3F49S

Anion-triggered engineered subtilisin subt_bacam
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
266
structure length
266
Chain Sequence
AKCVSYGVAQIKAPALHSQGYTGSNVKVAVLASGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQASWIINGIEWAIANNMDVINMSLGSPSGSAALKAAVDKAVASGVVVVAAAGNSGTSGSSSTVSYPAKYPSVIAVGAVDSSNQRAPFSSVGPELDVMAPGVSICSTLPGGKYGALSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGDSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anion-triggered Engineered Subtilisin SUBT_BACAM
rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
molecule keywords Subtilisin BPN
total genus 91
structure length 266
sequence length 266
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3f49S00
2WUVA 1S01A 1GA6A 1AVTA 1PEKE 1SH7A 4H6WA 1TM7E 3D43A 1Y3BE 3I34X 5ARCA 2W2NA 3LPDA 1R6VA 1Y3DE 4WOCA 3TECE 4NE7A 2SECE 2HPZA 3DW1X 1C9NA 3DYBA 1C9MA 1TM5E 1WMFA 5ARDA 1JEAA 3VSBA 4Z2AA 4C3UA 4GI3A 1GCIA 1SUAA 2V8BA 1KDYA 4OMCA 3TI7A 1BE6A 1IAVA 1SPBS 2ST1A 2PKCA 3EIFA 3P5BA 4OV6B 1TMGE 1SIOA 2E1PA 3BGOS 1SBNE 3LXUX 1XF1A 4K8RB 1GTG1 1SBCA 5JXIA 2DUJA 3PTLA 3T41A 3VTAA 1GNSA 1SIUA 3AJ8A 3DWEX 3SQOA 2XTJA 1WSDA 1AF4A 5ARBA 3CNQS 1UBNA 2Z58A 3CO0S 1SUEA 1EA7A 5SICE 3A3OA 1BFUA 4CG0A 4ZOQI 1LW6E 5JXGA 1WMDA 1V5IA 5I9SA 4WOBA 1SELA 1GA4A 1YJCA 3WQBA 3DE0X 5CW1A 1TM3E 2Z2YA 1AQNA 2W2OA 5FFNA 3DE4X 1S2NA 2WV7A 3VHQA 4AKTA 4AKSA 2Z2ZA 5K7SA 1BJRE 3L1KA 3F49S 2ZRQA 1Y1KE 1GTJ1 1MPTA 1OYOA 4I0WB 1NDQA 2TECE 1SBHA 1BFKA 1AU9A 1R64A 1Y4DE 3SICE 3TI9A 1SCJA 2ID4A 3GCWA 3VV3A 2Z56A 1TO1E 3WIVA 1DUIA 1Y3CE 2WUWE 3DVSX 1Y34E 3F7MA 1AV7A 1R0RE 2Z2XA 4DWWA 5JXHA 4M1ZA 1OT5A 3DE2X 1ST2A 2PQ2A 1SCDA 1AK9A 3QTLA 1SUCA 5B1EA 2IY9A 2PWBA 3ZXXA 1GNVA 4HX2A 1Y48E 2W2PA 4NE9A 1SN7A 3DDZX 3I30X 5FBZA 4OMDA 4DZTA 1Y3FE 4YN3A 4BWGA 4JP8A 3VV2A 4LVOA 1T1GA 1OYVA 4NMXB 1C3LA 1SCAA 1SUDA 1GTL1 3Q40A 4KG7A 1TM4E 1WMEA 3LPAA 1KDZA 3ZXYA 3PRKE 3QFHA 4CFYA 3DVQX 1NDUA 5JMOA 2DP4E 1KDVA 4DJ5X 2PMWB 1Y9ZA 1BE8A 1A2QA 3DE5X 5JXJA 3GT4A 5B1DA 4C3VA 4H6XA 4CFZA 3DE6X 4ZARA 2IXTA 1TECE 1P7WA 1KE2A 1TK2A 1CNMA 1SUBA 3H42B 3EDYA 1SBIA 3DW3X 2ID8A 3BPSA 3OSZA 3GCXA 3D9QX 4LVNA 2PYZA 5AMXA 3UNXA 5AVKA 1TM1E 1WVMA 4FONA 4B5LA 2SNIE 1P8JA 2ZWPA 4KB5A 1ZVJA 3DE1X 3QMPA 1GA1A 1C9JA 2G4VA 3DVRX 1AH2A 1IC6A 1EGQA 1SIBE 2B6NA 3GT3A 4RYDA 3VYVA 2X8JB 1V6CA 1YJAA 1YU6A 3DE3X 3HJRA 5AVJA 4MZDA 2P4EA 2W2MA 1KE1A 2Z57A 1NLUA 1YJBA 1THMA 2SBTA 2XRMA 3A3PA 3BX1A 3I37X 1SUPA 3Q5GA 4H6VA 2X8JA 2GKOA 2ZWOA 1ZVKA 3LPCA 2DQKA 3AFGA 2Z30A 1BH6A 1CSEE 2HD4A 1MEEA 2PWAA 3EE6A 2SICE 1TO2E 1Q5PA 1T1IA 2QTWB 2W2QA 3I2YX 1P7VA 1T1EA 3F7OA 5AQEA 5FAXA 1S02A 3WIUA 1SCBA 1Y33E 1DBIA 3WHIA 1GT91 2WWTA 1SVNA 1PFGA 1VSBA 3AJ9A 3DE7X 2PRKA 1SCNE 1ST3A 4HVLA 3A3NA 1SBTA 4KPGA 1PTKA 1HT3A 1PJ8A 1Y4AE 4J94A
chains in the Genus database with same CATH superfamily
1E1MA 2UV8A 4YK7A 3ZWMA 2WMDA 1FRNA 3I1YA 4TMYA 5LQNA 4LCBA 4EW6A 3K1AA 3UANA 3EA5A 4CQMD 4EO9A 4QPJC 1HETA 4ZCQA 5C46F 2YJZA 1JG6A 1FMCA 4IEIA 4H0CA 2VUTA 1FZTA 3PFGA 2QN6A 1OA1A 5BV0A 4EMUA 2I91A 4G07A 4D45A 2HLPA 3QVWA 1C3VA 4LI3X 1PO7A 1Y7TA 1YCHA 4DQUA 3C3PA 1ZUD1 3HB0A 3EG9A 4JQZA 1QIFA 3LY8A 1E5LA 1YQWA 3P5SA 3ZWOA 4D92A 3WWCA 2Q1YA 2WKQA 1HH4A 1ZONA 1OBHA 2QIPA 4OJMX 4C7OA 1QZXA 1UKEA 4PC1A 4B83A 5CX4A 2J4DA 1W5AA 1QIJA 2ZUVA 4NZZA 5EERA 5I9NA 2IUTA 2WAMA 1X77A 3DFFA 3MD9A 1ZSYA 4AF8A 4GI7A 2HXSA 5IC4A 1FDWA 2DPHA 2NVBA 4B3DA 2XUDA 4IZIA 3E9QA 4XVHA 3NHFA 1P4SA 1GDHA 5JUWA 1XD2A 3N53A 1BDBA 2GNPA 4BZZA 4ZIRB 4M7RA 2TECE 2ZB8A 1A7JA 1VL1A 3OZBA 1LW7A 4X63A 1GQYA 2AEFA 5JECA 3Q8KA 2GM3A 4YT2A 2O1EA 2C9YA 1GPJA 1VJ0A 3D7MA 1Z5NA 1NUTA 4GVLA 5C31A 3GN1A 1A4XA 3UYKA 2PH5A 4TOIA 3ZNNA 1Y3HA 1WM1A 5CFOA 2FNAA 4N7JA 4BFWA 4F04A 1ISGA 4JWKA 4M1ZA 4QA9A 1RAAA 3IQEA 1SUCA 4FE7A 4FJ1A 2IY9A 4N5DA 4XJTA 1XA3A 3CE9A 4DAOA 4EVIA 5E6SA 4EA8A 1O08A 4LXTA 3LSTA 2O8DB 3I28A 3L1HA 1D1QA 3IUEA 4LTDA 3G7NA 1X7YA 5HOEA 1G64A 1YS1X 2M6KA 5A06A 4A10A 2V45A 4RLHA 4EF4A 2UKDA 2H48A 3KQTA 4X1KA 3LOQA 4RPIA 4LOJA 5B4VA 1OSNA 3HCNA 1C2TA 2G7MC 1JJ7A 2ZDQA 3E35A 1WHSA 1OWPA 3EISA 3U5TA 1PSZA 4BNLA 3KVRA 3OTHA 2J0UA 5BY2A 1CR4A 1E6UA 1JHOA 1RC0A 1L3BA 3LC1O 3FR7A 2QDXA 5FPYA 5EJ6A 4F3YA 5I7SA 1HFJA 3DBLB 5ALFA 1W0JD 4N4AA 1WB6A 2ZBVA 5ECDA 1BD3A 2B5WA 4K28A 2H8GA 5CRIA 4YASA 2GJ4A 4LXYA 2XJ4A 3EIHA 4ND1A 3BEDA 4RK4A 5HS6A 3VJMA 4HZUA 3MJCA 5D87A 1J4AA 1H9BA 1N1DA 1USGA 2GEBA 4MW7A 2RGXA 1U99A 3FVRA 4KIJA 4J3NA 5HZHA 1QRTA 1W0KA 1WG8A 2R4TA 3PPYA 5AM4A 3OETA 3EGDA 4E03A 1NBWB 3V34A 1ZNWA 4L0MA 4QPZA 1THGA 3ZW8A 3CVOA 3ELUA 4IJ6A 2OBBA 1LZLA 3DBHA 2B3DA 1JR2A 3HCFA 2SICE 5HKKD 3FCXA 2J3HA 2AHRA 1W7AA 4JLDA 2JPDA 1SXHA 3I2JA 4RESA 3H7IA 3JVEA 3NBKA 1ULTA 3WMXA 2QR2A 1NV9A 2F1KA 1CUIA 3QWBA 2HHHB 4UNSA 1QANA 3MWEA 4IGFA 4MPJA 4PQFA 3JQCA 3T9DA 1COWD 2HRZA 2PFGA 4V1CB 2XBMA 1QVRA 3HHPA 3DFMA 3ZCQA 2E18A 4ZHQF 4QVKA 3C6BA 3NW9A 1EWYA 2P3OA 4KE9A 4OF4A 4B40A 5INTA 5C9ZA 3C3JA 1RSZA 4CNQA 4MYUA 1RFLA 2KBFA 4HUJA 1GCAA 4CKZA 3TNJA 5K8LA 3PVCA 3N2ZB 1KEZA 4MO9A 1U2PA 4OV6B 4B4KA 1FJHA 2X5OA 1IHXA 5AOBA 5IAOA 2FMIA 2Y71A 3GJRA 4BQQA 1ZJ6A 3LP5A 1AQUA 5IAKA 4CM8B 4OOEA 2CJFA 1WA5A 2EP8A 3QFFA 1ESDA 3CRNA 4MHSA 4P31A 3BJZA 3QTTA 4UQLA 1TQ2A 4QULA 2XRYA 5I5GA 3CVXA 4HGPA 4TMFA 3FSGD 5SZKB 5JY1A 3AOGA 2O8EA 1II8B 5D3KA 3K0FA 1PZXA 4ZN6A 2HA5A 5A71A 3RABA 4CT4B 2NOAA 5FFFA 1TXGA 1BN6A 1WLYA 1NC1A 2FWAA 3AUAA 1NUAA 3CX7A 1FS6A 2RGCA 3WLLA 1XD2B 5ER9A 2RE8A 1N7IA 4L5CA 1YASA 3RM3A 2X76A 1YRYE 5SZIA 1FUKA 4YRGA 2IF2A 4Z0NA 2XE6A 1KKLA 4RTQA 1ODJA 1PWZA 1FSZA 4I1YA 4MQFA 1FUIA 2X23A 5M2QA 2MSDB 2P5TB 3MWEB 2Z98A 4Y1EA 4H2DA 1ATIA 4FGKA 4KWIA 1FLDA 1A7UA 2WU1A 4Q9AA 3T6KA 2V03A 2H2HA 3WGOA 1T8SA 4P22A 3I8SA 5CX1B 1B0UA 1DZ3A 4CM9D 3DGFC 4LVOA 2PLAA 4UHDA 5TY0A 4ZALA 5DTMA 2P3SA 4HAXA 4XVCA 1EGVB 1ONSA 3AERB 5I01A 4RLFA 1XLUA 1NT4A 3Q2IA 4DIMA 2X9VA 3FGOA 1UWCA 4MITA 3VPFA 5C37A 2XR1A 2R7KA 4IILA 2LNDA 2QRGA 7MHTA 4I46A 3N7AA 1QCYA 4G25A 4TTQA 1NE7A 5ERYA 5EXSA 1LZKA 2J45A 1U3FA 1OTYA 3QFSA 4LMPA 1UMDB 3BXGA 4FEAA 3BILA 4E4YA 1WCYA 4ZWNA 4R7ZA 5ALGA 3U2QA 5BORA 3I5AA 2NP7A 1QG2A 1JFLA 3H5TA 4GPBA 4URHA 5CJPA 1P1RA 1IC6A 3L5KA 3ZJYA 2O6LA 2CNLA 3A6FA 2C4VA 3HYCA 4ROTA 2IIQA 3QE4A 5EZYA 3A70A 3HBLA 4WXEA 3VZBA 5CX1A 1XTQA 1YJBA 3FKQA 4AF6A 1LY1A 2QW8A 3O91A 5AIAA 4BO0A 5JBIA 2PUGA 1USVA 4M9CA 2VSOA 4LWOA 3AO0B 5DM0A 5B3KA 5K03A 2VHCA 2G1AA 3AY3A 3ZHTA 2YBEA 3TMAA 1X1SA 1XNHA 3B6MA 4IDBA 3PVZA 3WAJA 3FPKA 3GWZA 4N01A 2H1SA 3VISA 3TNYA 4IIUA 1L6IA 3GGSA 4PSUA 2VNIA 4IIXA 2NPOA 1KSJA 1E2KA 3KKNA 4EA6A 1JXMA 2YWEA 1Y4AE 4HDMB 3G88A 1T0IA 2LR0A 1SH7A 2WY2D 1USUA 4GLOA 4HO1X 1WP9A 4RMIA 1GQFA 1ZJ4A 1N0WA 2FZVA 1RHKA 3GELA 4TMWA 4U7FA 3ECCA 4ZPXA 4QDOA 4D3SA 1FDOA 2MWMA 1EVLA 3AU8A 3I32A 2JJYA 4Z2AA 1B4DA 2Q5IA 2VP9A 3PUWA 4BVEA 5LP6F 3GA7A 4FLEA 4P8RA 2I55A 3UMRA 4MQ4A 3V7FA 4AY5A 4K9DA 3WRXC 4MUBA 1PJZA 1QG4A 1A8QA 2GZDA 3PUJA 5JXIA 2WIFA 1R66A 5PNTA 5JJCA 1N2OA 2JAUA 4OA5A 3B48A 1AIPA 4PAMA 5L9AA 2WU0A 2R79A 2OFPA 4MR8A 4PZCA 3SE7A 1YMUA 2ERXA 3E2MA 4IGIA 4B3SB 2C2KA 1VBNA 4FYMA 3TE6A 1A98A 2RGUA 1X19A 3IPXA 3SMQA 1E2GA 1XKLA 3PC8A 5LBIA 4RSHA 3S40A 1KZHA 1AQNA 4BE7B 2ZIAA 3EEIA 1VBMA 4GI1A 3AY7A 1M2VB 4OM8A 4RM3A 1JR6A 1WB5A 5C8DA 2HR1A 3M6FA 3E9DA 3PHCA 2Q4TA 2YYZA 4XPIA 3CLRC 3SBXA 3WLQA 3UK0A 2XZOA 4RJ2A 1AU9A 3HACA 4ZOBA 1Z29A 2WB2A 3W6ZA 3ILVA 3ANTA 4Z9YA 1YE3A 2X6RA 2XWQA 3OPQA 4IUCS 1BMDA 1HDOA 3C3CA 3SR0A 5JDCA 4G0OA 1EI9A 2VXYA 3FSGA 4P4TA 4Q3OA 3GJZA 5FWAA 1NVDA 2WOJA 3JQQA 4ONEA 4R81A 2G9NA 3UUWA 1OLUB 2DUUA 2OXRA 4N8EA 2W6PA 4Z8XA 1ISMA 2QX6A 1Y1LA 5B2ZA 3RNLA 3LU1A 3WRYC 4AZWA 3QA9A 2DBYA 5SYMA 4BNIA 2EIXA 3JV7A 1A76A 2WJ4A 2DRIA 5A3QA 2CK3A 4YAJA 1E5VA 2Y0EA 4RPLA 2JLXA 4IBOA 5J2TB 1ZHFA 4HDCA 1KDZA 4PHTA 1O57A 5FPHA 3LKZA 1JP7A 4XM1A 1X7WB 2GXQA 2HK6A 2FPXA 3QLUC 4FSHA 5BV2P 3GLKA 1XLTA 1YACA 1TJNA 2BKVA 3NDRA 5K2MA 3RE1A 3IBTA 3QE9Y 1EBBA 1ESMA 4J7AA 3T3HA 3OZCA 2FDXA 2HHJA 3I58A 4YJKA 3ORQA 3PXXA 4ABTA 5G0UA 5G1PA 1CRZA 1E0AA 1Q12A 2GYUA 1GVHA 4ER7A 2VK4A 1KNQA 4TQGA 4QQFA 1TM1E 3AI3A 1OI3A 5F64A 3KB2A 2D0OB 3MVEA 5F3DA 4XAQA 3U7HB 4Y8VA 4LN1A 3GAMA 3L7YA 1FDIA 3CZ4A 1N0IA 5K6AA 1UPUA 3R6WA 3IESA 4LC0A 2EJBA 3VNQA 1CS0B 1GNLA 4QVGA 2W2MA 4OHZA 2LUOA 3M4XA 1JHQA 1HO3A 5EZYF 3VH3A 4BVHA 4E2ZA 2HPAA 4Z7NB 2GSWA 3SQDA 3VHRA 1V2HE 4NPAA 5CA1A 1SNYA 1TMKA 5AM3A 1JEYB 1PLLA 3BIOA 4ETIA 5F35A 1TCAA 4OMUA 1ZMBA 3S7ZA 1BGVA 1IB6A 1BC5A 1M5TA 4OHFA 3TW8B 4X7PA 2HX1A 3OZGA 4KOAA 3GF4A 4KFTA 4RF5A 2D5IA 3V1TC 1A8SA 1NYLA 3RD5A 1EU1A 2BSAA 2BGRA 3H5VA 4PX9A 3COPA 2B1IA 1ZI6A 3OT1B 3H1FA 1M0EA 2AIRA 3JASB 4KQ1A 4MUFA 4DA4A 3VAYA 1I94B 3D3NA 4UEWA 3V42A 3GVPA 5TNXA 5AJWA 1Q95A 1VRCA 3M83A 4LPKA 1L7EA 4CIWA 3CX4A 2HPZA 3CRQA 1T9CA 2IOHA 3TX2A 1DX9A 3FLMA 1JQLB 3UEOA 1QGZA 3E22A 1R4NA 1XN1A 3LUFA 4NECA 3N87A 2COKA 2SCUB 3JQPA 4EM6A 2JVIA 3EUFA 1JXOA 4UPDA 2BFBB 1E79D 1S8FA 3A1TA 4Z4FA 2XIQA 3SJAA 5F2EA 3H2HA 2PUBA 1PHPA 4JNKA 4HLCA 4M87A 3AVUA 4U5XA 2V7QD 1G5QA 5D86A 1ECBA 1K9SA 4LGMA 4NBLA 3RUFA 2HEGA 1B41A 4MJXA 4ZOQI 3K8OE 3K94A 3WJ2A 2XAAA 2WV9A 2A9RA 2PGLA 2CV1A 3L7OA 1GU7A 1A4RA 1YUBA 3T7CA 2QSJA 3GNQA 5HQJA 4DIEA 4BAGA 4YI5A 2AEJA 1KO4A 3NALA 3A10A 3ZG6A 2ZVPX 4YLYA 1H05A 3ZBUA 1OYOA 2D2FA 3TN7A 4B9EA 1NAIA 2CJYA 3DEHA 4QXOA 3MN1A 3DZBA 2QAIA 3HL0A 2R47A 4G1EB 1LPPA 4U0KA 1SEVA 5IZCA 2NNWB 2Q1WA 3VH2A 4FNGA 2J46A 1VG0B 1R4AA 3DT9A 621PA 3HU1A 4RYLA 2H1VA 4I8DA 3G0IA 4XB1A 3OHMA 1NU8A 2GZHA 3NBMA 2V0NA 4OUDA 4EATA 2Q1UA 1SCQA 3QI7A 2A5GA 3ODGA 2Y4OA 4DCOA 2QN1A 3H2JA 3LQ2A 4NJOA 2WI8A 5AI5A 1G8PA 1M9NA 4D4MA 3VR3A 4M0KA 2ZRHA 3BMOA 3LL7A 3HU2A 1SCKA 4ZO6A 2XXBA 2A5DA 2A6PA 1UWVA 5K3BA 3ZN2A 2IS4A 1VSUA 5FYQA 4LOIA 4OY3A 3KZKA 3B3JA 4JDUA 2ISCA 3G3EA 5EP4A 3ZU5A 5JAUA 4JEHA 3CWZA 3K70B 4MARA 2OORA 1X13A 4G0PA 2R8RA 1CRWG 1NR5A 4YDQA 1WUTA 4M49A 5EL0A 5JY6A 3PFIA 1M54A 3H42B 1PZNA 2H1WA 2ONKA 1RI1A 2CJPA 2FWJA 1MEOA 2PUVA 2IBMA 1XNJA 5FV7A 3EIUA 3LYAA 5EVCA 3LLCA 3T5TA 3TAUA 5A2GA 3L6OO 4F4HA 3HVJA 4BOYA 4Z3OA 2C3PA 4BVFA 2HW8A 3C3YA 5BQPA 4JUIA 1M2OB 1CZNA 1DFGA 3O38A 2JK0A 4N5LA 1QGED 4YCJA 5AVQA 1AQ6A 3BAFA 1NVMB 2WA2A 4DDKA 2HQOA 3HBAA 5CYPA 4ZVVA 3H84A 1KI6B 1ORVA 1TQ6A 4N1AA 4QLBA 2QIOA 5K6AC 3PZBA 4AWXA 2RK6A 5LM3A 1NW7A 1G2PA 3ONWA 3WTCA 2H0RA 4GH5A 5AK0A 4JWTA 1I3OA 1PJCA 2UZ3A 1DKUA 2H29A 4FFOA 2GPWA 5WRFA 4A03A 1RMQA 1OH8A 1PR4A 4MHOA 3VU9A 3T3DA 4CM1A 3QKWA 1L1FA 5A2QA 2B94A 5CLHA 1IJFA 1R10A 4BKMA 1QCDA 2B9EA 5FHQA 1KC3A 4JBIA 2ZJ0A 4UXIA 4GX2A 1MKYA 1TZ2A 2HLNA 5JRJA 5C7IO 4OAPA 4K1XA 5C5EA 1GUBA 3K0KA 1PFQA 1PL7A 3KHSA 5CA1B 3T52A 1CXZA 1T26A 3UUFA 1VPLA 3OF2A 5DNCA 4BXOB 4ZRNA 4U8GA 5CDYA 1W94A 4W8HA 5FTWA 1TZMA 1SIOA 1ZICA 1JR3A 2I8LA 1E6EA 2P9GA 2VOJA 3LHFA 4G97A 1JJBA 2C9OA 2ZI4A 4NV3A 2C00A 4D6XA 5BT8A 5HGXA 4B80A 5JAIA 5JSHA 3AUYA 3Q85A 4ND8A 2OGUA 4JLWA 4Z7OB 5AW7A 2MSLA 4KDCA 4OAOA 2H4YA 1NQXA 3LVBA 2D3TA 4D98A 1W59A 1ZG3A 2Y05A 4NMLA 4YJ2B 1G7CA 4ZVOA 4GOJA 1IBMB 3HXQA 3DV0B 3Q88A 3FPBA 3V8RA 1YZVA 1ILWA 1X7XA 3LW7A 1OPRA 4UREA 3A1VA 5AHWA 3MINB 1DXYA 4JI0B 1HT2E 1TK3A 1P9RA 2DGDA 3RWMB 2ZZMA 1IH8A 2VHTA 5JASA 1W19A 3H16A 3IUBA 4I9NA 1ISIA 5B36A 3P9XA 1GFZA 4QGFA 1USKA 3GP8A 4EGAA 1KFKB 1VI6A 1E2QA 1YUMA 3BH0A 4CV3A 4I5FA 3CW9A 3IGFA 1UMDA 2I9PA 1RJGA 4NMHA 1UKVY 4QG7A 2BDUA 3MT9A 4CF4A 4XM0A 4C76A 2XUKA 3CF6R 1AV7A 3FZYA 3IXMA 3D5QA 1FNDA 3JYPA 3UV3A 2CUKA 1T8RA 1YTLA 3RS0A 3IL2A 1Y37A 3GMIA 2HWYA 4OHOA 1ZUWA 2YN4A 3HNPA 2Q3JA 3G0BA 2IA5A 3UXHA 3V9PA 1GTZA 1Y7PA 4R8SA 4MI6A 1EZ1A 4BEVA 3CURA 1QHGA 3WYDA 2ONJA 2IHNA 4M9XA 4B76A 3WGUA 1T3ZA 3OZVA 5CB0A 3WSTA 1JPNA 4INPA 4L16A 2HV8A 2XKBA 1J0DA 1N6LA 2FGKA 2BFWA 2VPPA 3I2KA 5BW6B 4C7BA 1T91A 2IU0A 2OGTA 1UFRA 3I2GA 1RVDA 4I1RA 1XWFA 3A04A 4QT0A 2Z3ZA 4EB6B 1GNRA 1RIIA 4C08A 2GGSA 4IIJF 3KZ1E 2PGJA 4EY5A 3TRIA 5LJIA 2FR1A 3FR8A 3FPJA 5DLDA 2EERA 2J3DA 3IP5A 4QDJA 3IMGA 2NXNA 3KZVA 3C8MA 1UC5B 3M49A 2FQYA 3MMXA 5E6UB 1IQPA 3DOUA 1GARA 1PV2A 4X41A 1DOZA 3SC2A 3WQQA 4CKEA 4EQ6B 4EX6A 4IIEA 4OLBA 3QMMA 2QUIA 2EJTA 3FMPB 4HQLA 3DVRX 2ZCVA 1HOTA 1M3SA 4HKTA 3VKHA 2AG1A 1PQ4A 3OJOA 2C58A 3IHWA 1PFVA 2FEXA 2KHZA 3NRBA 1KSGA 4BCBA 1QIEA 1XB2A 1ZGAA 2MYTA 1GQ2A 3B20A 3VPHA 4BX2A 2IV7A 2AL7A 1FQJA 1U7XA 3AP1A 3ZY4A 1XPOA 1YZTA 2UXCB 2ZTUA 5EQDA 3RRXA 5DX1A 4H15A 5L8VA 3ELWA 4WKOA 2P2GA 5KJ6A 4C2UA 3HA5A 2F55A 2XTAA 4OD0A 1DBIA 1EDBA 1GUDA 2RHGB 5DTJA 5K51A 1K4MA 4MDFA 3TRFA 4KR6A 2PBZA 4Q4DA 3JW8A 1GTSA 2Y2VA 1L4UA 2FW9A 3BJRA 2ZQYA 2WABA 1H0HA 2G1KA 4NNOA 1G7SA 1DRJA 4E70A 1G66A 4PAOA 2R1VA 4HCJA 5JR3A 4ZA2A 3TNDA 3PQCA 1M6HA 1X7WA 5AK6A 4NE7A 1WB9A 6Q21A 3MPOA 3TJRA 2HSJA 3LX8A 2VCYA 3C6YA 4FD2A 2IXEA 1Q7BA 3GFPA 4XQ0A 5EE3A 1UQRA 4HNSA 3T9BA 4EZBA 4EY8A 2H3EA 2VF8A 1JFSA 3ZDDA 1TVKA 3G68A 3QLEA 5BV8A 3DEZA 3QW4B 1L8AA 3WLPA 3DLBA 1CFJA 2CSXA 4UCXA 3IV9A 1KQOA 3M1IA 5DTRA 5GQSA 1XF1A 2GM9A 1PIWA 2QZJA 3P0HA 2ZS7A 1BMFA 1Z0DA 3TINA 4I5DA 2BM0A 2ZUTA 2FXVA 2JATA 3VOAA 2F8SA 1G42A 3VDXA 4B8WA 5K6TA 3OCWA 1EVEA 5SICE 2HWKA 1CY6A 3FUTA 3D4NA 2Y1OA 4Z9BA 2HMUA 2EF1A 5SV2A 3OLZA 5CB4B 4U2EA 2WUFA 3FNRA 3D8BA 4Q6BA 3CA8A 5GJWC 4RA6A 4CM4B 1TU4A 2GN6A 3TQOA 1J6UA 4UM9D 3W3ZB 3LVRE 3ZS9A 4HDNB 1MX9A 1RTTA 1ZLYA 3AEQA 4D4JA 4TKVA 2O4UX 2PYDA 4IQGA 4CF3A 1QMGA 3ZY5A 4F71A 1DC7A 2FSIA 6CHYA 1U80A 4OXKA 3CMCO 2DPYA 3I62A 4KI7A 4AZSA 5IF3A 3S1LA 2WZCA 4J0FA 1ETHA 3R5XA 4ZEOA 3HO8A 4E0BA 4MWSA 2F90A 1VCIA 5C1DA 2M1XA 2JS7A 3UPUA 1F8FA 4FKBA 3HU3A 4IKOA 4LF6B 8MHTA 1P44A 4Y6QA 1BWRA 4NZOA 3CVJA 5F7XA 2QL7A 2XCRB 2H31A 1P18A 2WHQA 4NYIQ 3LCUA 3OIGA 3O8LA 5EE9A 2GN9A 3BMCB 4O59O 1XLWA 1GYRA 1H85A 1UJMA 1Z4KA 1SVIA 3BDIA 1Z8FA 3IBSA 1YDFA 4BV9A 1ENYA 3RG8A 4CJXA 2H2FA 1WBBA 4L5JA 1B23P 1IBSA 3A6GA 1PQPA 3ILSA 4WOPA 2PE5A 3VC7A 1DEAA 3R3VA 5KMGB 4NVRA 4EB0A 1RCUA 2ZIEA 4ENVA 4QM6A 1X15A 1WHSB 4MKGA 2YJNA 1Q0LA 3CISA 4JU8A 4WXYB 4YCBA 5DHSA 1Z75A 4F85A 4AKHA 4RK0A 3HABA 4RVNA 1BOOA 3I9KA 3O2QB 3RBVA 5L3SB 5T7BA 1KFJB 2YXNA 3BERA 4ZDJA 3W8EA 4JC0A 4KGZA 1P4RA 2UZ1B 4HTFB 3A58B 4MQEB 1J8YF 3ICWA 1GR0A 5D00A 3Q3EA 2W2KB 1RAEA 4M1QA 5DLQC 1EP1B 1NHGA 5KO2A 2RGGA 1S4QA 2OXEA 1EM8B 2CVOA 2K2QB 2DWPA 2XYVA 4CR8A 2PXAA 3VX4A 4J0DA 4WNIA 2OKCA 1U98A 3N0VA 3SJUA 3NHBA 4O6VA 5F12A 1ISPA 5BSKA 3NUZA 4ZYZA 721PA 4RD0A 2X1VA 1CR2A 1N2HA 2QD2A 1TIKA 5KSWB 3RYCA 1I01A 2ZYAA 5IWAB 4EARA 2P6RA 3WLAA 4UC0A 3PR3A 3G5TA 1PR3A 4Q9NA 1SJ9A 2HU2A 4GGPA 4IWXA 1XZNA 1TM7E 2QP9X 4EABA 2W11A 1IXKA 3EAGA 4QD3A 3L7NA 1H5QA 1S0UA 1O9HA 4Q7MB 4CDGA 2DWCA 5AD1A 4YV7A 3VMFA 3ICQB 3QPBA 5CVDA 5ARDA 2QL9A 1OI7A 2QP4A 2RHTA 3EZGA 3JTEA 3RROA 5CXQA 2BELA 1N5RA 2JHFA 3AFMA 2ZBGA 3RJ5A 3ZCTA 3K9GA 3B82A 1V1MB 2PKCA 5CT8A 1X7YB 2ONCA 4XIIA 4YONB 4BL5A 1WJGA 4F93B 1R0WA 4UM7A 3HA3A 1TEZA 4OYRA 1C0EA 1E7MA 4NEHB 1OUMA 1KIAA 1M67A 2OQRA 4KXWA 1LI4A 1PZGA 2FW6A 2C2OA 4XD7A 4PS0A 4OBWA 3VMMA 4IFEA 2JGMA 3RT7A 1RKUA 2Y92A 3EXIA 4FSDA 4UJ5A 1T2CA 3L1VA 5ALJA 2MSCB 1EYZA 3K8ZA 4CG1A 4UM9B 1DARA 1G5FA 2W2OA 5LXTA 3UK7A 5K7SA 1G21B 2ETVA 2IYPA 1DADA 1PGJA 4ARZB 4QOEA 4WKBA 1H3EA 3N2NA 1BMFD 3LBYA 1NJ1A 2ZRLA 2GK3A 1DEXA 4RQAA 2O0MA 4RTMA 1R64A 4MV6A 1SHJA 4PPQA 4QEKA 5B5SA 4ZJZA 5KYWB 2F8TA 1WULS 4P3XA 2VHJA 4IX9A 2OHJA 5EUBA 3TM4A 3AW9A 3W6UA 2PX6A 2QUKA 3L01A 4XR9A 2V3VA 4JKYA 5ADWA 2HIHA 4FHDA 1OXVA 1Z8HA 2NZUG 2XV1A 4QOGA 4H7HA 4PFJA 1DBVO 3ZI0A 1TRKA 5CDUA 2QTTA 3FPSA 4YMGA 4ZYVA 3W5CA 2JG3A 1G20E 1YULA 2OLKA 4N47A 2RDMA 5A7FA 4W5QA 2Q4DA 2WEKA 4ZAFA 3DTNA 4QYWA 4C7OB 1NI3A 3BCHA 1Z7EA 3LC0A 5FBVB 4LSWA 2G4CA 2TMDA 3SEQA 3DKRA 4UD2A 1UAYA 4PZPA 1KA9H 5FUXA 2FX3A 4J1NA 4TSKA 3QVVA 4IXTA 2BGJA 3OCCA 3N8GA 5TVKA 2BFEB 2PX8A 5K6RA 1DUVG 2PCJA 1XIVA 5E6RA 3V9AA 5E9WA 3M33A 2Q3FA 5FLKA 1A95A 5DWDA 3H8WA 4JQYA 1KEUA 3TQQA 1QQ5A 2DQZA 3UMMA 1U5CA 2QV0A 2UYYA 3NOXA 1E89A 1EVQA 1QH0A 1VHJA 2B5VA 2CYAA 2RAUA 3JYHA 1GZHB 4DLUA 4G4GA 4Y1FA 5AW8A 3GLIE 5EOVA 3ANXA 4KZPA 3N75A 3UMFA 1T3LA 4CT0A 3G79A 1Y3IA 2R1ZA 4LF8B 3SDSA 1W4AA 4ZK2A 3PP8A 4A2PA 2CLSA 1N4DA 3GT3A 4X9XA 1XF9A 4CG2A 3A4IA 5B1IA 2EJWA 3P96A 4JFAA 3KTDA 1GRVA 2ES4A 4RHEA 3IX7A 5HIIA 1K3TA 2PRSA 1CS0A 3MMNA 4UZFA 3WXMA 3U60B 1MOSA 2B92A 1MT3A 3D5EA 4M76B 2OXIA 5I7EA 3W9YA 5L40A 1ICEA 2Y0BA 4FFPA 2XA9A 2VZ0A 3J81A 5CB4F 3CVUA 4TV8F 4BNUA 1ADCA 3E1KA 5FTKA 1I7PA 3AONB 3ETEA 4U2CA 3ZY3A 4W99A 3AEYA 4JUDX 3ZU4A 1R18A 2ZQ5A 5HKOA 3IJRA 4HQRA 1TTTA 4E3ZA 1U9JA 1YA8A 4DR7B 3OKFA 5LPNA 1KDPA 2RK3A 4LNHA 2YWRA 3PU6A 1K27A 1U8YA 4DDTA 4YMUA 1CUJA 4NK5A 3ZDAA 4RY2A 1NIPA 3DNMA 4OU5A 4PYIA 4UHKA 1NMZA 4MVYA 4XUDA 5KJFA 5CPBA 5BMVF 1OAOA 3QF4A 3EXHB 2DH6A 4L4YA 4QTUB 4GLBA 2FZLA 4C22A 4AKEA 2NGRA 1A5ZA 4KC0A 5J58A 4C6TB 2BT4A 3AHGA 5CBKA 5DGXA 5ESWA 4QUDA 1SULA 1SUEA 1US8B 4ALJA 1II0A 4PLVA 1AMOA 3TLZA 3LLSA 5G4LA 3E9EA 2P3QA 2W83A 3CWCA 1Z39A 2QTVB 1XAJA 1BVRA 2IUFA 3H0CA 3KAKA 4DLYA 1CX9B 1HURA 7ABPA 5F98A 2X6QA 3OKAA 3A4NA 4K9RA 4F2WA 4EGSA 3BCRA 2IYZA 2QE6A 1A5AB 1J22A 1KMIY 3B36A 2CHQA 4BP3A 3OZFA 3R3SA 3DEYX 4H27A 2XUQA 3RHZA 3E9NA 4BO3A 4M0MA 4AO6A 3OHPA 1WCWA 3B6KA 3L1JA 5KYUA 2HWUA 2GX6A 3ESCA 1J8FA 1OAAA 2ZRCA 1N2IA 2F3PA 2WUWE 1C9YA 3EQ8A 2WJPA 3FCAA 3H5LA 3QE3A 2WIAA 4GPD1 1PF7E 2C2YA 1SCDA 3DAOA 3WGIA 4JYZA 1GPYA 2Q45A 1CE8B 4DSTA 3K35A 1XEXB 5ALZA 2O50A 1C9EA 3OQPA 2B7CA 1RQ2A 4M46A 3UHFA 2O1WA 2GCOA 1TU3A 3W5IA 3IP6A 3GBVA 1L1RA 2HI0A 4AJIA 1HQDA 3C6ZA 4WEOA 1ACJA 4CMGA 1EESA 2H00A 4B09A 4OX9B 3DAHA 2ZU0C 3ZHZA 1L1QA 3TSWA 1RYZA 4P5DA 3BTVA 3WRYA 2OMKA 2X3FA 3K20A 3O0TA 5HF8A 4ZI7A 3PJGA 3RIYA 4EKEA 4C30A 4JKIA 2PO7A 3L0PA 3IQGX 2ZJBA 1GGHA 3U3ZA 4DE5A 1HQKA 1F7UA 1KH1A 3JWPA 4BKRA 2ENUA 1B0PA 5ALLA 3BSYA 3D7LA 2QVGA 1T8WA 5E9AA 3LZDA 5CM2Z 3VU1A 4B3IA 1S3GA 4XYBA 2ZE8A 3BAZA 2BEUA 5BOVA 3HKDB 1L4HA 1HEUA 2FW7A 4RX1A 3VGPA 1X3SA 1Q77A 1YDHA 2YJ6A 3B6IA 1G4UR 3QE2A 4M83A 4BU1A 1G6KA 3S2FA 1H66A 1HBJA 4IV5A 4CU5A 1UIRA 4ZYYA 2HMYB 2IPLA 5DWVA 5KYUB 1OLSA 4WK6A 1W46A 4C0AC 4NFYA 1LLDA 1SKBA 3G9ZA 4WKNA 1PFKA 2B21A 2HDNB 3SHVA 5HMLA 2HH9A 1TJYA 1OB5A 4UE3S 3TFQA 1CJTC 4HS4A 2H7CA 4IOKA 3VOBA 4OLHA 3I2YX 1KI3A 1VL2A 3LA8A 3OCJA 3CN7A 3H75A 3Q6MA 1FVHA 2FR0A 2Q8NA 2GUWA 3CR8A 3M4YA 3TEJA 4DTCA 1L5HA 1DE0A 4YO7A 1ZK4A 3KLPX 5FOWA 1M5RA 3BE6A 1JQAA 3F97A 1NR7A 4PLCA 5K3AA 4B4WA 2A0UA 4H17A 3OTOB 3PRYA 2OORC 3GG9A 4O4HF 4DIDA 2BJVA 5ES3A 2E9SA 4B6JA 2AR9A 4DARA 4ETMA 1DKNA 4DS3A 2WHXA 1TQ8A 4H6PA 4YRZA 2GEVA 4KQGA 3NT4A 2WAAA 4ZXFA 2Z95A 2X0DA 1UBOS 4Y6PA 5F3WB 2WKWA 2P2ZA 4EH1A 3V3KA 4BQOA 1M6YA 4PBRA 1XV5A 1J2JA 1P0QA 5DM60 2MSEB 3EEBA 2BFFB 4DVJA 4QZVA 5LZ9A 4C6TA 1FEZA 3S5JA 4F7WA 4Q3BA 3R0JA 5CUQA 2QX4A 1IIBA 3R3WA 1Y6RA 1QK4A 3MWYW 5A9RA 1TFRA 2ZI5A 4JLUA 3RJMA 3RYIA 1MXFA 1OBCA 4V3CA 1VECA 3LTNC 1JKXA 3P9PA 1HY3A 5IT4A 4F0JA 5KNBA 2WU3A 1V5IA 2XUAA 5CJJA 4IQ8A 2C8VA 3TW0A 4ARZA 1Z0SA 2V74B 3T1HB 1XEAA 1FFXA 2EFHB 1VI5A 2X13A 2BUBA 2GCIA 1FDUA 2Y6UA 1DO8A 5K4AA 4FQ8A 1WX1A 2BFEA 1IY1A 4H7EA 1ZCAA 5EE5B 5BN5A 4GQIA 1I0LA 2QN7A 4RV9A 1Y4DE 2R6JA 4N5MA 5DNEA 4DMUB 3DFZA 1CY1A 4F6LA 1APBA 2GHTA 2JFQA 3DTTA 2PSJA 1TCUA 4FXPA 5CT9A 1C3XA 4JP2A 4P34A 4BNXA 2E21A 3GZTB 3IB3A 4OMFG 3OBBA 4QUBA 4U2GA 4U7GA 4UMVA 3IALA 2V9PA 1ZOLA 1EFLA 2EKDA 3P71T 1U2SA 2G0TA 4NJEA 5FBZA 2D0DA 3CSUA 4C4YA 4EG1A 3LFUA 4QU9A 2W93A 2AVDA 2MSKA 1OCEA 2WLSA 2ZE5A 1LI5A 1LXCA 3KUCA 3V7YA 4DC1A 4ZI7B 3R3JA 1XVIA 1CDZA 1M33A 2CZCA 5IJWA 5C1OA 4W5NA 1LSSA 2CHUA 2YY6A 4JI2B 1DTSA 5JSZB 5ICMA 3OI7A 1N2BA 1AO0A 3T3OA 4D80A 3QW2A 1I7LA 4X5OA 4AZVA 1DKPA 1NXVA 3FLEA 4NY1A 2BI8A 1WCV1 2BUCA 1T36A 1UOQA 1NXOA 4Y1GA 5HUQA 1LC3A 4JODA 1TECE 3M6MD 4OI4A 1EFAA 3WWPA 3HP7A 1IAQA 3P20A 3HO1A 2MINA 3NAMA 5BVGB 4NXMB 2QAGA 1EK2A 1N6PA 2FQXA 3IULA 3IHKA 2X8BA 4UE2A 2NUPB 4DV2B 1KP2A 3N8DA 3ERCA 1HFEL 2NTYC 3C3WA 4IM7A 4YA6A 4IS2A 4X8MA 1SA0B 1AKQA 3PIRA 4DR4B 3DHWC 3REGA 4CGYA 3RJTA 3T15A 3RPEA 3E53A 3WB0A 5DOZA 3CN9A 1YJAA 3D4LA 1DOHA 1W85A 2FETA 3CRVA 3V4PB 3IE2A 4ER0A 2A92A 4UBOA 5EZYB 1ZD4A 2ZSKA 1PSDA 5LA6F 1WTCA 2QLNA 1JNXX 1J21A 5J2TF 5HYVA 4GMXA 2WVGA 3LGSA 4EL0A 3VZRA 1EJ6A 2C3UA 2GVZC 3G2PA 4BWYA 3ISVA 2QTNA 3HWRA 3NOVA 3FJOA 2R0QC 3S2GA 3W8NA 4K9QA 4CR7A 3CF2A 1IZ7A 2R4UA 4FXOA 1N1MA 1R8QA 1HDIA 1TT7A 2V54A 2VZLA 4J9UE 1NP3A 1U9CA 2P4QA 1F3LA 1KAHA 2VT7A 3VJKA 3M3HA 4NOLA 2R6AA 4RACA 3ZH2A 3WBBA 4Q4LA 5BWCA 3TSYA 3MJFA 1U9YA 1ZM9A 3NXSA 3UT0A 1RJDA 2NSHA 2P9CA 5D3QA 4R5MA 3RTCA 1ZL0A 5FJIA 3WK8A 4DGQA 2ZR7A 4M2LA 3V32A 1XEWX 2R1UA 2AQHA 5E8JA 6NULA 1W4BA 2HHCA 1A72A 1LGYA 1ZH2A 2YJ4A 4PZYA 3H1EA 1E8MA 1NVXQ 4JSYA 3P4YA 4LPSA 3AEUB 4Z0HO 5HHTA 3T3IA 2GBPA 5G4KB 1PKEA 4X3PA 3AF2A 3X43A 1QS0A 4UAGA 3TQRA 2AB0A 4Z1OA 3A3OA 1EBFA 3R7WA 2C9CA 1ZPDA 2IYYA 3GVCA 5AUOB 3WB1A 4IOJA 5CW1A 1F4PA 2AQIA 3A11A 4BV3A 5IXSA 1QCZA 1XJCA 5TPZA 1JH9A 4X94A 1SOMA 2WV7A 1HDEA 3M5PA 1EFKA 1F9AA 4KQFA 3UBMA 2P9JA 1OX6A 2J7PA 3CEPB 3JTMA 1JEEA 2DBVO 3KZXA 1DWQA 4LDJA 1UC4B 3MYRA 4IYJA 2FX5A 1Q74A 1XZIA 4EI9A 1AS0A 2AMJA 2FRXA 2QUBA 5CM8B 1ONBA 2AK3A 3B1VA 3HCPA 4UQOA 3J80A 5U4QA 4YWJA 2WINI 4ZV4A 1K8ZB 1GGNA 4V3BA 5KVQA 1QVWA 5EZ6B 4EHBA 1MAUA 1W49A 1JJVA 3OFND 3GK3A 1V8BA 4MX8A 4RZQA 4TQAA 3EEQA 4WXRA 5TQJA 1XMQB 4A5SA 1OZHA 1LJ8A 4TWRA 3H5OA 5F52A 1W0CA 3KOZA 3L4EA 1J97A 2O59A 5AI6A 2WFAA 3NT5A 5EJ5A 3WMWA 4X6YA 1X74A 1S3IA 2AKAB 4XX0A 1VPWA 1XMVA 3BXPA 1LDBA 1SB9A 3IQZA 3LDHA 3OJWA 5BQXA 4DJ5X 4GZ5A 121PA 3NRJA 3FJYA 4EENA 2XUOA 2A67A 3Q5EA 4ZJUA 3QVTA 5CCXA 2F8MA 3H11B 3ZNQA 1XA0A 3UMYA 1P4AA 3EGXA 3NTVA 2IXAA 2NYVA 5ILQA 3O2SB 3R7WB 2Y1EA 4HY3A 4TZ0A 3NBQA 4URUR 4R2HA 3OMWA 3LNCA 2IYTA 1G9XA 3D1VA 3P9YA 5HK9A 1YR2A 4UBIA 5DCWA 3W05A 4XKJA 3B5EA 2WU4A 4KB5A 4KYVA 2CF5A 4M1KA 3ACBA 4RVSA 2BKUA 5JH7F 4FCWA 1IYZA 2RAVA 2B1RA 1LRKA 1XMJA 1NBMA 4JROA 3AB8A 4WZAE 4XM2A 2HCRA 1JHAA 3G6WA 3F4KA 3LLUA 1N2CB 2O8CA 1GL3A 2QRZA 1WOYA 2RH8A 2VWQA 1SXJC 2GRAA 3IRUA 4D9CA 1GFSA 1WDKA 3EBPA 1HOXA 3GFSA 1HKHA 4WECA 2OZLB 3JVIA 1H4TA 2VK2A 1AKEA 3VXKA 1ZH8A 1T1IA 2PZMA 2Q8QA 3PD0A 3OEEA 3KQNA 1F8GA 4YDHB 4JOBA 4DNPA 4Y9SA 5T3YA 2XGSA 3TEMA 4DPLA 3WAGA 2KB0A 3W3AA 3U26A 3FNFA 4D9IA 1RQNA 2H2AA 4BNFA 2I7DA 3REOA 2B2NA 4HPWA 3CZ9A 3HV2A 2H1FA 1LWNA 2WUVA 4QUJA 3QUTA 5BRAA 3F1LA 4R2IA 3SJBA 4M99A 4YRRA 3TZKA 4GBED 4ZHSA 3I5UA 5ELMA 3JYLA 3UATA 4EJFA 2HK9A 4CEIB 3NVAA 4NBTA 1JLRA 3KX2A 2D5CA 1PN3A 3WLIA 4DJFC 2IY7A 2ZS9A 3AHHA 3IJPA 1T2UA 3R0QA 4KDFA 3ND9A 5BXYA 4MMYB 4RKRA 2HBRA 1GZUA 2G76A 4ZO4A 4AIIA 4HDAA 2WT4A 1Q17A 1UANA 1TE2A 3ESQA 1EFDN 1GNSA 4TQ9A 3S4YA 2Y9MB 2R7LA 4FYKA 1RZ3A 4DBVO 3EZFA 2GZAA 3EQ2A 3OPXA 2F4NA 3AOEA 3P8ZA 4BLQA 3ETLA 5AXAA 4BP1A 1K5HA 3TTYA 5KNBH 4UEQA 2YZ2A 2F2TA 4PVCA 5KU1A 2JAHA 4Y2XA 1MAAA 2B36A 1XZAA 4J3JA 1KEKA 2O2SA 3M6IA 3F73A 4LF5B 4PC6A 1LLFA 2G6BA 2I2DA 4FDAA 5C8YF 2ATIA 2QAJA 2VNAA 4WKCA 1FOEB 5DBIA 1SO8A 2HFKA 4FEGA 4NCJA 4OP3A 5FQOA 3HGTA 3ZYZA 3BJMA 1MR3F 2C5AA 5HDQA 2AXNA 3C6KA 3SZRA 3TTVA 4OGWA 1QK3A 3G6KA 5K01A 3RW9A 5KEIA 2I6SA 2IODA 1XC7A 3ELBA 1MGOA 3K2QA 4CQLA 1GV1A 3RARA 3P19A 3BWCA 3QQ5A 4WK2B 4DV6B 4O1HA 3L8CA 2HSZA 2UYCA 2IZOA 3RSQA 2ILTA 3FZNA 4NESA 4PC2A 5AQ1A 5HQTA 4I50B 2HM7A 1CUCA 2B20A 2ZAMA 4Z4EA 3HJUA 5A7HA 5KVCA 3ESBA 2AJBA 1KH2A 1BXRA 2GZSA 2X4IA 2OHGA 3GDHA 3W3AH 4GZ3A 2O57A 4KDRA 1YZQA 2YBDA 4G67A 2HYIC 1RQXA 1AX9A 2HEIA 2VWHA 3FF4A 5EKUA 1JGTA 3L7LA 4QQNA 3OU6A 2VJMB 1T5LA 4OI2A 1CB7A 4GF5A 3WGMA 3AK4A 4RPCA 2WF7A 1Z0AA 4NLLA 4CT5A 4WH0A 3L92A 4KKXB 1U2DA 3GFFA 4G0NA 1AKWA 1DKOA 1SUIA 2YIMA 4GX0A 4ILEA 4LYHA 4QXRA 4D42A 3IOCA 1ODKA 4G8DA 1T6BY 2AT1A 2YNMA 1H5NA 1GSHA 1WMSA 2EHJA 2NO6A 3FWYA 5AMXA 3ID6C 4PG4A 5K0SA 3ZVNA 3INYA 3C5VA 3EPRA 3ZWYA 2RSLA 5FYDA 2D74A 1Y6GA 5DN6A 4RH1A 4COOA 2X0KA 4TS9A 3ZK7A 3PHHA 5TQ2A 3ZWPA 1Z9BA 1CUYA 1JAIA 1MG5A 4LAFA 4KXVA 3FHOA 1LNZA 3TB4A 2P11A 1NLUA 1AZSC 5T4HA 4KRYA 2XGOA 4L08A 3WGHA 4F3CA 2NVUA 5DHAA 4KZKA 3RVBA 3K1ZA 2YY7A 3MJSA 4TS3A 4DDWA 2W2TA 4PF1A 4UARA 2O2ZA 3IP1A 2PWYA 1EXMA 2OPBA 3OOWA 2JEZA 3E7WA 3NGMA 1KVQA 4OQXA 2FF5A 4CEHB 3WGLA 1OGJA 2CL7X 4IDFA 2DHEA 2P6MA 2OQIA 4E5KA 1M0TA 1H22A 5D85A 1RXWA 4S0XA 3ZLUA 1GXSA 3MSCA 3EWAA 3SPXA 5JVDF 3E4DA 3AWDA 3KV3O 5F5XA 5CB6A 1AMNA 2KQUA 4D3ZA 4BPBA 4P83A 4YT4A 1DHRA 1JHUA 1XE3A 2Y1DA 3ZE9A 5KU7A 3OA0A 2Y0DA 3CLTD 5G1OA 5KDOA 3FUUA 5LXTB 3OP4A 4FDVA 2BMWA 2ET6A 4JB2A 2VUIB 4Q0MA 5K8IA 4YMWA 3NBXX 1T5HX 1T5BA 4MV3A 3P2EA 4YRCA 1K3FA 1CJSA 1NVUQ 2HA3A 2CF6A 1G3UA 1F3OA 2DR0A 2I2AA 2QAGB 2XMSA 3O26A 3SLRA 4R83A 3HR8A 3TOVA 2QENA 1C1XB 2XDYA 4OFXA 3ILHA 1X2BA 1A27A 1JDZA 2XTJA 4YRDA 5JAZA 2ZE6A 1YFKA 4JBLA 4KIGA 2YV2A 2V6JA 3I9LA 1B3RA 2HA0A 1NHWA 4HH0A 3BRQA 5LN1A 1WP4A 4ARUA 1ODSA 4MH0R 4RSGA 5DYTA 2BTEA 1AO3A 5JSZA 3FIUA 4XIJA 1H1LB 3V4RA 2Z04A 3Q7QA 5I4CA 2W8BA 4RNCA 1ULSA 3VHQA 1I7NA 2J6BA 1BX1A 5FEMA 3T95A 2P6PA 4IINA 4CM7A 4EMSA 4FBLA 4KPYA 3HI4A 3PX7A 2XVZA 4PAQA 1DAPA 3CW8X 4A16A 2CV0A 1AGXA 2CLOB 2CFCA 5EIHA 3KLOA 1XPRA 3G8BA 4OHRA 3GCWA 4OQ4A 3U39A 1W4ZA 4S3MA 3OT1A 3T7SA 4AZ0A 5CVTA 5CK5A 1JR4A 5IN5A 5IJ9A 2GCNA 3PE3A 4JT9A 2RH9B 3I05A 4QDKA 1AHNA 2J7KA 2ADOA 4Q7KA 4CCYA 2JLAA 3NFYA 2PZAA 3JATA 2GZ3A 3FYUB 5LYJA 4G9EA 4J90A 4MJLA 1PR2A 3QNWA 1PJLA 4PW0A 4TROA 4Y2GA 1HFKA 4YLGA 2MOKA 4YAIA 5LCXA 4XJXA 1QOQB 1KZYC 1LCIA 1PJ4A 1U0JA 1W5TA 1XRMA 4XR4A 1P5RA 3CH4B 4QELA 4CLXA 3Q40A 1U28C 2XYHA 2I71A 2JDID 2OAEA 3LSYA 4RJIA 4XGNA 3CVWA 3UJ7A 5B53A 1ORWA 4MKFA 2VXCA 3KJZA 3TBFA 4ME6A 4L9AA 1JUDA 1VMIA 2VJYA 3DDSA 3GRVA 1ZXLA 3CUTA 3KSUA 5DK4A 3RTDA 2CJWB 3PRJA 3Q41A 4HUQA 1M8GA 1HEYA 2G25A 2ZUSA 4Q1VA 5EXEA 4D3XA 5KX5A 1CD5A 2JIBA 5CD1A 3DBIA 2WR8A 4II7A 2EARA 3AF5A 3FUCA 4N49A 1FUYB 5TRTA 4GICA 3KEMA 5DYNA 4GOKA 2DLNA 4R2WA 3PJEA 4G63A 3V46A 2CLMB 3ZU2A 4AS3A 1I24A 2P4SA 1ZS9A 3MEQA 3N2IA 4J1SA 3ZDYB 3P9SA 1IOLA 1Z5PA 2CNOA 2WE8A 4LFCB 1KF0A 3L40A 4XJSA 3VH4A 4B3HA 4DG5A 3V6MA 4HRAA 4OIMA 1NNEA 2R9VA 5AJZA 4TV9A 4B7ZA 4KBYA 4BE9A 1KKUA 1PP4A 2OXTA 3SHFA 1L2TA 3ZHCA 5CH3A 4E08A 5A6VA 1VZ3A 5IJ0A 4JASB 3WMEA 1CFZA 1M1NA 1R0BA 4WTOA 1IY0A 3GYGA 4B3BA 1BCSA 1TOAA 2QPLA 3ZOZA 3WIUA 3FETA 4BUJA 5KOHA 4WWHA 3BREA 2VDUE 2IX3A 2Q5FA 3C1AA 1WUJS 1VKHA 4HF7A 1M1XB 1D7AA 3LGAA 4YV0A 1WR8A 1YA4A 4O2BB 4YAOA 2X3YA 4MKZA 2ZIUB 5FUQA 5DCLA 1N8KA 3D2AA 1F51E 1P91A 1RRKA 2PRYA 3HVUA 2XMZA 4JK3A 3REQB 3DYBA 1MH9A 4FPXA 3I2FA 1NFQA 2A14A 3A1NA 2C54A 4CTNA 3TI7A 3IIEA 1Y8ZA 3LQRA 4IRMA 4E2WA 2IBSA 3WKEA 3ZCXA 4NZPA 4Y98A 3EA4A 4Y18A 2QVCA 1BX3A 2PHZA 3I0ZA 1IN5A 4WX2B 3S27A 3GV0A 4S2EA 3NMUF 2Q5CA 2C7GA 2OCXA 3SKXA 1RADA 5I45A 1DQRA 5MN6A 1YRQA 5KYXA 1YSCA 5BYJA 5DHPA 4OB8A 2HMSA 5KOHB 4U3JA 1UBCA 4BMXA 1FTQA 5KWSA 1EE1A 1TM3E 1KAOA 2G63A 5AJXA 3IODA 2C5SA 2GI4A 1OXKB 1ZRHA 3PKZA 3W7AA 1YQDA 4YP5A 5IAGA 1RI2A 3I1FA 2BKLA 1N7HA 3Q0TA 4MVJI 3I6BA 1G63A 2W22A 1V41E 4ZRMA 1K6JA 5HZMA 7MDHA 2RGNA 1DUIA 4HQFA 4FZ3A 3GJ3A 4C7JA 2HL6A 4PZEA 1BG6A 4RTSA 4GHWA 5I7VA 4GE0A 3BKWA 4N8DA 4RA9B 2VDNB 2HT1A 1E94E 1BDJA 4UMFA 3DCIA 1FFYA 5EYPB 2AVNA 3C87A 4CU2A 4ITVA 1V25A 4LJAA 5JEEA 3ML1A 3QIAA 2XOKD 1N6HA 2QG4A 5ESRA 3UY4A 3O8DA 3EXAA 4BECA 3UHAA 1OFHA 4H3KB 3ZVMA 3G17A 4RL4A 1WLSA 5BYBA 5A4FS 4S1OA 4LOKA 2BFCB 2V8OA 3DWGA 1FFHA 4DA0A 4IH9A 3H1BA 2P68A 4XRGA 4LRWA 4J0EA 2V65A 1Z8DA 1ODTC 2JD1A 1HF3A 3AETB 5DYYA 3TDKA 2Q27A 3H0KA 3VPAA 3OZWA 1J7JA 1RM3A 1HM5A 3LWDA 4TLEA 5EWMB 5T5QA 4B82A 4CLRA 3DJYA 1NUHA 3F98A 3MF4A 3FYUA 3PCRB 4HGQA 2J3JA 4MS3B 4V0OA 2JFUA 3D8NA 3GCXA 1Q6YA 3UNXA 1GFIA 2BEUB 2HNAA 5JCJD 1XZDA 3DFUA 2HA2A 4KEAA 5LXTF 4LHWA 5JQWA 1UDWA 2WM3A 4C07A 3QVKA 1OC4A 2OO5A 1Z22A 4G81A 4DUZB 1FS5A 2XB4A 1I4DD 2QXTA 1NZDA 2O06A 3IRVA 3ITDA 3LLVA 4GMDA 1TUBA 4JLKA 4ZMSA 2ZYIA 3GZNB 4WRRA 2GPJA 3GPIA 1OI4A 3MFQA 4MUHA 5A1JA 3IEVA 3TO5A 1VJGA 4KMRA 4MUIA 1WPGA 2O5VA 2R8ZA 2GTHA 1A69A 1WMAA 2VTDA 3IVAA 1Y1SA 4KQXA 1TKCA 5TVGA 4K05A 2QPOA 3G8AA 3IEUA 4EPVA 4ZCTA 1RYDA 2ZROA 2Q07A 4AW9A 4JVNA 3EMVA 1KJIA 4A1FA 2GXSA 2I6XA 1Z73A 3OC6A 5E7IA 1XAGA 4XZ3A 1TB4A 2NV0A 2YVKA 3L0BA 4CIBA 1HDGO 4KQHA 4KOEC 1FX0A 1VLQA 4KR0A 1JXQA 2A0XA 3QG1A 5CYFA 1MABB 2B78A 2QMHA 1B15A 4YPFA 2FF7A 2BYTA 1JHYA 3A2KA 1TIBA 3G8CA 1ISJA 2OZVA 3NU1A 1E4VA 3PXAA 3QG5A 1FQWA 4PZZA 1WSDA 3CNQS 4NQZA 2XCOA 3VZPA 1NNUA 1H2EA 2CCKA 3HUFA 3VNSA 2AFHA 1AQLA 1HG0A 1N57A 3KLBA 5ENZA 5JNRA 2ZRPA 3L0YA 4Y9UA 1RAGA 3AG6A 4TRMA 3OY2A 3CONA 1WV1A 4QFCA 3I76A 3G2NA 1BE1A 1ENZA 1MB0A 4BX9A 5ED4A 3OC0A 2G82A 4Y6LA 2PDAA 3PFFA 2J6HA 1Q14A 3RSGA 8ABPA 4K3UA 2II6A 4HEHA 1KBZA 1KP9A 4BEBA 1IVYA 5BSWA 1P19A 3GJ7A 5JYBA 4EGJA 3ZZ1A 1F6WA 2V6MA 3HFRA 4CCWA 3LE8A 3RIEA 1CQIB 3ZHVA 3AIIA 1ZGGA 1YQ9A 4HJRA 4JJ6A 3MHPA 2XWPA 1QE5A 3M0EA 4FZRA 4S2UA 4A82A 3S1AB 4ZHQA 4BMDA 1X8JA 1RWNA 2YQ4A 2NVUB 5B57C 5LZ4A 4G4SP 1UDCA 1FPQA 1BCRB 2XUIA 4X6UA 1QFXA 1Q0QA 3ME5A 5ALIA 4CEJB 3R9XB 5KVSA 2BISA 3KKPA 3G9QA 2B7BA 3T9EA 5EIFA 2GDZA 4UQPA 4YRTA 2YN0A 1S7GA 1P8AA 3PD7A 1QYDA 2QX8A 2P8JA 3E82A 3RK4A 1GT6A 4H3HB 5H8WA 2PUWA 4K7JA 1OTXA 1U3TA 3BTOA 4PIMA 3V7UA 4NU5A 2JFFA 3SQLA 4RJLA 1NJ6A 1XZBA 1PJSA 2IDMA 1RJFA 3BZUA 5LWHA 1M66A 3JAWA 1HDYA 1KJ8A 2IXBA 5TJHA 4E5NA 2H4JA 1CUVA 4ZVSA 5A9TA 1GZ3A 3SF8A 2G5CA 4JMPA 2OXCA 4DEYA 5KKCA 4CFZA 1THMA 3A3PA 9LDTA 3BQMB 2I76A 5HF6A 1I14A 4XOIA 3V8QA 4YYZA 1Y9JA 3EVDA 4L8GA 4K8OA 1V1RA 2Q62A 2FLKA 4N0QA 1U0FA 1JHRA 2FRDA 3FLAA 4G84A 3MRVA 1M7BA 2W2QA 2PNFA 3OLWA 4GG1A 3UB3A 4BASA 5KTYA 2EJCA 1K7CA 2C95A 3NB0A 4Q3AA 5JCXA 3ZOKA 5FLXA 1H1TA 1Z13A 3JD0A 4PWZA 2Q3EA 1BWQA 3EGXB 3E58A 3O8CA 1Z8NA 3VO8A 2JA1A 4BMSA 4FNOA 4QHYA 3SZLA 1ARZA 3D7NA 3MWKA 2V6IA 4EI8A 3B3AA 2J6IA 4JXJA 4KLAA 2BW0A 4YBZA 1JIJA 1M10A 4F1JA 4OXRA 4LECA 3O90A 4JXKA 4Q3NA 1NMYA 5IHPA 2XUZA 4PG7A 2P6UA 5JV5A 4UXJA 2NU6A 2NZWA 3H4MA 4GWLA 5E9JA 3FFTA 1DJNA 1NSTA 2PA3A 3E48A 4GLFA 4KK3A 2I6TA 4DV7B 2WG0A 1DCFA 5D01A 1U9IC 1V5WA 1S2OA 4EUNA 1CY8A 1G3QA 2C2ZA 2BY4A 2FSSA 2M6RA 5EEHA 1VJTA 4C87A 4F45A 4OH1A 1FSGA 2ZM6B 1T2FA 4FBMA 3DUFA 5M5BA 4FHZA 5IABA 4FBGA 4C20A 1FNSA 1HL3A 4G1VA 4YREA 4FX5A 4MA4A 4ZVPA 3DAPA 2PQMA 3SSNA 3JX9A 4PYJA 1WMDA 1O6GA 1YL6A 4YO8A 4ZEVA 2YKGA 2V7VA 4TV9B 3SZUA 3FWNA 1U3VA 3FSRA 2JJ1A 2VHEA 2VYND 3E22B 2XOEA 4OLJA 1M8JA 1GAEO 5D8DA 2X1MA 4LOAA 4BNKA 1N7GA 2Q4RA 3TR5A 5JARA 3ND8A 3GRKA 4F97A 1Z2DA 2QSYA 4TM8A 5K99A 4L78A 4DRXA 4LFBB 2FPPB 1U2QA 3NNSA 4RE6A 4REQA 1HQCA 3K0EA 1RYFA 5EJAA 2QUAA 4TWJA 2PYIA 3U4CA 4A0QA 1SXQA 1G98A 2HJSA 5JYCA 4UHCA 1WETA 5DYWA 2GAAA 5F5LA 2ZS8A 3CLSC 2WSYB 4KWEA 1W2GA 1KJWA 2PNJA 1TJ3A 4UVDA 4GKJB 1DPGA 2BDTA 3MUNA 3VC3A 1U1CA 2IL1A 3BIWA 5CDFE 5JMPA 3AKYA 1SCAA 1SUDA 2HDOA 1L5SA 4TSFA 5KVAA 3PPWA 4RTRA 3DH0A 3MJVA 2XCUA 3BORA 3LQ4A 4D41A 4CGZA 1YUNA 4H7JA 3VVCA 5B12A 5C7OO 2AZDA 1E2BA 3OICA 3OMXA 4I2VA 1QAQA 2GS9A 2W6IA 4QGBA 4HWKA 2GSDA 4TWZA 4U6NA 3UT5B 4C0LA 2XNKA 4CL3A 2B37A 3A27A 5KQLA 2KSQA 3LCRA 4ER5A 2PUDA 1U4OA 2QGNA 4R0NA 1Z83A 1YR8A 2Q2NA 1E61A 3KXIA 1JILA 1CU1A 3A9TA 3I2HA 3RLFA 2X2EA 4CQLB 1SUFA 1U0RA 4HAZA 4H3VA 3RAGA 3K0HA 4ZANA 1UXJA 1WSAA 3Q87B 4I81A 4IZ6A 4Q66C 3PFNA 4X93A 3CKLA 3RG2A 3A1CA 1I3LA 4JGBA 3CRRA 4C6HA 4TUYA 3HY4A 4JUBA 5CVEA 4O4LF 3G59A 4YUYA 3GD5A 4HQKA 3TZ6A 1QF9A 3FKJA 4QG3A 2XRMA 3S6JA 4YEDA 4OREX 1XYYA 1KGDA 4RXMA 1C9DB 2ZWOA 1D6SA 3OAAA 4R8MA 3AEXA 1VBFA 1C7EA 3CQ9A 2RC6A 1J5EB 4NR0A 3T4UA 2YY5A 4Q3LA 1VCOA 4AJKA 5DYIA 5NLLA 2AMVA 2YV5A 4INOA 5FBKA 2JCGA 4QGGA 3JQ6A 3O93A 1VL5A 4EKIA 4C88A 1V9CA 5FULA 1JLHA 3N8HA 3PRHA 3QKSA 1R9GA 4JLPA 3WZMA 4YJDA 4DUPA 2FFBA 4FFMA 4MGKR 5C51B 1FK8A 2EBUA 2PUAA 2BMJA 2DBQA 1LDYA 2FWNA 4G1CA 3I1IA 4DAEA 4F5WA 3LUPA 3BGIA 2ORWA 3AKZA 3P5BA 1EDZA 1UJ5A 4JBNA 1NOJA 5D7NA 3WRVA 1DOAA 2KYRA 3LXUX 3KZMA 4LXIA 5LQUA 4IWNA 3DEIA 1NW4A 1JDNA 3I8XA 2RGRA 2O8BB 2WJGA 5HWSA 1GKUB 1YQQA 2XIJA 3IDAA 4BJHB 2CXXA 1BN7A 3KZCA 3K9LA 2XMCA 1W4RA 5GZ6A 3ZWNA 4JN6B 1R9NA 3GR6A 5JISA 1KORA 1J2EA 3AVTA 4Y2HA 1UP7A 2FG6C 3QXSA 1U7PA 4IRXA 4LOLA 5ICSA 2I9KA 5AW0A 4ZO8A 1VHTA 2EZ4A 2OFWA 1ZOPA 2CB9A 1Y9AA 2PPVA 3AIKA 3FDXA 4BB0A 1ZNZA 3OQBA 2PQ6A 4JFRA 4JOSA 3UB4A 3GUZA 3CINA 1EINA 1RCFA 2VSQA 6REQA 4EVRA 1Z07A 3UKOA 4FW9A 4HZUB 5K3DA 1D6JA 5IK2A 4BFXA 1Q22A 1ZNYA 3F5FA 3P2KA 5J9FA 2YMPA 3C3MA 4RPHA 5H83A 3GCGA 5ALTA 1PYGA 1MHPA 4TMKA 4YJFA 4B5KA 1XHLA 4EJSB 4EVQA 1XLVA 2PZEA 2GZ1A 3OQIA 4ZQHA 2ZI7A 4M0EA 3IBFA 3WL8A 1KQFA 5A1TA 1BJTA 1Y48E 3RFFA 4NE9A 1NVTA 1SN7A 1H2FA 2GK7A 5H4GA 5BURA 4BIMA 1PWHA 4PCAA 4A0SA 2FXIA 1ZSNA 3GNSA 4LE0A 4QQKA 1GLNA 4JIGA 2W48A 1YZKA 3F2IA 1HE1C 1RACA 4Q1BA 3WHLA 4KG7A 1GHTA 4JLOA 5JD3A 2DPLA 2Y77A 1QO0D 4IWYA 3UJ6A 1ZVQA 4D3DA 5C53B 1I13A 1R8XA 4PVDA 1XMOB 2FKNA 1S5PA 3QUQA 2DMRA 4WFIA 4I1VA 2X15A 1GGJA 3D8HA 1Y9ZA 3E7FA 4RO0A 3P2OA 3E18A 1Z25A 4DLZA 2MSNA 1BS1A 1K5PA 1L0BA 3KFLA 3OOHA 2ECQA 1I3KA 1DELA 1NBAA 1QV9A 3BK1A 4HADA 4UXHA 4NEQA 5AI9A 2EBHX 2VPTA 1R0LA 5CNKA 4DXDA 2ZCJA 2YW9A 1NUUA 3UC9A 1QP4A 5IKXA 3HB1A 3BJIC 4ZAGA 3ZWCA 3CY6A 1MC1A 4HMQA 4KAFA 1ONPA 4XUCA 1DJQA 1OQAA 2V5VA 4MEAA 1AKUA 3G2OA 2WC1A 4OKIA 3IAXA 3PTAA 2Q3MA 4DVGA 2NM0A 2D8AA 4YRQA 2JFYA 821PA 4YPVA 1GM5A 1B16A 1L7DA 2ZYGA 4Q4JA 5JE8A 2VRWA 5EINA 1JHZA 1D8AA 1N8SA 5ALYA 5MN5A 1FDVA 3H04A 1ZEMA 3FBTA 5JS2A 5KPDA 5F7JA 1QDLB 3KOMA 1P3Y1 5TB5A 4G0QA 3EWSA 4Q9KA 4ZREA 3RVLA 3TUJC 4CMCA 3QU5A 3H7AA 1T24A 2P6OA 3AKCA 2RHWA 2G1JA 4PCLA 4YJHA 1VJDA 4DTIA 4I4NA 4JP5A 3ZHOA 1VSBA 1KMCA 3HZZA 3IFSA 4I1UA 4PWYA 3H13A 4TN1A 4WL0A 2IH4A 3N2GA 1RLTA 4OHBA 1Y89A 4WMLA 4ZV7A 1Q84A 5TQVA 4A0HA 2CLHB 4IKEA 5LDGA 3LBAA 4XGQA 3SVZA 3TTTA 4P4NA 1XA4A 4HDSA 2ZTLA 4J0HA 5LR6A 1FU7A 1WKVA 5EHNA 5G41A 1H2XA 3W2IA 5J4HA 4JV5B 5I9TA 1R37A 1LBEA 3QPCA 5EEGA 4PO8A 2IYEA 5EQJB 1JEJA 1QAMA 1BU8A 2F00A 2F64A 5KCZA 4YXWD 4D9EA 2WF5A 4ACBA 4B71A 4KGVA 2NO0A 1RRCA 2HU8A 5BWNA 4N03A 4L22A 3CGWA 3M7IA 3WBFA 5KTPA 4MRAA 3Q3GE 1TVMA 4UTZA 3KSRA 1R15A 5F73A 2FRDC 5G40A 5JSYA 3VH1A 5J4YA 3P9CA 1YL7A 2XUFA 3OHSX 4LSGA 4ZTUB 3NHUA 3OOEA 4RVUA 3H1AA 4EGQA 1N3LA 2R86A 1GUYA 1P17A 3DC2A 3L7MA 4MS1B 5GIOE 1SHTX 3GGPA 1YCDA 4NOMA 3HKEB 3DDHA 3EPLA 4BZQA 2O5EA 1G7RA 1P7PA 4HRXA 4XCXA 3HRIA 1JIUA 5H3CA 1S89A 4ERNA 2W6JA 1Y1TA 3EFOB 4OJNA 3VNAA 2BEVA 3OSUA 3SQNA 3ZV4A 1NLFA 2QMZA 4AROA 2FUG6 1YMQA 2OCBA 2C2MA 2IYFA 3ICPA 3OZ7A 3MGBA 1XDGA 1ZM3A 3RFXA 4E7PA 2ZJ5A 4ED9A 1CNFA 2JL1A 3JYOA 5FWNA 4C0BA 2ZZKA 2ATCA 4YAEA 3JQ7B 2QJFA 1EVZA 3KYJB 3PQ3A 1G8SA 4MRSA 2HLHA 1MXHA 5ALPA 4ZCLA 5AW4A 2NUTA 5HF9A 4GWGA 2R6HA 4H59A 1ZZEA 4AAYA 1UQTA 4Q3EA 1OI2A 1U11A 1E3WA 3VV2A 2WIGA 5BWMA 2R62A 2HQ1A 1VRWA 2C5LA 2XEXA 4ZOLA 1T9AA 3LPAA 1H93A 4UHJA 1JFFA 5BWLA 3EC1A 1RFGE 1XK7A 3TH5A 1FNBA 4WLUA 4D43A 5HX7A 5JMOA 2JF0A 2WWHA 2AJLI 4UVGA 3LT2A 3EJWA 5JZVA 2A0FA 2QRNA 1CBUA 1RHUA 1XJWA 1Z7GA 3AZPA 4BNVA 2OC9A 5TF4A 4TTTS 4XIGS 1SOWA 4L27A 4Q7JB 4TT3D 4M22A 4YJ2F 4EB3A 3B3FA 4HK4A 3SBOA 5KNLA 5F9FA 4X3OA 3WL6A 3FF1A 4LG1A 4R40A 5BSRA 1RWKA 4K2AA 4L7VA 2CGEA 2ZM5A 5K9ZA 3D0RA 4RD3A 1Z74A 1O6BA 3K5PA 3OKPA 1YQUA 1S8OA 2B2XA 4JI3B 2J0QA 1NBOA 1L4FA 5BN5B 4FJ0A 2C5FA 4LRYA 4BNDB 2BGWA 1P2DA 3ZGOA 1BO6A 2HU5A 1WXIA 3K5IA 1AZWA 5B64A 1BIFA 3KTOA 4FEEA 3WA6A 2FDRA 1QLHA 2ZJ6A 3WZ2A 1RZVA 2CXRA 3TOCA 2JIOA 4ITRC 5G0TA 2PWAA 4YJHB 9LDBA 3HB9A 3T7DA 3OZUA 5K0NA 2C7PA 4A1OA 5LMCA 1GG9A 2NUTB 4A2WA 3LJKA 3UV7A 1Z5OA 3FVWA 3R09A 1U5AA 4NEGA 3BWXA 2Q49A 3MZ0A 1DPFA 2BWJA 4L50A 2V7BA 4MS3A 2A9PA 2GCPA 3OM8A 1QMPA 4W5JA 4Z86A 1Z26A 2HNBA 4P7FA 2OA0A 3K2EA 4NBKA 4Q4JB 3U7JA 4CMIB 5J4VA 5JH7A 3EEOA 1PT5A 2HBQA 3GZ4A 1PNOA 1Z2CA 3W4IA 1AK2A 2BLLA 3VAAA 1AUQA 1P45A 3VSBA 2Q0XA 5FR1A 2QJWA 4Z6KA 4MVJF 3GRAA 4GDMA 4QYIB 3U0BA 1Z7YA 2ZIXA 3DSRA 4OK6A 4RHTA 4OSPA 1KKMA 4S1VA 3PXGA 3KHTA 2CXUA 3DCJA 4X71A 3ONVA 5CDSA 4X90A 1QRDA 1D2HA 3EVZA 3WWYA 1M83A 1NRWA 1RXIA 3MTQA 3ZDRA 2DWOA 2G8NA 3GA5A 3NZEA 3U3JA 2AH5A 1UDXA 3LX5A 5EWLB 1CQJA 4DIBA 2Z58A 4ES6A 1Z5ZA 3L46A 3SS7X 5IJAA 4D0RA 1KOJA 3DKIA 5D2CA 2B8JA 1B3BA 5KX5B 4PC3A 3SBDA 2WRZA 5GV7A 3WTBA 3PHBE 1SURA 2B1GA 3DCYA 3NYQA 2C1EA 1KK0A 4ENUA 4QDTA 4YVFA 3HWSA 3HUDA 4N6GA 2P6NA 1NRXA 3R9KA 4GECA 1QZTA 3G7SA 3W5UA 1DWPA 2QV7A 4LVUA 4B32A 1NDQA 4PG5A 5A6SA 3FNQA 4P7BA 5AM5A 5TQ2B 3QFTA 4S35A 3L84A 4RETA 2R6R1 5BVGA 3K71B 3T5DA 2GNAA 3W79A 1IONA 4FQ7A 5H70A 3BZBA 2PUTA 3R6TA 1IOWA 4JT8A 1D2CA 4GOMD 3VYSB 5GADl 2DT5A 4MKHA 1EX9A 2JGNA 1XO1A 1FB5A 2IYWA 1PLKA 4R9UC 5AKKA 5FT9A 4KFSA 1IK6A 3H6KA 1CYEA 2BGIA 5CTJA 4B3GA 4FZ5A 3I9NA 4ENSA 1Q3HA 1G21A 1Q0SA 1WNTA 1RJEA 3AMVA 4Y0VA 4QQRA 5LB4A 2AMLA 3VR4H 1G9TA 3L2OB 5JD4A 1O0CA 1W4CA 2C8JA 4DZRA 4YC7A 3QVLA 4TL7A 2YINC 1AY0A 3SLKA 1ZD1A 3ZVKA 3DVAA 2JIQA 4ZI2A 3PC6A 2JAPA 5KTMA 1TVEA 2EHDA 1H1LA 1VOTA 2CK3D 2HJHA 1DNPA 2QTCA 2WYUA 3KT0A 1QBKC 2H8KA 5LD2B 3PQ7A 1ZMRA 3R74A 1R4MB 3FIJA 4KRFA 3UAYA 1RPAA 2J9GA 2QRPA 4EG8A 4L1KA 4R1UA 4ABYA 1MOZA 1W1UA 2AEMA 1QVAA 4IAOA 3I01A 3I0NA 1CUWA 2HF7A 5F51A 2GM4A 5K45A 2YQ5A 2OFFA 4KQCA 4XDGA 1I33A 3HH8A 3WBKA 4AP9A 1X1BA 3NYRA 2FW1A 3G5AA 2HRCA 2O3JA 4OLFA 5DEIA 1Q21A 1Y4ZA 3G9TA 4PO3X 1YOVA 4L4RA 4GBGA 4LVCA 2OZKA 3C5CA 3RLIA 5B3LA 3W90A 5CVVA 4MWCA 5B6IA 2BI4A 1K68A 1M6VB 1JBEA 1CV2A 4L8LA 4D9JA 1ID8A 4ISBA 4P38A 5A7GA 1JDBC 2I7TA 3H9EO 5J2TA 5DSZA 3DDCA 3NBFA 4MGYR 3QXXA 3EX7C 4ZZ2A 4CKYA 3B8HA 1ZGHA 1DMRA 4V1CA 2DX7A 1CEQA 3U4HA 3ZK9A 2E4WA 2VDLB 5E4JA 3BH6A 3H2GA 1BD4A 2QU8A 3UCXA 3MHTA 2EDCA 4KFCA 3EEYA 4W9RA 4HAIA 4DMLA 1JDTA 4LF4B 3GJ0A 3GDWA 3L6BA 1QH1B 3LLMA 3MGKA 3UKDA 2NLOA 3WV4A 3FWZA 3JY6A 1Y3BE 3PR2B 5BNFA 4EPXA 1V71A 3S70A 2FW8A 3R5FA 3UXEA 3JYQA 1K7FB 2H0AA 3KLMX 5ALSA 4LGYA 5JHGB 2YXBA 1J90A 3G0HA 1ZQ1A 1QHXA 4DV5B 5ADVA 3BRWD 3TGLA 1E2PA 2PGAA 5ILOA 1I4EB 2CNWD 1JU4A 3BB4A 4X1IA 3PFKA 1ZOIA 3JQRA 4WBNF 2FSPA 4ZMRA 1R0ZA 4AJOA 1CRLA 1M8KA 4WV3A 4P80A 1VXOA 4ZVLA 3TQFA 1FYWA 2H1CA 1A04A 2K7FA 4N7RA 3BXFA 3NHSA 4TVKA 2NACA 3IJ5A 1E5QA 3DKPA 2IW3A 4XSVA 2AK2A 3LO5A 3OD1A 3RRNA 4Z49A 3ZJ4A 4HDKB 2P27A 1XK6A 4D9HA 1C8VB 2BBSA 2FX2A 4B6EA 1BYUA 1WPXA 3KVNA 3OF3A 2G9ZA 2Q6KA 1N3IA 2MTBA 4IQFA 2C0QA 3HXOA 1BKYA 2FQWA 3LWZA 4PPNA 4YP0A 3ADBA 1GDTA 2O2GA 2ID4A 4W7SA 3FM9A 3W5DA 1O6ZA 3N2GB 4UPVA 5ETJA 3RSZA 1E20A 1SGWA 1RQ7A 2G4LA 5TJ9A 1G8FA 3QV2A 4RZUA 5HJ5A 4O2AA 1IZ9A 1HA3A 2IELA 3LQKA 4L85A 3AB3A 4L4UA 2VHWA 3V8EA 1U7DA 5AR1A 5GONA 5SY9A 1W47A 1EK6A 4F6CA 2PZLA 4XVQA 4WCFA 1ZMTA 3LIIA 2JCSA 3KTAA 5DT2A 3NVDA 2F48A 4JUCA 1FA9A 2GBLA 2JLSA 3F6EX 3W4JA 1K7EB 1B8NA 1WY5A 5LIPA 2C4MA 1WU8A 2OK8A 1VIYA 2QYSA 2Z5VA 3QMWA 4H7KA 5EMMA 3FOEC 5EG5A 3RIMA 3KKKA 1GNPA 1LS1A 1GL9B 3QK7A 5FHRA 1FUUA 4FMBB 1T2NA 3NAQA 3H87A 1LSJA 1XAHA 3L0DA 1Q1ZA 2ZSUA 1DO0A 1NJ5A 5HBGA 4KNWA 3MTJA 3HJFA 3QVOA 2VNSA 3IO5A 4R68A 3KNZA 4RS3A 1FPMA 1L7AA 1XQYA 1Z88A 3BMXA 4W5RA 1AUPA 1YHYA 1TA0A 4KAAA 4XEHA 1IDN1 1N8TA 4G6ZA 4TYQA 2JGFA 2Q5HA 4R31A 1U8XX 5I7UA 5AJUA 2LIVA 5JWHA 1OH5A 1L5FA 1SKUA 3CR3C 4I5EA 5EI5A 4MLDA 4M88A 4O1MA 2ZIXB 3SYRA 3ZGYA 2WTUA 3FAZA 5EFZA 2XOKA 3LL4A 4RABA 1NBEA 2VPZA 3K0CA 1LX6A 2C7BA 4FX2A 3BSFA 4FFWA 1Q3TA 1ZM2A 3W8DA 1YVRA 2FAXA 3V8NA 1QAOA 2QR5A 1WDMA 2I4MA 1JVNA 1R2QA 1P7VA 4C3ZA 4EHDA 1NLMA 3Q11A 9MHTA 4MWDA 2H11A 2RHLA 6GPBA 3JQ8B 3ON5A 4J03A 3UXYA 3GLIB 1FXWF 2W70A 3W5JA 1ZIYA 2FUEA 3A6EA 1YCFA 1EQUA 1GA6A 2Q6IA 3CM0A 3GMSA 3Q5DA 1BVYF 4QBIA 3MSXA 3D43A 1BKSB 4YQYA 1CDOA 3OG9A 5DBHX 1NKTA 1PGQA 5D84A 3EUEA 2XUGA 5FV4A 2R96A 2WE7A 3PCXA 3TBKA 1IQRA 3T38A 1ULZA 2QROA 5AK4A 2H2GA 1P4HA 4DV1B 3OZEA 4KMOA 1SG9A 1GNQA 1PL0A 3AGQA 3IV6A 4W5OA 1ZX1A 5F4BA 2CV2A 4ZVTA 1U04A 1E3DA 2IJGX 3FN4A 4XLZA 4DM3A 2XKKA 3WQHA 4YRAA 3STHA 1YWGO 1E92A 2EWMA 4LUCA 5JYDA 5KTTA 1XZPA 5ALWA 2OBXA 4OQMA 2P8SA 2ANCA 2QORA 1ZUIA 1XTUA 3DUFB 3LF1A 5KYNA 1JFFB 2QLBA 1Q1GA 3AERA 4L02A 3ROPA 3UFBA 4INZA 5KYGA 4LJ8A 4NE2A 4CYMA 2I8AA 1MQAA 1HRDA 3N0XA 4DRYA 1RYNA 2F1RA 2P9YA 5I4IA 2XQVA 1XU4A 2QVYX 4NBUA 3W06A 1FYDA 3QKSB 4D4HA 1KY3A 2FRVA 3AR3A 1UOEA 3WSWA 4C9BA 3LQQA 2NTJA 1JSRA 4XIYA 5ELXA 2UUPA 1MRNA 2G0NA 5G02A 1YGYA 1G60A 4IOMA 2AR0A 3PBKA 4PO9A 3VI3B 4INJA 3ZDZB 4G0UA 1IK4A 1VKOA 2FWIA 2BR3A 1YJXA 3C4VA 3RYFA 3K31A 4KITB 3LG2A 2H9AA 4BFCA 2K5UA 1TM2A 2IPNA 3UJAA 1Y6JA 1A9SA 1S3SA 3KEOA 4LDQA 3DLHA 1QFYA 1A2OA 2IOFA 3KDPA 2W98A 1NVEA 4RIGA 3IYLW 4A7PA 4BLWA 1ZBDA 2PKEA 3PF8A 1TCVA 3AIOA 4AK9A 1IMJA 1DP4A 3LPNA 1TAHA 1FLAA 1K08A 1QDEA 2ORYA 2VH2A 2ZJ8A 3W78A 4WKGA 2XOXA 1B76A 4TSRA 4L3VA 2NPFA 1BW9A 4HP8A 3T3MB 1NX9A 5C5IA 3JQFC 2FOIA 3R8CA 5EZQA 3DD5A 4DA8A 3LC2O 3SMVA 1ZCZA 3MB5A 4LY3A 1PT8A 1WCIB 4Q9HA 2RGAA 2ZTHA 1FMTA 4HEQA 3WIEA 1PR1A 1SIWA 1K9VF 3IXQA 4K1LA 5FA6A 3C3KA 1Z28A 4TKLA 5HK8A 1W8IA 4EPRA 3PGKA 2NVOA 1VCNA 1C1DB 1YU6A 3E0XA 1PS9A 1W9MA 1NN1A 1MRSA 4PQEA 1IXYA 3PHGA 1BOFA 5KZMB 4XD2A 2WAYA 3ESXA 5EHQA 3ZZUA 1EUQA 3SSAA 4QRHA 2OD2A 4OU4A 3FZGA 1WZEA 1SG6A 4YCSA 2NUBA 1HZZA 4ENQA 3E05A 1U3WA 3W2GA 3I1JA 3IR6A 4QDXA 1Z15A 1IBKB 4UHFA 2POQX 2YJ5A 1QXSA 2WHPB 3P1JA 3TXYA 2PVCA 1PFGA 3AJ9A 1ZVMA 2NO5A 4IJVA 4UUBA 4GNRA 5JAMA 2FPPA 1TQ4A 1S2DA 1HLGA 3Q8XB 3MM4A 4HDKA 2CYCA 2X5KO 5ALRA 5JZBA 3M6WA 3QSYA 4P3NA 2V7UA 3CPSA 3PGXA 1V8DA 1WMFA 2FEPA 2IZ7A 1HDZA 3HLTA 4ALIA 2C5EA 4GI3A 2QMEA 2RAFA 4HL6A