3F44A

Crystal structure of putative monooxygenase (yp_193413.1) from lactobacillus acidophilus ncfm at 1.55 a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
217
structure length
210
Chain Sequence
b'ETPIFKIKKLTIAENDRSEYIRYAEKNMHDSIPAEEGTLLIGSGHDDAHGEDNYEIEVFRNKGAEDLHIAGSHADDFVETVNKIATKQKVIDLHPEVITTKAQDNFVMRLIKVEVKDADAEKFSHAVKKEMTTSMASEPGMEIMMSGTNIDNPNEWYFIEVYANDEAYDIHVKTPHYKEYIEETDGMVKSRDVKTLVRDTLATQGAIVLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative monooxygenase
publication title Crystal structure of putative monooxygenase (YP_193413.1) from Lactobacillus acidophilus NCFM at 1.55 A resolution
rcsb
source organism Lactobacillus acidophilus ncfm
molecule tags Oxidoreductase
total genus 59
structure length 210
sequence length 217
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3f44A00
3TOQA 1SB6A 3FRYA 3LGNA 1URRA 4HH1A 1CC7A 2QYCA 3DXSX 2FHMA 1CC8A 1APSA 1KVJA 2K2PA 1XBWA 1YJUA 2ZDOA 1Q53A 2BJDA 2LDIA 3E8OA 4HI2A 2OD4A 1Q4RA 2KT2A 3BB5A 2L3MA 2W4PA 3FGVA 4DN9A 2KYZA 1FESA 1FEEA 1TR0A 2GGPA 2EW9A 4OJ1A 3KG1A 2LXFA 5B09A 4OJGA 2XMWA 2VV5A 5T7LA 4NL5A 1FD8A 5A6WA 3VTIA 2BBEA 2HFOA 2HLTA 2QLWA 3HHLD 1CPZA 3HDSA 4A47A 1OPZA 3BR8A 4Y2MA 3QGPA 1FE4A 2AJ1A 1W2IA 2RU9A 4FNHA 5KAKA 4HL9A 3BM7A 1WD6A 2OAUA 3FMBA 4YDXA 5B0CA 1GXTA 2KT3A 1KVIA 2HFNA 2BUNA 2K7KA 1MWZA 5K9FA 5A6PA 1YJVA 1VQYA 2AJ0A 1P8GA 1YG0A 1YRXA 2OMOA 2XMUA 4HH0A 2GV1A 2ROEA 1IUJA 2XMVA 2FIUA 5F0WA 5B0DA 1S6OA 5B0FA 1N5QA 3BN7A 3GZ7A 4YEAA 3LO3A 1GXUA 3MZIA 1JWWA 1N5SA 1P6TA 4Q2MA 2K1RB 4U9RA 2ASYA 2ACYA 2Q3PA 2GCFA 4OJHA 1X8DA 4OJ3A 3IWLA 1OQ6A 2N7YA 2GA7A 4DPOA 4DL0C 3HHLB 4F67A 3I9ZA 2RILA 1AFJA 2FB0A 2IFXA 2XMJA 1S6UA 2ROPA 1K0VA 2HLUA 1TL4A 1SI9A 2AW0A 2HQIA 2LQBA 4Q2LA 4ZA1A 5F0UA 2OD6A 1ULRA 2AP6A 2OKQA 4OIXA 1JK9B 1Q8BA 2JDJA 3K7RA 1SQEA 5B0EA 4HI1A 1LQ9A 2BJEA 2OFHX 2XMMA 1OQ3A 2HIQA 3LGMA 5B08A 2K1RA 2N4DA 1OSDA 1TZ0A 3DCAA 2GO8A 2CRLA 1U7LA 2G9OA 2QIFA 1FE0A 2PD1A 1Q8LA 2GGPB 4Y2IA 3BDEA 4A46A 3BGUA 3QMQA 1RJJA 2RMLA 5T7LB 2ROGA 4ZOSA 3HHLA 4NPOA 1Y3KA 2VH7A 4FNIA 1N5TA 1X7VA 3CJKB 2ZDPA 4QOTA 3HF5A 1Y3JA 3KNGA 2N4CA 3KG0A 1YJTA 2KKHA 5B0AA 3F44A 3HHLC 2BYCA 2XMTA 2FTRA 3BF4A 1QUPA 1YJRA 3TNVA 2IYIA 1R6YA 2GFFA 2RSQA 5IXUA 3HFKA 1MWYA 3WDOA 2OP5A 2PGCA 3TRGA 1FVQA 4EFAC 1TL5A 2LQ9A 2QLXA 3IWXA 4Y2KA 1KQKA 1AW0A 3T9NA 4A48A 2OFGX 5B0GA 1Y9OA 3CJKA 1FVSA 1N5VA 3UDCA 3HX9A 3KKFA 2K7JA 5B0BA 1V3ZA 1AFIA 1TUVA 2W4CA 4A4JA 1Y0HA 3MCSA 1VQSA 1X0PA 2W4DA 2XMKA 2IYGA
chains in the Genus database with same CATH superfamily
5LXYA 4LF7J 3JS9A 4V1Ak 1YLXA 3W2WA 1VQPS 2OD4A 2EW9A 1NK7A 3VVUA 1S72S 5F3TA 4HYKA 3GIMA 4P73A 4ZN3A 2YWGA 1FJGF 2FIUA 3UR0A 2IMWP 2CJKA 1V3RA 2E5IA 3I9ZA 1T95A 4AUKA 3P96A 3GYXB 3FBEA 5LMNJ 4CI0B 3PEHA 4ECZA 4DQSA 1AXQA 1XERA 3B6BA 2XMAA 4RKUC 5E3PA 5GVQA 4K4YA 4C8YA 1WUUA 3KYLA 4MIWA 2J7UA 1XEZA 2ASJA 2V8HA 2UVRA 2RQ4A 4TU8A 3OHBA 2KZZA 5KG5A 6AT1B 1FTRA 3DRPB 2JHEA 4WU2A 3RW6A 1K8AT 1NNDA 2MZSA 1DLOB 3GU0A 3KJFB 1U1QA 1Y5NB 2B6AB 1Q86T 1N5YA 2CIMA 1KVJA 2GVZB 1OJ4A 1GAOA 3Q86A 1WNEA 3T5JA 1S99A 2MGZB 4AQYJ 1XC9A 5KG4A 1TU0B 4DQRA 1TKZA 2ZD1A 1FWPA 3MUVP 3GG0A 4NEZA 5KTQA 3TWZA 3GTYX 1EQ0A 3TJ9A 3FCVA 5HJXA 4ER8A 4Q2MA 2R7RA 1MNEA 3O6QA 2XSJB 9ATCB 1CJKB 3FRZA 1IM4A 3SIPB 2OTLS 2C3MA 4CO3A 1XK8A 2W2OP 2GMJA 1Q79A 3AHPA 2DGOA 1HBUB 5E3AA 3ZC4A 3CDWA 2ZHAA 4KV8B 5HVHA 4DR4J 1VJQA 2OELA 3H42A 1VHIA 2FY8A 1X7VA 3BQ0A 3SCJE 3G9CA 2B9WA 1IKWA 4LJMA 3MM6A 1X0FA 2YX4A 2RHSB 3W62A 1YJRA 3OL8A 2F8EX 1Q7YT 4C8ZA 2LQ9A 1UL3A 4HDHA 2LECA 2RKIA 1QM9A 1HNIA 1RXOB 5LSRA 5F8GA 1XR6A 3GILA 1QAJA 3SCKE 2BJDA 1I1GA 2V8PA 2F63A 2IRYA 5T7LA 2C2OB 2DPIA 1DQAA 2UXCF 5KFMA 3BR8A 4FNHA 3VHQA 2AJ2A 1HQUB 4W4MA 2NUUG 3DOLA 1NK9A 1SL0A 2ASYA 2JJ4D 2XSFA 5HQ8A 2VF3A 3PRDA 3KLGB 3C16A 2ZH5A 3KK1A 4PQUA 4JI3F 4I7FB 5LMUF 3RGIA 3D0HE 4WPAA 3OXGA 3DNCA 1J5EF 4DL3A 3G82B 3QMQA 1M5OC 5KFDA 1N4LA 2WTFA 3FSIA 1NRKA 3KLFB 5J2NA 1NAQA 1P27B 3SCLE 2IYIA 2GFFA 3HVAA 1IKXB 1ZAXA 2PGCA 3DRRA 3KLEA 4QWCA 2R2RA 1X0PA 3RAQA 2A0FB 1EETA 3BEGB 5A8RA 2W7OA 1CC8A 2E66A 7FD1A 2AEJA 2B7BB 1L3UA 3E8OA 1S1VA 4J9QA 3V4MA 2XYGB 2YNIA 1NO8A 4MH8A 1NK4A 4HHUA 3BYRA 4HL9A 4C0BA 4KHPF 4LFBJ 1PG5B 1SJ3P 2OMOA 4QR1A 4IFVA 3HVTB 2HNDA 1X4HA 2KZMA 1LK5A 4WTYA 1QAYA 4H54A 4A8KA 1RK8A 2HIYA 4X4PA 4GC7A 1VIXA 1UP1A 1KEKA 4B3SJ 2H65B 2RUSA 4X4RA 1RT1B 5AJ3J 2MQMA 4DL7A 5L1IA 5HQLA 4K5RA 4RJVA 4I2QA 4FP9A 1WI8A 5F8IA 3RUBL 1ELOA 2HHQA 1BQNA 5J2PB 4M5NA 4DI6A 1R8CA 1Q81T 3BDPA 4ZMMA 3BQ1A 4NX9A 2L9DA 1JX4A 4KTQA 5FLXU 1IWGA 3C14B 5B0GA 2W4CA 3H20A 4GO7X 2YTCA 3N79A 4DUTA 1S76D 3UPFA 1YJUA 2CJXB 4ZVTB 2WB4A 2AMCB 4ED2A 1X4AA 2AJ1A 1RTIA 3PX4A 4Z2XA 3KOAA 4O4RA 4AL6A 2DNLA 2JOQA 3IBCB 1VRUA 5CABA 5HATA 1SH2A 1TK0A 3PJXA 4DSJA 4C8NA 2UUBF 2RJZA 3N9UC 4K5SA 2DR8A 4OZ1A 2HQGA 3L7UA 2PO4A 3PV8A 2IMOA 2G1HA 3FEXB 2AGQA 1RGVA 3BJYA 1UFKA 4AE5A 2D3O1 4I1TA 4GKJF 3TQ1A 1FO1A 1Z2ZA 1PGZA 2ZH4A 4NLGA 1WOSA 3CNQP 1SJ1A 1HLWA 2KRRA 2DR5A 3DLEA 3TAMB 4KGKA 2J0SD 1S6QB 3VGTA 1S6PB 3TOQA 1HYSA 2F7VA 2QMXA 3U7JA 2H4YB 4RU9A 2RNEA 2CNOB 3HXMA 3CIZA 2EFQA 4OV6A 1JXVA 4RL1A 4IQXA 2CQ4A 3W1YC 1S97A 3BGRB 2PI4A 2BQRA 2MKHA 1KLNA 4NXMJ 4PXDA 4N56A 2X1FA 3T1YF 2HS3A 2RRBA 4RBVA 3NGUA 3KLVA 4JI6F 3W2VB 4FF2A 3PZPA 2Z2MA 2I9SA 3OSNA 2HRYA 4C3LA 2XBPA 1FDDA 3MM8A 4X64J 4QBUA 3S8SA 2XO6A 3EYZA 5IC4B 5KFCA 4Q45A 4DR6F 3OUYB 3OFEA 2KFZA 3ELHA 1RWWB 1EX8A 2EI5A 4DX5A 1M0SA 1RT2B 2WOMB 3CMES 2R7VA 2BE9B 3VAGA 3IS9A 3I0RA 1APSA 2K2PA 3HD2A 4I4BA 2AGOA 1YWXA 2FUG9 4LF7F 4DFJA 1TVRB 1ITPA 2WSEC 4FDFA 2LEPA 2ZH6A 5K9FA 3QT5A 2AJ0A 3AY0A 3FNNA 5DZ7A 4IKAA 3CDAA 3KMQA 2CPYA 2IM0A 2HQFA 4QR2A 3U1LA 2VL1A 2YBVA 3CD5A 3G8SA 1FKOB 3M8RA 4M63A 5C2CA 4WWSA 5DDQC 1UETA 1UCNA 3PY8A 5ETNA 4WYLA 2E5LF 1K1SA 1H98A 2BW7A 2GO9A 1DTQB 4M5DB 2HVDA 1E6YA 5D6GA 5CYQA 3AXKA 1WTFA 2PEBA 3QGIA 2WVEA 2R7TA 2MJUA 3I6PA 2C2KB 4Z7YA 4X4SA 4FBTA 3CCRS 3WBZA 4DZ6A 4OJ1A 4B3RJ 2FC9A 3GB0A 1VR6A 3W60A 1Q95G 2IM3A 3LP1B 4PZVA 5D4PA 4FXWA 4HH0A 9RUBA 2JZ5A 1RT5B 2UP1A 4ED5A 4F4WA 4RWWA 4K4ZA 4ZP7A 2ADCA 3MI7X 3QZ8A 1UA1A 4CH0S 4MIAA 2V2VA 1WACA 1HD1A 4DSLA 4K4VA 3V4IB 3L7OA 4QWDA 2CPFA 2FDNA 1X9SA 3QQCD 2DEIA 2JL9A 3CJ8A 5I3UA 4F8RA 5HVGA 1R27B 1TL3A 1BHNA 5IT0A 3DM2A 1RWVB 4DR4F 1U8WA 4QIVA 4B9SA 2CQGA 2SXLA 3RTVA 2Z2YB 4OI2A 4TU9A 4EEYA 1RT7A 2C2EA 1S10A 3THVA 2JEFA 2NXCA 1HBOA 3D1HA 2IBOA 1QLNA 2AEFA 4M94A 2P9CA 1FFGB 2Z30B 2QSFA 1U6BA 4ID5B 3J7YU 2ZDOA 2HFSA 2ALZA 5GAEU 2R2UA 3MPDA 1K1QA 1SJQA 1N8RT 3R9LA 4NCAA 4Y65A 4EK2A 1ZH5A 2NSBA 2C1EB 1VC0A 4OX9J 3ILJA 3M4XA 2JFKA 2YKNA 3BBBA 2YKMB 3IG1B 4K8RA 3GJSB 2AHOB 2BACA 3M2UA 3US5A 3IC1A 1U7LA 1FCAA 2VG5A 3KWMA 2FGOA 4HACA 3PO5A 2UV8A 4TLRA 1U1NA 2JWNA 2Y1JA 1UEKA 2XZTB 1C0UA 4DV5J 3BR9A 3T1HF 3DRYA 1AW0A 2EFPA 2ILZA 4DUZF 1HNXF 3CCWA 4RUCA 4HTJA 1NDCA 4KFBB 2DT9A 2BJ9A 1KS2A 2D7SA 2LDIA 2AYMA 1JJ4A 3R2CJ 6FD1A 1CBKA 2DITA 2OI2A 4RW9B 1WHXA 3KG1A 3RW7A 5ETRA 1S1TA 1TUWA 1WDDA 5C25A 2B6AA 3DI6B 4ED0A 4OHZA 2KJVA 1RAEB 4HLBA 3I82A 3CO9A 4OI1A 1ROFA 2GQCA 2HW3A 2VG6B 3VVTA 3O44A 1BQMA 2RQMA 4OZ3A 3OR2A 3H7HB 4A8YA 1SC3B 1RAOA 2EG2A 4B9LA 2Z2LA 4WZMA 3MUTP 5A2QY 4P2XA 2ROGA 2MKSA 1FXRA 3P4UB 2ZBQA 1R89A 5L8RC 2KFYA 2N4CA 1RYSA 4OI3A 4CLWA 2BANA 1HBUA 1RTDB 3QPIA 2BXJA 1VC5A 3G87A 5IXUA 2W7PA 3CPWR 4ELVA 3WIVA 1OY9A 2GHWA 1H38A 3R3TA 2ZFHA 2E9RX 1FVSA 3T5HA 1YBTA 4YMEA 1RWPB 4WBFA 1TKTB 2A6OA 4L6V3 4CLFA 2LKZA 3W5XA 2B5JB 3K59A 4NRTA 3M6VA 3DMJB 4YR0A 2F3JA 2L08A 5GMKa 4U95A 3J7YI 2EC0A 3RBZA 1ZOTA 1VQYA 1HNWF 3H0PA 2KG0A 1NK0A 2ZZTA 4WFYA 3R2DJ 4X4VA 2J7WA 1T9UA 2CDQA 4MYTA 2X7IA 4RLEA 3BKFA 1HQUA 3T9ZA 1IBKF 4Q2LA 3TEHB 2O01C 3DOMB 1Y7PA 5E3QA 3LGMA 5KT7A 3ICLA 4NE9C 1HW9A 1XJWB 1K44A 4DFKA 4PXEA 4NMLA 3LAMA 3OD2A 3GPAA 4PG6A 4P75A 2BYCA 1QTMA 3KG4A 3A12A 1SKUB 3GR0A 2AYBA 1KQGB 1WG5A 1GTHA 4IOBA 2RDIA 2IC3B 5KFXA 3KLFA 2W8KA 1SUQB 2F1FA 1EIYB 1B3TA 2MJNA 3FJ2A 1H74A 5E41A 1RB0A 4ILMA 1HNVA 1TK5A 1RQ0A 3FGVA 1PYTA 4RZRA 3KUEA 1LWCB 3VWSA 1N33J 1AYEA 2I1RA 2L48A 2YX1A 5E2QA 2V9KA 3QGPA 2KXNB 2DXDA 4ITSA 3TANA 2GV1A 1WC6A 3AJ1A 1CULA 3EVMA 1EKSA 1V5VA 1DTTB 2GCFA 2MKCA 3PX6A 4DMZA 1QSSA 3BBCA 2HNZB 3QBCA 4NXMF 5FD1A 4KT0C 1H0HB 4I2PB 1ZZFA 5HROA 4YFUA 4UW2A 4A8SA 2XC9A 1FDBA 5HP1B 3RB4A 3CC4S 3CJSA 3HSZA 3QFWA 5D0HA 4EWTA 4X64F 5JVHQ 3E01B 3AAWB 4R8UB 5J1NA 3PIOQ 1B4SA 1GFWB 1RHQB 4QIFA 2Z0GA 1UJ4A 3ZXWA 4DR3J 4B3MF 3N6NA 2BJ7A 3W9JA 3LP0A 4LFAJ 1M5KC 5F8HA 1RA7A 1RAFB 5AXNA 3BO3A 3Q8SB 3C14A 5K14A 3D6HB 3KMSA 4LMZA 3AFGA 1U0HB 4KC5A 2HK3A 1S79A 2M0GB 2EFVA 4XO0A 3QLHA 2XCPA 3C6UA 3SQOP 2Q1LA 3BGFA 1JLCB 4ZVHA 2WBRA 1RUSA 3K0JA 4TN2A 3N01A 2H9ZA 1UPMB 4Y2CA 1N56A 2VG7A 3HSJA 5HBMA 4DSEA 2GMLA 4AYBD 1SJ4P 2E5HA 1XQIA 2QYGA 4HI1A 2HNYB 1LW2B 5AXLA 2KB2A 1QD1A 3OVBA 5L38A 2CNNB 4WKRA 1CQNA 2AYGA 3RRHA 2U1AA 1VQLS 3G96A 5HANA 4A8MP 1MSWD 2OEKA 1TTHB 5KG6A 2CZVC 3AA8A 3N5FA 4TY8B 3HT3A 2GX8A 1TK8A 1CS4A 1NB7A 4J9OA 4C0OC 1X60A 2E5GA 4NA2A 2KH9A 2W01A 2LEBA 3V81A 3TAMA 3H2UB 4DOZA 1CJUA 2HAFA 1I5OB 5KT3A 1B7FA 3HP6A 3ENWA 3ZZZA 2DNMA 3WC0A 4QYRA 1VBXA 1N36J 1RYRA 2HGNA 1X4CA 1JWWA 4V19X 4A8QA 1RTHA 4QR0A 3FZBA 4ATNA 3T41A 4EZ6A 2VODA 1D3WA 4ZP6A 4F2RA 2B4OA 5C5JA 5ETLA 2B9EA 4KAIA 2M9KA 1IN0A 1F5BA 3NGKA 3PEJA 1XMBA 4GMKA 2WONA 4N47A 2HRTA 1Q78A 4ED6A 4DV3F 3FQKA 3W2VA 3MPUB 2IBKA 1NDLA 1R31A 5KFEA 2MMYA 2VC0A 3R7NB 2NXNA 1FVQA 1KP6A 4DV2F 4OZ0A 4OV1A 4OFZA 1SC1B 3PM9A 4PYDA 5CQGA 3RR8A 3IBFB 3I9V9 3J7ZT 1VC6A 1F2HA 1Q4RA 1DURA 4DV6F 1RT2A 1QTNB 2R42A 1PJ6A 4CLLA 2Z8QA 2LYVA 3ZZTA 3OLAA 2AYEA 3TR5A 1C1CB 3MCNA 4TYBA 5FLXY 3PW7A 4FYYB 3RZAA 1HWUA 2KT5A 4PPDA 3EDQB 3GIRA 3AT1B 1RTZA 3MEDA 4TY9A 1TVRA 4DPOA 4OYZA 5J1EA 2XS7A 3DFEA 3PYGA 4DZDA 2E44A 2BW2A 1VFJA 1ZAWA 3TZXA 3P3DA 2L41A 4TNOA 5L1KA 3DRSA 2VJUA 1B7YB 3JYTA 2DR6A 2HMIA 4K50A 1S9GB 4CM0A 5IM0A 3MR6A 3HHEA 4C98A 4DPUA 4CLKA 1IJFB 4WXWA 1OWXA 3TUZC 2KL8A 4DV5F 2W9CA 1RHMB 4KH0B 2XI2A 2ADBA 2FGCA 4BC7A 5KFWA 2C2RA 4CQ1A 3CC2S 1RAHB 2LVWA 1FESA 3K8WA 2XZWA 4EUVA 3V6KA 1RAIB 5HLFA 2CJYB 6FDRA 3QFHA 3CVKA 5KFJA 3TP2A 1N5SA 2LXUA 4CLTA 1A0OB 4RO0A 4LVOP 2M8HA 4Q8EA 1FWKA 3X3UA 2QL7B 1A6LA 4N8OA 4XDCA 1RLDA 2CWKA 1RT5A 2MZQA 1Q82T 3ISNC 3OR1A 5D8HB 2VFVA 3V4IA 2MHEA 5L9XA 3CCTA 1FXLA 4O0IA 4B3TJ 2C3OA 1VQNS 2NXUA 2CVIA 1D9DA 5LM7E 4YHHF 3QO9B 3O1LA 1YDLA 4P10A 4Q44A 4ID8A 5HVFA 2MPUA 3D0GE 2RS2A 4RBUA 2HBZB 2IM2A 3CWJA 3M8WA 3OSPA 2V4JB 1UWBB 1YBAA 2Y8YA 2DTJA 1VBZA 3TARA 3MWBA 2QFJA 4WCEQ 3GCWP 4ID5A 2XULA 2VOOA 3TX8A 5A6PA 5D78A 3OJUA 3IR7B 3KJVB 1RE1B 4KKOB 4BS2A 4DR7F 1VS3A 3PHEA 3GE9A 2YH1A 3NNCA 2YY3A 1WJ9A 3CD0A 3L4BC 2ILYA 2ABYA 1JMTA 1EB0A 2VPYB 5A0YB 4MAKA 3PR4A 4DR2J 1S48A 3T6JA 1ZAVA 1DQ9A 3QAUA 3E51A 2I5JA 1NM2A 4X4UA 3CDUA 3MM7A 2ZITA 3NBPA 4IOAQ 1VQ4S 1CJVB 4DHVA 2FVCA 2ACMA 3QAEA 3N4WA 2O67A 4NCGB 4PWDB 4OYMA 3KHGA 4C6AA 4R5PA 4JI2F 2UVVA 4FS1A 4MK9A 1LWEB 4ZLPA 2HHTA 1IBCB 4ECYA 2A6MA 4U6PA 4HH1A 2ZKUA 4K4XA 4WE1A 2BJ1A 1X5PA 3MTJA 5IC6B 1K9MT 4OJGA 1RACB 1VQMS 3R5CA 3VTIA 5KFIA 1N32J 4ZDNA 4DCOB 3B8HA 4KB7A 4XAKA 1VQ5S 4KFBA 5KT2A 4MK7A 2EPIA 3B4MA 2ROEA 4CTAA 3M2RA 4YEAA 4DQPA 1BC6A 3K57A 1X5TA 2W7AA 2CQHA 2R7XA 2IJNA 3MFHA 1PIEA 1U2CA 3UE2A 1HR0J 2F8MA 1VRTA 4I67A 4KGXB 2MZRA 3SDEA 4JI4J 4OHXA 1XNQJ 1NPPA 4EYIB 4NLOA 1R6YA 4CO2A 4DR5J 2HZVA 4PUOA 3BO2A 2QRRA 2F4FA 1J5OB 4LRBA 3FRYA 1IKVB 1RTDA 4M95A 5I3PA 3SV4A 3DLKB 1T9WA 4PQAA 4XTTA 4NXNF 3TVZA 2P5VA 1UZDA 1Y10A 3POTB 2MKKA 2FVRA 2IJFA 4LFAF 1TAUA 3NAHA 1TKTA 5ETKA 5KAKA 1BE4A 5MLCV 1KSPA 1SKSA 1B0VA 2VC1A 2V50A 3CIMA 1T05A 4BWMA 3TO8A 3DMJA 4LF8F 1HWJA 1KR4A 1PAUB 4DEZA 3KLIB 5HQMA 3FMWA 4NYZA 3MGJA 3MAHA 2VJVA 2F5GA 2APOA 2MYFA 1ICEB 2VQEF 4DU7A 3DRXA 2OUGA 1MMNA 5EN1A 4ZVRB 3TJAA 4QOTA 3CTRA 3VAFA 1LOUA 4LSZB 4ZP9A 4L76A 2E9TA 2OLWA 2ZM6F 2OP5A 3CCES 1HD0A 3NGTA 4MFBB 2RDDA 2IA0A 3T5KA 4BHQA 1WF0A 4EU0A 2C3UA 1YZ6A 5B0BA 2QL5B 1JLGB 2W4DA 4OIXA 5KFVA 5M2PA 1UEVA 3WX4A 3EICA 3V6HA 1Q53A 2A2CA 4ZVEA 3MEEA 4J9RA 2VUGA 1TUGB 2A18A 2YWWA 3HHLD 1KFSA 1HHSA 1SC6A 3IM8A 3PCOB 2DYAA 3K58A 3IXQA 3OHAA 2MLXA 4YOEA 5D0RA 5B0DA 4RPFA 1YKWA 4ZLLA 1W7WA 1LWCA 3LAKA 1N36F 1I51B 3CSKA 2YQ3A 3CEDA 1XTZA 4MKAA 1N5YB 3RRGA 5HMYA 1S1XA 3TZWA 4L3NA 1F3VA 4DFPA 3M8QB 2B4UA 2FJWA 3BGUA 1SL2A 1TKZB 2DNNA 2I38A 1HBMA 2XI3A 2M88A 2VHGA 4IRCA 2B4VA 2QGFB 1DBDA 3AH6A 4AXJA 3MM9B 3VGUA 3H2VE 3EPGA 4DU8A 3IAS9 1W25A 1KTQA 2PE8A 5M2RA 4AL7A 4P71A 4WFNQ 3ZZRA 4DS4A 4R8UA 2VPXB 2G13A 5C42A 4USVA 3UDLA 5M2UA 4WFBQ 1T8EA 1YVFA 2H4WB 4IQMA 4Y2MA 1VYAA 1IKWB 3RR7A 1D9FA 1QSLA 1WD6A 2LMIA 5G0RA 2PMZD 3QT7A 1K47A 2QA4S 2N82B 2IRXA 5F0WA 2KI2A 1KLMA 5KG3A 1GNKA 1N6QA 2WVFA 3UFCX 3ITHA 1HNIB 2VDHA 2KVQE 2OPPA 1Y11A 1SQEA 1WDTA 4YN3B 1F2GA 3UWTA 3KDNA 1YJ9S 3CCQS 2XWXA 2G2YA 4GC6A 1UVLA 5T7LB 1LV5A 4PYAA 3A8EA 2V67A 4URSA 2KFNA 2ZWPA 4AFFA 1F60B 1KWMA 3DOLB 1G2EA 3OFFA 3ZZPA 4JI7F 1KOOA 3DLLQ 1FJGJ 3C16B 3D68A 3KK1B 5I3QA 3OL6A 3MMAA 1GH8A 2BRKA 4ED1A 3QRRA 3A4TA 4WIQA 3VGVA 1VLOA 5IV4A 4TY8A 4RNMA 1FJ7A 5BYRA 3FMBA 4ZPCA 5J2NB 5JUMA 1PKUA 2LEAA 1B0TA 3U02A 4ZPDA 2LU2A 3NAIA 3RB0A 3T3FA 1O8BA 3MOZA 4JI5J 2Y0SD 2CJBA 3MMCA 1EETB 1X4DA 2PIIA 5A8RB 4USJC 3GFYA 3A13A 4YR2A 4OI4A 2KG1A 4NLWA 2UV8G 1JLQA 4YY3J 3KDOA 1S5ZA 2AKWB 1MROB 4IFYA 2R4FA 3Q0AA 3L3CA 3FVYA 3H8YA 1RI7A 2Z56B 4ED8A 4IRKA 1H2UX 1S4EA 2OPQA 2HNDB 1M5VC 2UVWA 4DPYA 4DJBA 2GNKA 1IKYA 2BABA 4F4KA 3M8YA 2PA8D 1T02A 2R9LA 4N77A 4F4XA 2CQ3A 2M52A 3M8PA 3PW0A 1H3DA 3R6LB 2FLLA 3MD1A 3K5MA 1H6KX 3DLJA 1LW0A 2MQ8A 4RUAA 2W9AA 2BBEA 4I2QB 2GQ2A 2V4RA 2EFNA 2F9JA 4EZ9A 2Q43A 2R8GA 4NZ6A 4KRWA 2AX1A 4TQRA 4KYZA 4DR1J 1N52B 2OPRB 4NI2A 2B0GA 2BQUA 3JQJA 5H9EK 5DM6Q 1DHMA 1T3NA 3OTEA 2ZBIA 2OD6A 3MFIA 3W61A 2B43A 2BOAA 4UZBA 4BC9A 2B3TB 4DR2F 1AROP 4G1IA 2GS8A 5DG8A 5H9EJ 1RTIB 3SQGA 1VMBA 1FRMA 3BF4A 2UXCJ 1ZA2B 2IPOB 3S7RA 1VRUB 3ZTSA 2CZ9A 5HSPA 1S9GA 3D2WA 4ECVA 2XGQA 5KFZA 3J7AN 5K8PA 5ETQA 3QRQA 4JI3J 2K8GA 3M9NB 2Q6BA 1Y5LB 5LMUJ 4O23A 1R8BA 4QZVB 2R8KA 5B09A 2BV3A 1SH0A 5A6WA 4ZKAA 1RWNB 5E3RA 3J80Y 2JEIA 1J5EJ 1LFWA 2AF6A 1WC1A 3W8GA 1EAYC 2ZH1A 1YRXA 2ZH2A 4Y00A 3BN7A 3DU6A 3MPVA 1P1LA 4LUBA 1RT3A 4O44B 4CO4A 1BWVA 1PBUA 4LF9F 2X1AA 1M90T 4C8OA 3DLEB 2Y8WA 1AA1B 2CQ0A 1HYSB 2ASDA 1QE1A 3IRWP 1RP5A 2P9GA 1X9WA 4A46A 1YSJA 3BSAA 4DL6A 2DGWA 2UZAA 4DCJB 1MMDA 4CLZA 4JI4F 4J9VA 3CCJS 4KHPJ 2VASA 1S1WA 4HTIA 2WSCC 2UU9J 4HHJA 4Y2KA 3QZ7A 2G2OA 1UVMA 2LQJA 1URRA 3FCHA 3OXFA 3CDEA 3EZOA 3KUHA 1TMMA 5LL6d 2MZ1A 2CFXA 2PT0A 3U27A 1DRZA 3MM8B 4C8LA 2CQDA 1TFWA 2DHHA 2GVDA 5H1SV 1CPZA 4NYOA 4NRUA 2HVIA 1YX2A 1RTJB 2V4JA 3OL7A 4M5IA 3D67A 1JXEA 3RAMA 4NLUA 4DS5A 3CCSS 1EQMA 4USTA 3DYAA 1SKRA 5G4DA 5T14A 1H7WA 4EYHB 2E29A 1FFSB 2FLOA 3IS9B 3GJRB 3I0RB 5CCMA 2E1PA 3GLJA 3EVOA 2V68A 4IYQA 1MLAA 3CJTA 2NPFA 5L1JA 1SIWB 2HFVA 3FDSA 3KJQB 1Y3JA 1U0SA 3PW2A 5J2QA 5LJ5Y 1WELA 1TL5A 1IR2A 3TZYA 1JJHA 5IFMA 2FHMA 2W2QP 5F8NA 2UUBJ 2KDOA 2HHVA 3AD8C 1U1RA 5DG7A 4B9UA 4I64A 2OH2A 4NL5A 4J37A 2R7SA 1ZM2A 3FSYA 2H54B 3SYZA 2QC3A 1XMOF 4YDXA 3VAMA 3GYGA 3IM9A 3WIUA 4UQGA 1S0NA 4GKJJ 4OHVA 1UKUA 3LO3A 5L46A 1FI4A 3PG9A 2O1PA 1UAWA 1E6YB 3EGVA 1Q5VA 3H5UA 5CYQB 3RJMB 2IVMA 1C4CA 1JKHA 5IT9U 5DZ6A 2HZCA 1NJZA 2M5YA 3MECB 1OQ3A 5J1PA 1MG7A 1FRLA 4YB5A 3TA1A 1VBYA 1SV5A 2FVSA 1JB0C 4KR0B 1NU4A 4FF4A 1D8YA 3N28A 1OY8A 1UW9A 3CMQA 4JUZA 1RA6A 4RW8A 3PJ9A 4RNHA 1H72C 3VCDA 2HQDA 2KM8C 4CT8A 1WKKA 1Y4ZB 1RWOB 3HVRA 2QX0A 2XNRA 3AOAA 1B0PA 2U2FA 3T1YJ 4G65A 4ALZA 4JI6J 3IBWA 3Q23A 1NDKA 3GIJA 2AZ3A 3FQLA 2AU0A 1TL3B 2HYIB 1YQHA 3DM2B 1CSJA 4DV7F 2BOPA 1WC0A 5DQGA 3TI0A 4DCPB 2XMVA 4DG1A 4PG5A 4FZVA 4DR6J 2FHJA 1I6JA 4RR5A 2Q3PA 1RT7B 2DJWA 4FYXB 2EXUA 3MXHP 1HBOB 3HHLB 2DXEA 4ZN1A 3R1HA 3I0SA 4P2SA 3CULA 4G3IA 3BSNA 2HIQA 5B08A 4N8NA 4UY8T 2HWHA 5LXRA 1JLAA 2UUTA 3C6TA 2ZDPA 3FBBA 3HVWA 1Q8KA 2JVRA 5HMZA 4AT1B 1WC4A 3T6BA 3PXGa 1REGX 1G6BA 5DQIA 4XIUA 1YGYA 2WVBA 2YKNB 1URNA 2R8JA 4LVNP 2E5JA 1AUDA 1S9EA 2KTQA 4CLUA 4TYAA 5DLGA 1KVKA 2W4PA 3M2UB 4MFBA 3I87A 2EC2A 2VG5B 4O3PA 1JLGA 4HACB 4WK1A 4F3OA 4CT9A 3CJ0A 3V5RA 4O3SA 4J9KA 2FJBB 1C0UB 2E5LJ 2XLIA 1KNZA 1GMUA 2DIVA 3DLGB 3WQPA 2CUYA 1EZZB 2R8HA 4CYUA 4OHWA 2XS2A 1L3TA 1RZMA 3HFZB 1GMWD 3CJ2A 1QSYA 3W3SA 2CYYA 1OSDA 4JI5F 1FE0A 2MZJA 3CCZA 5EX0A 4C0HA 1S1TB 1YI2S 4DL5A 2VH7A 3NWRA 3BGLA 1OS5A 2YWFA 4NMXA 5KFGA 3VQSA 4YY3F 5C25B 4NA3A 3KHHA 3Q8VA 2FJEB 4Y28C 1CG2A 5DRKA 4DLGA 4ZP8A 3KJNB 3M8QA 4F26A 5ETMA 1DARA 3WC2A 1BQMB 2WB1D 3HI9A 3OR2B 3UDEA 3K5OA 3FSXA 3MM9A 1CJTA 3JTPA 1QY7A 2H3EB 5GAHU 4F04B 5JVGQ 5LJ3Y 4BCAA 2OIHA 3NS7B 4WIIA 1MMLA 3I5CA 3H59A 4OYXA 2YNGA 2OAUA 1VJWA 5IWAF 4GO5X 2BANB 4IH5A 4O4GA 2YX7A 1G1XA 3D54A 4B3OA 5DDOC 1G7CB 2BX6A 3HCXA 1BXNA 2RD5C 3GG1A 1AT1B 2ZE2A 4I56A 4DR1F 4OZLA 4J90A 4F0HA 2V63A 4I0WA 2YKOA 4HDGA 3AA9A 2Z58B 4ECSA 4USUA 1N54B 4P52A 3MD3A 2J8SA 3IR6B 3J7Z5 1WF1A 2A1BA 3NOCA 3NCRA 4B02A 1WWHA 1G3OA 2XZDB 4J9NA 4OYIA 2LA4A 1PBAA 2JC0A 3OV7A 4AD6A 3L09A 2JNJA 2XS5A 3PKYA 3MCSA 1VQSA 1R6VA 3PYEA 3FUYA 4NLVA 2N7CA 4JV0A 3JB9k 1RBAA 2X1BA 4Y0FA 1XBWA 2J9EA 4ANDA 2GJ2A 3GQCA 3R5GA 1FK9A 3LUYA 1NPRA 2J0WA 2X3GA 3X1LB 1YZ7A 4UQTA 4CP5A 4JV5F 1WKJA 2FYXA 3SFUA 1MN7A 3DXBA 2IVFB 1SJRA 4X62F 4MT1A 1D8ZA 2QA1A 4ZIVA 2ACYA 2HGMA 1OQ6A 1NHVA 3T1HJ 5F41A 2HLUA 4DUZJ 1OMSA 5LT5A 1HNXJ 3W5YA 4UTGA 3NGRA 1HNVB 4FKXA 2N4DA 3N6LA 5KT4A 1P9QC 1NKCA 4RUHA 4J9SA 4DPXA 4JB8B 3HHNB 1FNXH 4FYVB 1YJNS 1JLBA 1RBOB 1WEYA 1MROA 1CULB 4LF5F 2FVPA 3OFHA 3VQTA 5I42B 5CXTA 5BYQA 4CLYA 2UU9F 4F25A 4R0JA 2VBYA 2VZ9A 2HG4A 2YQ0A 4NWBA 5HROB 1RKIA 1HKAA 2B7CB 4C11A 4XDDA 5MAOA 3B78A 3BM7A 2K7KA 3O8WA 1YJVA 1GQEA 3DDNA 2LQ5A 4OJ3A 3MAAA 4HR2A 2V2ZA 1YRUA 2Y0BB 3CUNA 2MSSA 3LP0B 2XNQA 2VDIA 2IIHA 2OPRA 1NSAA 4E2FB 1HNZF 1JNRB 2G9OA 4C97A 1UTAA 5K14B 3RBEA 5SUHA 1HBNA 1U1LA 5K8NA 3I96A 3QLHB 3MCOA 1NJXA 2MKJA 1K73T 1RHKB 3C6UB 2DK2A 1HNWJ 4K2JA 3JSMB 3FEYB 2VG7B 5HBMB 2CQBA 2XMKA 1TL1A 4Y3CA 1NKBA 3DLBA 2ZNZA 4CDIA 4WFZA 1KQFB 1DAXA 4QIGA 2CPXA 1IBKJ 3P6YC 3BB5A 4RW4A 4P9SA 3NNAA 2HHHF 1MU2A 1H7XA 4X2BA 3ENQA 4S0MA 4PPZA 1FX4A 1GXLA 4LSLB 5K20B 4U67Q 3SFGA 5D4LA 1FKPA 2AQ4A 2OGUA 1VISA 2JX2A 3H4BA 3OPKA 1RISA 5E3CA 4UUXA 4F67A 2RILA 3LP2A 7AT1B 2K3IA 2W1BA 4Y2AA 2VOPA 1CS4B 3OW2R 3D6MB 2H5EA 3VF0B 5F9LA 3Q8QB 2DGXA 2QMWA 4K59A 3PIPQ 4O44A 2JLGA 1HWKA 3V81B 3TAQA 3P8BB 4I6YA 1CJUB 3MF5A 3SSSA 2FZGB 1YJTA 2GAHC 1M5HA 4OQJA 3QSYB 1XR7A 3ILIA 2P9EA 3ZTQA 4NLTA 4DL4A 4O3OA 3LGHA 3TAPA 1RTHB 4DWIA 3W9IA 3ADAC 4PRFA 4A48A 3L7PA 1RWKB 3IA0A 2QYCA 1TL7B 4A8XA 3HO1A 2HHWA 2WONB 5E33A 3RBXA 1YRTA 4A47A 4EMDA 2QLFB 2OEJA 1JIHA 2HWIA 2F40A 1RWXB 1X4BA 2DNYA 4KO0A 3N0VA 3RAXA 1BY9A 4K4UA 4J9UE 5BR8F 4TU7A 3GYNA 1CEZA 4KY3A 2AZ1A 3LH2S 1HHTP 2KVIA 5F0UA 3DC2A 4GVBB 1FEHA 4B3MJ 1PCAA 1RTJA 4ZS6A 2W9BA 1U1KA 4LF1A 1Q0NA 3C8YA 4LBIA 5KFPA 3D6FB 2NZ4A 3S1TA 1DQ8A 2JLFA 3JTNA 2FTRA 4L75A 3J81Y 4NLXA 4NLYA 1OSCA 3UCUP 3MEDB 2RT3A 5DQHA 5CA5A 1OYEA 3T9NA 3DGVA 3G8QA 5J1EB 2WVCA 4XPCA 4IOCQ 4ICLA 2DY9A 1CC7A 1T9VA 4AXIA 3NS5A 1S12A 4IG0A 3DRSB 2LXFA 2LFVA 3ZNJ1 1OPZA 3JYTB 4GRSA 3IGVA 2HMIB 2A2DA 5KG2A 3AOBA 5IM0B 4K4TA 3Q24A 3UVJA 5F9NA 2J76E 2B9YA 1P6TA 2V8VA 2IDEA 2ZOMA 4C4WA 3D28A 1F9EB 3PYFA 1TKXA 5HN0A 2W9CB 4ZA1A 2BE2B 5CZXA 2F65A 3DHXA 3DN9A 3RU0A 5DS7A 2N3OA 1TZ0A 3R5AA 2PD1A 4WFXA 2E1RA 1RADB 3BDEA 4JYAF 3CF5Q 1N5TA 1VHFA 5HLFB 3K8VA 2QFIA 1FNMA 4KHMA 4PKDB 2DGTA 2EEYA 3MECA 1RAGB 1L3KA 1LXJA 1ZZNA 3BYPA 4X4OA 2GIQA 4P7VA 3EGZA 1S0OA 2EG1A 4CLPA 4ERDA 5F3ZA 3CJ3A 2R7WA 3OR1B 3TX0A 3EM1A 1UJ6A 2KM8B 1FRIA 4PWWA 2BQ3A 5SZTA 3QIPA 2ZH3A 4DV3J 1IBMF 4B17A 2EKYA 4O3NA 3D0IE 4JI1F 1U09A 3GWCA 4IG3A 4V19J 2DRDA 1ZBTA 4DV2J 3KXDA 4FN5A 3M6XA 4URQU 2I0XA 2OFHX 1KRPA 3TW0A 3Q2SC 5EUHA 3NXZA 1UZHA 3HHLA 2NPIA 2WAQD 3LOUA 4DV6J 4QCLA 2BKOA 2MXYA 1ZM9A 1M5PC 4LR9A 3LA0A 1J2VA 2RSQA 5AT1B 1FA0A 1HIYA 3IFEA 1NSKL 4ZVQB 2VFUA 3RB6A 2EK1A 2VFRA 3O2IA 4LFCF 3ET6A 4USIA 1I3OB 2VIHA 2NS1B 3NEKA 1NSQA 2I5JB 5J2MA 2CZ4A 1KOHA 5KFAA 1V3SA 3MM7B 3FBFA 1WSRA 3NBPB 4C7QA 4NLSA 4YR3A 3ZZUA 4X65J 2HFNA 1SQGA 1GX6A 1VI7A 1IUJA 4R5PB 2HHPA 2RDJA 4ZPVR 1WHYA 3T1AA 3MOJB 1FD2A 3PRBA 1JLFA 4M5HA 3NRBA 1N88A 1RCXB 2DCUB 3R5DA 2XY6A 2MKIA 2Z4PA 4HKQA 1C1BB 4WE1B 3DLGA 1HQEA 2MSTA 3RBDA 4QQBA 3VAHA 3ZTRA 1S57A 1KHVA 3OLBA 1RT4B 2M2BA 2W24A 3D3CJ 4CWBA 5GMEA 2Y1RI 4OZ2A 2H5JB 4OX6A 2DKOB 1MW7A 4CTAB 3M2RB 2QO3A 5IT9Y 1A7GE 5HI7A 2RE1A 2IDLA 2GZOA 3MR5A 2DH7A 4DF8A 4B9VA 1TFYA 4HVZA 2HBRB 4DV0J 2GHPA 4Q43A 5LSOA 1MN9A 1VRTB 1DY3A 3SXLA 4UOGA 3VALA 4IDKA 1PC4A 3FZ2A 1NH7A 3IP0A 2XGPA 3SDEB 4OYAA 3H25A 4DQQA 2L9NA 5DJBA 1HARA 1F5AA 2VFTA 5D4NA 3P5TL 3UO0A 1UVJA 5KFSA 3NWGA 4LBHA 3D9BA 5KG7A 5F8MA 4PUOB 4YHHJ 4TQSA 3FK4A 4DX7A 2AP6A 3H5XA 1ZS6A 2Y3YA 2QLJB 2PA3A 2FPHX 3C2PA 4ZJLA 3A1YG 5L1LA 1B70B 2GAGC 4ZCIA 2KXFA 2F8HA 1DFDA 3BH6B 4JBCA 3NP5A 3GV7B 1JQGA 2IY5B 4LRFA 3UN5A 1T05B 5JXSA 3A8JA 4NZ0A 2JC1A 4IUFA 5EWGA 4DR7J 1LKZA 2PFDA 4OX8A 4DSKA 5EWFA 2OHDA 1WORA 2RRAA 5GAEI 1T94A 4EGLA 3FEZA 4UUWA 1KONA 2DNQA 2L3MA 1AZSA 2XG8A 2MHNA 3BPSP 3IO1A 3QT8A 2OO4A 1C0TA 4NCBA 1ZPWX 1REVA 3V6DA 2RS8A 1WOOA 2JEGA 3ZNUA 1VBKA 2NQPA 4LREA 1MWZA 1L5UA 2F9DA 4EI2A 2E7VA 1F0XA 5A8KA 4Q0BA 2ZJPQ 1O6XA 2KHCA 4JI2J 3CW2C 4EBEA 4WP8A 1F1BB 3Q8PB 4DSFA 2WK4A 3MEEB 2ZZMA 1WG1A 2EBEA 4CIOA 2FVQA 2DGUA 1S1UB 4FNIA 3BREA 1WEZA 2CWXA 1R8AA 4JI0F 3JTOA 3QT6A 2XLJA 4TVAB 5ITHA 1UVNA 1TMJA 1U1PA 1XNRJ 1U1MA 3HJFA 4CO0A 4EO8A 1N5VA 4E0DA 4FPRA 3R5BA 3UCGA 3U1NA 4P72A 3EE3A 2GW8A 4G1QB 2FY1A 1S1XB 2V6AA 3CCUS 1TV6A 3G4SS 5I42A 1D1UA 2BJ8A 1IR1A 3KHLA 2AJQA 3NOGA 1FFWB 3GV8B 2VKRA 2AJ4A 2HKEA 2RIJA 3GV5B 2CKWA 3D3BJ 4BLGA 1HBMB 4L74A 2DEJA 2XMUA 2HSEB 2DIUA 5F8JA 1S4FA 1LNQA 5IV3A 3HKZD 2PSZA 2DGSA 1X5SA 5L9NA 1NHKL 2BA9A 3A3OB 1BMQB 2HS0A 1YK9A 2UUCF 4U7UD 4ES3A 3MM5A 1Q16B 8RUCA 2OKQA 2QMUB 5L39A 4MJKA 1RHRB 3LW5C 5C42B 3Q89A 2MQLA 4MIBA 2D69A 4NXNJ 1IVZA 4NPOA 5G0RB 2XTJP 3E3XA 3TEGA 3IGNA 1KLMB 1N6QB 1NZAA 2LDYA 3GFHA 3ITHB 4LF8J 1F9HA 2M4MA 3QATA 5AE1A 1KC8T 2ZH7A 2OPPB 3H98A 4HI2A 2KU7A 1GT8A 3HD1A 3UD4P 3VGSA 2DHXA 4ECXA 3JSMA 2FHOB 1R0CB 3F73A 2QLWA 2VQEJ 2ERRA 1W2IA 4O3QA 2RRNA 3VZHA 2XHCA 3HLUA 2BUNA 2RHQB 4U7UK 2DRAA 2Q6CA 3UQSA 3I55S 3GZ7A 4P6QA 4JI8F 1GMVA 1RLCL 2YPZA 4K0KF 3GMGA 2ZM6J 3D1QA 3EUNA 4J9PA 4LSLA 4KSEB 4PXBA 3BKTA 3MMAB 1EP4A 3D5MA 4EO6A 2KJWA 4ECWA 4ZPWR 3ZZYA 3RYLA 2XLKA 3SEOA 2DD8S 3NMAA 3SBMA 2E7XA 2PFFB 2H5IB 5ADZA 1Y00A 4ES2A 2DB1A 1QUPA 3TNVA 1IQZA 2GQQA 3CJRA 4C3MA 1Y9OA 1KKHA 1RKJA 5KFHA 2C2DA 4F3MA 3MMCB 2OEMA 5ETTA 4I68A 3OJSA 2RUGA 3G6VA 2O5DA 1JLQB 2MZTA 3HHKA 1VQ6S 4PG4A 1RBLA 4IFYB 2MQNA 1V6HA 2JVOA 1TL7A 2OPQB 4H4KA 1RWMB 1T3OA 2FD2A 3MR2A 1IKYB 2EFOA 3K5NA 3M05A 5FDLB 2MB0B 2VD3A 4Q5VA 2VPZB 3M8PB 2GHVC 2DPJA 4DUYF 5C2GA 2YKAA 4OYBA 1FJEB 2XB2D 1U24A 4C8KA 4AL5A 4ED7A 3PDNA 1LW0B 2CQCA 3CCLS 3H4DA 2XYPB 4GVBA 1E6VA 2J6UA 4F0MA 2XMTA 3PVXA 4LBPA 5CYMA 4QYZK 3OFGA 3KTQA 2J9DE 3M30A 8AT1B 3J7A1 4NI2B 3HK2A 1S9FA 4D3HA 4OMFG 2K7JA 1M1KT 3ZFVA 3I56S 4H4MA 2DBBA 7FDRA 3NL0A 5JJBA 4JV1A 1SVDA 3D4JA 3OXLA 4KGVB 4QYZJ 2ATLA 2DY1A 1LWFA 3A3PB 3CDBA 4Q7AA 4MYUA 2MQOA 1IBLF 2P2CB 3SQGB 4MMOA 5F8LA 4UY85 4OZ5A 3MZIA 4GKKF 1S0MA 3IR5B 4X65F 2J6SA 4JI7J 4PEOA 1KHWA 4W98A 4PG8A 4CH1A 1SI9A 4WTOB 4YUDA 1XWLA 1R0AA 4FVCA 4RNOA 2CXEA 3HPOA 3I4HX 2RH3A 5KFLA 3ZZ0A 3BO4A 3JSBA 3UI3A 3OVAA 2BE2A 4UOHA 2OSQA 4X4QA 3JAMU 3BZQA 3S01A 4CLSA 1RCOB 2HHUA 1RT3B 3P49B 4ZJQA 1SKWA 5E5NA 3GP9A 3LGNA 2WSFC 1QE1B 3D7SB 2JEJA 4LSNA 3C15A 3R5JB 3BPDA 5DG9A 5IQQA 2ZH9A 4DV0F 4DN0A 2I2YA 3ZTOA 4WF9Q 2RU9A 4DBQA 5AE2A 3EVWA 5B0CA 2HWTA 3GJQB 4NLRA 2CPIA 2AEMA 1JJCB 2GC8A 1HL6A 1CQMA 5A76A 3DLHA 2KXHA 1S1WB 2DNHA 1X8DA 3HZGA 4X84A 3TA0A 3MEGB 4WJBA 4KE5A 1KBRA 3GJTB 3MMBB 3G6ES 1IWAA 2JDJA 2Y9HA 4X66F 4D3GA 2CDRB 4JOUA 4LF6F 2GVDB 3I32A 1I94F 3KK2A 4OLPA 4DX8H 2QA2A 4ANCA 4URGA 3BQ2A 2B8PA 4MKYA 4CZCA 3WDOA 3IRXA 2NYHA 2YNHB 3K2YA 4J9LA 3CC7S 3DYAB 1Y0HA 3IAM9 1B64A 1GMWA 1RHUB 1YJ7A 3I4PA 5ETPA 5EDWA 2NR0A 3AXMA 4DV1J 3TJ8A 3KLHB 1F6TA 4NYPA 3EZUA 5HO4A 2X51A 1FERA 3V6JA 5CAAA 1NMEB 5J2QB 2GIRA 2C3PA 3IWLA 3DOKB 4M5JA 2K3KA 4PG7A 2ZC3A 3ULHA 1FNOA 2KYXA 1YIJS 2QEXS 3M6UA 1C1BA 3MMJA 1RHJB 2J0QD 2F4VJ 1PJ5A 3F41A 2PI5A 4IO9Q 2R7QA 1HQ2A 1UW4A 1RT4A 5LMNF 3VZIA 4USMA 1U47A 2NXEA 1JKHB 4LF9J 1SXLA 1XNRF 3E2EA 3AJDA 5KG0A 1TR0A 2GGPA 1SV5B 1Z2LA 3TVYA 3O5TB 2DO0A 5D3GB 1M1HA 1X4FA 2Z2ZA 1OYDA 3KUGA 2QV6A 2KT3A 1FXDA 3A3NB 4Z37A 2J9DA 4RW8B 4J9MA 4ILLA 2K1RB 3R6GB 2VB6A 3M1VA 2NXJA 2FB0A 1S6UA 1BQXA 1U2RA 1FWLA 4IH6A 3GIKA 3Q8RB 2YWHA 4AQYF 1T11A 2XMMA 2CPJA 1O0PA 3N5BA 1AUSL 3AQOA 1TP7A 2LU1A 2EWHA 3D6TB 1NHUA 4IR9A 2V5HG 3HF5A 1LWXA 2DCLA 3EDRB 5I4MA 3HHLC 4E8UA 2MY7A 5HMXA 3W8PA 4M5LA 2CQ1A 4DG1B 2C2MB 1GK8A 1ZPVA 2ZWOA 1HPZB 3HSGA 1N48A 1NEEA 2AJFE 5GMDA 3QNWB 4FVMA 4DDFA 1SB6A 3UW1A 1WG4A 3I0SB 3A8IA 3TUJC 3OT9A 4ZHRA 3UD3P 3M2VA 1JLAB 3OTOJ 1QJHA 3C6TB 1N34J 1KTVA 1FE4A 4ZPBA 1RWUA 1NJYA 4YB6A 4RW7A 1IJEB 2HFZA 1RU2A 2MQPA 1SQFA 2HBQB 1VK3A 3TUIC 2MY8A 2VPWB 4H4OA 3PR5B 4FYDA 5DLFA 3C3LA 2EK6A 1NSPA 3NGDA 2ASLA 3WZ0A 2ZUAA 1S9EB 2E1MC 4OZJA 5B0EA 1NJWA 2ZEJA 3OL9A 3UN3A 2RVJA 5E0OA 3JSRA 4MK8A 1NH8A 2D3UA 3AB2B 3L9ZA 2BDPA 2WBMA 1XMOJ 1NXIA 3BSCA 5RUBA 4DPWA 1QVFR 3MHYA 1S1UA 4RW6B 1CLFA 4CYUB 2CJ9A 3EWGA 1C2PA 4OL8A 2PC6A 1FKAF 4OYOA 3K17A 2G0IA 2HQCA 1ZETA 4W92B 4ILRA 3WHIA 5CHCB 3ISZA 4G1QA 1GX5A 4U7CA 5DM7Q 4DQIA 1FDAA 4G1PA 4ZITA 2Z57B 1QAXA 5EWEA 3DRPA 1F9FA 1DLOA 1K0VA 2WCXA 5KFRA 4F0KA 2GVZA 3TUPA 1Z4UA 2MGZA 1M5SA 1CJTB 5D15A 3K89A 3OTCA 3M8ZA 4PR6A 3BN4A 1RJJA 2WW8A 2J0XA 1R8HA 4LFBF 1XIQA 3R97A 4EBCA 3TQEA 2FJVA 2HBYB 2YNGB 1X9MA 4O4GB 4DV7J 5C7PA 4B3OB 3V2UC 4RBTA 2N3LA 4KIAA 2XSJA 3Q83A 4B3SF 1CJKA 2G4BA 1LXNA 4USWA 2ZE2B 3LF0A 2DGVA 2HK2A 4F4ZA 3HSDA 8ATCB 5AJ3F 4WZQA 4KV8A 2QG9B 1GEHA 4YQWA 2RQCA 3Q2TC 2IAJB 3W66A 5IQ6A 3N6MA 1ZA1B 3DGPB 1RSCA 2PMWA 4UOFA 3HULA 3PACA 2KO1A 4W90B 1P1TA 3Q22A 1UVKA 2ZJRQ 2IFXA 1TL4A 4O3RA 1U6FA 5HMWA 5CD4A 1J27A 3H90A 2NSCA 3K7RA 2YPYA 2G0CA 1FK9B 4C2MA 2ZBCA 4QWEA 2ZOGA 3VV2B 3QRPA 4KQZA 5KFFA 4LIWA 2XY5A 2OSRA 4WYWA 2DNGA 2EFGA 3TRGA 2YWEA 1HA1A 1CVJA 4M8LA 3KLGA 4B08A 2HFUA 1IM6A 4PABA 3RG6A 3BS9A 4I7FA 2V9WA 3HZEA 2E1CA 2OJ3A 2H1YA 4ZVGA 1ZTTA 3PFOA 4ED4A 4PCQA 4I69A 4Z7CA 4CNYA 3OTDA 3G82A 2FHJD 2VBZA 3HDSA 4QWAA 1NJIT 4J91A 4KGMA 1R43A 1TQLA 1JLBB 1IKXA 1S6OA 4U96A 3SI8A 4BDPA 2JFDA 5KOXA 2GJFA 3AODA 4MTPA 1Q1KA 3CCMS 4BBYA 4F2SA 4U8VA 1T7PA 3DHWC 3TVKA 1ULRA 4ZIWA 2W2PP 5IZHA 1LQ9A 1WEXA 1U8SA 2Q66A 3SSQA 1KQSR 2NLWA 5FDLA 4YP3A 4C11B 3LTOA 5KFQA 4DV4J 2J9CA 2DHAA 2DHGA 2DH9A 2ZOFA 1RAAB 3PX0A 4Y34A 4N76A 2FLNA 1BWEA 1KFDA 3HVTA 2W2NP 3KK3B 3MURP 5IWAJ 1KQKA 3I31A 4PXCA 1U25A 3C46A 1C4AA 3MAAB 1TUVA 5KFYA 5IS2A 3PO4A 4OYPA 3IN5A 1RT1A 5U47A 4C48A 3SMZA 4CM2A 1H2VZ 1FJCA 2HFOA 4ECRA 1HBNB 3MAQA 4I6WA 2DXFA 5J2PA 2J7KA 2GMHA 2HS4A 4DV1F 3ILOA 4DSIA 1PYSB 4ECUA 5KFOA 3AQPA 1U45A 4CH7A 4OLOA 3UDVA 4KPCA 5IOLA 3K5PA 1Q5YA 2HQIA 1TL1B 2OTJS 1HHQA 4RW4B 3EPIA 1MU2B 2RB7A 3SSRA 3MUMP 3CMAS 2B4PA 2KKHA 2IHR1 2O3DA 4JV5J 3BSOA 3EXYA 1FKPB 4P74A 2QLXA 2J6TA 3HHDA 4X62J 5H9FK 4NA1A 2L9WA 4ZCMA 3LP2B 4Y6IA 2IYGA 3NLCA 5K5MA 3UN2A 4XK8C 2F4VF 3I5AA 2ZBRA 2DNKA 3CE8A 2ZHOA 2WHOA 1LEOA 3O3LA 4KHRA 3J80U 5ETSA 3CGIA 3QGGA 4FYWB 3DDIA 2GJIA 3ZO7A 5H9FJ 1GXTA 1HWIA 2EKNA 5DO2A 4E98A 2H51B 4H4KC 4L73A 2N7YA 4C8MA 3GR1A 4LF5J 2RQKA 1S6QA 1S6PA 3M32B 3MDFA 2RF2B 2PN6A 4B3RF 3UCZP 4NASA 2E7WA 3PW5A 4P7TA 3EX7B 2Y1IA 2FLPA 4KBIA 1FF2A 3BGRA 2G0JA 1R3NA 3MEGA 2QJ3A 4B9NA 4QIEA 1RT6B 3MMBA 2A10A 4KO0B 1W2BR 3VAKA 3UDCA 5EX3A 4F4AA 3MPWA 1FRXA 4BWJA 4USHA 3F56A 3OVSA 3EZ5A 3DXSX 2KHDA 2W9BB 1FDNA 2GIFA 3AD9C 1L3SA 3KNAA 3FFIB 2OPSB 2YNHA 4HEA9 1HNZJ 2CAJA 5D0GA 2CNLB 4ZVPB 1R0BG 1V9OA 3H5SA 4OZNA 1KVIA 1SJFA 5CD4H 2P6SA 4QIWD 3OUYA 2YH0A 4ENOA 3OTOF 3UD5A 1N34F 4XPEA 1VDHA 2ZJQQ 2VA2A 5HK4A 1PC5A 3KLHA 2WOMA 5E7OB 3GONA 2XMJA 4ICLB 2R3VA 2UUAJ 2CJQA 1EHWA 3HMJG 3G6XA 1PAEX 1VIOA 2R8IA 2D1CA 2HGLA 2IM1A 4NOHA 3PKMA 4IG0B 4Y2IA 3DOKA 3QSIA 2HHHJ 4OX9F 3NKYA 3UVJB 4WKYA 5DDRC 4OI0A 1TKXB 4A4JA 3H2LA 3R8YA 1OO0B 3G8TA 2J8AA 1FKOA 2JRSA 3AJ2A 4GVLA 4N41A 2LQ8A 1N0UA 4M5GA 4FKYA 1SCJB 3JAMY 2VV5A 2FQQB 2HVZA 3CJ4A 2BKPA 1QVGR 1W26A 1A9NB 2HQ3A 1X5OA 5C24B 2DR7A 2IJRA 5CZVA 1OIAA 1ZM3A 1BGXT 1DTQA 2WRMA 4M5DA 1PO6A 4ELUA 3UNYA 1PILA 3QJJA 5D3GA 1WHWA 1ACMB 5LSLA 2D3OR 3AB4B 3M9OB 4CO1A 4P2MA 4F7VA 1UWAA 2K1RA 3ENVA 1HMVB 5DGBA 1Y3KA 3SCIE 3BKUA 5GADU 1Y5IB 2VICA 3GSIA 3LP1A 2D3ZA 3QIPB 4MKVA 2PDAA 1U1OA 3HFKA 1R7IA 1T9XA 4R0EA 4UF4A 2EVZA 4IG3B 2ATCB 1AB8A 1JNZB 5BR8J 1FT8A 1HPZA 1QAIA 4DN9A 3GCXP 5A8WB 2FJAB 2HZAA 3W7BA 2R2TA 3MCMA 1U26A 1NDPA 4N7TA 2R7UA 4ZCLA 2V8DA 2BRLA 3VR1A 1VRQC 2GA7A 4FXDA 2ALYB 1GTEA 4ECTA 2YWKA 4M5MA 1K0TA 3PRVA 2BJEA 3ET6B 2C2ZB 2M8DB 1UJ5A 3R27A 4QU6A 5J2MB 3CJKB 1NKEA 4NEYA 4FPIA 3DU5A 1WKLA 1VQOS 2MKYA 1SIZA 2P6TA 3DKDA 4L3KA 2AGPA 1VLYA 2YKMA 2MLZA 1JLFB 3IG1A 2J5AA 4NLDA 2HHXA 3PFEA 3W64A 5EGYA 3ISND 1RU1A 3ONQA 1HQEB 1JJ2R 4ZPAA 1P9YA 3PW4A 2DHSA 3QJPA 2DR9A 2B8QA 4RW6A 4ZVSB 2AX0A 1UEUA 2LXIA 1HI1A 2QSWA 2DGQA 3LPEA 4JYAJ 3BBFA 1R8PA 3PNIA 1FX2A 1VQ7S 3PJWA 3H5YA 4C9DA 3HFVA 4J7CA 2YNFB 2D9PA 2DISA 2CQIA 2CQ2A 1O5JA 1AFJA 3GSDA 2NUHA 1KDNA 1Q8BA 1BD6A 2JH3A 2CPDA 1D9AA 3DCAA 1N33F 2M3DA 4OI6A 4RW9A 4IDKB 4NLPA 3L95X 3W63A 2D9OA 1L3VA 1HWLA 3JSYA 1U2FA 2M7SA 3DI6A 3HKWA 4UOCA 4DL2A 1WHVA 4USKA 4DV4F 2DH8A 3QIDA 3IWXA 4HT5A 3J81j 2I6WA 1IBMJ 1S59A 5GADI 2VG6A 2OFGX 2VKZG 4JI1J 3W65A 1T9TA 3ETOA 2ZKTA 2VQFJ 4LRAA 5DDPC 2H48B 3PYDA 3ETMA 4YB7A 3M7VA 3ZTPA 4LQ9A 4UT4A 2D41A 5KFUA 4CRJA 5HJYA 2HAIA 4WFAQ 4RX6A 4YDDB 3VAIA 2RAQA 1X4EA 4DR3F 3G71S 2M70A 4B9TA 4U9RA 2IAJA 1T03B 2ROPA 3FC9A 2LQBA 1YHQS 4A8OA 3DGPA 2B5JA 3LALA 3UNGC 2X1GA 4KJIA 3Q8YA 1NZ8A 2GO8A 3NMRA 1AZSB 1B99A 4LFCJ 3D66A 1JLEB 1C0TB 4ZLNA 2XCAA 3OBIA 2YXLA 5D4OA 1U48A 1REVB 3V6DB 1WC3A 4IH7A 2G1DA 1HI0P 1SBRA 2HEKA 1H73A 3W2WB 5A8KB 4Q0BB 2IRUA 4LRDA 4X4NA 2V0NA 3SV3A 1OPIA 2HHSA 3BV8A 3DOMA 3NNHA 4FXVA 2EBGA 3QJLA 1FEEA 4A8FA 2XMWA 4B9MA 1WF2A 4DLEA 2HLTA 1FHTA 2PEHA 3MTKA 1WI6A 2MEWA 3RB3A 4KGZB 2XYHB 1S7HA 2FJDB 1P8GA 4QWBA 1FRHA 2A3JA 4DFMA 1SC4B 2NCKL 2IC3A 4OJHA 1SUQA 2UXDJ 3NCPA 4RU2A 1VQ9S 3B4DA 2XY7A 1HI8A 1LK7A 2PMHA 3NGSA 2BZ2A 2QL9B 4DX6A 3NG8A 1DZ5A 4WK3A 1SH3A 1T9YA 1TV6B 3T19A 2MQQA 2BM0A 3R7SB 1RAJA 1NPKA 3JQMA 4F36A 1XMQJ 1VCTA 1XR5A 4R25A 1NCLA 2UXBJ 4JV2A 3U1MA 1DTTA 3UR3C 1X4GA 2HNZA 2VBXA 2ZD1B 3MM5B 1UFLA 2QLBB 1SL1A 1OY6A 3EGNA 1U4BA 4OHYA 2AWZA 4DXLA 5LOQA 3KK3A 4LF4J 2DO4A 4I2PA 2JLEA 1WC5A 3TZZA 5GAHI 4TXSA 4G6VB 4QU7A 2P8IA 3AOCA 2DVIA 3B54A 5HP1A 5FJ4A 2VFSA 5KFBA 5AXKA 3KFWX 1ZYQA 3E01A 5KFKA 1N5QA 3M8SA 2AV5A 2IVYA 2XQCA 2CQPA 2I8EA 3MM6B 3FCWA 4F4YA 2XWYA 2C2NA 3R7BB 2UVUA 2CRLA 2FZCB 1EARA 3DDKA 3I5BA 3LQVA 1NK5A 2UUAF 2ZC4A 1U0HA 4OYWA 2RKIB 3QGHA 4ANEA 1PYOB 1M1GA 1EJ7L 3TA2A 2CPEA 5HAOA 1YITS 2YKPA 1VGYA 2E1AA 1VQKS 5KT5A 1JLCA 4O0NA 4ZPTR 1D09B 2R2SA 3HX9A 3KKFA 1V3ZA 4LF2A 3KNGA 4ZCKA 3LWMA 2MDAA 3T5LA 4LIRA 1EP4B 2HNYA 3EXCX 1FTCA 1UPPA 2QZ8A 1LW2A 4RNFA 3HJVA 2MTLA 2MLYA 4ED3A 3K5LA 2DNOA 2KN4A 2WW4A 1EKRA 1BUXA 4K4SA 3CXCR 4PQUB 4F50A 1RABB 3THTA 1QDUB 4UZCA 4JI0J 3CO0P 2W8LA 2QE5A 2DNRA 4CO5A 2UUWA 1IXKA 1PSDA 4C3KA 2V8GA 1Q8LA 3DRRB 4ETXA 4ZOSA 1NB2A 3LANA 3KLEB 3M32A 2DRBA 3CD7A 4DPTA 2XHWA 2RF2A 5AE3A 4Q8FA 1KN6A 4MKBA 2O66A 1D0EA 1NBEB 4U8YA 2BR0A 2JSXA 1X31C 1F3FA 2LA6A 4LR7A 1S1VB 3EMTA 4WP9A 2V2KA 1T0TV 2YNIB 1RT6A 4IR1A 2Y1LB 2Q79A 4HHHA 1V5IB 2UUCJ 5ETOA 1YBUA 1VOMA 5BXIA 4IFVB 2C42A 2R7OA 4IO1A 4KH1B 4B3TF 1S7IA 2G2ZA 3SZ2A 3QWPA 1ZM4A 1E6VB 1F5CA 1DJ0A 4LRCA 1PJ7A 5CYMB 1NK6A 2QA4G 3GFXA 5KT6A 1GXUA 3M30B 3FFIA 2WZ1A 2OPSA 4K7QA 3MPYA 2BM1A 3TYTA 2YVSA 2FZKB 3Q8UA 1S0VA 4FF3A 1BQNB 3C66A 2CNKB 2FC8A 2XEXA 4H4MB 2NYIA 5KFTA 2QT7A 1TKDA 3G2XA 1LWFB 3M9MB 3F0NA 3MR7A 3J81U 1C1CA 2DNPA 2COLA 4ZVFA 3H40A 2VA3A 4RNNA 5T41A 1FRJA 3A8KA 1MWYA 4LQ3A 2LP4A 3JXOA 3ENAA 4X4TA 5GAGU 1IQTA 2ZUGA 4J5OA 4JI8J 4M5KA 3S6EA 3P5BP 4K0KJ 1Q7LB 4OX7A 1R0AB 5KG1A 3LWLA 2KT2A 1S49A 1KD1T 4CNZA 5FIIA 2W2MP 1FD8A 3R1LA 1U02A 4F3QA 3W9HA 4QPXA 4EBDA 3CB4A 2V2QA 1ZTWA 4QJVA 4TKTA 4ECQA 2XM3A 3VAJA 3CJ5A 3PTWA 2LLZA 4DL0C 5C24A 2AW0A 2HRUA 4LSNB 5HL7Q 3C15B 5KFNA 3C19A 1N0VC 1N32F 4M1KA 3HT0A 3RRKA 4ES1A 3THPA 3KG0A 2ZH8A 2VONA 2FJXA 3IMQJ 3NCQA 3AD7C 4LR8A 5CCLA 1HMVA 2BEFA 3CD6S 3GIIA 1U6ZA 1HR0F 4ZVUB 2CADA 2CG4A 1TAQA 3HM9A 5D77A 4ELTA 4ETZA 4L72B 2LCWA 2X3DA 3P45B 5JMNA 2KYZA 1H2TZ 1XNQF 2C3YA 2QN6B 5AXMA 4DUYJ 3CCVS 2VQFF 2V4QA 2ZVSA 4A8WA 3MR3A 3EJMA 4DR5F 3KK2B 1FRKA 4ZJOA 2B51A 1YG0A 5IT4A 3QO9A 2E9ZA 1Z1ZA 3OQ2A 5CH7B 2K06A 4FS2A 2V34A 5A8WA 1HW8A 3IRXB 4RUBA 3ILLA 1UFWA 4FF1A 1IR0A 4WU3A 5BYSA 1VQ8S 4NZ7A 5DGAA 4K2XA 2V69A 4WP3A 2C22A 1UWBA 2FHKA 3CT9A 3EGWB 2CPHA 1WSVA 2RMLA 3B82A 2C28A 3G6YA 1NK8A 2AT1B 2HURA 1YTYA 3KJVA 1NUEA 2BKNA 1IBLJ 2NREA 1UA0A 3GFZA 4KKOA 1G4CA 2W25A 5EHHA 3CJKA 2BVZA 4GKKJ 2NZCA 5D0EA 4CCHA 5A0YA 2CG8A 4ZK7M 1UVIA 3CJQA 2BMBA 5GAGI 2QTWA 3D1OA 4F02A 1SPBP 1CJVA 4PAAA 2RU3A 4FBUA 4YS2A 2BJ3A 2B56A 4NCGA 4PWDA 3W5ZA 1S77D 2HVEA 1HFEL 3NS6A 1LWEA 4N5SA 2YKQA 4QW9A 2CJAA 3MEKA 4ZVOB 4JP8A 2VU5A 2CA9A 1JK9B 4QPTA 5THWA 5B7WA 2UXDF 2QIFA 2YNFA 2GGPB 3KHRA 1WOPA 4TLQA 1XN9A 2ZNYA 1Q8IA 4KPYA 4WXOA 5CYJA 5BJRA 2OMLA 4QW8A 1LFPA 4ZLJA 1WTBA 2CVEA 1XMQF 1JXLA 1AFIA 4HT7A 1BLUA 3M1VB 2CPZA 3LPYA 2UXBF 1RDRA 2VBWA 3WX8A 3FKBA 4LT6A 3NY0A 1VK8A 2DNZA 2HPUA 2BE7D 2POKA 1U49A 2V94A 1TELA 4X66J 1QUVA 3QWUA 2AIRB 4LF6J 4LF4F 2D74B 4PWUA 4P2FA 2IA6A 2B9XA 5A2QU 3BGOP 5DETA 4IRDA 5KOWA 5B0FA 1I94J 2WVDA 5I3UB 3ZZOA 3JQKA 4I6AA 2KRBA 3QYYA 1J5OA 1O51A 1IKVA 2ZHBA 2XO7A 3DLKA 1YJWS 5K8OA 3OTBA 4NLQA 1UMJA 4ZHRB 3POTA 3M2VB 2HVHA 3G86A 1NLKL 3PHTA 1T03A 5B0AA 3F44A 4RW7B 2ZZNA 1MWQA 3IWNC 5K8MA 3BH7B 4RWXA 2YQ1A 4H4OB 3FBCA 4EFAC 4K4WA 2AD9A 1JLEA 2ZBPA 3KLIA 2ZVIA 5ETVA 4YB1P 3M6WA 4DF4A
chains in the Genus database with same CATH topology
2V9WA 5LXYA 3IA0A 3HZEA 3D0GE 2QYCA 2RS2A 4RBUA 2E1CA 2IM2A 3CWJA 2OJ3A 4ZVGA 1ZTTA 3PFOA 3W2WA 4A8XA 1VQPS 3HO1A 2OD4A 2V4JB 3OSPA 4PCQA 4I69A 4CNYA 1UWBB 1YBAA 2EW9A 3OTDA 2WONB 5E33A 2HHWA 2DTJA 2FHJD 1YRTA 1NK7A 1VBZA 3TARA 1S72S 2VBZA 3HDSA 4A47A 3MWBA 2QFJA 4WCEQ 4QWAA 1NJIT 5F3TA 4ID5A 4HYKA 3GIMA 1JIHA 2XULA 2VOOA 3TX8A 5A6PA 4KGMA 5D78A 3OJUA 2HWIA 3IR7B 2F40A 1X4BA 1R43A 1TQLA 2DNYA 2YWGA 1FJGF 4KO0A 3N0VA 3KJVB 1JLBB 3RAXA 2FIUA 1BY9A 1IKXA 1S6OA 4KKOB 4BS2A 4DR7F 3SI8A 4BDPA 2JFDA 1VS3A 4K4UA 3PHEA 3GE9A 2YH1A 5KOXA 3UR0A 5BR8F 2IMWP 3NNCA 4TU7A 2YY3A 3GYNA 2CJKA 1V3RA 2E5IA 1CEZA 3CD0A 4MTPA 3I9ZA 1Q1KA 3LH2S 1HHTP 2KVIA 3CCMS 1T95A 2ILYA 5F0UA 3DC2A 3P96A 3GYXB 4AUKA 4BBYA 2ABYA 4F2SA 1T7PA 1FEHA 3DHWC 1JMTA 1ULRA 3TVKA 2VPYB 4CI0B 5A0YB 3PEHA 4ECZA 4MAKA 4DQSA 3PR4A 1RTJA 4ZS6A 2W9BA 1AXQA 1XERA 1S48A 3T6JA 5IZHA 1ZAVA 1DQ9A 1LQ9A 1WEXA 3QAUA 4RKUC 1U8SA 5E3PA 5GVQA 1U1KA 2Q66A 4K4YA 3SSQA 3E51A 1KQSR 4C8YA 2NLWA 2I5JA 3KYLA 4MIWA 3C8YA 5FDLA 5KFPA 2J7UA 3CDUA 1XEZA 4YP3A 4X4UA 3MM7A 4C11B 5KFQA 2J9CA 2ASJA 2V8HA 2ZITA 3NBPA 2DHAA 2UVRA 4IOAQ 2NZ4A 2DHGA 1VQ4S 2DH9A 2ZOFA 4DHVA 2RQ4A 2FVCA 3S1TA 1DQ8A 3QAEA 3PX0A 2JLFA 3JTNA 4TU8A 2FTRA 3OHBA 3N4WA 2O67A 4Y34A 3J81Y 4NCGB 5KG5A 2FLNA 4N76A 1KFDA 3HVTA 4NLXA 3KHGA 4PWDB 4NLYA 3KK3B 3MURP 1OSCA 4R5PA 3UCUP 3MEDB 2RT3A 4JI2F 1FTRA 5DQHA 4FS1A 2UVVA 3DRPB 2JHEA 1KQKA 5CA5A 4MK9A 4WU2A 3I31A 1LWEB 1U25A 4PXCA 3T9NA 4A48A 4ZLPA 1K8AT 1C4AA 3C46A 3RW6A 2HHTA 1NNDA 2MZSA 3G8QA 1TUVA 5KFYA 4ECYA 5J1EB 1DLOB 5IS2A 4XPCA 4IOCQ 4ICLA 1U1QA 4U6PA 4HH1A 3PO4A 2ZKUA 1CC7A 4ED5A 4K4XA 1Y5NB 2B6AB 1Q86T 1N5YA 2CIMA 1KVJA 4WE1A 3IN5A 4AXIA 1RT1A 1GAOA 1WNEA 5U47A 3NS5A 3T5JA 1S99A 2MGZB 1X5PA 4IG0A 3SMZA 3MTJA 1K9MT 3DRSB 1XC9A 2LXFA 4OJGA 1H2VZ 1VQMS 5KG4A 3R5CA 3VTIA 1FJCA 2HFOA 1TKZA 5KFIA 4ECRA 4DQRA 1D8YA 4ZDNA 1OPZA 3B8HA 3JYTB 2ZD1A 4KB7A 3IGVA 1HBNB 3MAQA 2HMIB 4I6WA 4XAKA 5J2PA 1VQ5S 2A2DA 2J7KA 4KFBA 3GG0A 2GMHA 5KG2A 5KT2A 5KTQA 3MUVP 5IM0B 4MK7A 2HS4A 2EPIA 4DV1F 3B4MA 4K4TA 2ROEA 4CTAA 3M2RA 3Q24A 4DSIA 5F9NA 2J76E 4YEAA 4DQPA 4ECUA 1BC6A 2B9YA 1P6TA 5KFOA 2V8VA 4Q2MA 3K57A 2ZOMA 2R7RA 3AQPA 1X5TA 1MNEA 4C4WA 3O6QA 1U45A 2W7AA 4CH7A 2CQHA 2XSJB 4OLOA 3D28A 2R7XA 2IJNA 1IM4A 3FRZA 1TKXA 2OTLS 2C3MA 3MFHA 3K5PA 4CO3A 5HN0A 1XK8A 2W9CB 2HQIA 1TL1B 4ZA1A 3UE2A 2BE2B 5CZXA 2GMJA 1Q79A 3AHPA 2F8MA 3DHXA 3DN9A 1VRTA 2DGOA 1HBUB 5E3AA 3ZC4A 3CDWA 2ZHAA 4KV8B 3RU0A 2OTJS 4I67A 5DS7A 2N3OA 1TZ0A 4RW4B 3R5AA 2MZRA 2PD1A 4WFXA 2E1RA 3BDEA 3EPIA 1MU2B 3SDEA 2RB7A 3SSRA 4OHXA 4JYAF 3CF5Q 1N5TA 1X7VA 1VHFA 3MUMP 3BQ0A 3SCJE 3G9CA 2B9WA 3CMAS 1IKWA 4LJMA 3MM6A 2B4PA 5HLFB 3K8VA 1X0FA 2KKHA 2IHR1 2YX4A 1FNMA 4KHMA 4PKDB 2O3DA 4EYIB 1YJRA 2DGTA 3MECA 4NLOA 3BSOA 1R6YA 3EXYA 3OL8A 2F8EX 4CO2A 1Q7YT 4C8ZA 1L3KA 1FKPB 1LXJA 2LQ9A 2QLXA 1ZZNA 1UL3A 2J6TA 3HHDA 4X4OA 2GIQA 4P7VA 3EGZA 4PUOA 3BO2A 4NA1A 2L9WA 4HDHA 2QRRA 2RKIA 2LECA 1S0OA 4ZCMA 3LP2B 1QM9A 1J5OB 4Y6IA 2IYGA 1HNIA 3NLCA 5LSRA 5F8GA 5K5MA 3FRYA 2EG1A 1IKVB 4XK8C 1RTDA 2F4VF 1XR6A 3I5AA 5I3PA 3GILA 3SV4A 4M95A 2DNKA 3CE8A 2ZHOA 4ERDA 3DLKB 1QAJA 3SCKE 4PQAA 2BJDA 2WHOA 5F3ZA 1I1GA 4NXNF 3TVZA 3O3LA 4KHRA 3CJ3A 2P5VA 2R7WA 3CGIA 3QGGA 2IRYA 3POTB 5T7LA 3OR1B 2MKKA 2DPIA 1UJ6A 2FVRA 2IJFA 4LFAF 1TAUA 3NAHA 1DQAA 2UXCF 1TKTA 5KFMA 3BR8A 4FNHA 2KM8B 2GJIA 1HQUB 5KAKA 5MLCV 1FRIA 5H9FJ 1GXTA 2BQ3A 5SZTA 2NUUG 1HWIA 3DOLA 1KSPA 3QIPA 5DO2A 1SKSA 2ZH3A 1B0VA 1IBMF 2VC1A 4B17A 2EKYA 4E98A 1NK9A 4O3NA 3D0IE 1SL0A 4JI1F 2ASYA 3CIMA 1U09A 2JJ4D 1T05A 2XSFA 3GWCA 4H4KC 3DMJA 4IG3A 4BWMA 3TO8A 5HQ8A 4LF8F 4V19J 1HWJA 3PRDA 3KLGB 2N7YA 4C8MA 1KR4A 2ZH5A 3GR1A 4DEZA 2RQKA 3KLIB 3KK1A 1S6QA 4PQUA 1ZBTA 3FMWA 4JI3F 1S6PA 4I7FB 3M32B 4NYZA 5LMUF 3MGJA 3MAHA 3MDFA 4FN5A 3M6XA 4DR3F 3D0HE 4URQU 2RF2B 2PN6A 4B3RF 2APOA 3UCZP 2MYFA 2I0XA 2OFHX 1KRPA 3OXGA 2E7WA 3DNCA 4P7TA 3TW0A 3PW5A 1J5EF 3Q2SC 5EUHA 2VQEF 3EX7B 4DL3A 3DRXA 3QMQA 2Y1IA 1M5OC 2FLPA 1MMNA 5KFDA 4KBIA 1N4LA 1FF2A 3HHLA 2NPIA 5EN1A 3BGRA 2WTFA 2WAQD 1R3NA 3FSIA 3MEGA 3LOUA 4QOTA 1NRKA 3KLFB 4QCLA 4B9NA 3CTRA 4QIEA 1RT6B 3MMBA 3VAFA 5J2NA 1NAQA 2A10A 1P27B 3SCLE 1LOUA 2MXYA 1ZM9A 1M5PC 4ZP9A 2IYIA 1J2VA 2GFFA 2RSQA 4KO0B 3HVAA 2E9TA 1FA0A 2OLWA 1IKXB 2ZM6F 2OP5A 2PGCA 1ZAXA 3CCES 1HD0A 3DRRA 4MFBB 3VAKA 1W2BR 2IA0A 3T5KA 4BHQA 1WF0A 4EU0A 2C3UA 3IFEA 3KLEA 3UDCA 5B0BA 5EX3A 2VFUA 4QWCA 1JLGB 3RB6A 3MPWA 2R2RA 1FRXA 1X0PA 3RAQA 2W4DA 4OIXA 2EK1A 1EETA 3BEGB 5KFVA 4BWJA 1UEVA 5M2PA 3WX4A 5A8RA 2VFRA 4USHA 3F56A 3O2IA 3OVSA 3EZ5A 3DXSX 2KHDA 2W7OA 1CC8A 2E66A 7FD1A 2B7BB 3V6HA 4LFCF 1L3UA 1Q53A 2W9BB 3E8OA 1FDNA 4USIA 1S1VA 2A2CA 1L3SA 4ZVEA 3KNAA 2NS1B 3MEEA 2VUGA 4J9RA 4J9QA 3FFIB 2A18A 2I5JB 5J2MA 3V4MA 2OPSB 2YNHA 2YNIA 1NO8A 2CZ4A 1KOHA 5KFAA 1V3SA 3MM7B 4MH8A 1NK4A 4HEA9 3HHLD 1KFSA 1HHSA 3NBPB 1SC6A 4C7QA 4NLSA 4YR3A 4HL9A 1V9OA 3H5SA 4OZNA 1KVIA 3ZZUA 3K58A 1SJFA 2HFNA 3IXQA 4C0BA 5CD4H 2P6SA 3OHAA 4KHPF 4QIWD 1GX6A 1SJ3P 4YOEA 2OMOA 1VI7A 4QR1A 3OUYA 2YH0A 1IUJA 4IFVA 5B0DA 3HVTB 3OTOF 2HNDA 1X4HA 4XPEA 1N34F 4R5PB 2ZJQQ 2KZMA 1LK5A 2VA2A 4WTYA 2HHPA 2RDJA 1PC5A 1QAYA 4H54A 4ZPVR 3KLHA 1LWCA 4A8KA 1RK8A 1WHYA 3T1AA 3MOJB 2WOMA 1FD2A 3LAKA 4X4PA 5E7OB 4GC7A 3PRBA 1VIXA 1N36F 2XMJA 1JLFA 1UP1A 1KEKA 3CSKA 3NRBA 1N88A 2YQ3A 2DCUB 4ICLB 3CEDA 1XTZA 3R5DA 2XY6A 2MKIA 2Z4PA 4MKAA 1N5YB 2CJQA 3RRGA 3HMJG 3G6XA 5HMYA 4HKQA 4X4RA 1VIOA 1C1BB 2R8IA 4WE1B 1S1XA 3DLGA 1RT1B 1HQEA 2D1CA 2HGLA 2IM1A 2MSTA 4L3NA 4NOHA 2MQMA 4DFPA 3RBDA 3PKMA 4IG0B 4QQBA 4DL7A 5L1IA 3M8QB 4Y2IA 2B4UA 3VAHA 3BGUA 2FJWA 4K5RA 1SL2A 4I2QA 1KHVA 4FP9A 3OLBA 1RT4B 1WI8A 5F8IA 1TKZB 2DNNA 2M2BA 3DOKA 1ELOA 2W24A 2HHQA 2I38A 1BQNA 4OX9F 5J2PB 1HBMA 2Y1RI 4OX6A 2XI3A 1R8CA 2M88A 1Q81T 4IRCA 1MW7A 3NKYA 2B4VA 4CTAB 3M2RB 1DBDA 2QO3A 4WKYA 5IT9Y 3BDPA 1A7GE 3AH6A 4ZMMA 5HI7A 4NX9A 4AXJA 2L9DA 3MM9B 3BQ1A 5DDRC 2RE1A 4OI0A 1JX4A 4KTQA 3H2VE 3EPGA 3MR5A 2DH7A 5B0GA 4DF8A 3IAS9 4B9VA 1TFYA 1W25A 1TKXB 2W4CA 4A4JA 3H2LA 4HVZA 3H20A 1KTQA 4GO7X 2YTCA 3N79A 1OO0B 2PE8A 5M2RA 4AL7A 1S76D 3G8TA 3UPFA 2GHPA 2J8AA 4Q43A 5LSOA 1FKOA 1YJUA 3ZZRA 1VRTB 4WFNQ 2JRSA 3AJ2A 4DS4A 4R8UA 4N41A 2VPXB 2G13A 3SXLA 5C42A 1N0UA 3VALA 4IDKA 2WB4A 1PC4A 3FZ2A 3JAMY 1NH7A 3UDLA 2VV5A 2XGPA 3SDEB 2HVZA 5M2UA 3CJ4A 3H25A 4DQQA 4WFBQ 1T8EA 4ED2A 1X4AA 1YVFA 2L9NA 5DJBA 4IQMA 1QVGR 4Y2MA 2AJ1A 1A9NB 1HARA 2HQ3A 1IKWB 3RR7A 1D9FA 1QSLA 1WD6A 1X5OA 1F5AA 5C24B 1RTIA 2DR7A 3PX4A 4Z2XA 2LMIA 5G0RA 2PMZD 2VFTA 5CZVA 1OIAA 5D4NA 3KOAA 4O4RA 2QA4S 2N82B 4AL6A 2DNLA 2JOQA 1ZM3A 2IRXA 5F0WA 1BGXT 3P5TL 1VRUA 2KI2A 1DTQA 2WRMA 4M5DA 5KFSA 1UVJA 3NWGA 1PO6A 1KLMA 5KG3A 1SH2A 5F8MA 5KG7A 1GNKA 1TK0A 4ELUA 3PJXA 1PILA 4DSJA 1N6QA 4PUOB 3QJJA 4C8NA 2UUBF 5D3GA 2RJZA 3N9UC 4K5SA 2DR8A 3UFCX 4TQSA 4OZ1A 3ITHA 1HNIB 1WHWA 5LSLA 2D3OR 3AB4B 2AP6A 2PO4A 3PV8A 3H5XA 3M9OB 2OPPA 4CO1A 2IMOA 1SQEA 2PA3A 2FPHX 3C2PA 3FEXB 2K1RA 3A1YG 3ENVA 5L1LA 2AGQA 1RGVA 3BJYA 1HMVB 1F2GA 3UWTA 4ZCIA 1YJ9S 3CCQS 2XWXA 4GC6A 5DGBA