3F4KA

Crystal structure of a probable methyltransferase from bacteroides thetaiotaomicron. northeast structural genomics target btr309.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
254
Chain Sequence
NNTSIHDFDFSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of a probable methyltransferase from Bacteroides thetaiotaomicron. Northeast Structural Genomics target BtR309.
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 87
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3f4kA00
2B2CA 5CCBA 3SXJA 2ZVJA 3I64A 3FPHA 3LPMA 3V8VA 3V97A 3EVZA 5K0FA 3I9FA 4RTSA 5DTQA 3KQVA 4GOMD 2Z6UA 2BR3A 2P8JA 3B5IA 2C7PA 2OO3A 3GWZA 2JH9A 3BGVA 1NW3A 3KQWA 4LG1A 1ZGJA 3DTNA 2HR1A 2P3OA 4PYLA 1AQJA 2VS1A 5GP1A 1QAOA 2F8LA 2DPMA 4ZTBA 3KPJA 3UA3A 4E2WA 3KPYA 2ZBQA 4KWCA 3SSOA 3PLAE 2ZWVA 3M6XA 2FRXA 4LECA 4WVLA 5DPMA 1NT2A 1KYZA 5EMKA 3Q7EA 4E2ZA 4U7TB 4YV0A 3VSEA 1NW5A 3FTFA 5E2AA 5D1HA 3ELWA 2G71A 3CGGA 3O4FA 2PXCA 2ZULA 5EEGA 5C1IA 3OCJA 1UFKA 2V7EA 1WXXA 1HMYA 3QOWA 1L1EA 4GOND 1O54A 4R6WA 4OA5A 1M0EA 3KPVA 5GIOE 2ZFUA 2I9KA 3NVKI 1H1DA 3NDIA 3NW9A 1NW7A 2UYHA 1X1DA 2HNKA 2P7HA 4YUYA 2NXNA 4KIGA 3HVIA 4RTKA 4PGGA 1FP2A 2FK7A 1D2CA 1JG4A 3F4KA 1IY9A 2AS0A 3M33A 4RWZA 1YFLA 3E8SA 1Q0SA 5FA5A 3P9NA 4U7PB 2YR0A 3BWCA 1OR8A 3GRVA 4PIMA 5DT2A 5GM1A 4C04A 1XDSA 4E31A 4YUWA 3OZRA 4UOEA 1JQDA 3LECA 5HIIA 2OZVA 1AQIA 3ERCA 2YX1A 1R8XA 3LBFA 1ORIA 3TMAA 3EPPA 3GNLA 3PB3A 3BKXA 4M7RA 4XCXA 4PYMA 4PNEA 2PV0A 5CVJA 3PX2A 1R74A 2ZSUA 4V0RA 4OBWA 2B78A 5DTRA 2PWPA 2PX8A 5E1MA 1BKYA 1KYWA 1F38A 2LD4A 3OFJA 3T7SA 4LWOA 1FBNA 3DLIA 5KQSA 3UJBA 4C07A 1I1NA 5ICEA 5LSAA 3OFKA 2I62A 2AN5A 4PYQA 2ZIGA 4RYLA 2AOTA 4MWZA 5EIFA 1MHTA 3GU3A 2EX4A 3B89A 1VPTA 4RVFA 3G7UA 3THSA 4PCLA 1G8AA 4GC9A 4M38A 4CTJA 3M70A 4PINA 4HC4A 5GOZA 2NXCA 2ZW9A 3FUWA 3FUXA 4C4AA 1KHHA 2JH8A 4AZSA 3OZSA 5DX0A 5BXYA 1VBFA 2VDUE 5C9ZA 3CBGA 4AZWA 3T0IA 3NWBA 4C03A 2XVMA 3TM5A 4A6DA 10MHA 3AJDA 1M6YA 3TQSA 3DH0A 3G2PA 4DMGA 4P7FA 5EMLA 2WK1A 4P7KA 3HTXA 2IDJA 3HA3A 1RI5A 1DUSA 2OB2A 3HVHA 2P3LA 2IBSA 1JQEA 2YQZA 4OQDA 1QYRA 3ANXA 4HGYA 5HILA 4ER7A 1L3IA 3GXOA 4DKJA 1KPHA 2AOTB 3DMFA 3GRUA 4H0NA 4BY9E 3PFGA 5EHIA 2C7RA 4QPNA 4IWNA 4PWYA 2YXLA 4PYNA 4QVGA 4HSGA 4KDCA 1AV6A 3GIWA 4P58A 5LQJA 3OU7A 2YTZA 2ESRA 3FUUA 1R00A 4GBED 2AN4A 3G2MA 4QTTB 4X1OA 1RJGA 3HA5A 5DX1A 4BLWA 2NP6A 3M6WA 2IPXA 2JHAA 3DUWA 1O9GA 3MB5A 5FCDA 5E1BA 3S68A 5LQNA 3UJAA 1WZNA 1KP9A 2QY6A 2ZZNA 3OE4A 4HRAA 4AZVA 1NW8A 1FJXA 4ER0A 1INLA 2GH1A 1F3LA 2GLUA 3LL7A 4F84A 2V74B 4DQ0A 3G2QA 5B1SA 5HIMA 2P7IA 2PY6A 5DWQA 4HTFA 4E32A 2PJDA 4HGZA 3UJ6A 5DXJA 5EPEA 3BWMA 2GB4A 4RTRA 1NBHA 3PTAA 1I4WA 4DZRA 2DULA 2ZIEA 2HMYB 4Z2YA 3A27A 1ORHA 4IKPA 4R05A 3DOUA 3P71T 5LQAA 4OQEA 3TLJA 2HV9A 1Y8CA 1QZZA 3R0QA 4MTLA 4EKGA 3KKZA 1RI4A 4R6XA 2IGTA 2IP2A 3LSTA 4PYKA 3DULA 4CWAA 1NE2A 1WY7A 1SKMA 4OBXA 4DA4A 2FPOA 1KPGA 4M37A 4RTOA 4GOLD 5CVEA 2CWWA 4GQBA 3KR0A 2JHPA 5FQNA 1PRYA 1RJEA 3E23A 4RVHA 4DCMA 5CIYA 2P35A 2AR0A 3TM4A 1R6AA 5F2NA 4HTFB 2OYRA 2XYRA 3D2LA 3H2BA 3ER9A 3FPGA 4M36A 2G1PA 2PXAA 3LGAA 3FUTA 3MERA 4L7VA 3R3HA 5EKUA 3HNRA 4KRGA 3FRIA 5HZMA 3FTDA 3KQOA 1SVUA 2IFTA 3B3FA 3JWJA 2PWYA 1YFJA 3EMDA 3BKWA 3FRHA 2EG5A 3U81A 3PVCA 5T67A 1JQ3A 5CVDA 4F85A 4RVGA 2Y1XA 4ER3A 1DL5A 3A7DA 3ELUA 3E05A 3JWGA 3GJYA 4FP9A 3LHDA 1N7IA 3TRKA 4YMHA 5DM0A 2ZCJA 3I53A 5CUQA 3DXXA 3R24A 1U2ZA 5F2OA 2YXDA 3KQSA 4RTNA 2PGXA 3B3JA 3EVGA 3R6TA 3HP7A 2NP7A 2ZBRA 3A26A 3EVAA 4XUCA 3GRYA 1JR4A 3NDJA 5K01A 5M5BA 1VP9A 2Q41A 3EVBA 5E1DA 3VYWA 2EFJA 3EEYA 3A4TA 3M6UA 3AY0A 4QDKA 1JSXA 3FPEA 5K0CA 2B25A 2P1DA 4GEKA 1L3CA 3SM3A 3KU1A 4BLUA 1NV9A 4EVIA 2PVCA 2UYCA 2OBFA 3HA7A 5FWAA 2N47A 3KR1A 5DSTA 4OA8A 3LDUA 5K0JA 2YUIA 5LQRA 3K6RA 7MHTA 1WG8A 1R8YA 5EC8A 4POOA 1N2XA 3P9CA 2AOWA 5CM2Z 2CL5A 3P97A 1ZQ9A 3TFWA 2BM8A 4ATNA 3KQMA 3QOXA 1SUIA 2PX2A 5LR6A 1BOOA 1SQGA 2C7QA 1NKVA 3IEIA 4QQKA 2B3TA 5KQRA 3G5LA 1XCLA 4PCAA 4BLVA 5EMMA 5EMJA 1UWVA 3ID6C 5EGSA 4PYJA 2OPBA 3LBYA 1P39A 1RJFA 3KPUA 3MTEA 5FQOA 4E2XA 4GUAA 3P9KA 4RTQA 5DM4A 5EZQA 2XVAA 3JWHA 3JWIA 4CKBA 3GCZA 2ZZKA 4QVKA 2XYQA 4RTMA 2VDWA 2XYVA 4R8SA 1X1BA 3L8DA 4RX1A 5BW4A 3TOSA 5HFJA 4QQNA 3HEMA 1KXZA 4PIPA 5FHQA 4K6MA 3SMQA 4FR0A 1KIAA 3LDFA 1RI2A 1O9HA 1P91A 2I7CA 1RJDA 3VC2A 3NWEA 4KVZA 1EG2A 5K0GA 1R18A 1JG2A 2ONZA 3B3GA 5P8WA 1KR5A 2AVNA 2YXEA 5EOVA 8MHTA 2ZWAA 2HTEA 3BGIA 3HCFA 2PT9A 3EGEA 3OZTA 5JUWA 3BT7A 2QRVA 1XDUA 5E2BA 1HNNA 5GM2A 3DXYA 3HCDA 5DLYA 3RODA 1YZHA 5GWXA 3BWYA 5GINE 3B7PA 3LX6A 5E8RA 3G88A 1QAMA 3REOA 2YVLA 5F2KA 4FT2A 5KYGA 2Z6QA 3M6VA 3FYDA 2ERCA 4PYOA 3PX3A 5DRYA 3SSMA 3VC1A 2ADMA 2FCAA 1D2HA 1NW6A 2P41A 4E70A 5DXAA 2G72A 3BUSA 4C06A 3FUVA 1L9KA 5HIKA 2BR4A 3A7EA 5T6BA 5ICGA 3M4XA 5H02A 4DCGA 4EMSA 3TPZA 1ZKDA 3DP7A 2PBFA 5E9JA 2UZ4A 1NBIA 3DR5A 1G55A 3DLCA 1XJ5A 3MAGA 5K0LA 3MQ2A 2CKDA 3GO4A 5EIWA 5K0EA 1SQFA 3A25A 3KQPA 4X63A 2O57A 2ZBPA 3LDGA 4IV0A 2QRVB 4P7GA 5FA8A 3TR6A 3KR9A 3O31A 2Y1WA 5MHTA 2A14A 4RTPA 2NYUA 3MTIA 3BXOA 1DCTA 1V39A 1ZHFA 1ZG3A 3CCFA 3SSNA 2EJUA 5CVVA 3UJ9A 3LKDA 3RW9A 4Y2HA 4KDRA 2AOXA 3UJDA 3P2EA 5E8JA 3FYCA 4RV9A 2NXEA 2FK8A 5E9WA 3HM2A 4E2YA 2CMHA 2AZTA 1RI1A 5K8VA 3PS9A 3KQYA 3O7WA 2BZGA 5HEKA 3CJRA 3C3YA 3EGVA 5DSXA 5FULA 3HCAA 3UJCA 2PSSA 1VE3A 1B42A 3K0BA 4GC5A 5LQUA 3THRA 2IDKA 2ORED 3X0DA 4ER5A 4PONA 5K0BA 4CXMA 2JG3A 2FHPA 2ZLBA 3RIEA 2OKCA 5K03A 3PT9A 1YZ3A 1JTFA 4DM3A 3DMHA 3UWPA 2H1RA 3CJTA 3P8ZA 4KIFA 3C3PA 3FPFA 1WXWA 1X1AA 1XTPA 4FGZA 2GAFA 5EG5A 4YUZA 1PJZA 5FUBA 5DX8A 5FADA 1IXKA 4B17A 3NVMB 4BP1A 1QAQA 4RVDA 2ZZMA 1VIDA 4YMGA 2BR5A 1G6Q1 3EVEA 3DXZA 2UYOA 4PGHA 1X19A 3SGLA 3GRRA 1P1BA 3C0KA 3GRZA 3HCEA 5EHGA 4FT4A 1UIRA 3SVZA 1D2GA 1BHJA 5E1OA 5T64A 5HOQA 3HCCA 3ELDA 5KVAA 2G70A 3E7PA 3P2IA 3AXTA 4CKEA 5LQKA 5FWDA 3ER8A 1NV8A 2AOUA 1SUSA 4YUVA 2P3QA 2IBTA 5ICCA 3EVCA 3G2OA 5EQJB 2C7OA 5K09A 1YB2A 1XXLA 3HVJA 1EAMA 2O0LA 3WSTA 2O07A 1KPIA 2BM9A 3LCVB 2KW5A 1SG9A 3UFBA 5CVUA 5IKMA 2ZTHA 4AX8A 3T7RA 4MHTA 4BP3A 4HH4A 1XVAA 3C6KA 3P2KA 2I6GA 1EJ0A 5FTWA 1VL5A 2JJQA 4P7JA 1JG1A 4C05A 1RI3A 2O06A 5DM2A 3R9XB 2GS9A 3LCUA 2AOVA 3G8AA 5HIJA 1YUBA 4HG2A 2AOUB 1WS6A 1TPYA 2CMGA 2UYQA 3CKKA 3AWIA 4EQZA 5GIPE 4FSDA 5EEHA 5EKXA 4FS8A 2IH5A 2EJTA 1T43A 4X41A 3NTVA 4F86A 3KPWA 4XUEA 5EZSA 2IH4A 5IH3A 3BGDA 2PXXA 1JSZA 4FSXA 5BP7A 3FZGA 4MQ4A 3IV6A 1P1CA 1MJFA 4CKCA 2GA9A 3UJ7A 3LCCA 2WA2A 4KW7A 5CCXA 1TW3A 2OB1A 2PX4A 3P9IA 2OXTA 4A6EA 4WXHA 2BH2A 4ER6A 2R6ZA 3KQQA 1ZGAA 2ZIFA 2FYTA 1FPQA 4MIKA 4DF3A 2PT6A 1IM8A 2R3SA 3OU6A 3G5TA 3LKZA 3UJ8A 4RTJA 2NNWB 1Z3CA 4AZTA 1FP1D 4EK9A 4ISCA 2AVDA 1EJ6A 2HWKA 1N7JA 3GGDA 3TKYA 2E5WA 3NMUF 1JG3A 5DTMA 3SR4A 2PLWA 3BWBA 2IH2A 3ME5A 3MCTA 4YV1A 4LWPA 4RTLA 3OE5A 4CTKA 3Q87B 3UZUA 2IIPA 5G02A 4PYIA 4X60A 4YUXA 5K05A 1EQAA 2GPYA 3UA4A 3FTCA 3KQTA 3MCZA 5E9QA 2OY0A 3OPNA 5D1NA 1G8SA 2H11A 2QYOA 2PKWA 1G60A 3HCBA 3OU2A 4OX9Y 2XBMA 4E33A 2B9EA 3EMBA 3NJRA 4YV2A 1XDZA 2H00A 5DM1A 1VLMA 3EVFA 3IHTA 4V0QA 2QM3A 3EEOA 1TW2A 3DMGA 4QDJA 1G38A 9MHTA 5EVJA 2VDVE 4E30A 1JTEA 4XUDA 4G56A 4GF5A 1VP3A 4R8RA 5U4XA 5FHRA 3ORHA 5BW5A 2O05A 3G89A 5KS2A 3AXSA 3CJQA 4Y30A 3IYLW 4NECA 1AF7A 1VQ1A 2WA1A 3SX0A 5K0NA 1L3BA 4QPPA 2G8NA 4C08A 2VZ9A 1XCJA 3T7TA 3KHKA 2JHCA 2AN3A 2P40A 2QE6A 3ELYA 3I58A 3C6MA 3MHTA 2VP3A 4QTUB 1BC5A 3TKAA 4O29A 5LQCA 5C0OE 1X1CA 4X61A 5JR3A 3UBTA 3FTEA 3I5UA 5DRTA 5ICFA 1I9GA 3FPJA 3G8BA 5CD1A 3GDHA 3HVKA 3PFHA 3CC8A 4EKIA 3EGIA 1YF3A 1Q0TA 2PX5A 3EVDA 3QV2A 3MGGA 1QANA 2K4MA 4JXJA 5ERGB 4GOOD 2Z6AA 1EIZA 2NXJA 4RSRA 3KR2A 4IV8A 3BZBA 4AUKA 1M6EX 3CVOA 4FZVA 2ONYA
chains in the Genus database with same CATH superfamily
3WWDA 4RHUA 3EZGA 3BTOA 5DOVA 1RRVA 3I64A 5HUHA 2BGLA 3JARB 1GPNA 4MJLA 4BAUA 4AWAA 3RJTA 4WOBA 2FA9A 4H1HA 1Y4AE 3A6PC 3ND6A 2AV6A 5IVDA 4ZO6A 2O2HA 2OGUA 3SBOA 2J0EA 2RONA 1BW9A 1OFHA 1AMOA 3N5KA 1NJGA 3R4CA 4JEUA 3WO0A 3BEDA 1P7CA 2O3QA 1NWCA 1YS4A 2VO1A 4UE6A 1XZFA 5DNEA 1K8ZB 3KZCA 4QOJA 4K8RB 3SSOA 1ESZA 3U0BA 2JGLA 1ZVKA 1NSYA 1THTA 2WDPA 3E81A 3T8YA 5AOVA 1C3EA 3S70A 3BWVA 2G6BA 1RZVA 3NRBA 5EMKA 4S24A 3PYMA 4NQZA 4NZ9A 1NW5A 4OMFG 3VQTA 5CITA 4JEHA 3SHOA 4YLYA 3WLLA 4WKPA 1QG0A 4X85A 2AL7A 2ZQYA 2X8JB 4EW2A 2PLAA 2SHKA 3QXHA 3REFA 4LC1A 5JRJA 3OETA 1JDJA 1OREA 3CUEF 4LE1A 1C4XA 4LY0A 4MEBA 4Q66C 3UMFA 4C0HA 5A5EA 1L1EA 3GNSA 4FDAA 2ZFUA 5IJXA 1T9GS 1XLVA 4KRFA 3KYBA 2WKRA 2K87A 1KZ1A 4BNNA 3L7LA 5LWHA 1IG3A 3A2NA 3F78A 1JLHA 4P3XA 5JJKA 2PUWA 1JF8A 3GJZA 3WB2A 1GTRA 2P9EA 3F4KA 2OR3A 1FDUA 1T10A 1Q0SA 4AD8A 4O25A 3ZQJA 2EQ5A 2ORVA 3GLUA 3X1WA 4IDEA 2G06A 3HU2A 3G0GA 4CG2A 4GKVA 3AHIA 4L02A 4Y1RB 1NVDA 5CP8A 2PSJA 1JGTA 3PU6A 4K7JA 3F3KA 1M2VA 3WLSA 2DLCX 3WIVA 4ALKA 2VUHB 1TZJA 5DTRA 3WLRA 4EO9A 2DECA 2CEKA 1SXJD 2RHOA 4HAIA 3K35A 4MH0R 1KP3A 4C07A 2FE1A 1ILEA 4P9NA 1F1BA 3FH0A 3LRPA 2JB9A 1IHOA 1P2TA 3I23A 5TE9A 1ONPA 4X9XA 3R20A 3TQHA 2XYGA 1JAIA 2J46A 1W5SA 3RK4A 2O2IA 4LRWA 1Q20A 1QYDA 1YS2X 2FN8A 2QTGA 1GSHA 1J9ZA 1V95A 2ZU0C 1G8AA 1XVIA 2J3MA 4EHJA 2XVYA 2N75A 1U28C 5JJIA 1XTVA 3IR6A 5D51S 3ZW8A 3OZSA 2Q3CA 4J43A 4WBNA 4ZQBA 1S2MA 4YMWA 4PICA 4PRYA 4FB5A 4FFMA 1E9FA 3DEHA 2J30A 4JVMA 3DKKA 3IOBA 2MJLA 4RQAA 2LCQA 1XC7A 3B1FA 3TO5A 1CF2O 3G79A 4YC7A 5TT1A 4BDSA 4YCMA 4M9UA 4QPDA 3ND9A 1DU4A 5G0SA 5JW6A 1M2FA 2PMKA 4HB4A 2V7VA 2IBSA 3F5SA 5BSVA 4OQDA 3VOBA 2JHGA 4HGYA 8OHMA 1UMCA 4P7BA 2PSDA 3GLHE 1XMOB 5LOVB 2HA6A 3PI7A 4G07A 4Q05A 4D5GA 4AUNA 2YXLA 2QVLA 4JEIA 5EYPB 1KEWA 4R9NA 1GA6A 4B45A 3GBSA 1YKSA 1AG9A 3FUUA 4GBED 1FJGB 1CIPA 3CUWA 4CR6A 4X1OA 2GBLA 2RGYA 5CB8A 1EFLA 1H4SA 1FYFA 1LFDB 4A5SA 1WULS 5D87A 4ZOCA 1AHHA 1KJIA 2VF7A 4WESB 2X76A 1VJ5A 3P32A 1UZMA 4WD3A 1YR8A 2MYTA 3DS8A 4HLUA 3UQYS 4E1VA 1SMKA 5IDYA 5LZ9A 3JQAD 5B6IA 4X1KB 2ZT7A 1LPBB 1SD5A 2QV0A 4LRXA 2DPYA 2WIBA 3PFCA 3DLTA 4PN3A 1NIJA 1RYBA 2BHRA 2O50A 3M82A 4K40A 2UVDA 3DQQA 5GMOA 4ZO9A 4D9GA 2WD7B 2BYTA 1TM4E 2ASEA 4D8XA 3KJEA 1ODJA 2NACA 4FGWA 4G24A 1R6XA 4B6QA 2F64A 4O5OA 3QXSA 4XPZA 4L22A 3MTJA 3TZEA 3ZBQA 2IYUA 1Y8CA 3STXA 1RM3A 3TRFA 1DG9A 4DZTA 3BXGA 1J4AA 4OJKA 1X8XA 3OFSA 2VSFA 3IAM1 3U7QA 4CWAA 5JD5A 1D4ZA 2NPFA 5TGTA 3QQPA 4CIDA 4DA4A 3VDRA 5E6RA 3H84A 4YDHB 3C7TA 2AG1A 3LL4A 1NSFA 2OHJA 3NBFA 4UHFA 2UVPB 5GJWC 4C7MA 4CQJA 3PP8A 3ZJ5A 2HTFA 1RMQA 2PAFA 2HHLA 2IYZA 3LFUA 1FFHA 1SEPA 3EZNA 3H7IA 2IWRA 2EFCB 2C07A 4OHKA 1SHJA 2QN7A 2UZAA 3ZX4A 1U3WA 3ER9A 3RRYA 2FI1A 2H8GA 1G16A 2QW0X 3FUTA 4GT1A 3LBHA 4XVQA 2XJ9A 4J90A 5FOUA 2OBXA 1P4HA 5L6LB 2O8EB 2HQSA 2QZZA 2WIGA 5GZ6A 3V2HA 1U6IA 2J8ZA 1MOZA 3ANNA 1MQ8B 1HG0A 2DM6A 4U63A 3JWJA 3W4IA 1RPJA 2KWIA 1XELA 2GPTA 3LLCA 3EMDA 3BKWA 3L77A 4JC5A 1ZI9A 1H8HD 2J9ZB 2Q27A 3MUNA 3ORQA 1E79D 3X1KA 3AL3A 5C46F 1PQPA 3HJAA 1G1MA 1PDVA 1GZ4A 1OXXK 2JFYA 3QVUA 4ODIA 1F7VA 1M2OA 4AI6A 1TZBA 4JYPA 2ZBUA 4CNQA 2HRQA 4CF6A 1CP2A 1WRBA 5ALIA 5D3QA 2H18A 2WSYB 3WKBA 2PKCA 2BKAA 2JIRA 4H77A 4QT4A 4BTLA 4UUMA 4R84A 4M76B 2Q41A 2CLKB 2BMFA 3ZI0A 3QYAA 4JU9A 4GICA 2UYCA 1XP8A 4PAWA 3W3AD 3E1KA 3N2KA 3ICQB 1GRRA 1LTQA 2OD7A 1FUIA 1T8SA 1R3DA 4BQFA 1JAZA 1FMJA 3JR3A 3NNDA 4R40A 3QLVA 1DOAA 5DSTA 3K9GA 4KR0A 3B70A 3GFOA 1JHRA 3IQFA 1CY2A 1XAGA 3R0IA 1PV4A 2OCXA 1HQYE 3PPVA 4LYYA 3LVBA 4E5UA 1YJAA 1E3IA 3L1HA 4POOA 1DV2A 2GN2A 5TVGA 2DUJA 2YJTD 3TL2A 2ECPA 3BIWA 3LC7O 4B6RA 1I7DA 5FI0B 2Y1DA 3H8SA 1DQYA 1O1YA 5K6RA 1RWMA 2MYPA 4MP8A 2MWMA 2O1XA 3C45A 4GX1A 3I6QA 4ZV4A 3N7AA 2IE0A 4PYJA 1C3XA 2H7CA 1WB5A 2PVSA 4HRXA 1RJFA 3HUFA 2WM2A 4PV7A 5J2TB 2B37A 2PIDA 4FDTA 1F6BA 5JO9A 3ZZTA 2X77A 5T3UA 1M3SA 5KKAA 4HQNA 3CNHA 5DM4A 2Q4TA 1J9EA 3EC7A 3ZR4B 4C87A 4OXQA 4ZN6A 1WDMA 4P38A 2OMKA 2DBVO 2OXEA 1Y89A 1XX6A 3HEMA 4G3XA 1NY5A 3RS2A 3QPDA 1YOBA 3UAGA 1AGXA 3KTAA 4KVZA 4OM7A 3AEKB 1OW3B 5DIFA 3L5OA 1EGMB 1P73A 2QN6A 4CMEC 1G2QA 3DYIA 2CXQA 4AX4A 1PLJA 3CWZA 3HXKA 4QWWA 2O3TA 1SXHA 1JRLA 3VR5D 1JR3E 1TJ4A 2JANA 1XD2A 2PMBA 1MOQA 1KH1A 2EL9A 2QRVA 2PL5A 4U2BA 1XCOA 3IVRA 5ITVA 4TSKA 3VSBA 2WWRA 1YBVA 1LSOA 2BPOA 4NJMB 2V5UA 2D4HA 1EXDA 3PJFA 1Y42X 3MSXA 1W5AA 1KE2A 2GLXA 2X58A 1DOZA 5KVCA 3FYDA 2J3JA 4L0MA 1ZD4A 3PX3A 1W0KA 4RMJA 1A97A 2HMUA 1XAHA 3EXFB 5DRYA 1P4SA 2P41A 4D3FA 1SCUB 1UOOA 2GK6A 3BUSA 1DUIA 4R1PA 3MA0A 1Z7YA 3KJZA 4QPJC 1WTAA 2ZQ5A 3KTOA 2NT4A 5TT0A 5LUAA 3FAKA 2E2WA 2JFXA 3CMCO 1U0NA 3ESRA 1QNLA 1XZGA 2JIOA 1G0NA 1G55A 1ULSA 4A0RA 5KOIA 4INZA 3GRKA 4L3WA 2CKDA 3LUAA 3TIXB 2J33A 3RD5A 4O4IA 4EO4A 3D2CA 3TFQA 1E89A 1PN3A 1O94D 3D5TA 1KVUA 2VK8A 3GPBA 3KR9A 4R1NA 2G5PA 1VLLA 4S1TA 3OA2A 4KLCA 4UAJA 3W8DA 1DCTA 2ZYTX 2A1TR 4O0MA 4B3CA 1NDUA 1QP8A 4ZMBA 1LDNA 3CCFA 1DE0A 2Q29A 4W8HA 5DV9A 4CUKA 2VWGA 5JS7A 2C54A 2WEKA 5KYYB 3FLEA 4ENUA 4KDRA 2GPAA 4AT1A 3MN1A 1ZXLA 1E1DA 2YMLA 3W5IA 3BRWA 3AI3A 2M9MA 3VHQA 3AR6A 3DVLA 5E0KB 5EHXA 4MWBA 3UVEA 3A6LA 4LI0A 1ZMRA 3WKCA 5ALDA 3UB2A 2OM2A 5ALZA 3I4CA 4WCFA 3ZE7A 2NTNA 4YRZA 1YKGA 2FXVA 3K0BA 2ZJ5A 2EC5A 4DSZA 1SXPA 2D5CA 2R8EA 2C7BA 3HGMA 4M87A 4Y6SA 4NC9A 4ZPJA 1N7HA 3LKVA 1TLTA 2FZEA 4IIVA 4MWEA 2XUAA 1YJXA 3P8ZA 4XLLA 4M0FA 2WOJA 1WXWA 1WDKA 2XMPA 2CHEA 4HRVA 5EFZA 5INTA 3R5HA 5FADA 2UKDA 3L92A 3UW1A 5LQNA 1H2HA 4UMEA 1QAQA 4JENA 3KOXA 4FE4A 4DUGA 1FNCA 1RBYA 3JYPA 1LJUA 1S2OA 1OUMA 4OJNA 4D8WA 2QY9A 2YNMC 2IZ7A 1UIRA 4IIJA 1ADYA 4IOJA 4KREA 1BOFA 2EL7A 3O8QA 2F17A 3DKIA 3T7DA 3H8VA 1Y8RB 1JHYA 2E4XA 2W8ZA 3OZWA 5H3CA 1PJCA 1NV8A 2DSTA 3WDKA 1OAKA 1CRLA 3U6BA 1ORTA 4XDHA 1VB3A 2IBTA 3BXFA 5LP1A 4JP5A 5DM70 1O58A 3C6XA 1NX6A 4TRJA 4TSRA 5EQJB 4EVRA 3NCTA 1XXLA 2YIDA 3MD9A 4O4HA 3PGXA 1N1EA 4RANA 5EGNA 1AXEA 3FYSA 3NONA 3NASA 3G68A 1UPXA 1QIMA 1K5PA 4BGUA 4R9UC 4ZC8A 5MDHA 2J5QA 1YQUA 4YASA 1X1TA 1XVAA 1Q3TA 2I6GA 2W7TA 2ZWIA 3LNCA 3ZWKA 3AJAA 3MHPA 4GBJA 1VPEA 4DNOA 4D25A 4JR2A 1BVHA 2FUCA 5K7SA 5FUVA 4EVSA 1KHTA 4HWGA 1GPYA 4NNPA 3CVVA 4CVNA 4HG2A 3U56A 1V7CA 4BNZA 1XZ8A 2CMGA 3IMGA 4BCBA 3LT0A 2HCTA 1A2QA 2EJTA 2YVAA 5JRZA 5LBIA 1XEXA 2Q5OA 5AVOA 1S6YA 5IH3A 1AXGA 3AI2A 4RKRA 3RGWS 1EIWA 1JSZA 5BP7A 2WT9A 1CSEE 2AK2A 4WZAE 5E0OA 4QKQA 2EJWA 4UJ5A 4C3OB 1XV5A 3PXUA 1U65A 1Q21A 3OZBA 1TZ2A 1ORVA 2WKSA 1LK5A 2HLNA 2YWJA 4FBMA 4UCQA 1KE1A 4WJLA 4MPJA 4O4JB 4I3FA 1RAHA 4CBVA 1X7HA 3S8YA 3FFAA 4ZVVA 3OU6A 2J3KA 4OF4A 3TLKA 4XRRA 4CHTA 2NNWB 1T8PA 1Z3CA 4AZTA 3PZRA 2AVDA 3TIVA 2CEAA 2X9VA 4Q9JA 1VYUA 2GAAA 1NZDA 2F00A 4F8JA 2QBYA 2AT1A 4ETMA 1USVA 2C9OA 5D01A 4YV1A 3J80A 4R69A 1JIJA 2COKA 5T8KC 1GUDA 1M1YE 3FYUC 1YRHA 2BHLA 1TC1A 2DHDA 5AHRA 3GRPA 2G8LA 1W8IA 4HNGA 5BNWA 4NBSA 3SF8A 2AGVA 2QP4A 3I6YA 3ZS9A 4CM8A 4PLCA 1CNMA 1SD1A 1T13A 4DIBA 2J48A 1UBNA 3FWNA 3D0KA 3EHDA 1H6BA 1D5WA 1EVKA 2QROA 2OQ2A 3L9XA 4YV2A 1XDZA 2H00A 1ST2A 2N3ZA 1IIRA 1WA5A 2JI4A 3C85A 3EBPA 1NY6A 1Z7GA 5LC1A 2BFCA 5CDYA 1W4RA 2IK8A 4B80A 4C30A 4X62B 3P0FA 1S9HA 1NRXA 4MIYA 1V48A 4R8RA 2K2QB 4YJDA 1BVUA 3ORHA 1JHDA 4XW2A 4ID9A 1UBSB 1ANKA 3HYNA 3QTBA 3MYRA 1SBQA 4IIFA 1FE8A 5F1PA 2V9ZA 4ZCQA 3IE0A 5KOHB 3R75A 3R41A 1YQDA 4C2UA 3VMMA 2BFBA 3I32A 1N9KA 1TVEA 4MJ3A 1JWLA 2J31A 1PZMA 1EGHA 1E3SA 3ADKA 5LZ4A 4Q1BA 3MHTA 4EPYA 5HMLA 2DUNA 1EFRA 4KGVA 2R00C 5AW5A 2AFVA 3OEED 4P1ZA 5FB3A 3WQHA 4RGBA 1BD3A 4I55B 1M0WA 4J1SA 4QOHA 5IK2D 5JJCA 5CD1A 1YA8A 3JD0A 2O48X 5TARA 3R6DA 1Y34E 2WU8A 1DXYA 4PQYA 1GAXA 1XLTA 1T6BY 3WOVA 2BUBA 4H6WA 1OFVA 2CHVA 3FGOA 1N32B 1VDMA 3OMLA 1ZIXA 4HB0A 1Y4DE 5ADUS 1FX0A 4CN8A 4B3SB 3HUEA 4AAYA 2I2XB 1EVIA 4A2QA 2XD9A 3PK0A 1QCDA 5E7QA 3SXJA 1FDOA 5AIBA 5CCBA 1UDRA 5DHFA 2O1EA 1IG0A 1L7RA 2RGNA 5J4YA 2P68A 4XFDA 3GVIA 4PBSA 2COUA 1MEOA 3L4KA 1OIXA 3OF5A 4KNWA 4MLZA 5B1IA 2Q4OA 4HDKA 1CR2A 1AM4D 3Q9NA 1XPJA 5C34B 1YFKA 4S2EA 5BSEA 3BQ9A 2EKQA 4I4IA 5CXUA 4IGIA 1FW8A 1TUIA 3KPJA 1E1NA 2A0FA 3DW3X 3M5CA 4MGZR 4CMAA 2VJYA 4AZ0B 3F49S 5HQTA 2GO1A 1PE0A 3UV6A 3AHDA 3KYDB 4X84A 3W0LB 3E3OA 1N0HA 4ERXA 2IYPA 1IXZA 1HGXA 2JI8A 3TEFA 5B5SA 2IUFA 2XNSA 4D9EA 3TX2A 4DJDC 2P2ZA 4BNUA 2WIFA 1XL0A 3RBZA 3Q8LA 5EJ7A 1G21A 3ABQB 4L3OA 2XQKA 3QOWA 4RMHA 4AJOA 2YHSA 3CE6A 3HO8A 4MGYR 3NDIA 3ZGOA 2CXSA 3HRHA 2BGKA 2HMSA 4PGGA 3EIXA 1IJBA 2NV2B 2OESA 3AK4A 1S2LA 3AJRA 3P9NA 3PUIA 4LMBA 1U3CA 4PIMA 2C82A 1IOVA 2NVBA 2C3UA 1N1MA 2WY2D 4C04A 3FNFA 3KE9A 4MDHA 3GQBA 5HX7A 1G2OA 2OZVA 2OILA 3GJ4A 1PZFA 4TKUA 3T3IA 2PO7A 1AGNA 4JT4A 3RUHA 4EGAA 1TMYA 3GNLA 4O4LA 4M7RA 4TL9A 2FFAA 2AFIE 2AR7A 2GTIA 2W4QA 2H31A 3VFDA 4EHKA 3DD1A 5BSGA 4QJBA 4V0RA 4P98A 4C7OB 1E8MA 3K9NA 1YK0A 1YQXA 3OFJA 3INYA 5AO9A 5EKDA 3OO1A 5EJIA 3MD0A 1TKRA 2QD1A 4N7BA 3CXRA 4BNVA 2YHIB 3DLPX 4MRRA 2YW2A 5IYZB 1GM5A 2L18A 3AVVA 3DBRB 4D9FA 1BEUB 4KXMA 3IHWA 3PQ4A 1KO7A 4MR8A 3ZD8A 3FFTA 4Q01A 2D5LA 2YUTA 4BO5A 2XXAA 5H9WA 4TS3A 1MX5A 3NTQA 1Z28A 5L51A 1SIWA 1TXGA 3C24A 4MUJA 3SZUA 2RK4A 4C0QC 1E1CA 1IBSA 2FZ5A 2BE7A 4OU4A 2G07A 5EZYA 5I7FA 3BS4A 3MJSA 3PEUA 4PPQA 4DQLA 1OLXA 2WSLA 3CLTC 4Q6BA 5F9HA 3NM5A 2FOXA 2E5LB 7GPBA 1NA5A 3L93A 1KI9A 4DRYA 4YRMA 1BE1A 1JG7A 2EF1A 3D3WB 3EDOA 4FLFA 2XT9A 5KMGA 3OT5A 4DKJA 3TIIA 1WMDA 1PR3A 2YHUA 4P0TA 5GONF 2H4WA 1JU3A 3H2HA 3I72A 4BO6A 3A10A 3T15A 5KIAA 1GYQA 2AWOA 4I4NA 5TY0A 2ZIVB 4P58A 4QL3A 3OT1A 1VCHA 5D3MB 4BMNA 4E22A 1Q84A 1VXRA 1WXGA 4PRLA 4XB6B 1A8UA 1QUEA 4PS0A 4A27A 2HIHA 3AZPA 1HSZA 1Z07A 2CFRA 1L4BA 4RZHA 4AB1A 5LQMA 4NU0A 3KKMA 3ELBA 4TTJA 3DO8A 1FFBA 1QDEA 3WG9A 2EAUA 3ZOZA 2QN8A 3A4NA 3MT8A 4XD2A 2GLUA 5EQFA 1RP1A 3DL0A 3VXKA 4OI0A 5DF1A 2G40A 5D86A 2YY6A 4I1RA 4J0QA 3AESA 4ZZ0A 1SIUA 1PGOA 1IMOA 4EG7A 4BE9A 4KR3A 4Z51A 3HYTA 4G0QA 1KYYA 4V0NA 2ZIEA 1W94A 4UM8B 4Z2YA 4GXRA 1JZTA 3K31A 3ROKA 5JS2A 4A0FA 5JS8A 2GM4A 4F3YA 2YYAA 1R8QA 3W34A 1XOIA 3VR1A 1A9QA 3K96A 4MOWA 5IBRA 3LD9A 3SFTA 1QIIA 4I3GA 1NE2A 1EHIA 4NULA 2JJMA 1GVHA 1ZK2A 3K1YA 1CB7A 1T5SA 4TLDA 3SZRA 3MJHA 2C2WA 1AK9A 2AKYA 5BWMA 1QS0B 2VRCD 3SJZA 3JQ7A 2C9ZA 1F0KA 4AG5A 2Q6TA 2AJDA 4GE3A 1Y5MA 1YGPA 3EUWA 2XYRA 1Z2DA 3ADPA 5JH7A 1RYDA 1IMJA 5A7GA 3MERA 4JY7A 4NK5A 2TRSB 4YJKA 3REGA 2QMOA 2Y2VA 4F91B 2XTAA 2PRJA 1NU6A 4BYGA 5CA1B 2XAUA 3E3AA 5HGJA 2X14A 1HA3A 2AD5A 3LM8A 4XGNA 2Q9UA 2JCSA 4X7RA 2EX1A 3NBUA 2JJ2A 3KSUA 4CCAA 4TQAA 5T67A 5BW6B 1PGPA 4JQCA 4MYRA 5KNDD 2R5FA 3Q41A 5AK0A 2RKWA 1T9ZA 2PMWB 1PGQA 4G0MA 1ZOIA 3JAKA 4NF2A 4NOKA 3D3KA 4LOIA 1V5WA 1C3OA 2QMYA 4PAQA 5GZ1A 3TH5A 3PE3A 2IC5A 2BL4A 2XQIA 4GLFA 3HO1A 3UC5A 4W8OA 4KO4S 1PUIA 1J20A 2HQBA 4A15A 3DUFA 1N9ZA 3IXMA 3R3YA 1NI4A 1FEZA 1RRFA 1BIFA 1WBJB 2JA2A 3AEUB 3DFKA 3MG9A 4NYMQ 4ND3A 2XMBA 4RH3A 2R6FA 2XZLA 4GEKA 1OASA 1L3CA 3N2GA 1MOSA 1NV9A 3N0RA 4YCBA 1KIMA 3BXPA 4KACA 3PRJA 2Y27A 3RTBA 1SNYA 5FUMA 1PAUA 2QVYX 2VUIB 3EE6A 1EX1A 1EP3B 2BGNA 2H4HA 3DDHA 3MBKA 4DLAA 5K0JA 4RAQA 4RE6A 4AU1A 1U0TA 1SD2A 4MGEA 1TQHA 5DGTA 2YWFA 4ZK6A 2BFNA 3HRIA 1OV6A 3NV7A 2GPWA 3ESYA 4MV9A 4W82A 1N2XA 3FF4A 3CUTA 3MINA 1KMHA 3PFIA 3T9EA 4EYOA 1I14A 4NIMA 2BSAA 3AF1A 1IVNA 2H3EA 2JD0A 3FN4A 3VHXB 2E4WA 1JIKA 4CU5A 1VYTA 5L7WA 1R9MA 2KI5A 2VUTA 4G89A 5IC5A 1XCLA 3HI4A 3KZKA 3O3NB 4UU1A 4XSGA 3VR2D 1UWVA 1DTEA 4LXXA 4BNXA 1IBCA 2VHYA 2ODAA 3OA0A 4JR0A 4ZI2A 3RUCA 1CEXA 4C5BA 4FOTA 1C30B 2I1QA 2BGTA 4QOEA 2FMUA 4LYEA 1GARA 5HS6A 4JWTA 5EZQA 3SC3A 2XYVA 2GDJA 2O8FA 3HSSA 1SA0A 4R9RA 1TLFA 4QEKA 4UM7A 1Y7HA 3BFXA 5IJ0A 1OYYA 5FP0A 4MTCA 4OQNA 3X1MA 3REQB 2CLFB 1DCKA 3AINA 5ELXA 1WETA 4HLQB 1U90A 2V9CA 1YZQA 1U1DA 2ACVA 1DMRA 3KZVA 3QH4A 1Z5GA 3H3XA 3D81A 1UWLA 1D6SA 1RQ7A 2DBRA 1T4MA 3H1PA 3QX8A 3VMFA 3WR5A 1WF3A 4W7HA 1QKKA 2XNHA 5B1EA 5JUWA 4IDGA 1RS0A 2BFDA 3U61B 4ZKEA 2JKZA 1P5RA 2XJ4A 4M9QA 5LJLA 2P77A 3CZAA 4X8MA 3NUQA 1NYTA 3UAOA 4WASA 4BN0A 5FV4A 2C4HA 3OQVA 2X4DA 2PUEA 5E8RA 3OM8A 4FFPA 1RZRA 1S4MA 3CG4A 3OPVA 4K9QA 4UU8A 1XEAA 3IEXA 3TZCA 2Z5VA 1XWWA 1A4IA 1XQVA 2EIHA 4M7WA 1JDBB 4HGQA 4M9CA 4JT8A 5ILGA 4BV9A 1MR3F 5J1SB 2XOKA 3PWSA 4AMBA 3FUVA 4URYR 4TV8B 5ICGA 1W76A 3BT7A 2JK0A 5HP4A 2IXGA 4WECA 1RWXA 2C3OA 3EF1A 3Q2KA 4RIGA 1C0KA 1ZNXA 2WWYA 3GFSA 3RADC 3JAWB 3M6MD 2B1RA 4RFVA 5FWNA 3V3KA 3IDOA 1PW7A 2W8BA 4BS9A 2V0NA 4UAUA 4RPKA 4DY4A 1T8YA 1ZC3A 3OD5A 3C97A 2NYRA 4ZAVA 4DCSA 5F4ZA 3H9UA 1KI3A 3F6BX 1QR6A 5KJ1A 3DBOB 4C3ZA 5JQWA 5LB4A 1LFAA 1ZONA 4IQ4A 1YB7A 2SICE 1OH7A 1MO5A 4EYGA 2Q2OA 5I47A 2O8VA 1IM5A 1LDEA 4HYQA 2GNAA 1OWNA 1QHGA 2B92A 4GHWA 3AU9A 2L82A 5JCJD 3THYA 2CJPA 1VE3A 1LBEA 2IDKA 1OWMA 1TOAA 1Z5NA 4L78A 4CXMA 5K0BA 1RM0A 2Q3LA 3CRW1 1JJVA 2M6LA 4H6VA 3IAEA 1LBTA 1NAHA 4KIFA 1B14A 1TNDA 3IBSA 5EHQA 4AF7A 3FPFA 4TTVA 4DIKA 4MZDA 4MV1A 5ALWA 1JT9A 3VYVA 3RC8A 3MAJA 1UPCA 3L4EA 4X3PA 3QI7A 1V37A 2FGJA 3NVMB 4RVDA 2Y9PB 4EB6A 4YRIA 1UBCA 4NV0A 2QLLA 4MS3A 1CLUA 1MABB 4ED9A 1XTKA 4JUCA 2QYSA 4YQZA 1XZBA 3GN1A 5LDHA 2EOAA 2RKBA 1H85A 4LOKA 1UBKS 3AXTA 1RHRA 2B2XA 3F2VA 1AXRA 1IUNA 5EQTA 3SQNA 3R0JA 4XQ9A 2DR0A 5IM5A 3EZXA 1Q7TA 3ZTTA 4L4XA 3WKEA 2JAHA 3LT1A 4ENPA 1Y3CE 3DE5X 4JNCA 4AIRA 4DOMA 5EJ5A 5K09A 2XB9A 1FS5A 4R0NA 4KMOA 4Q02A 2XMCA 5ESDA 2XCIA 5C3UA 3S5UA 2XNDA 4RK6A 5IN4A 3THWA 2VPPA 3KAPA 4WA8A 1J1IA 3ZTWA 2X0RA 4OFWA 3GPCA 4KPEC 1KVQA 3T7RA 1BZYA 4PNPA 4MW7A 1TC2A 3RBVA 5F7XA 1HFKA 3CF6R 1YXMA 3UAXA 3KQHA 3NDBB 1XQXA 1ZJ5A 1ZD9A 4PLGA 5FF9A 4C05A 4BO1A 5AFSA 1HSOA 3IXLA 4Y0NA 2QAGC 4RZIA 2R2AA 1B3RA 2F43B 4YYZA 2KBEA 2ONCA 4RY9A 5KOJB 2WQ7A 3BMNB 1OAOA 4FS8A 3SZMA 5CDFE 4F56A 1B00A 3KPWA 4BVHA 1SUEA 4KHZA 5C51B 4URVR 1XQ6A 4ZVUA 3IMCA 3BGDA 3LWBA 4BXOA 4CEJB 2ZR0A 3B3QA 3HDTA 5D6OA 1E2MA 3L3BA 4OHRA 4IVRA 2VOJA 3AKDA 1GNLA 1WBDA 1H9CA 4JOSA 2QLBA 1TW3A 3GI1A 3IO5A 1DJPA 1NRWA 5J2TF 1GQRA 3SQMA 4DNFA 1DQPA 4NBUA 4Q93A 4G5YA 4XYEA 5G53C 4Q4AA 4X1IA 2DWUA 2CLOB 3GB9A 4WY5A 1UKZA 1D04A 4YJ3F 1AMNA 3A1WA 4O02B 2GESA 3FCUB 3RIHA 1O6FA 4UEOA 1TYEB 3GEBA 3I9LA 2IUTA 1X9IA 2V97A 4W1RA 2DBQA 4KXYA 3ME5A 4CFYA 3IBFA 3AIKA 3FCAA 4HNRA 3KXLA 3Q0EA 2Z5FA 4KVGA 2FLWA 4WJZA 1PP4A 4PF1A 1G42A 5LLSA 3PDHA 4GSYA 2ZAOA 3FTCA 3KQTA 2HB6A 2JFBA 2OFXA 4ZAWA 3VPDA 3HCBA 1T2NA 3GZNA 1XAIA 4BVJA 4RSHA 4BP9A 4LQLA 1GG5A 1HX7A 1PV1A 4ZCPA 4J1TA 1DS6A 1O4VA 1TF7A 3NWJA 4HGRA 1TW2A 1URPA 3I52A 4DMMA 1N2HA 1CU1A 1D7OA 4G67A 4F6RA 5A0VA 1RAIA 1RFLA 3K32A 1KEEA 1E6MA 1DKOA 3BH7A 3IVMA 4FE7A 1J1ZA 3CH6A 1ZD3A 1CUXA 2YJ4A 5DGCA 1QNFA 4BO0A 2FNAA 3RRZA 4PW0A 4WIAA 2IHYA 3BB3A 4J16A 4HH1A 3TLCA 2LDXA 3L4BA 2JHCA 4BX9A 1VKZA 4HATA 4I99A 4QU9A 4GZ3A 5CVCA 5CG1A 3R7WB 3CZ5A 3PENA 4HBZA 4IIBA 4QTUB 5SY4A 3TKAA 1QZUA 4F84A 2HMAA 3DLAA 2A5LA 4ZGBA 3OQBA 1CVIA 4ZT2A 4EPWA 3CS3A 1T2DA 2MSLA 2A30A 3OE1A 3O8OB 3PC6A 4HJRA 3S40A 1IVYA 2OGTA 4PZ0A 3FSGD 4LJ8A 5BUCA 3K9CA 4KXUA 2G28A 2OTCA 4H6XA 1QANA 2R8RA 4JXJA 3L4JA 2Z6AA 3BOSA 1NNI1 2PGDA 4MKGA 3V4OA 4AUKA 1T2UA 3OIGA 3UBMA 1FU4A 2WF9A 3WKDA 4BNMA 3LT2A 2E21A 1AUPA 1TFUA 4EJSA 1HFEL 1YJ5A 2Q3FA 2JGRA 4TYPA 3LPMA 4NDAA 4JELA 1YC2A 3NTOA 4HAVA 2GK4A 2YNMD 2X9GA 1F2TA 3Q6NA 4Q1DA 1DTWA 5FIUA 1O6GA 4DV5B 2IW3A 4UE3S 1YACA 2ZIAA 3ND7A 3E27A 4LNHA 3W78A 2G25A 2EGUA 2IHZA 4XWKA 4IM7A 4MIEA 2OSBA 1Z4NA 3VBEA 4GR4A 3H2JA 5GP1A 2B2NA 3PGVA 4RKWA 2F8LA 2R4QA 5CAEA 1SWVA 4MYHA 2AN9A 2V58A 1UEIA 3I4LA 3N3BC 4V39A 3TSWA 4GR5A 3N2YA 4JC4A 3S44A 4LF7B 3NFYA 5BN4B 2IXAA 5LDGA 3U3OA 4NR0A 5JXIA 3B9PA 5CH5A 1ZR2A 1FXWA 1KJJA 2P27A 4TLLB 4D4IA 4A16A 1F6DA 4PXSA 3UT5A 4QG3A 4PLTA 1QZ3A 4FEYA 1UFKA 3KV3O 3FMVA 4QE3A 2PDAA 2NMVA 1RHMA 4XM1A 2RHGB 1E9AA 3ABIA 3BHIA 4HAWA 2IOFA 2W2OA 1DKNA 2ZSBA 2NTEA 3MWFA 2IEZA 1E6KA 2P7HA 2F90A 1S8FA 1QHIA 2CBGA 5BQOA 4EUKA 4RTKA 5B12A 2ZI9A 3MPOA 1ZCFA 3FIUA 4P93A 3Q7RA 2FP4B 4O1MA 4B87A 1D1QA 1M74A 3RSFA 2AQIA 3U09A 2WSBA 4HWSA 2P9QA 5J3JA 3ZDXB 1XIVA 1OZAA 2FZVA 4R8MA 1ZHHA 4TT3D 3ERCA 1A9XA 2K2WA 3KX2A 1J99A 3CCBA 5BOSB 1JTVA 4RK0A 2AKEA 1YCGA 1Z0IA 1GY8A 4FSHA 1P74A 2O5CA 2REQA 1WHSA 2BP7A 3DC2A 3M3HA 1X7GA 4EW1A 2YDXA 3ZX5A 2PZMA 1JQLB 1X2BA 1FLAA 2J4CA 3GR6A 2O8CB 3QJGA 4ZALA 1KQNA 1U0HC 1VMIA 1Z26A 3MB8A 3AVXA 1SRRA 4HDSB 4V2IA 5J59A 1MO3A 4RBNA 1E63A 4Q24A 5AK3A 3QXJA 5B3KA 3THXA 1E9SA 2DFTA 2PV7A 1ADJA 1MGPA 1T1SA 3D7RA 1RAAA 4IHJF 2HBZA 1IUPA 2IHJA 3FAZA 4B32A 5FLYA 1J07A 1SKAA 1UZAA 3PNYA 3OPYB 3PGMA 1A9OA 3OX4A 4MVJF 2C31A 4LTDA 2J5RA 1X7YA 1AKNA 2OYCA 4CLDA 1GCGA 1TAGA 1JFVA 1AGPA 1ZL2A 1M2EA 1GAQA 4QLOA 5DN9A 1Z4OA 4JX8A 3GP3A 4C0JA 3VC3A 1C7QA 2P1RA 1KJWA 1GZUA 1KYQA 1MH1A 2IDJA 1H4QA 3WL4A 3FBWA 2GRAA 5LXTA 1TVKA 3IUYA 1TIBA 4KV7A 4K26A 4OJTA 3ND8A 3GXOA 4FW9A 2YRFA 2VL7A 1ISJA 2YRWA 5FI5A 5H80A 2WSSD 4EUEA 2X15A 5A5DA 3T5CA 1E2DA 3V4SA 5LZ8A 3QM1A 4G37A 5HKKA 3AOGA 4JD5A 3CXUA 1QE0A 3NG1A 2Y67A 1ZJZA 4PPYA 4Q3BA 5LQJA 5IT4A 1JFLA 3COWA 3PE6A 1RRCA 3NTXA 4L74A 4EHAA 1R00A 4QTTB 1I2DA 2BEUA 3HA5A 4BLWA 1HDCA 1R0WA 1VL1A 1ECBA 3D02A 5CIQA 3K8QA 1WLYA 1O9GA 4GU5A 5DTIA 3ZE1B 3DO6A 3N07A 4NX2A 4P3NA 4DDTA 1XMPA 2MYUA 1KK0A 3H18A 5BVHA 1SC6A 2HC9A 3A6FA 3W2HA 2CV1A 3CURA 1SXJA 1F17A 1YKFA 2CUTA 4Y9UA 3UWMA 4PCUA 1BCRA 2RI0A 1P17A 4M8SA 3N86A 4L08A 3LAWA 2CFOA 2FPIA 2CYAA 2PWAA 3NBQA 3UJ6A 1PZNA 1RPAA 4RTRA 1NBHA 1IBLB 3PTAA 2HMWA 1R3UA 4UXHA 3ENQA 1L2TA 1V7QA 1W25A 1ZN7A 2XNKA 4IKPA 3DOHA 2R7LA 3I6BA 3EBOA 4R5HA 3UK1A 1JJ7A 1QZZA 3UMSA 3VU9A 3WWZA 4OHBA 1RI4A 2AHRA 3DULA 4XVHA 1XEWY 1V5FA 2HLDA 3EODA 4YRLA 2Q7DA 3WL8A 4J75A 4OYHA 3WYBA 2ZJAA 3CRZA 4NNJA 3ITEA 4O1HA 4GQBA 2Q7OE 3VZSA 3ZVRA 4RS3A 3OHSX 2CNOA 5F78A 1DWOA 4RVHA 3WK8A 4LGMA 5DU2A 1A7JA 2OV6A 4Q7KA 5F2NA 1XZMA 1FUYB 3STTA 4ZVSA 4N47A 4CM4B 2HF7A 2QU8A 2GKSA 1I4TD 1V41E 4W1SA 2IYWA 2NUPA 3T35A 2QX9A 3WI7A 1O5TA 4ZQHA 2HIMA 1UEXC 1X86B 2Q1YA 4G86A 2RD2A 3FRIA 4KQ1A 1W1UA 3AVUA 4WK4B 2GO7A 5IT5A 4HYEA 3FOEC 1YFJA 3ZK8A 1QB8A 2IV3A 2QMUA 1MT3A 4F85A 1SUCA 1VE7A 1LPSA 2Y6VA 4HVAA 1AB6A 1IQ0A 2HM7A 4LA4A 3EVTA 3LJKA 1FP4B 1YDEA 1NW4A 1NUQA 2RBGA 4XM0A 3RVKA 2CVPA 3X1YA 3ZHCA 4B79A 4MAFA 1TAUA 1Q1QA 1EK1A 5B1YA 5DGIA 2G9RA 4FMBB 1EM6A 2XVZA 5E4FA 2EKBA 1RKUA 3FPEA 1CUDA 4UVIA 4YN3A 2G9QA 1IIBA 2GETA 1IEWA 3WGQA 4TXHA 3AHCA 3JS5A 3F6CA 1O8BA 3V55A 4OHMA 5B3AA 4YY3B 3PICA 1UDWA 3MUEA 1FLDA 2AJCA 2ZEJA 4F1WA 3K5WA 5C53B 4F6CA 1WDWB 5KAPA 2CVZA 2G76A 3F4LA 3LHIA 4IJVA 1BE0A 3TSOA 4DHWA 3LDHA 1WUYA 1VYVA 2XH8A 4NCXA 2R48A 5CTAA 4PLZA 2F67A 3CLTD 1E1MA 4JBWA 5IZ4A 1FFSA 3H5VA 4YGXB 5C31A 3VBCA 5B30A 1CDEA 4YMIA 4QFCA 1DQZA 4Q3OA 4EX6A 3CO0S 5FQOA 2ZYGA 2Z9BA 3P4XA 1HE8B 1YULA 1T29A 4QDTA 5GV8A 1T3TA 3CZQA 1NQXA 1SPBS 2MSWA 3QU4A 1D2EA 1BDHA 4QVKA 3TB6A 1Y1KE 1MQAA 4A0GA 3KEGA 6REQB 5HFJA 1Z4QA 3T7AA 1GPJA 1ZNYA 2GF2A 2HADA 3ETLA 3ILXA 2FJ0A 3DYBA 4MUKA 2WFMA 3I28A 4WGGA 4R1SA 5ELLA 1FOEB 5CA0B 4XSVA 3IB6A 1HLGA 4YFVA 1R18A 1QX4A 2WJVA 1TO2E 3E4CA 1DRJA 3FKSD 4HZUB 1F06A 2XZTA 4LVNA 4QO7A 1EXNA 2H2GA 5M29A 2K7ZA 4RQUA 3RVQA 3H4TA 4IEEA 4L85A 3BGIA 2ZAIA 4UOZA 2A2ZA 3D2BA 3IEPA 1DGQA 1WVIA 3QEAZ 4H7JA 1JEQA 1HNNA 5GM2A 3DF9A 4ZI3A 3A0UA 4Y2PA 5AVQA 1BJTA 1NQUA 3AIOA 2O2YA 4WDRA 1Z4LA 4GXTA 4GWGA 5K2OA 1CHDA 2FW0A 2Y6UA 4DS3A 3ROZA 3GLFA 3BFJA 5H3LA 4UNRA 1PZXA 4U4AA 1ZMTA 4BNYA 1XVVA 3Q8WA 3QELA 4E21A 5CNJA 1G4UR 4M8KA 1L5HA 3T3MB 4TVSA 4R3WA 3FTQA 4Q9DA 2I4OA 3V4RA 2A5GA 2HZ7A 4G5FA 4MSUA 2XECA 4BO3A 4B0OA 4KXVA 3RSLA 1F2UB 4G5SA 2VDJA 3NHKA 1AJEA 1FQWA 1BRTA 4PHGA 3FFXA 2IUYA 3RUDA 5IXSA 4MQLA 1HNZB 1L5WA 1I6MA 1SQFA 2Z57A 3C3KA 5FA8A 3K5HA 3LDGA 4QA9A 1KIFA 5CT8A 2A5FA 4RKFA 3DKVA 4EGSA 2OCAA 1Y6JA 3C3XA 4IGAA 4DSOA 5DT9A 1LV8A 3B5JA 3FNBA 2W43A 1T36A 1J2TA 1ZHFA 2QLNA 2DJ5A 2ES4A 2IXEA 2PH5A 4PX5A 2PRIA 4U39A 2W42A 3LO5A 3QFHA 4Y6PA 4K9DA 4AJ2A 1EI9A 3FNRA 4GDMA 4LS3A 3RRBA 3VVCA 1VCNA 2VTEA 3JALA 3ZE0B 1JR3D 1A71A 4N3CA 3VKUA 3RSOA 3RJMA 2EATA 4HFNA 1BMFD 3L01A 4IDAA 1QB7A 1QZXA 1RI1A 1NBOA 4YO8A 1XZHA 4X7PA 4ZJUA 4LXHA 3X1ZA 4KK3A 1X7WB 3QUBA 4ZVRA 2H2WA 4AYTA 3K0FB 1TAQA 3U1TA 2H9IA 4YMSA 3S27A 1HUQA 1QO0A 2FF5A 1BD4A 3EZLA 1PNRA 2ODQA 2VDLB 3KEFA 2JKVA 1NF8A 2C5AA 2OKCA 1E1QA 4C14A 3CKMA 3HB0A 1IZ0A 3D3QA 3JQDA 3VU8A 1ZJ4A 4AY4A 5FJIA 5JYEA 2YZNA 4D3YA 3RB8A 1EZZA 1XN4A 5JU6A 2O6HA 5EWMA 3RHFA 1FU7A 3VJMA 5BMVB 3UJNA 3COVA 1RABA 1TL7C 1ZIPA 1NUHA 4LUCA 3NYIA 4BP1A 4ZVKA 1QQ6A 2OV8A 1S3IA 1E32A 2IY7A 2ORWA 3NP7A 2H51A 4BU1A 3RUPA 1P1BA 1OV4A 2DUMA 2ZGVA 2EGHA 2HU5A 4FFDA 3B2EA 3W5HA 5CA1F 3BHMA 1YOVA 5DLDA 5E1OA 2FG5A 1BS1A 5J40A 1FCJA 1CZUA 1SHUX 2FEKA 3H9BA 3PGA1 1KDVA 4Z7QB 4PO1A 5FWDA 5HJ5A 4H7HA 4A8JA 2AOUA 5JBNA 1I6LA 4KFTA 1QHHA 1UDXA 2H2FA 2ZYDA 1IM2A 3BJRA 3A9TA 3DZIA 4MS4A 4WLEA 2ADOA 1CZKA 2ERYA 2HL6A 2VK1A 3HKBA 5DCWA 3STUA 4B6EA 3BX1A 3AH8A 3M9XA 1DAHA 3WSVA 4Z7OB 2M6SA 2BM9A 1FLVA 3GPLA 1O94A 2MHCA 4I8DA 1DADA 1II9A 2BKVA 2J1LA 3CF4G 4U7GA 1E7SA 5FAKA 4FJ2A 2E0IA 5JBIA 3GVCA 3H5NA 1P33A 3JPWA 3RVPA 1K5HA 4LZNA 5I7VA 4RCZA 4EG3A 1VKJA 1UAAA 2O0HA 1KAGA 3G9XA 1FNNA 1FFXA 1NVUQ 5D85A 5DNUA 1WVMA 3ZU2A 1B0PA 1ZPDA 4IUCS 3O4IA 1WS6A 3AJ8A 4ZEOA 2F3UA 3RYHB 3W8NA 1JVBA 3V2GA 1YZNA 2J6HA 5FWXB 4GQIA 4X41A 2NUAA 1VBKA 1IWPB 4L57A 4QRIA 4W63A 4LCJA 2GKGA 3LW7A 4KQ2A 5DHTA 1P9LA 1PG2A 2WZQA 2C4UA 4E6PA 1RQRA 1P1CA 4N0MA 1MJFA 1N78A 3ET5A 1R4NB 1YZVA 5GONA 2BTQA 2EIXA 2TMGA 4A6EA 3D6AA 1A4XA 5DE3A 2BH2A 4KVFA 2JFWA 5DCUA 3RJ5A 1EWTA 1KQ3A 4FNAA 3QG1A 1Q91A 2HJHA 2JASA 4EF4A 3RYIA 1NG9A 3K16A 3ADBA 5WRFA 3L8ZA 1T0IA 2PD6A 1K63A 2HSEA 3AB3A 1CBUA 1PG5A 4MR9B 1CY0A 2V7UA 5DTMA 5BVGB 2VQEB 3R9WA 3EF3A 4LN1A 3II6X 4RPGA 1WNFA 4AS1A 5HKLA 3S7ZA 2DLNA 4H7IA 4LWPA 3Q87B 2EX0A 2IIPA 3VDXA 3VR6H 4EG5A 2A1UB 1L4HA 3GLGA 1B26A 1T1JA 1OXSC 2YC4C 1WZEA 2H65A 2C58A 1Y8QA 3HFJA 1OGIA 4RDXA 4PVDA 1G8SA 3BM5A 3LLSA 4Q21A 3RYFA 2XBMA 1U6JA 3QLTA 2K7FA 3EMBA 1O08A 3PPWA 4PEVA 4MXDA 1RAEA 5TS2A 4N48A 1AKTA 3VR2A 2G5TA 1JE1A 3GFQA 3QKRA 4P0QB 2NUTA 1NF9A 4NZPA 4PPNA 1EG7A 1PBTA 3FMGA 1EA7A 4DC9A 1BDIA 3BRSA 3I2GA 2EV9A 4DLLA 2WU1A 2AC4A 3ICWA 2GMWA 2QNBA 3AXSA 5ALLA 1ML3A 1EPUA 1RCTE 3O93A 2W4MA 4J0EA 1TT7A 3NHRA 2PRYA 4UBNA 2EWMA 3U9LA 3JARA 4F1KA 4PPGA 1IHDA 2A78A 3MJEA 3E9RA 3L8EA 4J7CA 4OQYA 4UDNA 2PTGA 4R81A 5L3RA 1B41A 1L7AA 2CC2A 1I01A 2X4LA 3N2NA 2NM0A 1XAJA 4DXAA 3PNMA 4BASA 4EFDA 1BC5A 3LYHA 4L73A 5C8DA 2OO5A 3SCZA 2JZNA 1YI1A 4V03A 2QPLA 3RS7A 5LL6P 2AG0A 3V2UA 3U16A 3PUXA 3NO4A 5KOYA 1I5RA 4EKIA 1YF3A 1U3UA 1YHYA 1O0SA 4HEA1 3ZYCA 4BMXA 2PX5A 2ENWA 4NMMA 2FDXA 2RBKA 2PPVA 1RDFA 1MTOA 1M6EX 1QYXA 2VAPA 2CBXA 3JQ6A 5AVTA 4I9UA 2B2CA 4EL5A 5AHOA 4BQSA 2X8JA 3VA7A 1FQOA 1PJ3A 1S3GA 2Q49A 3S29A 2PUAA 1Y5NA 4O6VA 4GOMD 4KK4A 3K09C 4YPFA 3S1AB 2JAPA 1Y3HA 3AQIA 3V1LA 4BZWA 2WKQA 2FB9A 3I76A 1F1JA 2ZRLA 4FFNA 1XHLA 3NOOA 4FTWA 1QHXA 1MAUA 1U2GC 2FSPA 4QELA 4R1TA 5HE9A 1UKVY 3K9LA 4AICA 3W1EA 5IBCA 1PZHA 3CZ9A 3WIEA 2X4GA 3HCWA 5KEIA 1KWKA 3U3DA 1M54A 2F62A 2QXTA 3PEVA 4D96A 2IU3A 2XUOA 5K3OA 2P9FA 3BD7A 2REOA 4U7TB 1UDAA 4PZLA 4TLCA 1G4HA 2VPTA 3D6VA 3F98A 3OZDA 3PPXA 4GKAA 5E2AA 1XR3A 4JA0A 2Y68A 4Y1RA 1YMQA 1I3OA 4G5GA 4UBIA 1X9GA 2V7EA 3G8CA 5KZMB 5FOVA 4UM5A 4LGCA 3RTDA 4KDEA 4OH7A 4KSCA 4L5YA 3HKEB 3ZWQA 1M0EA 4EA8A 1WDLA 4OA5A 4DC0A 2FDRA 2WE8A 5KTTA 1H1DA 2DQZA 1B8UA 1S7GA 2I7DA 1JVNA 2QUBA 2WDZA 5EIBC 4ZZIA 1OGYA 1W44A 5CJ2A 2NOAA 2NQ8A 2WM9B 4CT0A 3A1EA 4M0MA 1EWRA 4FCWA 4B71A 1Z0JA 3M33A 4DIOA 4QUBA 3IAHA 2AS0A 3A9CA 1M66A 2FWRA 1VJ0A 4V3CA 1JA9A 3WYCA 3BWCA 3DE4X 3CZCA 2AF4C 5GM1A 4ACBA 4YRAA 2II6A 1XDSA 5EY5B 1FC0A 3UH1A 3GP8A 4I4TF 4GQAA 1QHYA 5E7IA 5B58T 2V6IA 1VIMA 4FN5A 1ZGZA 3MCUA 2QVZX 3N2LA 3CNOA 2R7NA 3H0KA 4FYJA 3PB3A 4PTZA 3TMAA 3EIOA 1I1OA 2PV0A 1SUWA 1N8TA 5SZHB 1YZYA 1V25A 3VOAA 1W87A 3A32A 4YS6A 3W1WA 2G36A 4BLRA 3H4VA 1CZHA 4XQGA 2OK8A 3TTWA 1H5UA 2JLQA 4AG6A 4CMHA 5KTKA 1I80A 1YFZA 2YXNA 3EDMA 1IY0A 4WLFA 4L6CA 3K0AB 2I22A 4J3FA 4M98A 4DY6A 4D4GA 5B7NA 2X3YA 2OP0A 2NYVA 1IFXA 3WNBA 4O3MA 1JKJB 2AI2A 1I0IA 2W71A 4YDQA 3U3MA 5HRUA 1HFJA 4M0PA 821PA 3IC5A 3G7UA 1AN0A 4FINA 3CLSC 2R60A 5EYPA 3EPRA 1ZD5A 2H8KA 3F7TA 2GNOA 3DOFA 4PINA 5BSHA 4QXMA 1T2FA 4B7UA 1TK2A 2X8BA 3LPLA 4Q7LA 3EMKA 2DAPA 1AIPA 4C03A 2DLDA 4KH1A 2Q46A 1DC4A 3TBFA 3V8BA 1A9PA 4A6DA 5C8ZA 3ZWOA 2C61A 4RWEA 1NWHA 5JG7A 4CCSA 4YROA 4D43A 2E87A 4I4LA 2OKGA 2QS9A 1RI5A 1DUSA 4FYMA 4UU7A 4WESA 4BJ5A 4NRDA 1E77A 3IP6A 1NUUA 3TZQA 4B09A 4B7AA 2JDID 3QA9A 1TJYA 4W7SA 1NMSA 4D8TA 5HFNA 3FTNA 4B9AA 4ER7A 3IKLA 1E9VA 3KWMA 4X1KA 1GGNA 1ZK4A 4H0NA 4Z6KA 5L8VA 2C7RA 3ZNQA 2HNAA 5EWLB 3UKDA 3NC0C 4TSFD 1QJCA 2PGIA 3TAXA 1C8KA 2WD7A 3WRXA 5BRNA 1NLUA 3E4DA 3R1IA 2C0CA 2IUEA 2OFPA 2WIDA 4YPOA 2PUFA 2WWWA 2ODTX 2QRMA 4K2HA 1AE1A 1QHFA 3F1LA 4HMPA 2ZT5A 4MPDA 3ZU3A 1OGJA 3A8TA 4E4TA 2P4UA 5JVDA 1HQDA 1M5UA 3KJGA 1TMGE 2WHQA 2XF2A 2YY7A 2OVBA 2ZJ7A 2ZR9A 4M7OA 5AXDA 3W5SA 2LNDA 3N2IA 5E1BA 3S2GA 4JJIA 4WVFA 4YONB 1JWAB 2C1ZA 1GP2A 4F9TA 3SFZA 2HJVA 4AZVA 4PHFA 1NW8A 2DJIA 4TN1A 3TLXA 5FEMA 1INLA 1DO8A 5BNZA 2JIMA 2MTBA 2DFNA 4XIJA 4A5OA 3SNHA 1E9RA 2YS7A 4TMFA 1Z0ZA 3SY8A 4AS3A 1DRUA 5H16A 3OBIA 2PUDA 1QGYA 2QQEA 3OCYA 2OBYA 3OT4A 3VR3A 3A0RB 3EWAA 5K0ZA 2EG9A 3W90A 3A27A 1DWQA 4HN4B 3GJQA 3P0IA 2FRDA 1RYZA 3DFZA 2HV9A 3W9YA 4D41A 2GEVA 2V4UA 1CDOA 1ZUIA 2ZPAA 1XN1A 1VA5A 1XWIA 1COWA 2HRBA 2H85A 5KYKA 4CLHA 4BNKA 4MQFB 1JR2A 5L40A 1DT3A 1LDMA 3OOEA 1YA4A 3WGNA 4RTOA 3JVIA 1KP2A 1HYEA 1MV8A 1OBHA 4P2GA 1ZWKA 2QMEA 3KOUA 5SZKB 4HLDA 2AKAB 1KYTA 2NSYA 3P9ZA 2EKPA 3V80A 1T5DX 4BMSA 3GFPA 3MILA 3HJFA 3ZHSA 1Z83A 1D2NA 2RGXA 3C41J 3CF4A 1SB9A 2XDYA 5ADVA 3KFVA 5I48A 3EIFA 5DDIP 3QI2A 3GBVA 5ALSA 4CPDA 2J32A 1VKHA 1VDZA 3MOSA 2WAMA 4HN9A 1THGA 4EELA 1NIPA 2EZUA 4I1SA 4P6VF 2R6HA 2C9BA 1FXUA 2DT8A 3R3ZA 2WW8A 3GZ4A 4O8CA 3OJLA 3E05A 4U0KA 3WMXA 3L05A 5DO9A 1KEVA 1S8NA 5G3ZA 4HXGA 4UMDA 3SYTA 2BFPA 2RSLA 4BX0A 4D9CA 2NP7A 3R6TA 1FNDA 3AQ4A 1UBOS 4O8ZA 4CKYA 4YP7A 4X90A 1O57A 1Y4SA 4AKEA 5BV7A 1EUYA 1JEJA 4EPRA 4M99A 2QL9A 1WX1A 1G66A 2O8BB 1Z6XA 1ZU4A 2BEJA 3IOMA 3OEHD 1NN1A 4I7EA 4WA7A 2ET6A 1N6PA 5J2TA 2HUPA 2W6IA 2C5LA 2OBFA 5FH9A 3W6NA 3KR1A 4K0KB 4MCJA 4B6JA 4DC1A 1G7TA 1N5IA 4GEGA 5EXXA 2NADA 4I14A 1SG0A 4KXFB 2R97A 4J3NA 3M3PA 1ND6A 5AD1A 4Z3OA 1UZUA 3MF4A 3K6RA 1XTRA 3QBTA 4K05A 1M83A 1SHLA 3AEKA 1Z62A 4WLVA 4PX3A 2JVIA 3ITKA 3QOXA 1U3VA 4UVDA 2C7QA 2VPQA 3I5MA 4MA0A 2JGKA 1GNPA 5F23A 2BE9A 5AT1A 4LISA 2VRCA 1NOJA 2XUZA 3HABA 3ID6C 4KGDA 4WN3A 4ZRDA 1NMXA 1NQWA 1U4NA 2ASVA 2YV2A 3CF2A 3G85A 3QE3A 1HDEA 4NJMA 4Y6RA 5GOTA 3IRVA 4YACA 3SX4A 2NZUG 3DCIA 4DGSA 4N5IX 4NK4A 1MJGA 3JWIA 4D99A 2GBLC 1QYCA 2ZZKA 2VF4X 1LCIA 3VO2A 5BW4A 4EX7A 1G21E 3EXFA 3S0JA 3ZC3A 1Z0KA 1NJ2A 1E2GA 1MTZA 2CLIB 2VR1A 1VL6A 3E9QA 2QTVA 1SCUA 4NYMR 1OXKB 5BQ3A 1K2VN 2HQRA 1HO3A 2QI9F 1O9HA 1CIJA 5LVAA 4FILA 4KGXA 3E9MA 1YD7A 2I1LA 1JG2A 2JATA 1RT9A 5EP2A 2VAVA 5KNDA 1Q14A 3IT1A 3WLEA 1WLSA 2CXXA 4KVAA 4EFLA 5J23A 3ZE9A 4EZIA 5DYTA 4YMTA 5KYNA 2I0FA 3FW1A 1GLVA 2JBWA 3PQ3A 4ASUD 2EWVA 3DPUA 1OLSB 3HFRA 3IIIA 5DNYB 1YRAA 2ZXFA 1HE4A 5B1DA 1G2IA 3REOA 2G9NA 5KYYA 3CNLA 2PJZA 5AM5A 1LF0A 1DEKA 5KWIA 3C3BA 1WCXA 1L6RA 3RWBA 2CNWA 1QZTA 4BEBA 4TMTA 4HNAB 2GN4A 3LDAA 1ZSVA 4LY6A 2FUNB 5DHPA 3L7YA 4TYQA 3B85A 3A06A 1Q6ZA 2QTWB 2GZHA 3GLSA 3S2SA 5C2JB 4BGVA 5K0EA 1AHPA 1U04A 1U4OA 4P7GA 4RQBA 4DPLA 4UCWA 2QW1A 2X3UA 4L1KA 4MKZA 4MROA 2R1VB 2NYUA 1D7AA 1BA3A 4Q1VA 4B48A 2O2XA 2OHFA 4JLAA 5SYMA 4A2PA 4F5DA 3U4CA 1XO1A 2B69A 5AUQA 4HUTA 4DRZA 1K9VF 3RW9A 1MRSA 2QT0A 1MJNA 1T4DA 5ALYA 1OIVA 1S89A 5KCZA 3PNLA 2BN4A 3NUZA 1BEEA 3UPDA 4PRKA 1VHLA 2Q0QA 3O7WA 1E2IA 3V4VB 4QTYA 2C9MA 1GPWB 1IATA 1E3JA 2Y4NA 1KMMA 1JDNA 1Z88A 1KAEA 2OZLB 1JPUA 4POAA 1U2PA 2NZ8A 4G4SO 3H4MA 3KSDO 4IXTA 1RKQA 1E1RA 3M4JA 3QU2A 4E09A 1R66A 4Q16A 1YVEI 3PT9A 3SZLA 2H08A 3MUFA 1UFOA 3DMHA 2VHJA 4MICA 3COSA 1LWNA 4HH3C 1GGKA 3T38A 3DM9B 2C9YA 4XQ0A 2ZWOA 5EXPA 1XTPA 2GAFA 1E5DA 1WSBA 3EFEA 1PJZA 1VLHA 3PYXA 5IXYA 3NR2A 1HM5A 2B4YA 2V4ZA 2ZB4A 4F3NA 4JT9A 3OPXA 1H9BA 4XVRA 3WLMA 1LLUA 1X19A 1PT5A 3GRRA 2AYYA 1N2ZA 3QLVC 3CH7A 4M8NE 2FWJA 1KDZA 1PD1A 2GZ2A 3NOXA 5EHGA 4ZOQI 4FDVA 4WXMA 1A8SA 1P2BA 1NBME 3E35A 2X86A 4X71A 4UEWA 3TW8B 2G70A 1YJBA 1LH0A 3CN7A 3CB4A 1KVSA 4D0SA 1FSGA 1R6BX 2DFLA 2FJUA 5ECYA 4YUVA 4INJA 5BSTA 4AJPA 4C78A 4U7DA 4PZZA 5EZ6B 1E60A 2B7CA 4X66B 2CD7A 2PZBA 3O74A 4KO1S 2NPOA 3JU3A 4H7DA 3QBDA 3K1AB 4BJ6A 3TMYA 2WJ3A 3B36A 3RSZA 2XWBF 4FOPA 3D6MA 3JTEA 4Y2VA 2R7AA 2YWGA 2BIFA 3EW7A 1TTTA 1PYGA 1RYNA 2ZAYA 1J21A 1J0EA 4BFXA 4AXBA 4IHJA 2KMLA 3VX4A 4BP3A 1UWKA 3UK6A 3MUOA 3NV9A 5BWBA 1MQSA 1VL5A 4YB8A 4O4JA 2FW1A 3TVDA 2IYEA 3D0RA 1ZUD1 1K7FB 4Q3AA 2X0KA 5I9BA 1HNWB 1RC0A 4S05A 1KEZA 4AKTA 3NUGA 3VJLA 5EE0A 4DYDA 3UGTA 2INGX 4MRAA 2C95A 5JCJA 3VNSA 4RM2A 1P9RA 1IULA 2CK3A 3A9WA 2ILVA 3FB1A 4R83A 3SD7A 4MHOA 4TTSA 2J07A 5AHWA 2CHQA 3ESZA 3LUBA 2XNJA 4WDQA 3L0BA 1K89A 1PR9A 5DYYA 2H92A 3P9XA 3W79A 1UBUS 2FMXA 2PMDA 4EHNA 2J0UB 1X8LA 2ID8A 3ZGZA 2VYCA 4AYWA 2FYTA 2WG1A 5EIEA 3AFIA 1K5DA 1QFZA 2KPOA 3EDQA 3ZWWA 5CEJA 2VHCA 2ONKA 4GI2A 1NQOA 1TM2A 4L9SA 4YJ2F 1A9TA 2C4KA 1WUJS 2JRCA 4JL6A 4NTZA 1UXGA 4OD0A 4XIIA 5SZIA 1MCZA 1U99A 3FROA 2AF3C 1F5SA 2GQ0A 4XYBA 2HJRA 3PNQA 4P3OA 3F96A 1Y63A 3Q3EA 4FONA 3OE5A 5CB4B 5KOHA 3NBMA 1PYOA 4X60A 4B5LA 4F4IA 3HE3A 4OK3A 3EYWA 3THYB 1TCBA 5LM3A 3R8FA 1EFAA 1HKUA 2HJGA 3CX7A 3IIJA 3AHEA 4WZZA 4Y1FA 4OX9Y 1TU0A 3V7YA 3G8DA 2HMVA 4LHWA 3HY6A 2XWQA 2BBWA 3OVMA 1GL3A 2CSXA 3GVXA 1R37A 1U8YA 2H63A 4I55A 3DGEC 1DIGA 3FD8A 4RKYA 2R9VA 1KEUA 3EEOA 5KKCA 2PU5A 5EVJA 4EG6A 4E30A 2QG6A 4QRHA 4WCFC 3ZI4A 5CDSA 4IX9A 4YXWA 4HPJB 2ZBEA 4HGOA 2FZ4A 3GFVA 1HG1A 2C4VA 4HY3A 5EJGA 1AF7A 1E66A 1P1IA 5LA6F 1K97A 1SU6A 1JBQA 1XNHA 2GERA 4R3NA 4AC9A 4XIYA 4II2A 5F1OA 1XCJA 3LX8A 3AUSA 1YR7A 5JEEA 3QNWA 3MJDA 3C6MA 5FV7A 4OQQA 3ODPA 3HVRA 1T5IA 3NM4A 4WK6A 3U9SA 2QVXX 1GGVA 3IIKA 3O6VA 1ODTC 4B7ZA 3FPJA 1ZKMA 4UEJA 3G8BA 3G2JA 4QFDA 3BK7A 2Y9MB 3CW8X 3V4LA 3WLQA 2TECE 4I3HA 1IN7A 1OVMA 2CXNA 1RQXA 1F8YA 1YI8A 3C1OA 4ND2A 2EJBA 3MGGA 3KYDA 1T9BA 4RDHA 2WHPB 2JI9A 3CVOA 3PYLA 3RS5A 2ONYA 4RF4A 1ZHOA 5TX7A 4KBGA 2PQ6A 4LX8A 3AFGA 4FWTA 3LVFO 4BO2A 1NHGA 3IDZA 1HORA 2WJ4A 2P8SA 1ZIDA 1F0NA 3GWZA 2G63A 4ZT7A 5HA5A 5ALVA 5F3WB 1XKXA 2PA0A 2CV2A 4IR7A 4P80A 3MQ4A 1W88A 4PYLA 4BRUA 2VS1A 3I9V1 1NR7A 3OQIB 4R1UA 2MSCB 1CYDA 3BCUA 3QVTA 5BMVF 2UYYA 2V7BA 1TI7A 2X22A 5TGZA 2J45A 3TQIA 3I6ZA 4J0DA 3MCVA 4GX5A 2Y99A 4CIVA 5ALQA 3E2PA 2VP2A 2DU8A 2XUKA 1H0KA 3HJNA 4NE9A 2Q5QA 3ABRB 4BV8A 1QPGA 2M2IA 3NJ4A 1TE2A 3M1IA 3QX9A 2QD5A 2Q6IA 4H7EA 4MA4A 4JWKA 4DBZA 1OVGA 2JW5A 2C3MA 5CJJA 1HMYA 2ILTA 1Q77A 2XCLA 4C7OA 1J7JA 3U62A 3HBJA 3KPVA 4F3CA 3C15C 2WI8A 2C8VA 3H5TA 4CTOA 3QFCA 2Q5LA 4MW4A 4C4OA 1KKLA 2NXNA 2QLMA 5IYZA 5IAKA 4QBFA 4MWCA 4YR7A 1YFLA 1RXIA 3DBRA 2QUJA 3EW9A 4U7PB 3FYTA 5CURA 4B2PA 1QCCA 4NVRA 3LTEA 2IW1A 2P9ZA 3LECA 2JCYA 3A11A 3TDNA 3GFBA 5DBIA 5GQSA 1QSGA 2Q1SA 3OP4A 1KGDA 1UAYA 1VIAA 3FCOA 4LTNA 3WKAA 2V1UA 4KMSA 4KHPB 3UUEA 3KLBA 4OXXA 1GTSA 2O23A 2QPOA 4MRPA 3O84A 5B7QA 1I2BA 3JX9A 5HJEA 4LHXA 1M7HA 3H6KA 2BDTA 3HZZA 1BKYA 4PQFA 3WWYA 4M1YA 1A04A 1T3HA 2YNMA 3CZRA 4KJZA 3TR0A 3USZA 1L7VC 3V32A 3MLBA 1ULHA 4RXUA 3D3WA 2NLOA 2BJVA 4DA9A 2IIBA 3OQHA 2WVJA 1D4FA 2NN3C 2WG0A 2CY0A 3AF0A 4LDQA 2O52A 4RVFA 5BR1A 1Y80A 1AKYA 1QRRA 5I4IA 1ZC4A 5TLSA 2PBZA 1N7GA 2R44A 4PQGA 4CTJA 1YMVA 4ARBA 3ZW9A 5HJ7A 1EFPB 3MMXA 2ZJ3A 2ZW9A 4H0CA 3T1QA 1N6IA 1PEDA 3NAZA 3B1ZA 3A6GA 4LXGA 1E4EB 2OC4A 4TLEA 5IXJA 1IY2A 2J3IA 5NLLA 4UUBA 1Z33A 3FMFA 5DJ5A 6YASA 3SYNA 5HDQA 3G59A 5BUQA 5THQA 3DOEA 4D9MA 1XZEA 3HKCB 3I83A 4W8GA 2OK7A 1N8KA 2NV0A 2PGLA 3GAAA 3GEPA 2J0VA 1DDIA 4QYSA 2BEVA 3ORRA 3H5OA 4DR1B 1YDMA 3LZ6A 3GP5A 3BE8A 2O1WA 3FVRA 3KZMA 4HEHA 1XLTC 4AUMA 2H1WA 2E1RA 4ARCA 3OZEA 4LJRA 1YHZA 4FQ7A 3IURA 1ZGHA 2B7BA 3F5DA 3VKGA 4YAJA 3NORA 4BGIA 2YIMA 2GHRA 3JVVA 4H1WA 3T1VA 1U7HA 3X1XA 2FPKA 3NGXA 1ZJYA 1V2HE 4HWOA 1RJGA 2RGNC 3ZYZA 1N0IA 2B4AA 3CPJB 1XRMA 1I30A 3M6WA 1ID8A 2GBGA 3D64A 4Z8XA 4CCYA 2AI1A 3R2JA 2QZ4A 2YWBA 2QT1A 5FCDA 3IL2A 1SCJA 1MDBA 2F1KA 5IS2A 3AU8A 4KSBA 2W00A 1GZ5A 5CDUA 5L7TA 1MB0A 3TE7A 1QCYA 5KVSA 2HA2A 1KAQA 1QS0A 3EG9B 2VSQA 4WOPA 1K6IA 4U6SA 1SC4A 1E5XA 5IFLA 4YP6A 2HIGA 4PGFA 5DXJA 2IIQA 4WAUA 5T8KA 3TLYA 5F1KA 4ETIA 3PEWA 2O5RA 4XVCA 1I4WA 1GKYA 3QU9A 1X92A 2HMYB 1SH7A 4RO0A 3T3NA 4CGZA 3M5DA 4P32A 3OUZA 4ROTA 3K30A 5F12A 5CA1A 1Y8AA 5I5EA 3R0QA 2WFLB 4WQMA 4BZZA 2OECA 3UMGA 1FTYA 1CPYA 4PYKA 5AKZA 4N65A 2D3TA 5AK6A 4R68A 3TTSA 1L7BA 2ZTMA 4V0ME 1YA6A 3EPHA 1V0JA 2H1HA 2YFYA 3GPIA 4B76A 4C2TA 1JS1X 1XMSA 4FKBA 1IY8A 4F60A 1SO8A 1IUOA 1IZ8A 2PKXA 4W5WA 4CDMA 2IE8A 3A1FA 3LPAA 1CZOA 2NZVG 1LU9A 4HMQA 1V5IA 2XQGA 1JYSA 2WSSA 3L41A 3AEUA 5EIBD 4REMA 1N5OX 5CM9C 2VJKA 4ZOLB 3RTGA 5AW2A 4GX0A 3UKJA 1TUEA 5K5EA 4XDYA 3HNRA 1IVSA 1Z4PX 1A2BA 1RWPA 3IPLA 1SVUA 2IFTA 2CGEA 2R00A 5LZ7A 3TOZA 3ZIUA 3GFFA 4J0KA 4CIWA 1TB4A 4G8JA 4PC1A 1CVRA 3OCVA 5CFLA 2LPMA 3MRTA 4QXOA 2AG5A 5CVDA 4B6SA 4EDHA 2N42A 4LF4B 4OOFA 4ER3A 4WKOA 3MOIA 1GYRA 3JWGA 4ZV7A 5FBLB 2GFHA 2H9AA 3TRKA 3N28A 4LY3A 4LYJA 1PJ2A 2VF2A 3L1JA 5CUQA 4AQDA 4DIMA 3MIIA 2C1EA 3TQFA 3VHXA 1TAHA 2QLTA <