3F49S

Anion-triggered engineered subtilisin subt_bacam
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
266
structure length
266
Chain Sequence
AKCVSYGVAQIKAPALHSQGYTGSNVKVAVLASGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQASWIINGIEWAIANNMDVINMSLGSPSGSAALKAAVDKAVASGVVVVAAAGNSGTSGSSSTVSYPAKYPSVIAVGAVDSSNQRAPFSSVGPELDVMAPGVSICSTLPGGKYGALSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGDSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anion-triggered Engineered Subtilisin SUBT_BACAM
rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
molecule keywords Subtilisin BPN
total genus 91
structure length 266
sequence length 266
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3f49S00
1AF4A 1R0RE 4AKTA 3F49S 2ST1A 1GTL1 3DE7X 1DBIA 1GT91 1XF1A 1S02A 1BE8A 3DWEX 3DE5X 2GKOA 2SBTA 3VV2A 5B1DA 1V6CA 1SELA 4GI3A 4HX2A 3F7OA 1ST3A 3EE6A 1UBNA 3GT3A 3DYBA 5JXJA 1AU9A 3D43A 2XRMA 1ZVKA 1CNMA 4OMDA 1ST2A 2DP4E 4WOBA 1SCJA 1WSDA 1SUDA 2PWAA 2TECE 1BE6A 3D9QX 4JP8A 1KDYA 1SBTA 2Z58A 5ARCA 5I9SA 1SIBE 1TO2E 4MZDA 5SICE 3HJRA 1S2NA 1SUAA 4OV6B 4HVLA 3DE6X 3BGOS 1WVMA 1SUBA 1Y34E 1ZVJA 1TM3E 1SVNA 3ZXYA 2W2OA 2ID8A 1PEKE 4M1ZA 3WHIA 3DE3X 1TECE 1PJ8A 1WMEA 3GT4A 1OYVA 3DE0X 3EIFA 2XTJA 1JEAA 4J94A 1TM7E 2W2QA 4C3UA 5ARBA 1GA4A 5AQEA 1HT3A 1THMA 3LPDA 1Y48E 5B1EA 2SECE 5ARDA 3A3PA 1SPBS 1Y33E 4DJ5X 3GCWA 3DW3X 1GNVA 1EGQA 2WV7A 4H6WA 3BX1A 1YJAA 5AVKA 4WOCA 4CFYA 1AQNA 1SCNE 5FFNA 3DE4X 1Y3BE 2IY9A 2ZWOA 4NMXB 3ZXXA 1GCIA 1SIOA 1AV7A 1SCBA 3DDZX 3EDYA 2P4EA 2G4VA 5AMXA 2PMWB 3WQBA 1VSBA 1Y4AE 3LPAA 3TI7A 4B5LA 3I34X 2Z30A 4RYDA 1GA1A 2X8JA 3H42B 1BJRE 1PTKA 2PRKA 4NE9A 3VYVA 1LW6E 3UNXA 2W2PA 3TECE 4AKSA 1NLUA 3Q5GA 4OMCA 4ZARA 4DZTA 2W2NA 1PFGA 2Z57A 4LVOA 4DWWA 5FAXA 1CSEE 3A3NA 3LXUX 1T1EA 3QFHA 2WUWE 1WMFA 1KE2A 3VTAA 2ID4A 1BH6A 2E1PA 1SBNE 3DVSX 4H6VA 1KE1A 1P8JA 1C9JA 1EA7A 4CFZA 2Z2YA 2ZWPA 2ZRQA 1SUCA 2Z56A 4C3VA 4KG7A 1IAVA 2WUVA 1T1GA 3CO0S 3OSZA 4KPGA 3VV3A 1C9MA 2Z2ZA 1SUPA 2DUJA 1Q5PA 3AFGA 3I37X 1C9NA 1V5IA 4NE7A 1IC6A 1SCAA 3BPSA 3VSBA 1TK2A 3DW1X 4ZOQI 4K8RB 1SBCA 1GA6A 3Q40A 4H6XA 1SUEA 5AVJA 3CNQS 1Y9ZA 1MPTA 3QTLA 1SCDA 5JMOA 1S01A 2IXTA 4YN3A 1GTJ1 3DVQX 2HD4A 4KB5A 1DUIA 1Y4DE 2QTWB 1P7VA 3SICE 3F7MA 1TO1E 3DE1X 1C3LA 2WWTA 1SIUA 2SNIE 3GCXA 1A2QA 3TI9A 1NDQA 1Y3DE 3DE2X 4I0WB 1T1IA 1KDVA 3WIUA 3WIVA 1SN7A 1TM1E 1TMGE 1AVTA 1WMDA 1Y3FE 2SICE 2W2MA 1P7WA 3AJ8A 1OYOA 3PTLA 4LVNA 1KDZA 3VHQA 1SBHA 2B6NA 2PYZA 1SH7A 3LPCA 1TM5E 3A3OA 4CG0A 2DQKA 2V8BA 1OT5A 1Y1KE 1NDUA 1YJCA 1BFKA 1BFUA 1GTG1 5JXHA 3AJ9A 3PRKE 3T41A 4Z2AA 2PQ2A 3I2YX 1AH2A 3SQOA 1TM4E 3QMPA 3L1KA 5FBZA 3I30X 1MEEA 1AK9A 4BWGA 2Z2XA 4FONA 5K7SA 1Y3CE 2HPZA 1YU6A 1YJBA 1R6VA 5JXIA 1GNSA 3P5BA 1R64A 2PWBA 5CW1A 3DVRX 2X8JB 1SBIA 2PKCA 5JXGA
chains in the Genus database with same CATH superfamily
5EP4A 2Q3MA 2VUIB 2B0CA 1E61A 4MWEA 4CETA 5L6LB 3UY4A 1EBFA 5CVVA 4FLFA 4OXXA 2UU9B 3H9QA 2C7OA 2AX3A 2DWPA 1V6CA 5HDQA 3R0VA 1A2KC 1X7HA 2MU1A 1C1DA 3DL2A 5CIYA 1PU2A 2ZROA 3T5TA 3ZLTA 4C7VA 1M2EA 2C07A 1SC4A 2P3QA 4Y1RA 1IEQA 5EOVA 4DL9A 4HAVA 4BHTA 2E5WA 4MMYB 4YCJA 5B55A 2O1WA 4GU5A 1QQ5A 1VSUA 2ASVA 3KKQA 1GGFA 2ADOA 3IQXA 2Y66A 3G1WA 3MUNA 3MS2A 2D4HA 4ROSA 1CEXA 1ISIA 4IH9A 2Y6VA 1Q3KA 2WY2D 2XAAA 4ERNA 4QM6A 1LXCA 4R7TA 3S55A 3PK0A 2OBYA 2VF8A 1MC1A 1MNAA 1G1MA 3GT4A 1YB7A 4HH0A 3A6HA 2OXCA 3F67A 2OD7A 2FEXA 3HDHA 1BCRA 1VCNA 3PDJA 1NYTA 2FF7A 4B6EA 2SECE 5IDXA 5H83A 1BXGA 2R2AA 2YZNA 3E03A 2WB4A 2RGBA 3BERA 3GAZA 2G04A 3PIRA 3T99A 3TVDA 4NBLA 3OIGA 2I4OA 4TPKA 1KFBB 2KW5A 2YWHA 3C41J 1IN1A 4G3XA 1EGMB 1XVAA 4J0DA 1I9GA 3H0EA 1NI4B 2PQ6A 1GLGA 1V9SA 1C9YA 3KQPA 3LQ4A 3QUTA 4KQHA 2UYHA 2O5CA 2VPXA 4B84A 2LP4Y 4II3A 3UTCA 3WIBA 4AXXA 4PSKA 2UZ3A 2PBRA 2ABWA 3EFHA 1G2QA 2C3YA 1WTCA 2HO4A 4CYMA 1AMNA 1R16A 1NVMB 2GN0A 3AR9A 4I1UA 2PN1A 2E18A 4BB5A 5C4GB 2E2WA 3RVPA 1XRMA 3H2BA 3LY7A 3MQFA 1QGAA 1K5PA 2UVQA 1CZOA 1QO0D 2A35A 2WT4A 1BD4A 4DBZA 3K5HA 3OLZA 3FRHA 1IRXA 4F04A 4JYAB 1HLPA 4MPTA 3BK2A 5CLHA 2CLIB 4U6QA 2HEGA 4N8EA 2IYUA 5EKUA 4N7BA 1W0JD 4X60A 1QQAA 2GUWA 2HMSA 4H1TA 1XPOA 1WBBA 1Y8RA 2HIAA 3BFPA 3CXRA 2BGUA 2OCDA 2R1TB 4FD3A 4C14A 1VKNA 5CP8A 1MIHA 4WXYB 1ULHA 2D3TA 3OMLA 2GM3A 3PHCA 4Q9HA 2HXGA 4ISCA 1SXJB 2QTBA 1LH0A 1XRQA 1RTTA 1VYTA 4J1TC 2JFXA 1C2TA 1S4QA 2ACWA 4DLKA 4QC2A 4CM9D 5ELMA 1PCXA 5IDYA 1K8ZB 4YR7A 4CM4A 1ZESA 2I2WA 2ZWVA 4JLSA 4BECA 4W5QA 2FSSA 4GWGA 9MHTA 1YKGA 1T4MA 2AJCA 2HQOA 2J5XA 2XEDA 3DTVB 3DDSA 3G88A 3GC6A 3L1JA 3LMKA 4J90A 1YT5A 1Z8DA 4MLPA 4C7KA 4DA6A 1W36C 3FDXA 3DVLA 4X6UA 2VP6A 3L18A 3GFBA 3OZVA 4JB0A 1JQLB 4RSRA 5JEEA 4X6XA 5BSVA 2AGVA 3G0OA 2ZSKA 3D8RA 3I9V1 4H7IA 2GI4A 4WTOA 3NTVA 4MINA 3UHAA 3VPHA 4LV5B 5CJPA 1YHNA 4G4SO 5KYKA 4CM9A 3IAAA 2AI3A 4NPCA 2JEZA 3G8CA 1GYPA 4HVCA 1F6DA 3DONA 1UPXA 2FN9A 2KLBA 3BF7A 3I04A 4FDMA 4Q39A 2HU7A 3SXUB 3FYDA 1OAOA 1SBTA 1WZEA 5C8YF 3VPAA 5J2TF 1VKZA 2VF7A 4QU9A 2V9PA 2XE4A 2OVFA 2XITA 3G6WA 2IY8A 4FYXA 3P96A 2QAGB 3V32A 2MT9A 3K35A 3GUYA 1QH1A 5HCNA 4YCMA 3W4KA 5EXEA 1SU6A 2PSEA 3H87A 4WT7A 2D1RA 3CWCA 4LDPA 5DP1A 3VR4D 4O8ZA 4D2IA 2VDNB 2VDWA 2W8BA 5ALHA 1SZPA 3PC3A 3SWWA 4OO3A 4FNMA 4Q34A 5FBRB 4JT8A 2CE7A 1Y33E 2JKZA 5A0TA 4Q00A 5CB4F 3WNZA 4JEUA 1T3TA 4G8BA 4J6EA 1VTKA 3HA7A 4OQQA 2OG1A 5IFKA 4BVBA 3VZBA 3SZOA 1VL6A 3I2FA 1ODSA 5EKTA 1SZCA 2EP5A 2F8SA 3COSA 1J9ZA 4FOPA 1RQ2A 4DCCA 1P1BA 1F8FA 2YVLA 2AQKA 3VISA 4DEYA 2H17A 3NOOA 5A0FA 2DT5A 1O94D 4Q9AA 3HMQA 4GXQA 4QG3A 1Z83A 2HHHB 5JSKA 1O0CA 3V33A 2JI4A 2QG4A 3BREA 3WTCA 4Q6BA 4EFMA 3EXFB 4WINA 1KJIA 5TE9A 3WA6A 5A5DA 3V3TA 4MVJF 5L53A 2I1VB 5L3SA 3M4NA 1KERA 1V0JA 1FQOA 3MXOA 4QDXA 3TR0A 3CF0A 3RUIA 4H1WA 5IT0A 4QBTA 2VK4A 3II6X 4BFZA 3RT9A 4L5CA 2J9FA 3JVIA 2Z5LA 1S7GA 3DFIA 3QYFA 3LVFO 4L57A 4UBMA 3SEFA 3I9NA 4DMKA 5HHTA 1R6DA 1J0BA 3IUPA 1KY3A 2NVBA 2BTQB 5E6SB 2HLHA 1J8DA 4UM8B 4C4AA 4X6LA 4F5EA 4Q4AA 5EINA 4DMMA 4ZOQI 5EZYB 2ENWA 1LNZA 2O3RA 3HI6A 4HTAA 2ZT5A 3FFTA 1ACJA 3BXPA 1GNPA 2DR3A 2J48A 3L7OA 3QLUA 5CCEA 1WIWA 3WWEA 2YOHA 4P86A 1KGSA 1D0SA 2CYCA 2GQ0A 5IT4A 1ISFA 3P0JA 1W75A 2HEIA 3C24A 1R6TA 1VMDA 2BGLA 3ZNQA 3ZWBA 4MVJH 4BNDB 1X38A 4Y30A 1J09A 2WR8A 5EI5A 2BHRA 5FL7D 5KHLB 3SKVA 1DG1G 1PJAA 1G7RA 1WPQA 3BSFA 3MHPA 1L5ZA 4RJKA 4EYKA 5AKJA 3MWJA 4OSPA 4EVRA 1WB5A 2B5VA 2I78A 4ZZ1A 3REGA 4XYGA 4J0FA 2HRDA 4FYKA 3AT1A 3U3MA 5JE8A 1FB5A 4DSAA 3IV9A 3W7BA 3AUXA 1PE0A 3DNPA 4BLQA 1UP7A 1HE8B 4LDRA 4X94A 3RUPA 2QBYB 2HRCA 1MQAA 1XXHB 3AF5A 2GTPA 1EQ2A 1M0WA 5EMLA 3NEAA 3LCJA 5EN4A 3QU4A 3IOMA 5HX7A 5AKIA 4GPEA 4MMZB 4OUKX 2AG5A 4ZZ3A 3OUUA 2FSIA 3AR2A 2FRDC 2OGUA 4AZ3A 3ORHA 3IESA 1N3LA 5J59A 5J58A 1SKUA 2Q5JA 4MW6A 3BM5A 3GG2A 4A82A 5LFAA 1GFIA 1QM5A 5DT2A 1DC3A 1CVIA 4IHJA 4JUFA 1ZVKA 1R4ZA 3BRCA 1UPCA 3IALA 3PNKA 1SUDA 1RP7A 4HDNA 1KDYA 4M60A 4RO0A 3BWBA 1FX1A 1U9JA 3OQBA 1I6MA 4NV0A 3QUSA 5G4KB 1ODKA 2WIGA 3K32A 4MAAA 4UVGA 2P30A 2H48A 4X8LA 3TO5A 4RPCA 3RYFB 3VPDA 4ER5A 2R4UA 4M83A 2NUTB 4UEQA 2YMQA 3FVQA 1N2BA 4IJ5A 1GPYA 2GPNA 2NUPB 2VT2A 3HACA 5CTJA 4YYZA 1QOPB 1GU1A 5ED0A 1M6VA 4CL0A 3RTGA 2J4CA 2OBNA 3A31A 3KEMA 4ENRA 5LIRA 1LLUA 3HKBA 3AB8A 1PQUA 4NZNA 1I2MA 1PEAA 1W4BA 2R7MA 2DTEA 1YFZA 2G1JA 4IUDS 2QM3A 2PJZA 3E48A 5CUQA 4CDNA 2VSFA 1JA9A 4LCEA 4DDKA 2ZKLA 1K88A 1T0UA 2XMGA 3EY4A 3LDFA 3OIDA 2JCGA 4DYHA 3UNXA 4BKQA 5T41A 4NU0A 3D1LA 5FPPA 1KEPA 3GEMA 2XJ4A 1VGQA 2D4AA 2DLNA 4GMKA 3V4PB 3SSAA 5AUPB 1A8HA 1N5DA 1NVVQ 3N75A 4GKAA 4W9NC 4F71A 1K9VF 3OQHA 5IEJA 4WV3A 3IXMA 4M0EA 2EX0A 3IPAA 4ZCTA 4TROA 1TVCA 2JHAA 4KL8S 1A2BA 4MUNA 1KR5A 1E2GA 2IF0A 3PKIA 4RF3A 5SY9A 2X9NA 3FNQA 1P5HA 3RAJA 1YOVA 2IOHA 2VCYA 2HCRA 3KJFA 3VSDA 4AX4A 2GB4A 3EPPA 2XLCA 5E38A 4WSOA 4XYEA 2C29D 4W8GA 3L0IB 1ISHA 2HK8A 1U31A 4BO9A 4YIHA 1TYCA 1C81A 3OPYA 1JG7A 4MVJI 1KKLA 4QECA 4IY1A 2E87A 4KI0A 3RYTC 2C92A 3EC2A 3M2TA 3DF9A 5BV8A 3H5LA 4H0NA 1XKQA 1I2ZA 2XUDA 4NZOA 3GZJA 1F9AA 1NP6A 5CAEA 4BFCA 4ZDJA 1DX9A 1PAUA 1C3OA 2RK6A 1MB9A 1AZTA 1GG2A 4XH9B 5B1SA 3TOCA 4V0KA 3AVUA 3AF4A 4QRIA 1AHHA 3PTLA 1NOJA 2WOJA 5H3CA 3SVLA 3FOZA 4KNYA 5J5CA 3OCWA 2ZYGA 4B6FA 1BQ4A 1COWA 2CK3A 4XE5A 4DRYA 1IZ9A 1T3LA 2FPGB 1BFUA 3AKDA 1XD2B 2VPTA 1DC7A 1TLFA 1Y81A 4PNHA 1BDHA 4X1KB 2QLMA 2NSLA 3R3ZA 2AMVA 2RGEA 2NWQA 2HQBA 4XLTA 4MV5A 3S8MA 2QN8A 5DYWA 7AT1A 4PG7A 1IN4A 4Q9LA 2WIJA 3QF4B 1YVDA 1ZH8A 1DPFA 2HUPA 5CW1A 3DVRX 2VBCA 3V2HA 2GRJA 4RHTA 5DEOA 3A6EA 4Q93A 1NX9A 4N40A 4Q7EA 3AEKA 2Q07A 1Q1NA 4RZXA 3ICPA 2MSCB 1RHQA 1F51E 1JAYA 1YZLA 1C8LA 1GGEA 3CRZA 3F6BX 4XQ9A 2MMGA 2E4UA 4KFUA 3DYVA 1CUJA 1U4OA 4NG5A 2FTKE 2FEWB 1R66A 3FUUA 4HRAA 1JXMA 4HZGA 1EUCB 2G0TA 4DDVA 4Q5IA 1PR1A 2C0CA 3CTPA 4X90A 3KYBA 4FEAA 1I80A 4ZOLB 1C0EA 5J2UB 3KKOA 5CTAA 1VBFA 2INGX 3UK2A 2TRSB 2CDBA 3DM5A 1UMDB 3FOWA 1XZAA 3SQLA 3JARB 4PC7A 5LQAA 4IOMA 2XW6A 4ERXA 1TECE 1YUMA 5LD2B 2QD2A 4QDKA 3E4DA 4CXMA 2YXNA 2JFGA 4HDSA 4IV0A 2YJ6A 3AJDA 4BLSA 1V1JA 4LX0A 1BE1A 3HC7A 3GVCA 4IQ8A 5L9AA 4ACBA 3OPVA 4N8SA 1RBQA 4OHZA 3TN7A 4A91A 4NBRA 4US0R 1SKMA 4GECA 3V34A 1B74A 1OCEA 4QLBA 5HGJA 3D81A 3I34X 3U44A 1GKUB 4PG4A 1X19A 1XJ5A 2XECA 1RLJA 1QCZA 2HXYA 4L2IB 1BJRE 3CRNA 4C89A 3C8MA 1BHJA 3OIVA 5FOSA 2WG0A 3GU3A 3VJKA 1OFUX 3BE6A 1UXJA 4Q9JA 2H2WA 3KT8A 4JOBA 4DWWA 1CD5A 4D79A 5KNCH 2PBFA 2UV8A 1F2VA 4XCQA 1KEVA 3UOAB 4OI1A 5DNUA 1JLKA 3I6BA 3EZXA 1WHSB 3GRUA 4BFXA 2DC1A 3TK1A 4U7TB 1JQEA 5SYMA 1GCAA 1JYFA 4RZUA 3BWXA 3F46A 1NBME 3C87A 5CPFA 3MWGA 2ERCA 3G5AA 2AR7A 2B7LA 3BPSA 2GJSA 2DU8A 5K8LA 3B1KA 1GZUA 1TYZA 2AOVA 4UM9B 1WHTA 1MV5A 4IGIA 5LWQA 2OPHA 2H7YA 1ADYA 1C3EA 2JJ1A 4XR9A 1EK5A 4CIXA 3HKCA 5BORA 1QF6A 1P17A 2COEA 2WSBA 2DH6A 2WMDA 3WOVA 1EIZA 2Y99A 2HMWA 2BSQA 4YCDA 1XZHA 4EPVA 4HH1A 2WT9A 4BAZA 1ADBA 2H16A 4ES6A 2HRBA 3FYUA 3H84A 4YP0A 1YF3A 2G40A 3U49A 4UVDA 1A8UA 1D6NA 3H0CA 3THYA 4D3YA 2DFNA 3Q72A 3PFFA 4XDZA 3OURA 4Z53A 4OXIA 2L69A 1TM2A 3D3WA 3H2YA 3KJGA 3EIHA 3ONDA 1K98A 3AM4A 4O8CA 3VZRA 1F2TA 4DA0A 1LDGA 2NIPA 5LLSA 4EEZA 2H4HA 3HXKA 2JRCA 3INGA 4FEEA 3PUVA 4KFTA 4C3OB 4J0CA 5BV7A 3U5TA 5GONB 3I4LA 4EPXA 1GO2A 2HU8A 3I6ZA 2O8FB 4B6RA 1H42A 5G41A 5HPYB 4B3RB 2QX8A 4LNUA 3AVVA 1QIDA 2YWGA 3T1QA 2FF5A 2C4TA 2QJOA 5FLXA 5CFPA 1YS7A 2PO5A 4DHWA 5ENZA 5BOSA 5CCXA 2J3MA 3DDUA 3IEPA 5K9ZA 4DLAA 3VU0A 3KSBC 1Q7RA 1GZHB 4C9BA 3OZIA 4MR7A 3UKOA 2MMCA 2QUHA 3VPCA 4QXOA 2ZBQA 2JGKA 1EA5A 1P0QA 1QHEA 2NVWA 2OTCA 3JALB 4MEJA 2P4HX 4LIPD 3RIMA 2UXCB 4G81A 3UYLA 4HMQA 3OEYA 3WQRA 2P9FA 4R0NA 3N58A 3TQIA 3AI1A 3L5OA 3CRVA 3DWFA 1JAIA 5JJ5A 1A77A 1C7QA 1YRQA 4PN3A 5I01A 4M88A 4ZHQB 3Q2IA 2IEAA 1GA4A 4NF2A 1M34E 4PICA 2R8YA 4Z9BA 2BI7A 1X1BA 3SMQA 4KVAA 1WEKA 1IM2A 8GPBA 5K05A 4XLZA 4PZDA 3C7CB 4G41A 5D2CA 5EMMA 1L5KA 3NBUA 1KO7A 1BSVA 1TKRA 2FX2A 2G83A 1TF5A 3L1HA 4PNZA 1W0KA 2IITA 4JHXA 5EKSA 3S99A 1LI5A 3EDYA 4F8JA 4YRSA 1QRUA 3GJRA 2WF5A 2WF6A 3TAUA 3KOOA 2FG6C 1FSZA 1RXEA 1JS1X 5TV2A 2IGTA 1G5HA 2NVOA 1O8CA 3LK7A 2RHWA 2R5NA 3ND5A 3X2FA 3GK3A 4D9JA 3ZDYB 4NEGA 4WEQA 4Y7DA 4GX0A 3T4EA 3FBGA 3COZA 3STXA 2JLSA 3CF4G 3PEUA 4RVSA 3O3CA 1GARA 2L2QA 4BB6A 4N5IX 1PBNA 2EW1A 2QTCA 1YACA 2YN0A 1SU8A 3V97A 2FP4A 4GO1A 1IUOA 1XAGA 1X8XA 4CL2A 4UUQA 1I4EB 3PQ3A 3FFBA 3HPQA 3AF0A 8AT1A 5T7BA 3GLFA 1RC8A 2Q6LA 1ZINA 1TD9A 2NU8A 4TLMB 3U7RA 1T5IA 1NM5A 2V7TA 2J3EA 2X9QA 4NC9A 4UCXA 1MORA 3G9UA 5CCDA 1G5IA 1FRZA 3C3KA 3HUEA 2IYSA 4Z4CA 4NY1A 3HJBA 2OQIA 4IIJF 3EZLA 3G1TA 4PYJA 1P60A 1YZFA 1P72A 2G0NA 4KVZA 5L4SA 4I6GA 4MUJA 5T4BA 3M9LA 3V1KA 1E1CA 3CH4B 5JECA 2EJUA 2XUOA 5EIBD 3SP1A 4IXMA 3UH0A 3X44A 4NICA 1W49A 4OATA 4XIFA 4QQRA 4JC5A 2VEDA 2AOWA 1V96A 2EWVA 2YZ2A 1OPXA 2J41A 5GOTA 1ID1A 1ZS9A 4E5DA 3PJEA 2Q8QA 4K87A 4HNGA 1YASA 2HBRA 3E3AA 4HYYA 1U2SA 4TYMA 5C0OE 3TPFA 3ETNA 4CQLB 4EG7A 4W82A 2XUGA 3L8HA 3L7KA 5K4HA 2Q50A 3T41A 2OZPA 4F93B 1CK4A 3RU3A 3NIBA 3SZRA 4BLWA 1V47A 1JVSA 1W46A 5T8KA 4OHUA 1CJTC 3T1YB 4ZEWA 3QVUA 5EJ7A 1DARA 3LBNA 3AUTA 2GRAA 3D7NA 1KFEB 4QU8A 1PJSA 1NUTA 3SYTA 2NAFA 3OFND 5FTKA 1GRNA 3VDXA 1NQXA 2GGSA 4D42A 4BRSA 3FTFA 5ALGA 2RBKA 3H2JA 1AV6A 1DXQA 4PAGA 1X94A 4M7PA 4D92A 1ZHOA 2VTBB 1YRBA 3INNA 1H1TA 4MUFA 4EUNA 2PZ8A 3EOBI 5TQ2B 3ETEA 2RKOA 3NTUA 2QNIA 1EFRD 1OPRA 1T5LA 4HDAA 5JMOA 2WU3A 2GBLA 4MUGA 4RETA 2P5TB 1Y89A 5IK2A 4EY4A 1WUKS 3X3HA 3ZV3A 2WNIA 3MTQA 3OEHA 3HRKA 1Q0UA 2HGSA 1SB9A 1N8TA 1SWWA 1YRYE 1EVZA 3M1AA 2FDCA 4QU0A 2XH8A 1JFLA 4IGAA 4KNVA 1MABB 4F97A 1RI5A 2ZDGA 4INJA 4BLPA 5CDUA 4GLOA 1MA3A 1DNPA 2IU4A 4X24A 5GJCA 2IYPA 3OY2A 4G0MA 1A9XB 2J7KA 2JIDA 4OJNA 3UJ7A 2V55B 4TMVA 4Q7LA 1LFAA 4AYTA 1F1JA 3FHLA 4UD6A 2N3ZA 3JU3A 3LT4A 5DCLA 1F5SA 3GMIA 3ROXA 1J90A 1SRRA 4JU8A 5B2ZA 1YQGA 2XDYA 1AHPA 2ZBDA 1J2JA 3Q7PA 3WGVA 1OX4A 1SC6A 2F1HA 3LQ1A 1PP4A 3OU7A 5HXAA 2H3EA 2GBGA 4QUJA 1L7XA 3ZU6A 1UMCB 4MRMA 1NYLA 4OB7A 4TTTS 2AH5A 1IIRA 3VX4A 1OJ7A 1BGWA 2WVAA 1CS4C 4RZ2A 2GFIA 3DT6A 1TIPA 1EWRA 1Y7TA 4G09A 2Z57A 4ER3A 5AJVB 3VKGA 3IBYA 3IJRA 4WKCA 3G02A 4AF8A 2F8LA 2XYGA 5NLLA 2BDUA 3GEPA 1P9WA 1CS0B 1QYDA 3KKMA 3RS9A 2Z9CA 1UKAA 5ALPA 3ZEIA 4ETMA 2AWNA 4JI0B 3HSKA 4WFKA 2R62A 3WRXC 2WJYA 1E0JA 2V97A 1V16B 1UDCA 1T5TA 5L3QB 1Z26A 3FUXA 3D02A 2P67A 1GHTA 3KB8A 2AKAB 4EMTA 4Z3KA 1JQ5A 1WNFA 3QBTA 2X3YA 4UE3S 2F3QA 2GF2A 5CDSA 4K9RA 4S12A 2BDTA 3JY6A 1OY1A 2PX6A 2CL0X 3KHSA 2NO5A 3U39A 1E4YA 3A7DA 3HVUA 1NW3A 2IX9A 1DAFA 2O7VA 2XYQA 3I9OA 3JR7A 3ETHA 3JTMA 4Q9IA 2I6XA 4ZVNA 3L0SA 4PWZA 1KNQA 5DGTA 2XA2A 1J2EA 2FK7A 2SKDA 1VMKA 1JB1A 3F7MA 2NZVG 1U8AA 4UOZA 5CG2A 3NAGA 4RPJA 1R3DA 1B6TA 1HG1A 4LGCA 3B1FA 1DOZA 3RKSA 1UJ6A 2BFBB 2BRUA 2YXEA 3JVEA 4YMTA 3SPXA 3VJLA 3IAXA 3UW3A 4BGUA 1DTWB 2H1IA 1XZJA 4JL8A 5LLTA 3HXPA 3CVXA 5HA5A 3MIIA 3I2IA 2ZSEA 4JEHA 4NBTA 3UQYS 3FPJA 2AEMA 3PNSA 1KOLA 4GAEA 3D7SA 1AKEA 1TA9A 1RHRA 1K68A 4QEZA 2VJMB 1XEWX 2GA9A 3IPRA 5KHOC 2NXNA 4E15A 4QVIA 1UDAA 4MQ5A 1R64A 4GE3A 1ACLA 3WC4A 3GLQA 3A05A 4AY4A 4N7JA 4NX2A 1BTOA 4FNAA 3R8XA 4B7CA 1H4TA 1VBMA 5FEUA 5I9NA 1OLUB 5EZSA 4KIJA 1VSVA 4TLDA 2FRXA 3L7CA 5JZ9A 1OB2A 3PYMA 3A6PC 1YIDA 1F8YA 3Q9SA 1HR0B 4RVCA 3N76A 2A59A 2IXFA 2C0PA 3KKNA 5LP6C 2HTFA 1J97A 4X0EA 3WR5A 2I3GA 2BEVB 1X1QA 1QXSA 2PCJA 1J24A 1QHNA 2I33A 2XHZA 3CE9A 3FCXA 3O2SB 3OX4A 4K9LA 5FQOA 4EELA 4WDQA 3EAQA 2OHGA 2R8ZA 4JAVC 1MGOA 3MCWA 5K20A 5FUXA 3L7MA 3T7JA 2C94A 3PGVA 3QHQA 5CLGA 3W78A 1JU9A 1UWCA 4CM8A 3ADKA 4GE0A 2EEZA 4KH0A 4IVPA 1YR7A 3B12A 1IZZA 5C1PA 1WMBA 4RLFA 4A8JB 3CLSC 2XY4A 2LKDA 2XVXA 3A14A 4MV8A 5BRNA 4GMGA 2OK7A 3CH5A 3Q1KA 4RVDA 1JFVA 4MW2A 1VQ1A 3H65A 2H52A 2M98A 2ZS9A 4S1VA 3BMNA 1I5OA 1WOMA 3CW2A 2ZRDA 4FXPA 4M8KA 4OKIA 5J5VA 2H2GA 1CIJA 1UXHA 4LXHA 1BVHA 4PYQA 4E5UA 4CM5A 2OLKA 2ZRCA 1QKJA 3PFNA 3J81A 4LBZA 3KQHA 2FUCA 3ADOA 3FUVA 5FORA 3TZKA 4K9PA 3DHNA 3WLFA 3G9TA 4QJ4A 3DZ8A 2O3QA 1ZUNA 2GDJA 4WI1A 1K7FB 1PTKA 3TTYA 3WQSB 2NLOA 4WAUA 1GAJA 3MBKA 3Q5GA 2HDOA 4O5AA 4FFOA 5HJ7A 5F7XA 4IS2A 1Y7PA 4C0BA 3QVSA 4BO4A 3IUBA 5CX1A 5I7SA 2O19A 3JV7A 3HK2A 4YX9A 3TKLA 1ONOA 1N33B 4N0DA 4UEWA 1MVLA 5ALQA 1ANKA 3WXBA 5I51A 1XD8A 1ATZA 1OI4A 3VZPA 2EF0A 4DDUA 1PR6A 2F43A 2ZCVA 5SZJA 3U4CA 2WM8A 4A6EA 1I51A 4G4IA 1GKKA 5K09A 3EFOB 4V0MA 1ORIA 4QJ3A 4KO3S 1MR3F 4L1KA 4FUTA 3KAPA 5L4NA 2CVZA 1K97A 1N2SA 4XJVA 2P4UA 5HP4A 1RQGA 3O5AA 1Y9ZA 4LY6A 1I33A 1SCDA 3M5DA 1W5EA 1UC9A 2PUVA 3NHRA 3REFA 3U31A 4ZQFA 1A9OA 3MEQA 2YZ7A 2J59A 1RYNA 4PBRA 3DWIA 1T2UA 1ZH0A 4ZYXA 2YFHA 3I52A 1PJ2A 1RQXA 4IXNA 4IQ4A 4JLVA 3TZEA 4M7RA 1VHDA 3VQTA 2E9SA 1OGJA 3AR6A 3NGLA 3AJ8A 3VTFA 4MHSA 4W7SA 1QB7A 1TM5E 2OKGA 3Q3IA 4PIMA 3FF4A 3WSWA 2XOEA 4FW8A 4K40A 2UXDB 3T34A 3N6RA 2QP4A 3UXYA 4RFSB 4JB2A 3J7TA 2AK2A 4HJXA 3TE7A 5DBFA 1K5DA 1E7QA 1MO6A 1C3JA 1USUA 3W9YA 2IQIA 3D7KA 3E22B 4OQLA 4V0ME 5DI9A 4ZALA 4E7PA 3FAZA 4JHLA 2HA2A 2O07A 3QI2A 3PPVA 4UULA 2OZVA 2AN3A 3CW9A 3MOGA 3AR7A 5JCJA 1F6WA 1U2GA 1SUFA 1M75A 2PKQO 1VI2A 2Q0HA 4UDOA 4NXNB 2V5VA 1E1DA 1TPYA 1YA4A 3E22A 4W7IA 1XF1A 3PF9A 5IMBA 2HSDA 5DNDA 3TKYA 3M1YA 5C8ZA 4LQDA 3HU3A 1RCUA 2C88A 3A36A 3RS8A 3HZZA 1GQOA 1L5LA 4Z9FA 3BXGA 5TS3A 3HDJA 2NPOA 4TSKA 1M0EA 2AE2A 1YHYA 4FN4A 4PBSA 3T9BA 1G21B 1O87A 3EYWA 4OUDB 1YNSA 1BX0A 3T7TA 4M0KA 1NX6A 1YB5A 3GO4A 3PVSA 2PAFA 4G8DA 4JP2A 2OHVA 4XM2A 2VR1A 1YCDA 1S6YA 1T34A 1OC4A 1E4EA 2Z8YM 1TCUA 1WMEA 2HIMA 2QJWA 3N53A 4GYYA 4RF4A 3VU1A 1GKLA 5CLIA 4AJPA 5IF3A 3PNPA 1II9A 3JD2A 3PB3A 3UG6A 1Y8QB 1L4YA 2FB9A 3P94A 4P31A 2P6PA 1IWOA 5AVVA 2JEYA 1CDDA 5HZGA 2I7CA 2PQMA 5COQA 4I3HA 2WIFA 3EXG2 2F43B 3GAFA 4FNOA 1N1DA 1M2JA 3EZ9A 4OM7A 1RHKA 4EYGA 2F9MA 2YJ3A 2R6DA 5AUOB 2IE0A 2XUHA 4LOJA 4X9XA 4KNWA 2EWWA 2V0NA 2ZJOA 3BWVA 2DUNA 1J5XA 3W5DA 2J9ZB 1V1RA 4M89A 1HDIA 3P9NA 3IP9A 4B4UA 3EF0A 3EQ7A 2PE5A 5ALXA 2I7DA 4RTLA 4W1QA 4ZT6A 4DZTA 4X20B 3U1VA 2CFRA 3OH8A 1Z0DA 2GESA 3EARA 3KJHA 1PZNA 5DSZA 2ZRKA 1G291 1V8FA 3NEPX 3TSCA 1N5IA 3LRPA 4FUQA 4FZ3A 5KU7A 3ACCA 1CUAA 3CT4A 3KO8A 3DT8A 1W35A 4KQ6A 4P3NA 4TRMA 1H05A 4KQFA 1U8TA 2CUNA 4LQCA 4LYHA 4QT0A 2C7PA 2R1UA 1EH5A 2OD2A 2OAQ1 1V4NA 2QG9A 1QGUA 3H5VA 1MMFB 5TPWA 3D8NA 5KTKA 5JW6A 1QVRA 1ZUIA 1VL0A 3ESZA 4EJSA 3THXB 3F4BA 5K3EA 1E6MA 4A8JA 1XB2A 3KTFA 4GX5A 4N5DA 4RSHA 5FBLB 3WNCA 4LISA 4AICA 1DPGA 1H2AS 2VAMA 4RTPA 1UMBB 3L0YA 1LBHA 2GJKA 2G25A 1ZH4A 2HD4A 1HH4A 4NESA 1HDYA 2P40A 1VMIA 4TWIA 4V1CA 1GNTA 1T8SA 5DWVA 3WWOA 4DHEA 1ZLYA 1XTVA 3AI7A 5ABPA 1PG5A 3U7QB 1Z17A 2GAOA 3FFWA 1ONPA 2IGBA 3OHMA 4Q15A 5DYGA 4MROA 1ZU4A 1G9XA 1SR8A 3HR7A 2GFHA 3C6MA 5BVHB 2WTEA 2Y1OA 3EJ6A 4DQUA 3I72A 1R0YA 2JIRA 3ZJYA 4C6TA 2P9QA 1FU8A 1YFKA 2WUDA 4OMUA 2BGMA 1JAXA 5ALOA 5A06A 5LP6F 2P65A 3TRIA 1MW9X 4F11A 3VDMA 3NVKI 3AX6A 4C08A 2Q45A 2GHIA 4YP5A 1DOHA 5EJMA 1K6IA 3ZE0B 3YASA 2ZS7A 3K20A 1ORHA 1KO8A 2IZOA 4JFAA 3DMGA 3M5PA 2C42A 5HM8A 1IY8A 1FRNA 2PZMA 3R5JA 2X42A 5EL0A 5CFZA 2IFTA 2HRZA 5L51A 1ILEA 2NYVA 2PSJA 5KJFA 5L3VA 3NMUF 1IHPA 1T24A 3FKJA 3R23A 1WSDA 4GGOA 5JVDB 5BW5A 2C5FA 1EAMA 3K4PA 5JSUA 4KRYA 1FDVA 3WFZA 1WF6A 2O6HA 3ROQA 3RSOA 3Q7EA 4WZ6A 2NACA 3HZHA 4MDEA 4H77A 4XM1A 3DG9A 1P4RA 3ZDFA 4RJTA 1O9GA 5K8IA 3B2NA 4WASA 2BP7B 3FTCA 4YP1A 4M1ZA 2O8CA 5CLLA 4K5QA 4HQRA 3RVOA 1Z62A 4HUJA 1CP3A 2ISSD 1VG1A 3B1ZA 3FPAA 3QUAA 2NNLD 4K86A 3WNDA 2F9FA 1E20A 4MVWA 4UHFA 4J76A 1PVOA 1NW6A 5IAJA 4FYYA 3CUKA 4LF6B 1P91A 4MYCA 3WGMA 1EFVA 3DEAA 5HIJA 2FSGA 4NR0A 4QYMA 1QZ3A 2J3KA 1MIOA 3ABOB 4R4JA 3IUMA 4KIGA 3C45A 3NG1A 4P33A 1EWTA 1V1MA 2CLLB 4XCXA 4A2PA 3GPLA 2RGRA 1MFPA 1P5FA 3GA5A 4RA6B 4KXUA 1VKHA 4QLOA 4HZUA 4PO8A 1SHLA 1L5QA 2OCAA 3KFVA 2YV4A 4I4CA 4AN0A 4OHVA 4P5PA 3H5IA 3L6BA 4F6LA 4D1YA 1USGA 3I6IA 5K0GA 1A8PA 1RPTA 2BGRA 3IP6A 1T2AA 4CV0A 4QG7A 3FGZA 3EBOA 3PHJA 3UWMA 2V6GA 4EKIA 1C1XA 1ZD2P 5IXJA 2XCOA 3ZD6A 1UEIA 1OX4B 1YULA 3C5WP 3FSJX 2GN4A 3C6KA 1RIFA 1W48A 3AILA 4XIIA 5ERGB 3UA4A 3WFJA 4AL4A 3GLVA 3UN1A 1G64A 3K1YA 4JI6B 3GFRA 3M9XA 3N07A 4HQNA 4JLUA 3GPBA 2YASA 4LF7B 3WQQA 4WESA 5KQMA 1NJGA 2C5SA 3OZGA 5DBHX 3FNFA 1RPZA 1JJIA 3T54A 5B6JA 3ROTA 5IXSA 1MABA 2UYOA 3D3JA 1PL6A 1BHSA 2QY9A 2Q9BA 3GF4A 3H8JA 4HGQA 4IVNA 3W04A 1S3IA 2O2SA 4EYSA 1UWKA 5J4KA 4WN9B 2BBOA 2P62A 2VLIA 2FJUA 2HKIA 2IHBA 4D8XA 4M22A 3CVUA 1C30A 2M32A 1AO3A 1U3FA 5A5EA 5BQFA 3VHQA 4XXHA 3N2GA 3LQKA 1UINA 3ZHZA 4TTAA 3EOAI 5DYIA 1Y7IA 1Q14A 1YIOA 4O4IA 3VU9B 3D1VA 4Z4FA 4JSYA 1UJCA 1A2OA 2IXDA 4ZPXA 3PHGA 2PMCA 1AQIA 3HKDA 1KYYA 3GI1A 5EWLA 4HI0E 4MUMA 3VNUA 5BN1A 1HZZA 5FBZA 3D2CA 3I30X 4H4DA 4M8SA 5E2BA 3DMDA 4Q3BA 1OFHA 4MB0A 2QKYA 1DRVA 2EP8A 1T3HA 1WV1A 3FMIA 2F1RA 4KQEA 1SKAA 5A02A 2GA8A 4CLDA 1SHKA 4YO8A 3D0QA 1XK7A 1F6BA 3AY6A 2H00A 2IZ6A 3GGSA 3HB7A 3OC0A 2P79A 2HHJA 4DJEC 4F92B 1XZKA 3G85A 2PUBA 1YR9A 1NZFA 2IKSA 4L5YA 3ES9A 2ZIEA 2AOUB 5A9TA 3WLTA 1UBNA 4I1RA 3S4YA 3UWKA 4IHKA 4D4LA 1Z36A 1SZDA 1R9JA 5KZMB 2R68A 2Q1YA 3UAXA 3H4TA 1NULA 2G0AA 2RHDA 3LO8A 4JJ7A 4YS6A 3W2HA 4HDRA 3ZU3A 2GJAA 3GLGA 1DKMA 1TTTA 3RSGA 2F3RA 2B7CA 4P82A 4RHCA 5LYJA 4JI5B 5KKCA 2GEVA 4JJKA 1TJ3A 3A1DA 5KKAA 3O1IC 3W8DA 2B36A 4CLRA 5KOJA 5LUAA 3RQIA 4NJMB 1TUIA 1VYHA 3IOCA 3PL1A 2JH3A 1W73A 1LBQA 3RTCA 4C3UA 1JVBA 4TSRA 5DM70 3N9IA 5JV5A 3DBRB 2EKBA 1P3JA 1S9DA 3X1JA 1IPFA 4F2GA 3IUJA 2BGWA 1F2UB 1GZ7A 2QM8A 2W4QA 3LYAA 4MVCA 4WK6A 3TMAA 4M1MA 2X9VA 2HSEA 3TRDA 3MT0A 3TTSA 3WKBA 1UK8A 2V74B 4Y6GB 3NTRA 5ALMA 3NGXA 4MPDA 3HXOA 3UCFA 2G17A 1U0OC 4R8KA 4Q0MA 2GILA 3LNCA 4KMSA 3QOWA 2WJHA 3WQBA 2HMVA 4HFNA 3PUIA 4Q21A 2J1LA 2OZKA 4L4SA 2EJCA 1HLGA 2IOYA 4HGPA 4C4ZA 5KX5F 1USIA 3TOSA 4LZZA 3GWGA 3W3AH 2AC2A 3SI7A 2GX6A 1FXSA 1GR1A 2X23A 4LQ4A 4RESA 2A8YA 5FDFA 3VO1A 3TG8A 3TZCA 5C3UA 3A26A 3HYCA 1BH6A 2VPIA 2CLKB 3K1TA 4E0BA 4HMOA 3QEAZ 2O3TA 1E1MA 1JKMA 4JVNA 1IG3A 2P2CA 1VA5A 3STYA 4ARCA 2NZ8A 3IPCA 3C7DB 1NN5A 4QA9A 3AEUB 3IJ5A 2GUGA 4FQ8A 1A9RA 2XYHA 2EYQA 2YW9A 2Q3CA 1EDOA 1UM9B 2Z5VA 1YS4A 1ORRA 3OQ6A 1MKYA 3IA7A 2VUUA 4G1BA 4U7DA 4TL7A 4PZ0A 4N3CA 2BI8A 2QV7A 2IVFA 1KK1A 3MD0A 3ANTA 3JZFA 1U81A 4OYYA 4RKEA 4ZYZA 1R5NA 1XXHE 3ZHSA 4U02A 3EBPA 4YA6A 1G8MA 4BKOA 4YUAA 1YA6A 4WHMA 2FSVC 4TKUA 4YMSA 4AJEA 3EG9A 4FPXA 1O1YA 1UWLA 1P19A 3L0BA 2P0EA 3V8PA 5EPUA 2ZJZA 5FTNA 4B4DA 3PLAE 4QOJA 1I4WA 3AIIA 2AVDA 4ROTA 3C3JA 1GZSA 2VVTA 2RSLA 2DHRA 3MJ4A 1CV2A 1PJZA 2V7EA 4U3JA 2CV0A 1QK3A 1X9GA 2IOQA 3BB4A 5FWYB 5G1NA 1XPUA 3M0EA 1CDEA 1S8OA 3T3EA 1LPAB 1EX1A 1BDMA 1YZTA 3HB4X 3NKLA 3W2IA 5AVRA 4RKYA 1JIIA 2NXJA 5HF6A 4EDFA 1FDRA 4XCVA 3RFFA 1UZAA 2VHZA 2WVGA 3R44A 1O7JA 3U6KA 4HP8A 4EA9A 1SWVA 3HJAA 2BCJQ 4GZ5A 2VJAA 3B85A 1KU0A 4QAQA 1X0VA 3P9CA 4Y98A 3ZHVA 3EVCA 3QEMA 3L8YA 4BAGA 4MUAA 1J7KA 1YCGA 4I9NA 4F6RA 1VL8A 2VUSA 4EFNA 5I6DA 2WFAA 2P6MA 2SBTA 3CX3A 2K2QB 3NJRA 1BU5A 3LGXA 3Q2KA 4OQDA 3L1VA 4L0MA 4EZIA 4P4UA 4KGZA 3RSCA 5BSKA 4OD0A 3AZOA 2COUA 1Z6YA 2WKQA 3KHTA 5JS8A 2A4MA 4UUMA 3HUUA 1TUGA 4B79A 1DJPA 1OF1A 4MYDA 4MS1A 1QFYA 5TQVA 3HZRA 4KKXB 1JSRA 1V48A 2NU6A 4W8HA 3DLCA 3MVEA 1EHCA 3AWIA 3CUVA 1S9HA 5AYVA 1DGQA 4R9RA 5ALKA 4TWZA 5E0OA 5AVSA 2JFZA 4E2WA 3CX4A 2QU7A 1JR3E 3E7DA 1YJ8A 1BOOA 2QZ4A 1KZ6A 2HSGA 2BFFA 3DMYA 3B53X 2B4RO 1A5ZA 2REOA 2B8WA 3EF1A 3L9WA 1TRHA 2WILA 4Z0PA 4XIGS 4DABA 1NKVA 3MERA 4Y9TA 5AI9A 1IJFA 1DRWA 3I2HA 4Q4CA 2FJPA 4BY9E 1KI2A 2O0MA 3LF1A 3LFUA 3OLQA 2UZIR 5CNIA 2RJOA 3AR8A 2J0UB 1PSDA 2E49A 1HT1E 5A3QA 1XTRA 1DEKA 3BA6A 1V8DA 5FOWA 2AI2A 2CXPA 1UP6A 4GWLA 2Y05A 4TM7A 2GPJA 3KTAA 3RVBA 5KYYB 1L1RA 1Y4UA 4Q3EA 2AXEA 3NBXX 2RCNA 3FPEA 5H7XA 1Q1ZA 1BXRB 1SQSA 2FZGA 2J4FA 4V0SA 3ULKA 4BFUA 3Q8KA 1NRXA 4O2BB 2QGZA 1RAHA 2L19A 4Q3DA 4GMXA 1ZQ9A 4XD7D 1RWNA 4BC0A 4EQ6B 3RU2A 1OQAA 1USWA 2CFOA 2DX7A 1C9JA 3K15A 4N8DA 4KMMA 1BDBA 4MR9B 3T52A 1VHJA 1E4VA 3IIKA 3USES 2C7BA 3STUA 4KREA 1JG6A 4M55A 2FY8A 3AKZA 3TZBA 5K8JB 3K0KA 4B43A 5IVKA 9LDTA 3BMQA 1L8LA 2GJ8A 2QZSA 6Q21A 4CEHB 2Y67A 4NNPA 2C9BA 3TEFA 4BLUA 2I4IA 1XZMA 2M6RA 2VYQA 2YYAA 3BDIA 3DBRA 3OT1A 3JVUA 4V24A 4TS3A 1D07A 1ECGA 3Q88A 2G70A 2VA8A 1DT3A 3DOCA 3IULA 4L72A 2ZJ0A 2VDPB 1NN3A 2ZVQX 1DIOB 1JHYA 3GLTA 4JB3A 4TUYB 5FPHA 5HK8A 2WP8J 4CQJA 3BKXA 4M1QA 4OH7A 1NSYA 2QRHA 4U7GA 5HFNA 1GGVA 4JN6B 1TQHA 5A7GA 4MIKA 5J2TB 2PLAA 5BYJA 4RULA 3E05A 4JEMA 3IVRA 2I8AA 5D01A 4PZAA 3V8MA 4DE5A 2X5OA 3RH0A 3GY0A 1HDEA 4YRPA 1E96A 1NDUA 1A8IA 4YMIA 4Z49A 2FWRA 1R0XA 2IUUA 1SURA 1UPUA 3GMDA 2ZDHA 5BN3B 1RWVA 2E4YA 1UFKA 4RE6A 3SC2B 2WWYA 2O0HA 2PLNA 1ZISA 4NNJA 1PYDA 4YDRA 1KDPA 2EOAA 4EB0A 4FD2A 3KVYA 3AUSA 3EZ6A 3QYAA 4KYIB 4X84A 4CLOA 1GSHA 1LD3A 2QVXX 5JYDA 5AHXA 4CHTA 1SCIA 1FMTA 5KMGA 3K6SA 4HGOA 1EQUA 3TTXA 1T1SA 2B6HA 5KQRA 1W88A 2JFOA 4MIYA 4C0LA 4X1KA 2QP9X 1YRAA 1PT6A 3DE5X 4DLYA 2IXEA 4QE3A 1VLVA 3FDFA 1DIGA 2DHDA 4CV2A 5EJ6A 1F0NA 3BGVA 1RRFA 2CCGA 4GOOD 1EYZA 5CFQA 1J0CA 1FNDA 2QMZA 4HN2A 3GV0A 5AK4A 3TX2A 5KNBA 2ZB4A 2Q49A 1KL7A 2WIKA 3LA8A 3BMOA 3OE7A 3F3KA 4HLNA 4MUKA 2DVMA 3K31A 1ZRSA 4YMHA 2UUOA 1PF7E 4KO1S 1U3GA 4RIHA 5FI1B 4YJKA 5FV4A 3JAMA 5AKHA 3KXIA 1L4EA 5E9WA 2OQVA 2J3IA 4CIAA 1NVKA 4R2WA 1QV6A 2X3UA 4NCXA 2ZT6A 3NHLA 1VPWA 3CLSD 3DNFA 1I4TD 3IAM1 3JZIA 1PJ8A 3L9XA 5AHRA 1HV8A 4WUVA 3G2QA 4P58A 3UENA 2QYSA 3MAGA 3UV7A 1NVEA 5HKLA 4L4ZA 1NNI1 2YJ4A 1UJNA 4ZVRA 4B35A 3ZN2A 3WGQA 2OAGA 3O75A 4NPAA 4DRXB 5HMLA 4YPOA 4BVAA 1CZLA 2ZS8A 4NZYA 1ZI6A 2WLTA 3OTWA 5CFOA 3I8OA 4FZVA 3OJWA 2ZIFA 4Q7JB 4HDKA 4Z7JA 7MDHA 2EKPA 1XTTA 4EW6A 4F2HA 1XJQA 1EVJA 2ZRJA 1KC1A 4L7VA 4G56A 4EHAA 4JI1B 2XBMA 5K45A 3TLZA 4RYLA 2P9EA 4ABTA 3QA9A 5KSPA 2BBTA 3AUFA 2HXSA 2JCSA 3V8EA 5H1YA 5LWHA 3MB5A 3V4SA 3PEFA 2Z1MA 1MQ9A 2BR5A 1VKOA 3QE4A 3H1BA 1ZOIA 4HTFA 3ASYA 4YJFA 4YDHB 1HOXA 5A9SB 4LQLA 2P5UA 3H5RA 1OI3A 4FLEA 4MUBA 1KO4A 4ZHSA 1IXKA 4MI3A 3ADCA 1VJ0A 3BMCA 1YOBA 1V43A 3DAFA 4FMPA 4ECAA 3NWJA 1JR6A 5TIIA 4YXWA 4BQSA 3WK7A 5LDHA 1FZTA 3KKEA 3KDPA 1TMOA 4P3XA 4EJ0A 1FFDA 2FLVA 2NOAA 1D03A 3EASA 2XNSA 3VO2A 4TGLA 2NUPA 3WZLA 4E21A 2RHHA 1E4OA 5I7OA 5KYUA 4ER0A 2PXXA 3PU6A 3W0LB 2BP7A 3V4VB 1DEXA 1YJXA 2UVPB 3O4FA 1E9AA 3UC9A 5IM4F 3KSAC 4YHBA 4Q47A 2DAPA 1GRQA 3H1FA 1LI7A 1JFSA 3EDRA 1Z4NA 3JQEA 3AMVA 3DNMA 1QR2A 5AJUA 2WUFA 5IF9A 1BVYF 4UNQA 4KTTE 1LLFA 2PKQP 5K0TA 2PX2A 5EC8A 4QYXA 1WZUA 2ATCA 2HPHA 4B6OA 4IZOA 2Q3BA 1JP7A 4GX1A 3SKXA 1NPDA 1UZLA 3DV9A 3FXAA 2ZSIA 4LYFA 1JLLA 2Q2VA 4C6HA 4KLCA 2PBZA 4E33A 1CRPA 4BVHA 1K6MA 1H5QA 1K6JA 1MC8A 1UF9A 2AMFA 5JANA 4UNIA 2BCEA 3B1YA 4ZOBA 3GNTA 1RXSA 4TQAA 4GI7A 3GPDG 3SIWA 1PJ4A 5CK5A 5B6PA 3BS4A 1C0LA 4I55F 1JQJC 2QRZA 3IHKA 2GK4A 2W2KB 1QGYA 4J8PA 4C4OA 3VDRA 2PTHA 1PHRA 1R6UA 1O9BA 4B8YA 1T6XA 3K96A 3P5SA 2VWPA 2VJPA 4M9QA 4PTZA 5JQGA 1BD3A 1GZ3A 3PHIA 2WW8A 4LRWA 3UMBA 5JNVA 2XZDA 3F5DA 2CV2A 3IPLA 1F17A 2P2GA 2O8NA 4H31A 2PKEA 5FUYA 2C3OA 3OWHA 4R71A 4MQMA 5ECGC 4V1CB 3WSTA 3GLRA 5D87A 2V9CA 3K16A 3QHAA 3USCS 4PHTA 5K1ZA 4L5AA 4QOGA 3GJ0A 1W36B 1UOQA 2JS7A 5DGXA 4YV2A 1CEYA 5FUWA 4L76A 3F8WA 3BD8A 4MV7A 3MJVA 3BB1A 3KKPA 3L2OB 1IQUA 1YB6A 2EBUA 4Y67A 4FKMA 3A2KA 4ZVTA 4TYWA 3OFSA 5ITZA 2XGMA 1Y9JA 3ZHXA 2BSXA 2C7QA 4F9FA 3STTA 4JGIA 2YQZA 1IPHA 1U11A 3C97A 3CKMA 3DL4A 2H4WA 2V7WA 6GPBA 3ILYA 1K5GA 1XNJA 1E1QA 1YUNA 3LJKA 4IYJA 4JLWA 4UQOA 3IAM6 2XGSA 3DXXA 2EJWA 2IDMA 2YJZA 4N9QA 1QX4A 3HM9A 5HQJA 2D2FA 2RE8A 4H3HB 2ECPA 3RS2A 4MEBA 4NBSA 2C7RA 3EXFA 3P97A 5HOEA 5C3MA 3P0HA 1GLNA 1HMYA 2VEOA 4URHA 5PNTA 5EXDA 3TRFA 5ES4B 5IVPA 5KYUB 1B26A 1Y6QA 1PG2A 3C39A 3IQHX 5B3AA 3VOBA 3ZE8A 1FDWA 1T9BA 4EY7A 3LBIA 3O21A 1KJWA 1T35A 2VBIA 3WWCA 1UXIA 2JDIA 4KPGA 1ZK4A 4TQGA 4UNPA 4FIZA 2WA1A 4OK5A 1SXIA 5EZ5A 4RX1A 1G4UR 1G5TA 4JNKA 4MR9A 1P33A 1ZJYA 2BJWA 2JCYA 4AG6A 1G3RA 1GL6A 1UBRS 5HCUA 2HM7A 4E5SA 3JWHA 4UUAA 5B4TA 4TXJA 4XUCA 3LRTA 3U09A 3LE8A 3UJPA 1E4EB 1KEWA 3SYNA 1Q1BA 4BWYA 5CVJA 2PT9A 4FB5A 2A33A 4BMYA 2OBBA 5FTWA 3O8QA 5BSUA 1G41A 2F67A 3T5AA 1Q7CA 1RRKA 2O1EA 1W8IA 1WUIS 3LOUA 1N5JA 1VJGA 2A9KA 1CCWA 3KJXA 4TQUS 1KIFA 2EV9A 2H29A 4NBWA 4Q18A 4ZVMA 3LBHA 3UHFA 5BY2A 1XK6A 1GGNA 1EXDA 2Q29A 3GJ7A 4OGWA 3UK6A 2DQKA 1F0PA 5JZVA 1TE2A 2PZLA 3PV0A 5IC6A 3T3OA 2QW1A 1L7BA 2C1XA 1PZEA 2VHUA 3OJOA 3RABA 4YFYA 4ZC8A 3EJWA 1R9MA 2BFFB 4YTEA 3H1PA 4YY3B 4ZRNA 5AOBA 4C7JA 3SQOA 2IHJA 3LPNA 5CDFA 1FS4A 2P8JA 2BGTA 2H1CA 2PGNA 2QTGA 3LLVA 3ZI7A 4EF6A 1NFRA 4CU2A 2JG3A 1DXOA 2YVUA 1UK6A 4E31A 1AN9A 1QV7A 1R0RE 1YQXA 4PE5B 4F3RA 3AFMA 4G4GA 1L5HA 5AXBA 1KMMA 4WMLA 2OECA 3EGWA 3HBLA 3IEUA 3LXMA 1V11B 2DY0A 2X7JA 2BFPA 2VT6A 1XP8A 1V5WA 2HY7A 2ZAMA 3I0MA 1OH8A 3BJRA 1FPQA 1NVWQ 4MRNA 4BQNA 1G98A 1LV7A 3NM4A 5CB4B 4O1MA 1O2DA 4C87A 5KJ1A 1Q17A 3PPYA 1XQYA 1Y37A 2EFJA 1KNXA 2DPYA 3A9TA 3KVVA 1GXSB 2CYBA 1L3CA 1H9BA 4MSUA 4A0SA 1UT6A 1BGXT 1CJCA 1Z6ZA 3IUNA 1Z25A 2DE0X 3PFHA 4OBEA 5G3YA 5FFFA 4F0JA 4ZK2A 3G17A 5K0EA 1DKOA 4DXAA 1FFXB 2Q4EA 1A4XA 3SC2A 7MHTA 2Y71A 3OQMA 2QR5A 1DKPA 1RZ3A 5JAMA 1JE1A 1RXWA 3WLKX 1D04A 1DAKA 2Y1DA 2OCLA 4U3JB 3BJIC 4G24A 4AWBA 4I2NA 4F3TA 4E6EA 5DFAA 2OILA 1N92A 3PNBA 4LFBB 1QWSA 3OZBA 2JLYA 2G4VA 3UPDA 5DV9A 1NBHA 2AXNA 4RHEA 1Z7EA 2Z30A 3MSXA 2P9YA 4LMPA 2P1ZA 2XODA 1XBTA 4K9MA 4B83A 4BRUA 1H2FA 3TIXB 1KQFA 5HTOA 4I4TA 4G0UA 1NRIA 1NLYA 3KR1A 4TL9A 1E0DA 3QLVA 4JVSB 3DMRA 4IWXA 4HVTA 1EUZA 1RQ7A 3SY8A 4H6VA 1W0KD 4Q24A 1B7GO 5GGXA 1NI4A 2DPGA 4LHYA 1J8MF 4KX3A 4R2IA 4KPYA 3NTQA 3EZYA 3R0QA 3RHTA 4DIOA 3OZCA 3BT7A 4M0PA 2J9RA 1X2EA 3OZTA 3IFSA 2FGJA 2I6QA 4RIGA 1ZR4A 4JKOA 1TYBE 1ZITA 3FCCA 3B3JA 1P4HA 1BCRB 4Q9DA 3ZZ0A 2JFYA 3KELA 3K8ZA 1TW3A 4MH0R 2EZ8A 1MUUA 5EZQA 1BXRA 1KO1A 1U7UA 3OX3A 4CM8B 4D25A 1A8SA 2Y8EA 4U7JA 3ANXA 3P0EA 2Q28A 2AC4A 2W6NA 3FMPB 3QQPA 3WLLA 3EUAA 2IX3A 1R27A 1WVGA 2FW0A 3PDHA 4AP9A 1DP4A 2CXHA 1CVLA 2VDQB 4RORA 4ZCIA 4HNAB 1TZCA 3WI7A 5ICEA 13PKA 4HLDA 5AQ1A 4QUKA 4XM0A 1GUFA 1A97A 2RJNA 2X5KO 3C7TA 3LTEA 4JASB 5ALYA 3ROMA 1J2YA 1PYOA 3HA3A 3K94A 4COOA 2C9YA 5FADA 5B4UA 4QHSA 3N70A 4FZJA 4Z5XA 4OJTA 3QI7A 3CF6R 3P0FA 4FGKA 5JC1A 4D45A 2PQ2A 3UM9A 4BCDA 3SS7X 1KHHA 2JK0A 3QJYA 2H0AA 3O95A 3OF5A 5FXMA 3O4IA 4KQJA 3W2GA 4F91B 4W5TA 3DP9A 3L0ZA 3GNSA 4A3SA 3R5SA 2W5UA 4O29A 2JHFA 2R66A 3QZUA 4GVPA 3VH4A 2BEUB 1P2TA 1G8KA 1U0RA 3G2IA 4YUYA 3R7NA 1K8YB 1F1BA 3S40A 4GHWA 4DG8A 1BMFD 1KBQA 3OT5A 3PR3A 1MRNA 1THTA 1U0EA 1JEQB 1TZ2A 2ZBFA 3K6KA 3MRVA 4TT3A 1KEUA 4AULA 5LP1A 5B5SA 4UUPA 1P4SA 1WSAA 2MSDB 2FSVA 3OIUA 1C4WA 1ZSNA 4UEKA 1OA1A 2BFDB 4P38A 5TSDA 1XROA 2VXBA 3QEMB 4LSMA 3MA0A 3OLVA 4KMRA 3RYCA 3GLIE 3TAHA 2EDAA 1YU9A 1BQEA 1II8A 1CY1A 1P7PA 4G0VA 1YJQA 3O74A 4JJEA 4F4HA 1EZZA 4PFJA 3TFOA 2V0GA 1II0A 3E84A 3K72B 4FHFA 1XQVA 5TPZD 1YZYA 4ZO4A 2OKCA 3PC8A 2DHEA 2ET6A 2PX8A 4D0NA 5ICSA 1DOAA 5JCJD 2QN3A 4O4IB 1WEHA 4RJIA 3CNEA 3D8TA 3PX7A 3GEGA 2X0KA 3GL9A 3P0IA 3C3WA 1COZA 2ZG6A 4EKEA 2QTHA 5A6SB 3TDMA 5I7UA 3C7KA 2A58A 4QPCA 2FR0A 3FJ1A 3G0DA 1DUVG 1V16A 1FVFA 3G5UA 4PHGA 4AJ9A 1HF3A 2H5EA 2Q6TA 3GUHA 3NT5A 5E1MA 3RI3A 4CI0B 4F7WA 3U3KA 4S24A 1UKBA 3WTBA 3UT5A 3PXEA 2FFRA 2BGGA 2CHUA 1UFRA 1YBMA 2FWAA 1DLJA 1WCIA 2VOJA 2YY5A 2ZEJA 5E4FA 5B3JC 1EK0A 2ZE7A 2JFBA 5L7WA 4L0DA 1CRWG 2JBAA 4YI5A 4QJBA 4UHCA 1DMRA 5D7BA 4AYXA 2MJLA 2N75A 2WUVA 1FE8A 4BNNA 2AWOA 5TF4A 5FTLA 4R2KA 3W5AA 4HD8A 2NUAA 2FI1A 1W4RA 2Q6IA 1YMQA 2WU8A 1XTBA 3I05A 4XI9A 3SCZA 4DCVA 4XDGA 1D9ZA 5HRAA 5JQGF 1LQ2A 4XTCS 4Y9DA 2GJ4A 3L6UA 1O03A 3FZEA 1WPRA 4PCUA 4L75A 4DSOA 6ADHA 1QHIA 1AUQA 5CH5A 3OKAA 2W2XA 2AEEA 5KNLA 3SICE 3TQSA 4EA7A 4AN4A 3UHOA 1ZZGA 2OC9A 1IVNA 3OTIA 5H81A 3WMFA 4QTXA 4D46A 1N77A 2WTXA 3KQMA 1PX0A 3EX7C 2IYNA 5GADl 4Q01A 2A0YA 3A3OA 1E9DA 4FJ0A 2LWIA 5CLQA 1OI7A 3SR0A 4GQIA 4KWTA 4XRGA 5F5XA 3SJAA 1VE1A 3A1SA 3M70A 2I55A 3SC3A 1CQPA 3F6CA 3VYUB 3FIUA 4XVQA 1R1DA 4PPQA 4N41A 3PJRA 4R1LA 1CBUA 3TSOA 4NJMA 2QXYA 3P4UA 2D7DA 1H6AA 5IJZA 2WWXA 3WLNA 3DEFA 5CA0B 1L1EA 4Y2VA 4AKTA 3I53A 4BB9A 4HNHA 2ATVA 1VB5A 1VYVA 4RSGA 4IHQA 3A4NA 3K8YA 2WF9A 4JMLA 5IJXA 2GPAA 2A92A 4R3NA 2C2BA 1LSOA 4J7AA 5DLEA 2R25B 5KPJA 1ZBDA 4OSEA 2BISA 2CDRA 3LD9A 4KLAA 4HB4A 4W5RA 3CPEA 2AOUA 2P8SA 5IM5A 1D2MA 2ZE5A 5SY4A 4DBVO 5JCOC 1LPMA 5AKGA 4RTMA 3AEYA 5KIAA 2GTIA 1OLXA 1R5OA 5F7JA 5BN4B 1OAOC 4DREA 3ADBA 2D2IA 1QYVA 1XSEA 1ZH2A 3ASZA 5DRTA 1SVLA 3P19A 3W3AA 4XW2A 1VGRA 2I29A 1CRQA 1ZIPA 5HRUA 3K09A 4ESOA 3VTKA 3IE1A 2IH2A 4J94A 3ZIAA 2J9YB 1FOEB 3IBGA 2J0VA 1LKZA 2ZBRA 5KNDA 5KSYA 4Z4HA 2H4XA 2IS1A 1DIRA 5KOYA 4DLTA 4HAXA 1HY3A 2IPNA 3GH3A 3ZWXA 4A8HA 3IEIA 4ARAA 4DA9A 5LU9A 2XA9A 1WPXA 2IIQA 2XWBF 3X1ZA 4U8HA 1I0LA 2X2OA 2QRJA 1MH9A 2GYVA 4RVHA 5TQ0A 3TCKA 1WXDA 3VHRA 5I9LA 3HFRA 2A57A 2AFHE 3ILSA 4GD3Q 3QFSA 4QBKA 5KWVA 1Q19A 2JLWA 1QS0B 3VPFA 3GCGA 2X14A 3HTXA 2QA5A 3QG1A 4MR8B 4OX9B 4BE7B 5I3CA 3SEQA 4GEGA 3ROZA 3JYOA 1PTJA 2CJWA 3ER6A 2YRFA 3HY4A 3QELA 3FI9A 1Q7BA 1BKSB 1R8QA 3G2KA 4GNRA 4EJSB 3N8DA 4WESB 1NVTA 3PUWA 2VSNA 4MJXA 4Y2SA 3TB6A 2FPRA 5I4KA 2OGTA 5KJ6A 2QAGC 4WBNB 4BZQA 5A4MS 3GZTB 5C53B 4TZ0A 4Z9YA 5YASA 3B48A 4NZ9A 3RIXA 2VJKA 2XMDA 1MO4A 2ODBA 4MP3A 4J4BA 2PGLA 1I0IA 2VXOA 4K8RB 2IYWA 5F5LA 1LUAA 4WBXC 3TSYA 4ALMA 1XHLA 3LKBA 4H6XA 5CD9A 1QYRA 2CMGA 1VE9A 3NPMA 4R9SA 4EFLA 4LG1A 4D96A 1ZAKA 1USKA 4B8ZA 2Q62A 1Z0KA 5DLYA 5EJFA 4BKRA 4F5DA 4ZC1A 1E0KA 2IZ0A 5EZYF 1ZN8A 3B8EA 3O2QB 2Q5OA 3B5EA 4WOJA 1XLUA 3IAHA 2XVMA 3EIOA 1RT9A 4GGMX 2GTHA 3AINA 4NU6A 2OBMA 1FUKA 1XA0A 2Q5EA 5ALUA 3C1UA 4UXHA 3HDQA 4ZYYA 5A62A 5KWEA 1MW8X 1MO2A 2Z2JA 2QT0A 4INOA 1MBZA 2JA1A 2W2TA 5FPTA 5GAJA 1L7VC 4BJ3A 2YICA 4URYR 4D8YA 3PA6A 1KSFX 1Z5UA 3U16A 4W5NA 3DLPX 4XFKA 3B70A 2BUBA 3AFNA 4MGEA 1FUEA 2AL7A 1EZ4A 4ETNA 2RAPA 2IYEA 1JIJA 3K70C 5EJ9A 1E5QA 2V6FA 3GGJA 1SKQA 3TRKA 4X71A 1DIHA 3KUXA 3FOCA 4PLPA 2UAGA 1Z4LA 3OCXA 4OIMA 2BE7A 5A4JA 3EPKA 2B4YA 1DAGA 3SOZA 2BDEA 2J85A 4IH1A 3KSRA 3OKFA 3KSZO 4C5CA 4UMVA 1MQ8B 1QONA 2FKNA 1G3UA 2H5IA 3GFFA 4NG4A 5CYPA 4GIBA 3JASA 5LDGA 3L7IA 1X15A 1PBTA 1SD1A 4JP3A 4IX9A 3DFZA 1DKNA 3GGOA 4LHEA 4YV0A 1GAXA 1IN5A 1XZBA 4TYQA 4BCCA 3DMTC 3ANNA 1ULUA 3B7GA 4QJIA 4D9KA 1X86B 3MS4A 5FLKA 4U1RA 2W48A 4LFCB 1NW5A 1RXUA 1UCFA 2IHUA 4G1CA 3R4CA 4YJHA 1ZY2A 3ORSA 3GGPA 1U6IA 1EKXA 2A5LA 1XGKA 2AMJA 3D6TB 1PEKE 3GRFA 3NNSA 3VKFA 4YYEA 4CMKA 4YT4A 1U3WA 3IO5A 1Q2UA 3OT4A 4OLHA 1JV2B 1WAMA 2DBVO 4A27A 4QWMA 4EKNB 4EK9A 2DHQA 1BAPA 3SJ7A 3IMEA 2Y9MB 3A2LA 3PTZA 3HWRA 4QGBA 3KZ1E 1QTIA 2OHOA 3O4RA 3HFJA 3GIWA 3S0JA 1LNQA 4Y6QA 1D7AA 1YE3A 1RRMA 1X1EA 2V7GA 4BWVA 2FPKA 4UXJA 3ID6C 1H0HA 3P8ZA 4WL0A 4EHKA 2WPDD 3KRTA 5AVOA 3S68A 7ABPA 2R4TA 2Q9UA 5CDFE 1R6AA 3ML1A 2EJTA 1HK7A 1WUYA 3IERA 4KMOA 3VNVA 2OQ2A 2PPVA 4BC1A 5AXCA 1WP4A 3PHBE 4C0QC 1XMIA 4NQZA 1TJYA 2AHRA 3AEQA 1TVEA 5TJHA 1US8A 4YLGA 1CNEA 5T8KC 2LCQA 3VTAA 5KQLA 2RGNA 4H3KB 2P7HA 2JGJA 3V1TC 1EM8B 3A32A 3HKEB 1WCV1 2BEKA 3Q3HA 4YR9A 4S04A 1VE5A 3N7TA 4IRUB 1VE7A 2XA1A 1CVRA 3MMNA 4NFYA 4RVOA 3I92A 4PS0A 4K3VA 2FX3A 5LR6A 1U7WA 3GJ5A 3OD1A 2F1IA 1QX3A 3QHPA 3DOIA 4AUMA 3OD5A 4E2ZA 2IODA 2ZYTX 4D6YA 4HS4A 5M7EA 2PEYA 2QQ0A 4DB2A 3ZLBA 1GL7A 4CDRA 3FF1A 5G1OA 2YIJA 3NDPA 2M6LA 5IM4A 3W6ZA 3VOTA 2CMKA 1ZUNB 1PT5A 4Z9AA 5GTDA 3NH9A 3DOOA 4GH5A 1EIWA 3GMTA 1E3TA 4G5OA 2FFQA 1JGTA 2QT9A 2ZPUA 3WAKA 4BN5A 5MN6A 4YAOA 2Y4OA 5IBRA 5A9RA 4AUKA 4X1OA 1SBHA 2B6NA 3UAGA 2ZJYA 4KVFA 1BHO1 3WADA 1IOWA 1FTYA 4B0OA 4RMNA 2CLFB 4YRIA 5F1OA 2OUIA 4P7JA 4XVUA 2WAXA 3UUWA 1SMKA 4YHHB 4NMHA 1D8TA 4LRXA 3GGDA 2C95A 2VDJA 4JQOA 3VPXA 4MQ6A 1DJLA 3AVPA 1T0PA 4UAUA 2VHVA 3ORFA 4OGKA 4QRDA 2Y2UA 1RPNA 2JJ8A 2P5SA 4UASA 1MT3A 1TGVA 2VDLB 4HUQA 4GR4A 3ZCSA 3ZCRA 5EIFA 4UEOA 3GG9A 2X8JB 3DAGA 3OLYA 1X6VA 2JFWA 5BSGA 3VR3D 2Z6AA 1G5QA 5TEVA 3ZCVA 3ZIAD 3WGHA 1GTL1 2I3BA 1JU4A 1IZ7A 3I4FA 1N9ZA 3T38A 3PR1A 1JKIA 3EVZA 1J9GA 2PY6A 3OM1A 4RF2A 1ECPA 2JEOA 4YT2A 2AW3A 3C6XA 4RAQA 5K0FA 2XR1A 1NXPA 4WXMA 2WTAA 4KQIA 4YASA 3ZX5A 4HLQB 2ZI4A 5DYTA 2FW1A 4D57A 1L5WA 3DBLB 4HLCA 5A5VA 5HR5A 3L1UA 3KCQA 2R79A 2TYSB 3GEEA 1E9CA 3R6WA 4L73A 3SX0A 2JHGA 3ZDXB 4DA7A 2D0IA 2QI9C 3RIGA 1V11A 2A5FA 3DF7A 1U7TA 2Q21A 2V7QA 4GL2A 1GQSA 2A2ZA 4OV6B 2V4ZA 3A6FA 1LK0A 2A1TR 2VFAA 3BTVA 1YI8A 5JCZA 4YJHB 3WGKA 1Q0LA 3LBYA 4IKPA 4IUYA 5G1PA 2HNAA 4TTQA 4I4IA 3BHNA 3UJ9A 3ER8A 4XGRA 4YMWA 3I1JA 1FSGA 2GF0A 1UADA 2E5FA 2WD9A 4OK6A 4DV5B 1CFJA 4JUAA 2HX1A 2WHRA 5AJZA 4ZV7A 5GM1A 2G5PA 1Y9DA 1QYCA 2Q3LA 4WCFA 1RJEA 2JIQA 3Q0TA 3DMHA 2FG5A 1DCKA 2NQTA 4QXQA 4KGXA 3A4YA 3OOEA 4ZYUA 2B83A 3BWMA 3CT6A 1JBQA 3F6PA 4R51A 5FUQA 1DHRA 2GVZC 2XUJA 1QU2A 1U8UA 3O90A 4MITA 4BYGA 3ERCA 4MVJG 3ABQB 3QVGB 3ACDA 1SXJE 5EIWA 1K0FA 2ZB2A 3VDQA 2VNAA 1KOJA 3I8SA 4QFBA 1G6Q1 4M9ZA 5MGBA 1TCVA 5K4GA 3T8YA 4JUDX 2WICA 2CWWA 4HR7A 1VPEA 3ZHBA 1YGPA 4ZCLA 4D9EA 2WJ3A 5TY0A 3GZNB 3ZG6A 2C4HA 1RVV1 1VJ1A 3MGCA 4BMVA 4TOIA 2Q5QA 4G85A 1NKSA 1WZNA 2GPYA 4GOLD 3A9RA 4TV8F 5HW0A 4NYMQ 4RVUA 4RW0A 1X80B 1T8UA 3CSSA 4IX1A 1CB0A 3FMOB 3P20A 1EA7A 4CFZA 1QRTA 4N5LA 3KAKA 4GG1A 5DM60 4XWWA 1NJ1A 2I6GA 1YD7A 3HB9A 3N0RA 3T5MA 4KXXA 1SVUA 3Q3VA 4ZIRB 2C99A 2W6CX 1NKTA 2I03A 4EJ6A 2NPIA 2QUAA 3C6BA 3KPJA 3B51X 2WWFA 3MNFA 4MQ4A 1CS0A 2GCOA 3PFCA 3Q3EA 1CIVA 3O94A 1N7JA 1NVGA 2EKZA 2IPLA 2N46A 1A9YA 4JUIA 4MHTA 4H2DA 3TQHA 1NAIA 2OBXA 1XLWA 3PWZA 5EHNA 1SHTX 2BH9A 3KWMA 1VLJA 1CUZA 2F48A 2QIPA 1F06A 1O54A 4HDCA 4P83A 4CEJA 3BXEA 1SOWA 1XLTC 3K9CA 2G28A 4D02A 4RDHA 3C8UA 5DJ5A 5CD1A 1WMDA 1NA5A 4HG2A 4PHFA 2V6BA 1GDTA 3KOYA 3GROA 4YH1A 3VTZA 2C58A 3UVEA 1BRTA 2VOEA 2ZAOA 3LKZA 4NE2A 4JR2A 3MG9A 3NT4A 4AIIA 3N3AC 1FYXA 3SJBA 2PGOA 1ZEJA 4HS9A 2A6PA 3B6KA 1NXOA 2OZLA 3I2YX 3G2MA 1K63A 4M38A 2GYWA 1OBFO 3T7DA 1Z4MA 2GLTA 2F17A 4ZMRA 2RGXA 4AVYA 1I9CA 2OHIA 1JQBA 3B36A 5BT8A 3HY3A 5CDTA 3K9WA 4JK3A 5EZ6B 1CHDA 1HL3A 1XJWA 2J6IA 2CHEA 2FWNA 1M6EX 3JS5A 1Z7GA 4ZU1X 3HO6A 3CNOA 3IIJA 4LW8A 4UREA 5IJAA 1AKVA 4B6GA 1HL7A 5GMOA 3W05A 4BP1A 2I4MA 1P4AA 5E1DA 4TMTA 4QVGA 4CT5A 5JBNA 2Q1TA 2PFGA 3MQ2A 2GZ2A 3I61A 2ON6A 1AKNA 3V2IA 3PLNA 2V7BA 1C9KA 3MTDA 5CHEA 5J9FA 3GFVA 3TZHA 2F1JA 3TD2A 1Z0FA 2IYQA 4HAOA 1OLUA 2H8KA 3H1TA 3FNHA 1P75A 2XOXA 5CM8B 2Z8XA 4TXNA 2V6JA 2P9BA 3PXCX 4P2BA 1Z5OA 4L07A 5J4LA 4KQGA 4LVUA 5F51A 3FBWA 2QPTA 1AURA 5TB5A 5C8YA 1XTZA 1YONA 2D1FA 3KKKA 3QX9A 3GJSA 4V02A 3OPXA 4ZGBA 4FK8A 4YALA 1KWKA 1OHHA 3GDHA 2HH9A 5IWAB 4AG3A 4I6EA 2W70A 1ZM2A 2DWUA 3BBPA 1RKVA 1RLIA 2VHYA 3N86A 5FO0A 3RK4A 1W4ZA 3QOYA 4RUKA 5C80A 3P4XA 1E3QA 1D7OA 1QBKC 1I2BA 3O47A 1ITZA 2HMYB 3WICA 3LYLA 4C01A 3W6OA 2R44A 4L0QA 4RM3A 2XRYA 2JI8A 2ZWIA 4K6GA 2DKOA 4B45A 3AVOA 1OWPA 2GOYA 3UAVA 4Q6WA 2JLZA 3BMXA 4LXUA 1GQFA 2POCA 1E99A 2AKEA 4NU5A 1YV9A 3W8NA 4O0MA 1VLZA 4LJAA 4G0QA 1UAYA 2ZATA 1VRWA 1OSNA 4IIXA 3KL2A 4MV4A 1JKXA 3N6XA 1G2PA 5KTTA 1Q57A 3RHFA 3EXG1 3O92A 4D3DA 2PD3A 2JJ1D 2HUNA 3CIOA 4C4TA 2NU8B 4KRGA 4EZBA 3KSMA 5DTEA 3HCDA 5A2QA 5FF9A 3QJGA 1QKIA 5FQNA 4RQBA 3OECA 3FTEA 2OFWA 3V4OA 4MRSA 3UHPA 1YC2A 2GZAA 3BD6A 3WIEA 5IJ9A 4NDAA 4QO7A 3T1TA 1OWNA 1XCPA 2Q27A 5AO9A 2DT8A 3MC1A 3WLHA 2A9JA 4ZQHA 4IDQA 5JRZA 4PC6A 5DIFA 2E85A 3I23A 4ZVLA 2CLCX 1C9EA 3EQ2A 2NUAB 2XDQB 1J22A 2D2VA 1UBGA 3JWPA 1NMXA 1KAGA 3KXKA 1JPJA 3DQZA 1DBRA 2IIPA 1JSZA 5DGIA 2G08A 3DO5A 1NF9A 3FMGA 4GC9A 4HO1X 4EGSA 2VHCA 4X65B 4J75A 3VFDA 1DHTA 1W4CA 4DSNA 3AJ9A 3MUFA 4DRXA 3KX2A 1QZZA 3QF7A 1XMVA 3A3KA 3AP2A 4J0JA 3QKUA 4RSMA 3VR3A 3LKDA 4TL6A 4QOSA 3LS2A 3KQVA 1FMCA 1GCOA 3INTA 1U7XA 3MWEA 1JLRA 4IMRA 4M21A 4Z1MA 4I5DA 1HNNA 1WDTA 3B3QA 4KWEA 4QOFA 3ZWYA 1YDEA 2CHVA 2QI9F 1QFXA 1IYZA 2JZNA 3ND7A 4UHHA 5CT5A 3P27A 3ZHYA 4DNPA 5ITSA 4XFJA 4JDPA 2PGAA 2ZU6A 5G0SA 3F90A 1FUUA 3Q2OA 4QD3A 5CURA 1LSJA 1GT91 3DZKA 3RYHA 1B15A 2QN1A 3RRJA 5MGNA 3ZY4A 3DWEX 2DPLA 1D2CA 4J0QA 2IYXA 4RKWA 1K0UA 1LVUA 5IS2A 4H7HA 1Y1SA 2WJJA 3GPIA 1U3UA 1V9LA 3FNEA 1ZHFA 1YRWA 2W6OA 5AW7A 4A15A 2PZAA 1D4FA 4F6RB 3D0KA 4OHYA 1Q6ZA 1SIWA 4CTMA 2RH4A 2C84A 1AS3A 3GHYA 5E9QA 4DNQA 2DBZA 3R0JA 4BTVA 5KMGB 1BKYA 1X7WA 1FJHA 1O96B 2AHOA 3PG5A 1DEOA 1MB3A 4BX8A 3ZDCA 2KBFA 2ZIUB 3C14C 4IV5A 4MJLA 1KP2A 2M6SA 1TYEB 4OAPA 3ZJVA 4JI4B 1SQGA 2X8WA 3PEEA 3VKVA 1OFTA 1DDOA 4PG5A 3WRYC 1PZXA 1PYGA 3LPMA 4ZWNA 1AB5A 1KVSA 3GVPA 3X1DA 1PV2A 2ZCUA 4OA5A 3VVLA 4Q48A 2PXCA 3ZGOA 1YS9A 1YRLA 2AMYA 4FB4A 1BJKA 5ISMA 2RMKA 4O3FA 3UAZA 2OHFA 1JFTA 4WOCA 3DTTA 3PGKA 2FPMA 2C1EA 4HBZA 1GCIA 4ARUA 3OEWA 3PFGA 3QV1A 3IKJA 3B3FA 1VSBA 1B93A 4PWYA 4OJYA 3TFWA 4QO8A 5H9WA 1Y6JA 2QX9A 1T9GR 5DXFA 3ISVA 4M7OA 3WGNA 4DCTA 1QV9A 4MV3A 3R7AA 4F1KA 4E12A 1Z34A 1X8LA 1Z2PX 1GIAA 1ZOOA 1AKQA 2P7IA 3KB2A 4FTWA 4X93A 3IEMA 5KVSA 3U3RA 3AESB 1SC3A 1OFGA 3C48A 3WB0A 3WHPA 3GLIB 5ER9A 1MGPA 1IHUA 2HCJB 3RTEA 4BFYA 4WGGA 4CF5A 4C0AC 4CV3A 1YZVA 2VQ6A 3LT0A 3NXSA 2AEFA 2R96A 2ZJ2A 3LUPA 4K9KA 4MPRA 3AEUA 2H2IA 3ZH9B 1UDWA 4J3NA 4B7AA 1C9DB 2OB1A 1C3XA 1EVEA 3TWOA 1PR3A 2O2IA 2ZRPA 1WSBA 1Z47A 5ADVA 1IXZA 2WWGA 1UK7A 4A23A 3C6QA 1D2NA 3A2MA 1K75A 2CLHB 1QSGA 3ZUPA 4MB2A 4K6OA 3OJXA 1K7YA 1JDJA 4AF7A 3NIWA 1N7HA 5LYJF 2AN5A 4EM6A 4R9NA 2GAIA 3KQQA 1V95A 2EZ4A 4PANA 3RJ5A 3FG9A 1V8BA 3CLRD 4CMEA 1G66A 3EHEA 1ILWA 1FL9A 4HX5A 4URUR 1A0OA 3NWPA 2XF2A 2X4GA 3HB1A 3OCYA 3SEAA 4PAMA 1Z73A 1KFJB 5DX0A 2F3PA 4CTNA 3QEOA 1ADFA 1L4GA 1E1YA 3HLKA 3L7BA 1F2UA 4PTLA 3SR4A 5BNFA 3P9XA 3TIVA 4AKEA 1L4FA 3QWFA 4MWZA 1F4PA 2I7XA 4Q1AA 3ZS9A 4ADSG 1RKQA 2AOXA 4XAQA 2AJ8A 1DFIA 1QNFA 1U2ZA 2ROQA 4ASUA 1FIUA 2L82A 3QMPA 4ZTUB 2F6RA 3BJEA 1DS6A 4NABA 3JARA 3T7RA 1EU1A 1E9RA 4MKIA 1Z38A 1Z4QA 2TSYB 4KIWA 5ECDA 4UTXA 1M83A 1GFWA 4QTTB 1P2GA 3L1IA 1GUBA 2CDNA 2YS7A 3CZQA 4OTZA 4C1BA 1FVHA 3I6QA 2PHZA 2R85A 1OMOA 1W5AA 1Y5LA 3HFGA 3LT2A 1C8KA 1RMQA 1GKYA 2P78A 3JALA 4JH0A 1HNWB 2R6HA 1HI9A 4OOEA 4A8PA 4G63A 4QSHA 3A1CA 2GHQA 5EIAA 5JS6A 1RJDA 1RMYA 1Z5ZA 3P71T 3VBEA 2BZ0A 2CXTA 4L28A 3TBFA 1KAQA 3N2IA 1C1YA 4H6PA 2VDRB 1IN6A 4R2JA 3AIMA 1H6CA 5LA6B 1V3VA 3AEKB 3JQRA 1XAJA 3HYLA 4P08A 4UBLA 1KF0A 3L93A 2A9PA 2HTEA 3AP3A 5C1OA 4H7JA 3PXBA 2GF9A 1RADA 1I3MA 1XYGA 2WKPA 3M6WA 1EVLA 5LUBA 3BF8A 3NX4A 5F52A 1DFGA 1X7WB 1I3NA 1I1HA 2ID8A 4UTOA 1I0ZA 4ZJPA 5BMOA 4S35A 1S3SA 1ZD9A 3TW4A 3E5MA 4JSTA 4DJDC 2VK1A 2RHJA 2C78A 1HT3A 1ZHHA 2A9QA 2Q3HA 2K7ZA 3F2VA 1YJ5A 2QN9A 1TI7A 1U8XX 3EXHB 1ZIOA 2GD2A 2HV9A 3IVGA 3L3BA 3OM0A 4LWOA 2AD5A