB 2W4PA 1QTMA 1FJGF 1RHJB 4AL7A 4UUXA 2Z8QA 1AT1B 2QMWA 3DRPA 3H0PA 4X4RA 3GJTB 3TA2A 4CQ1A 1N33F 1TKXA 2LCWA 3W5ZA 5DGAA 2Q66A 4IH6A 3EXCX 1NKBA 5KFGA 4ZVOB 2XULA 3O1LA 3VGVA 2K06A 3K2YA 1EP4A 4NXMJ 2OTJS 4RW6A 1SJFA 4WU3A 3LANA 5B0DA 4MT1A 1UMJA 1Y5IB 4LR8A 3CO0P 5FLXY 4K8RA 2BE2B 3UN2A 3UNYA 3MM6A 4ED6A 2B4PA 3BKFA 2BE7D 5HSPA 2ACYA 1AUDA 4V19X 1NAQA 1PCAA 1Q7YT 4K0KF 1RA6A 2V69A 3BBCA 2EFNA 3J81Y 2DHHA 3AD8C 1J5EF 4Q8EA 3RB0A 4YOEA 3WIUA 1FKOA 4NL5A 5HMXA 1K47A 3D9BA 1KFDA 3FFIA 4DF4A 3GFYA 3PX0A 3GFZA 2E7WA 2VASA 3J7YI 5F3ZA 5EDWA 5H9FJ 3HLUA 3MEKA 4ALZA 3NG8A 3OXLA 4QWAA 4W4MA 4FS1A 3Q2TC 1T3OA 3UCGA 1KVKA 2IJNA 2W9CB 2NXNA 2F9DA 1SKSA 1RBAA 1VQ5S 1R0BG 5L1JA 2ASLA 2F8HA 3MM8A 1TKZB 4O4GA 2GQ2A 4MAKA 2XB2D 2C3UA 4S0MA 4TY9A 3JAMY 1WEYA 4A46A 2JVRA 4C11A 1NHVA 2CKWA 1RT2A 3H5SA 4OZLA 2PA3A 4ZP9A 3TA0A 7FD1A 2DO4A 3DRPB 3DRRA 4DUZJ 4DV5J 4KYZA 1TKXB 2E9TA 4DR2J 2KDOA 1UEKA 4DV2J 3AOBA 1JLFA 2FJEB 3CC4S 4K4WA 3G8QA 5D0GA 1EP4B 1T7PA 2DVIA 1HQEB 2Y9HA 3D67A 1L5UA 4RW6B 4DSEA 1RA7A 3LW5C 4KHMA 2RKIA 1EIYB 1P6TA 1HBOA 3TW0A 4QIVA 2FZCB 2GX8A 2MQOA 4J5OA 3QAUA 4OHVA 4XIUA 3MM6B 3AD9C 1WHVA 4KC5A 3CDEA 4R5PA 1VGYA 1DFDA 1S7IA 3LP0A 3MCMA 3R5GA 4ELUA 1NHKL 1FKOB 2V2ZA 1FTCA 2OH2A 3VAJA 3FZBA 3Q8QB 3FFIB 3CULA 2OMLA 2VQEF 4CO1A 3MR3A 4BS2A 2MY7A 3H4DA 4I69A 1JLQB 4KGVB 2B9WA 1BLUA 4LFAF 5GVQA 1NBEB 2ILZA 3MPUB 2O1PA 4DR6J 2CQ4A 1ZH5A 5KG6A 3F73A 2JHEA 1N34J 3VALA 3MM8B 4O4GB 3AD7C 4JI8J 4F2RA 5T41A 4DFJA 1D9AA 2J6UA 1D3WA 4J9SA 1TV6A 2Q3PA 2ABYA 1JQGA 2CJAA 3VZIA 2OEMA 2RDIA 4C11B 4I67A 4ELTA 3QGPA 3DRRB 2HHHF 3A4TA 4PKDB 1TKTA 1NU4A 2Q79A 3TVZA 2BM0A 1JLFB 4KH1B 3TUZC 1UWAA 1BC6A 5B7WA 3DMJA 2ATLA 2DNHA 2ZNYA 1NPPA 3X1LB 5E41A 2QEXS 3FQLA 2LEAA 3W63A 5THWA 5G0RA 2E66A 2BX6A 2RKIB 4TQSA 1HBOB 3UDEA 1Y10A 3CF5Q 3V2UC 3MCOA 2HQ3A 1UJ5A 3V81A 1KVIA 2HHWA 2NPFA 2W4DA 5EX0A 2HFZA 4O3PA 2YQ0A 1RWOB 4R5PB 1FFGB 3LP0B 4HTIA 4RUAA 4MK9A 4B9LA 2QL9B 3IC1A 5F8HA 1BE4A 4OYXA 3MDFA 1KKHA 3SCJE 1S10A 4C8MA 4PUOA 4B02A 4YP3A 4LF1A 5KFTA 2J0SD 3HD2A 1QAYA 1HL6A 2IA0A 2HZVA 1FXDA 3G71S 1HNVA 1OY9A 1FA0A 5CH7B 2FUG9 2NS1B 4ZN3A 1VI7A 4YB5A 2BV3A 1TV6B 3MM9A 1VOMA 3EGZA 3M9OB 5IC6B 5F8MA 1HHTP 2BACA 3Q23A 3QGGA 4UF4A 5GADU 2NSBA 3EMTA 1ITPA 3FBEA 4J7CA 4TU9A 1TKTB 1LFWA 4RWWA 5F8JA 1SC1B 2F5GA 5LXYA 4LSZB 2XBPA 3MPWA 4DR3F 3MCNA 2EW9A 4O3QA 1U49A 3DMJB 5LSRA 1AFIA 3R6LB 4F4ZA 4JV5J 4LF8J 5G0RB 2YH1A 3QIDA 1KSPA 4M8LA 3U1MA 5KT6A 1FJEB 1VBYA 5D4OA 4ZIWA 4YEAA 2XI3A 3V81B 2UXBF 2CFXA 4LF9J 3DU6A 4LSNA 3VGUA 2EG1A 2GJFA 4ZPTR 2JRSA 3R7SB 2VL1A 2HFUA 2GMHA 3GV5B 2VBWA 2HFVA 3KLFA 2CZVC 2WW4A 2C28A 2H48B 4DDFA 3ZZTA 4EEYA 4GVLA 2VJUA 4XO0A 4KH0B 4OI0A 4C8NA 1YIJS 2KXFA 4I1TA 3M9NB 3R8YA 4DV1F 4KT0C 3FCWA 4OZ2A 2EFVA 3V6KA 3DRSA 4PUOB 2HSEB 3OHBA 3MR2A 2V94A 4CDIA 5F8GA 3K5OA 4NYOA 2C3MA 1T9YA 3GYNA 2RH3A 1R27B 1NEEA 2LYVA 3SV3A 3NL0A 1HNVB 4N7TA 1H6KX 2HS3A 3FRYA 3HJFA 3W7BA 2JLEA 3TEGA 4P7VA 3W9JA 1F2HA 3MM9B 1NKCA 1NB7A 3M8WA 4ZK7M 4R25A 4KIAA 2X3DA 2GHPA 3P96A 1S99A 3MF5A 1Q1KA 2VBZA 3UD3P 2XWYA 3EPGA 2HNDA 2XS5A 2W24A 2EBEA 4CLYA 2XC9A 1FI4A 2GIFA 2CZ4A 2DNYA 2NZ4A 4ES3A 3GILA 3RJMB 2D74B 4IOAQ 2LLZA 4L3NA 3PRBA 4ZLPA 2RQMA 1CS4A 1UFWA 2E1MC 4ZP6A 2DR7A 1B70B 3DFEA 1AFJA 4LSNB 2J9EA 2G1HA 1N6QB 1DHMA 4X65F 1HIYA 4B08A 3KLFB 2OFGX 3BSNA 3JSYA 4F8RA 1SQGA 1S1WB 2BQUA 5IOLA 3OFHA 3UD5A 3B82A 2VFVA 1SH0A 5CABA 2I2YA 2RUSA 2HHXA 3O2IA 3RBEA 2UVWA 3OR2A 1ZTTA 3DRSB 2A6MA 2JFDA 2QSFA 2WZ1A 3QQCD 1IKWA 2KU7A 1S57A 1HR0J 1VMBA 4O3SA 3S7RA 2C22A 1HD1A 2W2OP 1F5AA 3T6JA 4OQJA 2BM1A 4F3MA 4YHHF 4RU9A 4KKOA 4B3OA 2VIHA 3BDPA 2RJZA 4NLVA 3ISZA 3P3DA 4DR7J 3T1HJ 4LRCA 7FDRA 5F0WA 4LVNP 4ZPBA 2ZH1A 2PT0A 3SXLA 1N5YA 2HNDB 4DPOA 2G2YA 4A8YA 4ECXA 5K20B 2XZDB 4GKKF 4M5DB 3Q8VA 5CXTA 1G3OA 4LIWA 1UTAA 5I3UA 4HI2A 2DRDA 2LFVA 1U6BA 1HNZJ 2VJVA 4ZVEA 2DPJA 4P10A 4X2BA 2R7WA 3OFGA 1V9OA 4DN0A 2MJUA 1CS4B 4DXLA 1I1GA 3UWTA 4LBIA 5A2QU 2NUHA 2UZAA 2F4VF 2J9DA 2BEFA 4UW2A 3AFGA 1ZZNA 1NUEA 5HQMA 1EX8A 1JXEA 3C6TA 1DTTB 3CD5A 3FBBA 3MAQA 3HT3A 1YI2S 1SPBP 3GG0A 3ZTSA 1U45A 3MR5A 3TOQA 3IBWA 2NYHA 2W25A 1RAAB 2KRRA 3GPAA 2RQKA 1IKYB 3OR2B 3SV4A 4NCBA 2L08A 1IKWB 2HK3A 1BMQB 2LP4A 3A3NB 3CDUA 3PRDA 2OPPA 4JI2F 2ZHBA 1LEOA 3EXYA 2ILYA 3QFWA 1T9UA 4Z7CA 4KKOB 4WE1A 1H2UX 4B3OB 1IJFB 1L3TA 4MK7A 2WVFA 2HVIA 1OY6A 2YKMB 1IR0A 3IBFB 3VR1A 4ZLJA 1WJ9A 2I1RA 1N5YB 1DLOA 3MR6A 3ONQA 2FLPA 1F9HA 4FP9A 3DLBA 3HKZD 1UW9A 3G6ES 1Y5NB 1RCXB 2DHSA 5I3UB 3DCAA 2KFNA 4K59A 5F8IA 1TTHB 5ETSA 1FTRA 3JXOA 3TI0A 3NRBA 2DIUA 5KFXA 3MR7A 5JMNA 2E5JA 2R4FA 2KT2A 2BOAA 2LU1A 1NK7A 5J1NA 4X4PA 3FCVA 4KY3A 2XMMA 4HHHA 1RP5A 1C2PA 1H98A 3C6TB 3KNGA 4WTOB 1VJQA 4EGLA 2Y1JA 2C3OA 2L9WA 1WKKA 3UW1A 1S1UB 1QVFR 4QR0A 1R3NA 5L1IA 2JJ4D 3GIIA 2AX1A 1QLNA 1U0HA 2ZHOA 3SSRA 4K50A 4RUHA 3NWRA 2HMIA 2GVDA 3RAXA 4CH1A 2ZHAA 3BV8A 1ZYQA 2IRXA 4WKRA 1OSCA 2OPPB 2GHWA 1VQMS 1URNA 1NCLA 4DX8H 4CH7A 5AE2A 1JLGA 4FBTA 4WE1B 3ILJA 4DV6F 4YR2A 4KB7A 3CUNA 1BQNA 2XMKA 2YNIA 1N54B 4MJKA 1U6ZA 4A4JA 4C9DA 4KV8A 4NXMF 3DOKA 2Y8YA 2BYCA 1YK9A 1IWGA 2X51A 1DLOB 4GVBA 1X31C 4QR2A 1VHFA 4V1Ak 2XY5A 3I96A 3H2LA 4ZVRB 1NK9A 3JTPA 2YKOA 1VRQC 4CO2A 2YX1A 4UT4A 2EG2A 1Q7LB 1HYSB 2HK2A 2G0CA 3WDOA 4RPFA 1FDBA 5DJBA 3MWBA 2W7AA 5ADZA 2L9NA 3HKWA 2KJVA 1FVSA 5K8NA 1H72C 1SL0A 1B4SA 3NNAA 1RTJA 4QW8A 3RGIA 3FEXB 3CW2C 3R5JB 1CQMA 2AX0A 2YWFA 2JLGA 2MZJA 3WQPA 1DURA 4DZDA 4ZP7A 2FLLA 1XNRJ 3MGJA 1U0HB 3HHDA 3MURP 5LMUF 2F65A 1AXQA 2BA9A 2HMIB 2GVDB 1SL2A 4M95A 2VG5A 2CQ3A 3SYZA 3RR8A 3Q8PB 1PBAA 2LXFA 1TFWA 3K89A 5EWEA 4KFBA 1B7YB 4DUZF 5K8PA 5LT5A 3DGPA 1XMQJ 4WF9Q 3BYRA 1AZSA 4H4KC 4CO0A 4DV5F 4DR2F 3KKFA 3OPKA 2ZITA 4WJBA 1JLGB 4DV2F 2CJYB 3HP6A 3L95X 1BQNB 4RW9A 2YNIB 2K3KA 4QPTA 1KLMA 3DYAA 5DZ7A 4KV8B 3GIKA 3CJ8A 4I7FA 2CPDA 1RLCL 2OKQA 2Y3YA 3AXKA 3D2WA 5KFHA 1YJRA 4J9LA 1SH3A 4DSJA 3FMWA 4U7CA 3CD0A 1ZBTA 5BR8F 2BE9B 3I5AA 1KFSA 3H40A 3GG1A 1YSJA 2DGVA 2VONA 5LXRA 1Q79A 3LF0A 2JNJA 1RLDA 4OJGA 2MTLA 2IY5B 1VQYA 1KC8T 2HS0A 2EK1A 3VWSA 2KT5A 4DG1A 4Q0BA 3BSAA 1ZAVA 4LUBA 2P5VA 2XHWA 2YY3A 5F8NA 4FPRA 2DTJA 2QT7A 1GMWA 4GC7A 2K3IA 1IM4A 1FWLA 1H73A 1VQ9S 1RTJB 3U7JA 4DR6F 1KDNA 3KK3A 3CD6S 2UU9J 2HBRB 4FXDA 1JLBB 3CNQP 1N34F 3KLHA 1GXTA 1VC6A 4ZS6A 4A48A 4JI8F 3L9ZA 1VIOA 4K4UA 1O5JA 3R5CA 4OYWA 2CPXA 2JEJA 4JI5J 3ET6A 2DGQA 2VG5B 2V8DA 1TMMA 1WC4A 4KFBB 3KYLA 3DGPB 4BC7A 1AZSB 1H38A 2ZVIA 2PFFB 3PFOA 3EDRB 4CIOA 3QJPA 4RW7A 4RW9B 3OTDA 2HKEA 5D0RA 4QQBA 1KLMB 2Y1IA 2WONA 3DYAB 4AQYJ 4I7FB 3SEOA 3TUJC 2GGPA 1ACMB 2CPZA 1PSDA 1KS2A 3NAIA 1HWIA 2FC8A 4UOFA 3QRRA 4EMDA 3TRGA 3PEJA 3I9ZA 2GAGC 2MKSA 2Y8WA 1Q8KA 4F0HA 4QWEA 6AT1B 1NPKA 2BJDA 4M5IA 1YG0A 2AKWB 2A10A 1KQKA 3CCUS 3B4DA 1RE1B 1K44A 5K5MA 3H5UA 2HS4A 4DG1B 1ZAXA 4Q0BB 2A1BA 4TVAB 1VQSA 1RSCA 2W2MP 1VIXA 4ANCA 1LW0A 4FYYB 3TP2A 2WOMA 1GFWB 1EKSA 4N8OA 4K4VA 5HQ8A 4USMA 2GMLA 4UY85 2AJ2A 2CNKB 1NHUA 3KK3B 2MYFA 3IWLA 4TYAA 1D09B 3AA8A 2MKIA 2KFYA 2MHEA 2F8EX 4WFZA 3TVYA 3WX8A 2FJVA 3ET6B 3H5YA 4DSLA 1S1TA 1Q82T 4DR4J 3RG6A 4Q44A 4DV3J 5BYSA 5EHHA 3T9ZA 5CYMA 4PXEA 2D7SA 4LFCJ 4RW7B 2K8GA 1SC3B 2E29A 2WONB 4DV7J 1TL1A 2GGPB 2FJXA 4CNYA 3Q86A 4JV5F 3KJVA 4LF8F 1ZM9A 1U02A 3G6XA 2V8PA 2XY7A 4D3HA 4P2FA 3RTVA 3AJ1A 2FVCA 1IWAA 1LWCA 1DTQA 2DYAA 2N82B 2VB6A 2H5IB 2IRYA 4EUVA 1U1OA 3NMAA 4LF9F 4Y65A 1RAIB 1JK9B 3LWMA 1TL3A 3V6DA 3AODA 2V50A 4ILLA 3JSBA 3EX7B 1YLXA 4N76A 4AFFA 2RNEA 4FVMA 1LW0B 2J76E 3WHIA 4A8SA 2WOMB 3LPEA 2GVZA 4HACB 4ZVPB 3KHGA 1CJTA 3H98A 3RRKA 2KN4A 4I2PA 2JX2A 1Y5LB 2XCPA 4L73A 4BC9A 1BUXA 3W3SA 5GMKa 3LOUA 1RI7A 4MMOA 1HFEL 3GONA 2VV5A 3UCZP 4ECSA 3OSNA 3KK2A 2RQCA 5CYMB 3KTQA 2JEGA 3PM9A 3UO0A 4P72A 3O44A 4ETZA 3TJ9A 5I42A 1PC5A 4PG7A 4HI1A 3LA0A 2GJIA 4FF2A 1TL1B 1S9EA 1LK5A 4JP8A 3J81j 4E2FB 2DNPA 3KJVB 1RGVA 4ED8A 2R8JA 4BLGA 4J9QA 2AYBA 3BM7A 4HHJA 4FF3A 1LWCB 1DTQB 3H5XA 2HVHA 4HH1A 3SFUA 1WSRA 4BHQA 2B4OA 5L1LA 3HHLC 1XEZA 1U1QA 1TL3B 3PO4A 3QBCA 3V6DB 3M1VA 2HWIA 2K7JA 3R1LA 2BKPA 1YJ7A 2ASDA 1T05B 3PW0A 1TQLA 4PG5A 2GC8A 2ZBIA 2ZDPA 1P1LA 1M0SA 3HX9A 3NCQA 4EFAC 2MZTA 3PYDA 1R7IA 2K7KA 4C98A 1QUPA 4F4KA 2YQ1A 1UVIA 3V4IA 3OJUA 2GVZB 1X5OA 2Z0GA 1HR0F 2QO3A 1CJTB 3TQ1A 5KG3A 4IOCQ 3T5HA 3CPWR 1VCTA 4I2PB 1O0PA 3W64A 1TL5A 1N5SA 3DXBA 3PKMA 3AB4B 1PO6A 4WZMA 4C8YA 2AZ3A 2JL9A 2PDAA 2KYXA 4RUCA 3T1HF 3MXHP 5B0AA 4QU7A 4FYWB 3QLHA 2G2OA 4L6V3 3CDBA 5IFMA 1IBLJ 4ES1A 3FZ2A 4K4YA 2YWKA 3KK2B 3PX6A 4ANEA 1P27B 5KFDA 1R8CA 2JC1A 5B0BA 3PDNA 1F3VA 5I42B 1N36F 3J7ZT 1HNZF 1M1GA 2N7CA 2KM8B 1S9EB 2HNZA 4IFYA 2XGPA 1R6VA 5AE3A 2DGSA 3PR5B 5FDLA 1GXUA 3GJSB 5KFOA 2VHGA 1WC5A 3VZHA 4ZVQB 1SI9A 1HBMA 2YNFB 3MOJB 9RUBA 4PQAA 1N8RT 1VRTA 3BDEA 2RS2A 5JVGQ 3ILIA 4FYDA 3K7RA 4WK3A 2BRKA 3M1VB 3L4BC 2ROPA 2MKYA 2ASJA 3PCOB 3A8EA 4DZ6A 4NASA 2C2RA 1TL7A 3JYTA 2CYYA 1S48A 4LFBJ 8AT1B 1IKVA 2YXLA 2M9KA 3UPFA 4O4RA 4J91A 5KT5A 2AZ1A 2KXHA 3BGFA 3S01A 3R27A 2CRLA 5DDOC 3V4IB 4B3MJ 3FEYB 3I0RA 3LP1A 2QG9B 2QYCA 4J9VA 5ETQA 2XLJA 3EE3A 3M6VA 1VRUA 1TUGB 3VAIA 3C16A 3QYYA 4W92B 1S1XA 4QOTA 1UVLA 4K4ZA 4AXJA 1VQNS 2JC0A 3QLHB 1JXLA 3ZXWA 3HVWA 3CSKA 3BSOA 2H54B 4LF7J 2XM3A 2C2KB 3GB0A 5D4NA 2LECA 3K8WA 2P9CA 4UZCA 3CMES 3TX8A 4TU7A 3N4WA 3N6NA 1H0HB 4IO9Q 3ISNC 5KOXA 3ZTQA 1HNXJ 3OFEA 2IRUA 4IFYB 4HEA9 1MLAA 1X0PA 5KFVA 3NGSA 3FCHA 1TK0A 4IRCA 5AE1A 2OSQA 4X84A 1F2GA 5MLCV 4RUBA 2MQNA 4RJVA 1EB0A 3MD3A 1HBMB 2E5LJ 2R7QA 2ATCB 4ZITA 1FRJA 1VRTB 3T9NA 4J9PA 2FJWA 3CEDA 1NSQA 1REVA 2OPQA 3G82A 3HHLA 1TL7B 4FF4A 1VR6A 3JYTB 2WW8A 4RBUA 1OIAA 2MQQA 4K5RA 1IKVB 1J27A 2XO6A 4N8NA 4DEZA 5B08A 3H90A 1PJ5A 2XZTB 1A9NB 2AW0A 3EGWB 4C4WA 5DM7Q 5C24A 2EWHA 2E1CA 2NCKL 3T1YJ 3HCXA 3Q83A 3LP1B 1TKDA 5KFQA 1JJ4A 4PEOA 1DARA 1GK8A 3ETMA 2J8AA 4CP5A 1VRUB 4K5SA 2LQ5A 3C16B 1U47A 2IMOA 1S1XB 3NS5A 1X9SA 1J5OA 4JI0J 4XPEA 2DR6A 2HAFA 3BN7A 3PNIA 2QFIA 4OHZA 1XERA 3GV8B 2W8KA 5C25A 1JXVA 1GX6A 1X4GA 5DG9A 1X4AA 3MEGA 2V2VA 2POKA 4FBUA 3PHTA 1NJWA 3OR1A 2XMUA 2V4RA 1MMDA 4LREA 5IZHA 1OWXA 1GH8A 1TU0B 1TUWA 3RBDA 3DLHA 3D66A 3I32A 5ETOA 1WACA 3DLJA 5D4LA 2B51A 3IFEA 1VQ7S 4Q5VA 2VFSA 4DR5J 2CQIA 2QMXA 2XLKA 5L38A 3NXZA 1VLYA 1HHSA 2PI5A 5GAEU 4PWDA 1REVB 3G82B 1R8BA 3HHLB 4TQRA 2VDIA 2RB7A 3KDNA 3HVTA 1XNRF 2D1CA 1IR2A 2H4WB 2MY8A 1HW9A 4NMXA 2D3O1 5C24B 1XBWA 2EEYA 2UUCF 3DM2B 1S79A 1ZZFA 2PO4A 3T41A 2V8GA 3SQGB 1VK3A 3C6UA 3CIMA 2ZH4A 1XMQF 3HPOA 4F36A 3D1OA 1YJUA 3WC2A 4UUWA 3ZZUA 4DF8A 2GW8A 5SZTA 2HFOA 2YWEA 2RRAA 1FRIA 3M9MB 4WK1A 5C25B 2P2CB 2J0WA 2E9RX 1TAUA 5I3QA 2HHUA 4CWBA 4DX7A 3DLKA 3MEGB 4OLOA 3OR1B 4CNZA 2HBZB 2BJ3A 5GMEA 3KLVA 2Y0SD 3BO4A 4B9NA 1ICEB 1FRLA 3R3TA 2C42A 1URRA 3D54A 1QDUB 1WG4A 2X3GA 2MKKA 3KJQB 5DDPC 1UEUA 1EJ7L 4NLDA 1FE0A 1X9WA 2BKNA 2FTRA 3NOCA 2VDHA 4B3RF 2H9ZA 2ZZNA 3ZNJ1 2NSCA 4FNHA 2CQBA 3LGNA 4J9UE 4WP8A 3F41A 2R42A 1V3SA 2QTWA 3PYEA 5BJRA 3H4BA 5DDQC 1BHNA 3ENAA 4ECVA 4F3OA 4F25A 2WAQD 1NSKL 4Y2AA 1DQAA 4PWDB 2E44A 2HWHA 3GJQB 5DDRC 4KHRA 4C0OC 3L3CA 4JI3J 1XIQA 4ETXA 4LRDA 1S77D 2ZBPA 1T9TA 4Y2IA 3HVTB 5KG0A 3VF0B 1I51B 2HW3A 4OX9J 4OYPA 2YKQA 1DRZA 5GAEI 3WIVA 4JI5F 4NLQA 4B9MA 3HMJG 2EKNA 3GMGA 3C6UB 2HQDA 3H59A 2BJ8A 2HURA 2ZNZA 3IP0A 5IQQA 2FC9A 4RBTA 2FJBB 4FXVA 5KFSA 3CCMS 2V9WA 6FD1A 4AQYF 3RRHA 2HZCA 4ZPDA 2CDRB 3DLKB 5KG2A 4AL5A 1Y3KA 5DS7A 3IMQJ 2NXEA 3TQEA 1EHWA 3NNHA 2AEJA 1SJ4P 1KP6A 3W66A 2HPUA 4E0DA 4ZMMA 1XQIA 1FDNA 1S0VA 2DNLA 2L3MA 3D7SB 3A12A 4Q2MA 2P9GA 5LOQA 1RABB 2DR5A 5LJ3Y 5H9FK 4C3MA 5AXLA 2XS2A 5HO4A 4IR1A 4EBEA 4NLWA 1NK6A 3T3FA 4F50A 3KLGA 2ZH8A 1GQEA 1DBDA 2GMJA 3IG1A 4ZLLA 3OTCA 1WHYA 3GJRB 2AQ4A 1T11A 3UR0A 1EETA 3CCQS 4AD6A 2IJFA 2OAUA 2HHPA 4C8ZA 2GHVC 4IH7A 1FX4A 4K7QA 1C1CA 4YB6A 2E1PA 4DR4F 1G1XA 3N79A 3DU5A 3N0VA 4DV3F 3HJVA 2C2ZB 4B9UA 4U8VA 4DHVA 1FCAA 3B8HA 1WI8A 2QRRA 4DL6A 5CAAA 4LFCF 1IKXA 2UV8A 2I9SA 4DS4A 5EN1A 1FEHA 1F5BA 4DV7F 3MUMP 2V6AA 2VBYA 2WHOA 2MSTA 2I5JA 1GAOA 1Q16B 1J2VA 1RAGB 5K14A 4RZRA 2BJ9A 2Q43A 3A1YG 1OPZA 2XSFA 2BKOA 3TNVA 4LMZA 1VS3A 2XG8A 3I87A 5D0EA 1YTYA 1YRUA 1OO0B 2RAQA 2F40A 2OIHA 3B78A 3UN5A 4LF4J 1GX5A 2VC0A 3W1YC 2FHKA 2IYIA 5DQGA 4CCHA 4ZPCA 4LRBA 3KLGB 1IBMJ 2LDYA 1Q0NA 3IG1B 2KJWA 2FYXA 2LQ8A 2LA6A 1GMWD 3C15A 5FLXU 1TR0A 3DKDA 1EETB 3K5MA 2RSQA 2Z30B 3W61A 4ECYA 1G6BA 1S0NA 2DHGA 2PSZA 3UCUP 3ILOA 1IBCB 3AJDA 1C1CB 4CO3A 1HW8A 4ZA1A 2KYZA 2KHDA 2AEMA 4ECRA 1HQUA 1RU1A 1OMSA 3UNGC 4KBIA 4ATNA 2CQPA 2DGUA 3MEDA 5IT9Y 4CI0B 1IKXB 5KFJA 2WSFC 3F44A 5HROA 4OV6A 4MKVA 2BUNA 4ZHRA 1MN7A 4LT6A 1VBKA 3ENQA 1M5OC 1YGYA 1LWXA 1LNQA 3JAMU 3HHKA 5K8OA 1YHQS 3SFGA 5K14B 3GSIA 2CXEA 5KG4A 2AJ0A 1FXRA 1FKPA 4KHPJ 3RU0A 1WUUA 1H2VZ 4OYAA 3R5BA 4MIAA 3TAQA 1HWUA 1KN6A 4QYZK 4MYUA 3ZO7A 2ACMA 3R1HA 4KRWA 3OTOJ 3W2VA 3M4XA 1FFSB 2PN6A 1FKAF 2X1FA 1L3KA 1A0OB 3QJJA 2O01C 2R8GA 3PW4A 2W9BA 1MWZA 1QM9A 3I0SA 4DS5A 1LKZA 5M2PA 3OL8A 3GLJA 2D41A 3QFHA 4IKAA 4HHUA 3BN4A 5RUBA 1CSJA 4DJBA 2R7UA 3C15B 5A8KA 4CM2A 1Q4RA 4Q45A 2OUGA 2E1RA 3UD4P 3RAQA 1W25A 4P71A 3W8PA 2OHDA 3DHWC 1JLAA 2E7VA 1SKRA 1D8ZA 2KTQA 2FVPA 2XMVA 3JTOA 3Q0AA 4LF6J 2BR0A 4L75A 3OHAA 1SKUB 3ETOA 5L8RC 1WC3A 1HQUB 1IBLF 3IR5B 4EYIB 3EVMA 3IRWP 1FK9A 4RKUC 3OTEA 5E2QA 1NXIA 2Z2LA 3CMAS 2G4BA 3FNNA 4DFMA 3R7NB 3HD1A 3RB4A 4B9SA 3LPYA 3MEDB 2W9CA 1RK8A 5LSOA 1T9WA 5HROB 4LJMA 1MMNA 4ZHRB 3UE2A 4MK8A 2YX7A 3GE9A 1PILA 2G9OA 4Q2LA 3DC2A 2MSSA 8ATCB 5KFNA 2MZQA 4OJ3A 1AYEA 4YUDA 4ZPAA 3VVTA 4DX6A 2CWKA 5IQ6A 5KT2A 4DQIA 1FKPB 5JVHQ 3RZAA 3SQOP 4I56A 4TKTA 5KFUA 3THPA 4RX6A 3LWLA 4JI7J 4URQU 1QSSA 4CO4A 3CGIA 3W2VB 2XTJP 3AH6A 2IAJA 4ZVUB 4QZVB 2G0JA 1HQEA 5CA5A 4PYDA 2NR0A 4QU6A 1BWEA 2R7SA 3BR8A 2GIRA 2VFUA 3QO9A 2W9BB 3I0SB 2HBYB 1YITS 2FQQB 4YN3B 4B3MF 1DAXA 2MQLA 1WDDA 1KQFB 2Z58B 3SBMA 5A8KB 1NPRA 2FB0A 3CCJS 1RHRB 2AIRB 1FT8A 1JLAB 3QGHA 1VBXA 1N32J 2CUYA 2B7CB 2B9YA 3I4HX 2APOA 4PQUA 1T95A 3CJ0A 1KEKA 2CPIA 1FJGJ 2ZBCA 1FK9B 1IJEB 1JLQA 4WIIA 1SBRA 3CJ4A 1RHQB 3CD7A 4JV2A 4LR7A 1N33J 5D4PA 5L9NA 2RDDA 1N5VA 4N56A 2UP1A 2I6WA 4N41A 1E6VB 2HGNA 1Q8LA 2GNKA 3MTJA 4JI4F 2VQFJ 2CJKA 2IA6A 1E6YA 2E5LF 5KTQA 5DG8A 2ZZMA 3M8ZA 4USIA 5J2QA 4V19J 3E3XA 1OYEA 2DEJA 1CEZA 2IAJB 3ZTRA 1K9MT 1NJZA 1FRXA 1NDKA 3QO9B 2GZOA 3BO3A 4X4NA 4RW4A 2L9DA 3UR3C 5KOWA 4M5GA 1UPPA 3V4MA 2IIHA 3SSQA 1HMVA 4DL5A 3NCRA 2Y1RI 3NMRA 2CPJA 1YJ9S 1RU2A 3M7VA 2IC3B 1FWKA 4A8WA 4JI0F 1O8BA 3K5LA 3CDWA 4C97A 3PRVA 3HVRA 4PQUB 2N7YA 1V3RA 4M5JA 4LF5F 2W2PP 3KLIA 4HL9A 1RKJA 4DN9A 3HSJA 2ZD1A 4MH8A 5ETKA 2YBVA 4OV1A 1QY7A 1OQ3A 2AJFE 4MIBA 2I38A 4USWA 1JX4A 1DZ5A 1FF2A 1X5TA 5LMNF 8RUCA 4ED3A 1K0VA 2QLBB 2ADBA 2DHAA 2V63A 3LTOA 2E1AA 2HZAA 3FEZA 2ZH5A 3KFWX 1RWMB 3D6HB 4KPYA 3Q8UA 1G4CA 3BKUA 1SV5A 1HA1A 1SKWA 1ZOTA 1E6YB 2F3JA 1NK4A 4DR5F 1NH8A 3CJ5A 5J2QB 1R89A 4HYKA 3IM8A 2D3ZA 2ZM6F 1V5VA 3IAS9 3UDCA 5DQHA 5BYQA 2RS8A 2VKZG 2RU3A 3CCSS 3QZ7A 3TJ8A 3D28A 2W2NP 5L46A 3LO3A 1M5KC 4F4WA 1FVQA 1OPIA 4RW4B 3KHRA 3FKBA 3CCRS 2D3OR 2A6OA 2NXCA 2LEPA 1I6JA 2GO9A 1HMVB 2HYIB 3CC7S 5B0FA 3UN3A 1MWQA 3P45B 1HKAA 4DQPA 2XCAA 3A8KA 4TU8A 1U1NA 3LH2S 4YY3J 4C48A 2DBBA 3AAWB 1RAHB 4U96A 1WEXA 3TANA 4XDCA 3NGUA 1RWPB 2C2DA 1UJ4A 4QWBA 3KLIB 3LGMA 1NJYA 2MJNA 4QYZJ 3QSIA 3R5DA 4NLUA 3KK1A 2ZD1B 3FGVA 3JSMA 2ERRA 2KI2A 3HFVA 2ZVSA 3O8WA 2GQCA 2DGWA 1FNOA 5C2GA 3LGHA 1U1MA 2V9KA 3FC9A 4WFBQ 3HFKA 2UXDJ 3M2UB 3MTKA 3C3LA 4WXWA 1RT7A 2HVDA 2XY6A 4TNOA 1SV5B 3M6UA 3Q2SC 2YWHA 2ZH6A 3D0IE 2B4VA 2CA9A 2J6SA 2ZBQA 2GA7A 2HHSA 4QPXA 3DXSX 4NXNJ 1MG7A 2UUTA 3V6HA 4JI3F 4X64F 1X8DA 4L3KA 5E3CA 4JI1J 1YBAA 1VC5A 4QYRA 1HI0P 2J9CA 4OX9F 2U2FA 1UWBA 3HHLD 2BRLA 4NRTA 2Y0BB 2V68A 3BGLA 1SQEA 4ECZA 2QE5A 4C8LA 4WKYA 3TARA 2MQ8A 1N6QA 2VPZB 2MQPA 2XYPB 1S1WA 3UQSA 3OVAA 3H25A 4QCLA 2DJWA 2HNYA 4EYHB 1ROFA 2W4CA 2HVEA 4C8KA 1EQMA 1RJJA 3KK1B 1M90T 2DR9A 1R0AA 2ZEJA 4J9KA 3JSMB 1YRXA 1LOUA 2IPOB 2UVRA 4F0KA 2HBQB 3NBPA 2MQMA 1RTHA 5HQLA 4DR3J 2B5JA 3D6FB 2BZ2A 5C42A 1WORA 5F41A 1RT7B 2ZDOA 1FHTA 1U09A 1IXKA 4K4XA 3NGDA 3VAGA 2Y1LB 4UTGA 4J90A 4WFAQ 4LSLB 4OLPA 4DPTA 3VTIA 4CTAB 1HWLA 2YWGA 4QR1A 2R8HA 2DPIA 3E51A 3RUBL 2YX4A 2UXBJ 3HSDA 1RKIA 5CD4A 4M5DA 1MWYA 1WWHA 4NLRA 4RWXA 1X0FA 3G6YA 5FIIA 2UUAF 4XPCA 3EPIA 5EWFA 5GADI 2CPFA 3HVAA 2MKJA 1Y4ZB 4ZPWR 1FWPA 3MOZA 1UWBB 3M8PB 3VAFA 2O67A 4QIGA 5B0EA 3P4UB 3FBFA 3M05A 2WVDA 2BABA 3CXCR 3PO5A 2XNRA 2V67A 4AE5A 1RB0A 1DTTA 1KR4A 2BBEA 2HWTA 1IBKJ 2HNYB 4ANDA 2WB4A 2N3OA 4O44A 4A8MP 2ZZTA 5B0GA 2OSRA 4YDXA 3P5BP 3PXGa 1FXLA 1IKYA 3CVKA 4KO0A 4AUKA 3E8OA 3IR7B 4OI4A 1R0AB 2AT1B 3H2UB 3G86A 3TEHB 3H20A 4HR2A 2A3JA 3NBPB 1RTHB 5AT1B 4JYAJ 2B5JB 1WKJA 3AB2B 5C42B 2GO8A 2ZKTA 1FE4A 3D68A 1KONA 2AWZA 4HT5A 2YKMA 2R7OA 3ZZRA 3CC2S 3DRXA 4DQSA 4AXIA 4FS2A 2V0NA 4DWIA 3ISND 5C2CA 4DR1J 2OFHX 1IBMF 1NK0A 4A8QA 2J7UA 4IG0A 1FX2A 4DMZA 1Q5VA 4I6AA 4YFUA 2VH7A 1S6PA 3TAPA 2DY1A 3UDLA 2YNGA 1T03A 3J7A1 1D9DA 1ZS6A 1UP1A 3C19A 1VQ8S 4KTQA 2QLXA 3KMQA 2QL5B 1YX2A 5CCMA 2R7VA 1DQ9A 3AHPA 2EVZA 3F0NA 1UJ6A 2CPHA 1S5ZA 2QN6B 2UVVA 1U1LA 1NJXA 2DXDA 1S1UA 1F0XA 4O44B 4ENOA 3MMBA 1H7WA 3KG4A 1CC8A 1RZMA 1KD1T 4KO0B 3LP2A 1K1SA 1S9FA 3GU0A 3PV8A 2HHQA 3IO1A 3X3UA 2EC2A 3QRPA 1UVJA 2FGOA 4KHPF 4N77A 2LVWA 3TR5A 4X4OA 4JOUA 4J9OA 2MZSA 2ZE2A 4RW8A 1RYSA 2W9AA 4A8KA 4ED4A 1LK7A 1U0SA 2ZKUA 2JEFA 2XWXA 5A0YA 3VVUA 3OVSA 1Q81T 2Z2ZA 3M8RA 4F0MA 3DI6A 5D0HA 1K0TA 1U8SA 5IV4A 2MLZA 1TK5A 4G65A 3PZPA 2QV6A 3JS9A 2YKAA 1RT5A 2RU9A 2MLXA 3HF5A 5ETLA 3TO8A 1TFYA 4IG0B 5EX3A 1HYSA 3R7BB 3H8YA 3SZ2A 5A6PA 1S6PB 5CD4H 4X4TA 3HXMA 2VF3A 4DU7A 1VQPS 2YNGB 4USHA 1T03B 1S1VA 4P9SA 1OJ4A 1WC6A 1I5OB 2XYGB 4DX5A 4LF6F 2HFSA 1XR6A 4RNHA 4ZCMA 2VG7A 1XMBA 4P7TA 4BWJA 4DL0C 3EVOA 2FY8A 4C2MA 3WZ0A 5T7LA 2M70A 2DGXA 4ZVSB 1C4CA 3E2EA 1YKWA 2J6TA 4RO0A 5LSLA 3MMBB 2AHOB 2PI4A 4WPAA 4CT9A 3LP2B 2CQDA 3IXQA 1RYRA 5CQGA 2R3VA 3SCKE 4Y0FA 3R2DJ 1X4BA 4KE5A 2RUGA 1S97A 4LRAA 4DL2A 4MKAA 4F02A 3VGTA 4PG6A 1F9EB 1PYTA 2WVEA 2J8SA 2XMAA 3QT6A 2ZE2B 4RW8B 3G2XA 1N4LA 4ZCIA 4R0EA 4JI7F 1SIWB 1YJNS 2XLIA 5A0YB 3CMQA 2W8LA 2VU5A 3DI6B 3HT0A 5ETTA 4CRJA 4LQ3A 3CJ2A 1NLKL 3HK2A 2QLJB 4CYUA 4DCJB 4U7UD 1F5CA 1RAFB 2CG8A 1RT5B 4MFBA 1AB8A 2ZOFA 4J37A 2MZ1A 3NS7B 2ZC4A 2MGZA 4DUYJ 2DNQA 1KVJA 2BVZA 4E98A 1GMUA 1C0UA 1S1VB 3S1TA 1N32F 2F7VA 3L7PA 2G0IA 4YMEA 3B54A 3HHEA 1JB0C 3PY8A 2RHQB 2VG7B 3CCLS 3TJAA 2CNOB 4WBFA 1Q8IA 1WI6A 3WBZA 5T7LB 2B9XA 4G6VB 2MKCA 3NGKA 2JZ5A 4J9RA 3H42A 2W1BA 4NLTA 1JLBA 4DV6J 2WK4A 2XNQA 2UV8G 3KUHA 1U25A 3WC0A 1TMJA 4I6WA 4F7VA 2V4QA 2NXUA 2HQFA 1B0VA 3ELHA 2VQFF 2PGCA 1KTQA 1S0OA 3RBXA 4WP3A 4LR9A 2A18A 2DIVA 3FSYA 3FUYA 1N0VC 5KG7A 2BW2A 1APSA 1SUQB 2LMIA 4YR3A 3MM5A 4RNFA 2LA4A 5BXIA 4ID5A 2JWNA 2C3PA 4PPZA 2GIQA 1RWWB 1QJHA 2DXEA 2HQIA 4EO6A 4CYUB 2HG4A 1VHIA 4M5NA 4MFBB 3HSGA 4DLGA 4OZ5A 3G96A 2G13A 1RTDA 1NB2A 2QA4G 5AJ3J 5E3AA 5HBMA 3TUIC 3O3LA 5F9NA 3MEEA 1P9QC 2MGZB 2GS8A 4FN5A 1F9FA 2V2KA 4ECQA 3OQ2A 3T5KA 1C0UB 1BD6A 5J1PA 3CJSA 4WCEQ 5LMUJ 1H74A 1RDRA 3QWUA 1LWEA 4YR0A 1WHWA 4BWMA 3GIMA 1ZM2A 4O23A 2F9JA 1EARA 3PVXA 5GAGU 1DJ0A 2MPUA 4I2QA 4OYIA 2IBKA 1S0MA 3AA9A 4OX6A 2UUBJ 1Z2ZA 1W7WA 1W2BR 3BPDA 3I9V9 3KLEA 3KWMA 2HGLA 2HIYA 1FESA 3PFEA 1Y00A 3P5TL 4U9RA 1BXNA 4RNNA 5HVGA 1EZZB 4DQQA 1Q78A 1FFWB 3MM7A 2FHJD 2VOPA 3FQKA 4F26A 3RYLA 3IGNA 2MEWA 5BR8J 4PWUA 3R97A 2CG4A 3JSRA 1YWXA 1VQ4S 3NAHA 2R7RA 2ZOGA 3MM5B 2B6AA 5EGYA 2KM8C 1FERA 1X5PA 4ID5B 2V5HG 2HLTA 3KNAA 4TLRA 1RT3A 4IH5A 1HARA 3M2VA 2DXFA 4Q43A 1F6TA 1VQ6S 1F60B 1T94A 5DLGA 1ZTWA 3BF4A 3ZTOA 1WG1A 4M94A 2J9DE 4TXSA 4KGMA 4U8YA 1RTDB 5HBMB 5CYJA 1QE1A 4NLOA 3MEEB 1IN0A 1O51A 3CO9A 2WVCA 3HHNB 4WWSA 3J80Y 2DCLA 1RHUB 5F0UA 4YY3F 4Y00A 4HVZA 4WYWA 2KZZA 2KT3A 4CLTA 1HI1A 1LWEB 2AGPA 3P8BB 4PZVA 2FHMA 1RT2B 3PR4A 1P8GA 5GMDA 1B3TA 3UI3A 2UVUA 2LDIA 4I2QB 3U02A 3ZZOA 3O5TB 3FVYA 4OMFG 3KMSA 1M5HA 4HACA 3W65A 3NCPA 3LUYA 3Q8SB 3PJ9A 2MKHA 1SQFA 3KLEB 2QA1A 3THVA 5GAGI 2UXDF 1QTNB 1S49A 3PX4A 4HLBA 2PMWA 5DQIA 4M5HA 3MM7B 2VZ9A 5JXSA 1SL1A 2AU0A 3M2RA 1CBKA 3PG9A 3OL6A 4AL6A 1VC0A 2RD5C 3CE8A 3EVWA 3HFZB 1C4AA 2B6AB 4NXNF 4X62J 4ECUA 3GV7B 5DGBA 3VAMA 4IRDA 3T19A 3SMZA 4F4AA 4USKA 3ZNUA 3DDKA 2B3TB 4JI1F 4JV0A 1RT3B 2ROGA 1Y11A 3M2VB 3OXFA 4DL3A 4TN2A 4JI6J 5K9FA 4IDKA 3AQPA 5J2MA 2R7XA 5LM7E 1CVJA 1KHVA 2WCXA 4A8OA 4ZVFA 3K5PA 3PKYA 1QE1B 1FD8A 2RT3A 1FDDA 4K2XA 3DLEA
chains in the Genus database with same CATH topology
3DOLB 2L9WA 3HHKA 2L48A 5K8OA 3UW1A 2PMHA 5CCLA 1S1UB 2D3UA 1YHQS 3SFGA 1U6FA 3MMCA 3T5JA 5K14B 1QVFR 4QR0A 1T05A 2OJ3A 5KG4A 1R3NA 1QUVA 5L1IA 4ED5A 2AJ0A 1FXRA 2JJ4D 3GIIA 1FKPA 2AX1A 5JUMA 1QLNA 2ZHOA 3SSRA 3RU0A 1XR5A 3U1NA 4K50A 1H2VZ 2OPQB 4EZ6A 4RUHA 3R5BA 4MIAA 3TAQA 2HMIA 1HWUA 3NLCA 4BCAA 3CCVS 4IG3B 3RAXA 1KN6A 4NZ0A 3MCSA 4CH1A 2DH9A 2ZHAA 2NREA 2ZUGA 4MYUA 5KAKA 3R1HA 1ZYQA 1ZM3A 4KRWA 1U4BA 3W2VA 4F2SA 3D0GE 3M4XA 2IRXA 4WKRA 2PN6A 1FKAF 2ZJPQ 2X1FA 1OSCA 4OHXA 1L3KA 4ECTA 2N3LA 5HLFA 2OPPB 4KHPF 2IM3A 2GHWA 1VQMS 3HO1A 3QJLA 4D3GA 5F9LA 5K8MA 4LSLA 1URNA 3QJJA 4DX8H 3OVBA 2O01C 2R8GA 3EGNA 1MROB 5HI7A 4CH7A 5AE2A 3PW4A 1JLGA 2W9BA 1X9MA 4FBTA 4CTAA 1MWZA 4WE1B 3IA0A 5DLFA 2M8HA 4DV6F 4YR2A 1QM9A 3R5AA 3I0SA 4KB7A 1LKZA 2OPSA 5M2PA 3OL8A 4DS5A 3CUNA 1BQNA 2XMKA 2XS7A 2B7BB 2HLUA 2M52A 2D41A 2YNIA 4PPDA 1N54B 4IKAA 1LW2A 3BN4A 4MJKA 3QAEA 1U6ZA 4A4JA 4C9DA 4KV8A 4NXMF 3BGRA 1CSJA 1KHWA 4DJBA 3DOKA 3FJ2A 2BYCA 5AXNA 3M2RB 4TYBA 2R7UA 2X51A 1DLOB 5A8KA 2F8MA 4QR2A 1FO1A 1ZETA 1R8HA 1Q4RA 1VHFA 4Q45A 2NUUG 2KG1A 2XY5A 2E1RA 3H2LA 3I96A 3IS9A 3UD4P 3RAQA 2H5EA 1W25A 4JV1A 3HI9A 4EZ9A 3MUTP 1NK9A 5J1EA 3JTPA 5AXMA 2WRMA 3DHWC 1JLAA 2FIUA 2LQBA 2YKOA 3SSSA 4GC6A 2CQCA 4CO2A 1SKRA 1D8ZA 2U1AA 2YX1A 1R6YA 4NLSA 4NRUA 1NO8A 2XMVA 4Y34A 2FVPA 2EG2A 3JTOA 3Q0AA 3M8PA 1SJRA 1Q7LB 2KVIA 3Q24A 2BJEA 1HYSB 2BR0A 4QW9A 4EBDA 3EZ5A 3OHAA 4IQMA 2CQHA 1HWJA 2EI5A 3ETOA 2KB2A 2G0CA 3WDOA 4HKQA 5L8RC 1HQUB 2LKZA 1IBLF 3IR5B 2XI2A 4EYIB 1NK5A 3IRWP 1U1KA 1FK9A 4RKUC 3OTEA 5E2QA 2QIFA 2Z2LA 3CMAS 1FDBA 2CDQA 5DJBA 2G4BA 4QWDA 4A8FA 3MWBA 2OD6A 2N4DA 3FNNA 4DFMA 3N6MA 2W7AA 5ADZA 5E33A 3KHLA 1IUJA 4NWBA 2L9NA 3HKWA 5KFZA 3RB4A 4IDKB 4B9SA 3LPYA 2KJVA 3MEDB 3CWJA 2W9CA 1RK8A 1FVSA 2FD2A 4G1QB 5J2MB 5DG7A 1YVFA 5K8NA 5LSOA 1M5VC 2V8VA 5HROB 4DSKA 4LJMA 2J7KA 1MMNA 4ZHRB 3UE2A 1SL0A 4MK8A 2N4CA 4CT8A 2PA8D 2YX7A 1KQGB 2YNFA 3GE9A 2MMYA 4DV4F 4UQTA 1PILA 1VQLS 4IOBA 3NNAA 2G9OA 1RTJA 2DNGA 4Q2LA 2AYGA 4QW8A 3FEXB 1H2TZ 4EWTA 3DC2A 2MSSA 4O3OA 5KFNA 3DLEB 2MZQA 4OJ3A 1CQMA 1XNQF 1QAXA 2AX0A 2YWFA 2JLGA 2MZJA 4YUDA 1DURA 4ZPAA 3Q22A 2VA3A 4ZP7A 4IO1A 2FLLA 3MMCB 4OZJA 1IBKF 3G6VA 3MGJA 5A8WA 4NA3A 5IQ6A 5KT2A 4IQXA 4B3TF 4C0HA 2LQJA 4DQIA 1FKPB 5JVHQ 2DNRA 3HHDA 3MZIA 3RZAA 4I56A 3MURP 4TKTA 5KFUA 5LMUF 2VFRA 3THPA 2QFJA 4G1PA 2R2SA 2M2BA 4RX6A 1AXQA 1H7XA 2BA9A 2HMIB 2KRBA 1VJWA 1SJ1A 3LAKA 3LWLA 1SL2A 4M95A 4URQU 3GR0A 1QSSA 2VG5A 2CQ3A 1KOOA 3IWXA 4CO4A 3PIOQ 3SYZA 3RR8A 3CGIA 3Q8PB 1V6HA 2IHR1 4M63A 4IR9A 1IQTA 2LXFA 3W2VB 4FNIA 1TFWA 3AH6A 3MAHA 5EWEA 3DRYA 2IAJA 4KFBA 4Q7AA 5U47A 4WTYA 4DUZF 1RTIA 4QZVB 5K8PA 3ENWA 5LT5A 1HQEA 5HLFB 3DGPA 5CA5A 4WF9Q 2NR0A 2IM0A 4H4KC 4QU6A 4RNMA 4CO0A 4DV5F 1BWEA 2R7SA 1BY9A 3BR8A 4DL4A 2QSWA 4JYAF 2GIRA 2VFUA 1Z4UA 3KKFA 3OPKA 4DR2F 2RVJA 2GFFA 2M5YA 2ZITA 1JLGB 3O6QA 3QO9A 4OZ1A 4WJBA 4ES2A 4Z37A 2W9BB 4DV2F 2J0QD 3HP6A 2E7XA 3I0SB 2OPSB 5KT4A 3L95X 1YITS 1BQNB 2DK2A 4RW9A 1U1PA 4Y3CA 2YNIB 2K3KA 4QPTA 4MKYA 3BB5A 2DO0A 1KLMA 2P6TA 1LW2B 1LFPA 5IXUA 4B3MF 3DYAA 4KV8B 4OJHA 3BGRB 3GIKA 4I7FA 1DAXA 2MQLA 2CPDA 3RB6A 4DR7F 4OI3A 1KQFB 2OKQA 3ZC4A 2RMLA 3ZZZA 5A8KB 5DM6Q 1XWLA 4B9TA 2FB0A 2RRNA 3QZ8A 3D2WA 3IS9B 3CCJS 1M5PC 5HMYA 1J5OB 1UA1A 1XK8A 1YJRA 5KFHA 4J9LA 4QIEA 5IT4A 1SH3A 2RE1A 1FT8A 3MPVA 5J1EB 4DSJA 1YJTA 3KG0A 1SXLA 4FF1A 1JLAB 3FMWA 3QGHA 4U7CA 3CD0A 4DR1F 1NK8A 1VBXA 1ZBTA 5BR8F 4FXWA 3I5AA 4F4YA 1KFSA 2B7CB 1K8AT 2FVRA 2B9YA 3H40A 1YQHA 3I4HX 3GG1A 1UAWA 2APOA 2B56A 4PXCA 4PQUA 1YSJA 5HL7Q 2DGVA 1AROP 4M1KA 2VONA 3EYZA 2DNKA 1Q79A 3LF0A 4OJGA 2X1GA 5LXRA 1T95A 3CJ0A 1KEKA 2CPIA 2AJ4A 5E3RA 5G4DA 1VQYA 3AQOA 2ZBCA 2NYIA 1FK9B 1IJEB 1K1QA 1KC8T 1JLQA 1RT6A 4WIIA 3ZFVA 1SBRA 2HS0A 3CJ4A 2EK1A 2BQRA 3VWSA 3CD7A 4JV2A 3OL7A 1S9GA 5L39A 4F4XA 2KT5A 4DG1A 2R2TA 5D4PA 4Q0BA 1SH2A 3BSAA 1ZAVA 4LUBA 5L9NA 2P5VA 2XHWA 2YY3A 1N5VA 5F8NA 4FPRA 3AJ2A 4N56A 1KOHA 4IYQA 2UP1A 2DTJA 2M4MA 2JSXA 2QT7A 2OO4A 5F8LA 4GC7A 3MHYA 2K3IA 1IM4A 4N41A 4OI1A 1E6VB 2HGNA 1G2EA 1VQ9S 1RTJB 1QVGR 1Q8LA 4XK8C 5KFYA 2LXUA 2KKHA 2GNKA 3U7JA 4ED0A 3L7OA 3VAKA 4U67Q 2BXJA 3MTJA 3VCDA 2NPIA 2V8HA 1WG5A 4JI4F 2YNHA 4DR6F 2E9ZA 3KK3A 5KFPA 3CD6S 2DH8A 5KFRA 4FXDA 1TL4A 1JLBB 1N34F 3KLHA 1GXTA 3T5LA 2C2EA 1VC6A 5CZVA 2CJKA 4ZS6A 5A8WB 2IA6A 1E6YA 1FJ7A 4A48A 3G8SA 2E5LF 4JI8F 5KTQA 2R8KA 1VIOA 4K4UA 1O5JA 5DG8A 2ZZMA 4USIA 3R5CA 1MSWD 2CPXA 4NPOA 5J2QA 2JEJA 4DQRA 2EKYA 4C3KA 2FJAB 4V19J 3SCLE 4KGKA 3E3XA 2MZRA 2DGQA 2X1AA 2VG5B 2OTLS 4Y2CA 1BQMA 2V8DA 1CEZA 2Q6BA 4NYZA 4UOCA 3C8YA 3OL9A 4KFBB 2IAJB 3KYLA 1RTIB 1K9MT 5E3QA 4ED1A 1ELOA 1NJZA 4BC7A 3QGIA 3SI8A 1FRXA 2Q1LA 5HP1A 1LWFA 2DD8S 1H38A 4O0IA 2XSJA 2PFFB 4C7QA 3QO9B 2QA2A 3QWPA 4LF4F 1KTVA 2EFPA 3BO3A 4X4NA 4RW4A 3PFOA 2J7WA 4CIOA 2L9DA 2M8DB 3QJPA 4RW7A 4H4OA 4RW9B 3OTDA 3UR3C 1X7VA 2RF2A 2B4UA 5KOWA 1QSLA 4QQBA 5DRKA 1KLMB 4RBVA 2Y1IA 2WONA 3DYAB 3U1LA 3V4MA 5J2PA 2VPYB 3BQ1A 2WBRA 3SSQA 5FJ4A 4I7FB 3SEOA 3TUJC 1HMVA 4IFVA 3BO2A 4DL5A 2GGPA 3MFIA 3OFFA 3NCRA 2CVIA 2CPZA 3B4MA 4N47A 1PSDA 1KS2A 2Y1RI 2ZOMA 3NAIA 3NMRA 1HWIA 3NKYA 4WFXA 1SIZA 2CPJA 1YJ9S 4KR0B 2FC8A 3M8SA 4ID8A 2HFNA 1B0PA 2IC3B 2M88A 3TRGA 3PEJA 3I9ZA 5KT7A 3ICLA 4A8WA 4JI0F 2OLWA 2MKSA 5E7OB 3MECA 1O8BA 3GWCA 1Q53A 3K5LA 4DSFA 3K59A 3CDWA 2J0XA 3WX4A 2HAIA 4C97A 4YQWA 3HVRA 4EBCA 4PQUB 2N7YA 2XMJA 2RQ4A 4QWEA 1V3RA 1Y7PA 2CQ2A 2BJDA 2HHVA 4GO7X 3RR7A 4LF5F 2KTQA 3KLIA 1YJVA 3FRZA 3GFXA 1YG0A 4OFZA 4HL9A 4WZQA 2A10A 1RKJA 4DN9A 1RT6B 1KQKA 2MXYA 3S6EA 3CCUS 2ZD1A 3B4DA 1NJIT 3NNCA 1AW0A 1CLFA 4MH8A 3CJKA 1S9GB 4J9MA 4ZP8A 5K5MA 4F67A 4PG4A 3M8QA 3H5UA 2HS4A 4DG1B 4OV1A 2PIIA 1ZAXA 3ZZYA 4Q0BB 1FRHA 1QY7A 4P6QA 2WBMA 2A1BA 1OQ3A 1VQSA 2K2PA 2AJFE 4MIBA 5H1SV 5M2UA 2I38A 1X4FA 1VIXA 3G9CA 1LW0A 3POTA 3V5RA 2I8EA 1JX4A 1UKUA 1DZ5A 3TP2A 1FF2A 3DN9A 1X5TA 2KH9A 5LMNF 2WOMA 3IAM9 4N8OA 4ED3A 1N5TA 4K4VA 1K0VA 2FJDB 2FGCA 5CYQA 5HQ8A 2AYMA 2DT9A 1GTEA 2ADBA 1FDAA 2DHAA 2GMLA 4UY85 2XZWA 1WTBA 2ALZA 1VQKS 2E1AA 5DETA 1D9FA 3FEZA 2IVFB 5IT0A 2ZH5A 4WFNQ 2FPHX 3KFWX 3J7Z5 2YNHB 1NHUA 3KK3B 2MYFA 2OPRA 3H2VE 3IWLA 4TYAA 4KPYA 5CHCB 1C0TA 1SV5A 1HA1A 4DLEA 4K4SA 3SDEA 1JLCA 1VFJA 2CPYA 1SKWA 1ZOTA 2JLFA 1E6YB 2FY1A 2F3JA 3AA8A 3IR6B 5A6WA 2MKIA 2OMOA 2VFTA 1WEZA 2KFYA 1XC9A 1NK4A 2MHEA 3N9UC 4DR5F 2F8EX 3VQTA 3OUYA 1NH8A 1FEEA 2JFKA 4O3NA 4WFZA 3TVYA 3CJ5A 4Y2MA 5J2QB 2FJVA 2KO1A 2JDJA 2JOQA 2CJQA 1R89A 3JB9k 3CT9A 4HYKA 2QA4S 2DISA 3H5YA 4DSLA 2YKPA 1S1TA 4BBYA 2D3ZA 2ZM6F 3DM2A 1BQMB 3IAS9 3UDCA 3HM9A 1N0UA 1WNEA 3BGUA 5DQHA 5BYQA 1Q82T 2RS8A 4RNOA 4B3SF 2VKZG 2RU3A 3CCSS 4Q44A 4QWCA 3QZ7A 3OTOF 5BYSA 6FDRA 2E5HA 1UEVA 5EHHA 2IM1A 3D28A 5HP1B 1LWFB 3SQGA 2EFGA 3U27A 4NLXA 2XSJB 3T9ZA 1X4EA 4Z2XA 3LO3A 5CYMA 1B7FA 1M5KC 1JLEA 3NP5A 4R8UA 4B17A 2RDJA 3OJSA 1FVQA 4F4WA 1CQNA 1OPIA 3THTA 4RW4B 3KHRA 4PXEA 2D7SA 1L3UA 2B0GA 3CCRS 2CQGA 3N01A 2VOOA 4RW7B 4H4OB 2K8GA 2RF2B 2D3OR 2EPIA 2DNMA 2ZJRQ 2E29A 2VUGA 1Y0HA 2WONB 4WYLA 5J2PB 1RT1A 2LEPA 1I6JA 2GO9A 1HMVB