3F4KA

Crystal structure of a probable methyltransferase from bacteroides thetaiotaomicron. northeast structural genomics target btr309.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
254
Chain Sequence
NNTSIHDFDFSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative methyltransferase
publication title Crystal structure of a probable methyltransferase from Bacteroides thetaiotaomicron. Northeast Structural Genomics target BtR309.
rcsb
source organism Bacteroides thetaiotaomicron
total genus 87
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3f4kA00
3UJ8A 4PONA 4V0QA 4XUCA 3R6TA 3NDJA 3PS9A 5K01A 2YX1A 4AUKA 2NXJA 4RVDA 4YV2A 4IKPA 2ERCA 2EJUA 3UJCA 1JG3A 1JQ3A 1UFKA 2PBFA 2PXAA 5KYGA 3THSA 2BM8A 2FRXA 3EMBA 5EEHA 2HMYB 3IHTA 3KR2A 3LKDA 3O4FA 3Q87B 4LG1A 4QDKA 2ZTHA 4CKEA 4ER3A 3BXOA 1WS6A 4GQBA 4QTTB 1EIZA 5BW5A 3HVIA 5LQJA 3TR6A 8MHTA 4U7TB 2UYQA 1Q0SA 3F4KA 4YMHA 3KR1A 3M70A 1P39A 2B3TA 4QDJA 3CJTA 3MCTA 4YUWA 3M6VA 3ME5A 3G2QA 1ORHA 5DRTA 5K03A 2DULA 1I4WA 3OU2A 3EGIA 5DLYA 2Y1XA 1SUIA 2B9EA 5EZSA 3EVFA 3TM4A 10MHA 4AX8A 5ICGA 2B25A 2IIPA 3CJRA 1VP3A 3P2KA 5T6BA 5HILA 3ERCA 3TOSA 4DCGA 2P41A 3HCAA 3SSNA 5K0FA 3I58A 5GM1A 1NV8A 4KRGA 3K0BA 4PYMA 2IBTA 1BKYA 2ORED 2QY6A 5DM0A 5KQSA 1QAOA 4KVZA 1SKMA 5HOQA 4HC4A 1RJGA 3M33A 3UA3A 2UYCA 4ZTBA 4FGZA 1ZKDA 5U4XA 4AZTA 2B2CA 2FHPA 4YUZA 2H11A 5M5BA 2Z6QA 3DLIA 3OU6A 5HIMA 1I1NA 4YUXA 2VZ9A 1VQ1A 2NNWB 1JG1A 4EK9A 3AWIA 3I53A 1KPGA 2IH2A 3ELUA 3FUUA 1JSXA 1L3CA 3JWIA 1KXZA 3QOXA 4XUDA 2O0LA 4OBWA 2IBSA 2PX5A 1QZZA 3EVBA 5FUBA 3NMUF 4PYJA 4PGGA 3OPNA 5HEKA 2AN3A 2P35A 1JR4A 2G71A 1UIRA 3C6MA 1X1BA 3EEOA 3UFBA 1V39A 1WG8A 3I5UA 1KHHA 1SVUA 1L3BA 2EJTA 3DMGA 3P71T 1H1DA 4FR0A 2FK8A 3A7EA 3U81A 1R18A 5DPMA 5FWDA 1FPQA 3TKYA 5DSTA 5EOVA 1T43A 2YUIA 3FUVA 2QRVB 4RTQA 1JG4A 5DTQA 4MTLA 5EC8A 4CKBA 2AS0A 4A6EA 5ERGB 5LR6A 1JQDA 4KDRA 3R24A 1JQEA 2PLWA 3DMHA 5D1HA 3SXJA 4EQZA 2OB2A 4G56A 1YB2A 3OFJA 4DZRA 1AQJA 2ZWVA 1IY9A 3AXSA 3LECA 5CUQA 2OXTA 5JR3A 2WA2A 5HIJA 3GJYA 5E1MA 3FUXA 2OYRA 3MGGA 3CJQA 4PIPA 4OX9Y 4EVIA 3HP7A 5EPEA 5E2AA 5B1SA 2XVAA 2PT6A 5DSXA 5E1OA 5FQOA 3B3GA 2YR0A 2VDWA 3GRVA 1KP9A 3P8ZA 4X61A 4IV0A 1HMYA 1KR5A 2AOTA 4MIKA 3E8SA 4HG2A 3BKWA 3THRA 2AOUB 2OB1A 3R9XB 4M36A 4CXMA 2ONZA 3KPUA 3KPYA 5CVEA 3UBTA 4GOND 4Z2YA 3RW9A 4DMGA 1JTEA 3ID6C 5E8JA 1JSZA 4IV8A 1G8SA 5K05A 3OFKA 5CIYA 4RVHA 1SG9A 3KQWA 2ZULA 1XTPA 1ORIA 3G8AA 1RI1A 5C9ZA 3FTDA 3EVDA 3M6WA 3SR4A 4PYKA 4QQNA 5FULA 1UWVA 2BH2A 2G8NA 3B3JA 4F85A 1DCTA 2JHAA 2H1RA 3DXZA 5K0EA 3ANXA 2GH1A 2I7CA 2PXXA 3CKKA 5GOZA 1PJZA 5G02A 2PWYA 5GINE 5EMJA 2ZZKA 3G5TA 1TPYA 3LHDA 2OY0A 3I9FA 5D1NA 5EIWA 5GIOE 1X1CA 1O9HA 3BWCA 3DLCA 5EKUA 3FRIA 4AZWA 5GM2A 3UJ6A 2F8LA 5EMKA 2GS9A 5C0OE 5K0LA 3R0QA 4QPPA 2IPXA 3NDIA 2K4MA 4POOA 2JJQA 3A7DA 1ZHFA 4P7KA 2QE6A 4P7GA 1KYWA 3ELYA 1RI3A 2ESRA 3WSTA 2EX4A 2OPBA 2OKCA 2PKWA 2C7RA 3EVGA 3VYWA 3VSEA 2ZW9A 2VDUE 4PWYA 2NYUA 3A25A 3KPWA 3UJ7A 3DP7A 2AOTB 3G2MA 2OBFA 3P9NA 3GIWA 4P58A 4C08A 1G38A 1Q0TA 5K0NA 1FP2A 1Y8CA 3FZGA 1U2ZA 2I9KA 1ZGAA 3OCJA 3FTFA 1FBNA 1G6Q1 4PNEA 5EGSA 4MHTA 2ZZMA 1EG2A 4M37A 3FYCA 5E8RA 2CWWA 3MCZA 4E2WA 2JHCA 4GOMD 3PFHA 4PCAA 5DX1A 4P7JA 4EKGA 3KR0A 4MWZA 4GOOD 4X60A 1BC5A 2GPYA 5IH3A 2ZBPA 2NXEA 2FK7A 4C05A 4DM3A 3E05A 3P9CA 4FT4A 1QAQA 1IXKA 2AOVA 4X41A 2YXLA 2YXDA 3EVAA 3G8BA 5E1DA 5EKXA 2IDKA 3GGDA 2QRVA 3I64A 3B89A 4L7VA 2BR3A 3LX6A 4M38A 4RTMA 4YV1A 2BZGA 3K6RA 3GRRA 4Y30A 3SGLA 1YFLA 3SX0A 1KIAA 2YXEA 2ZBRA 5CD1A 3CVOA 2ZSUA 4QQKA 2VS1A 4H0NA 2C7QA 1M0EA 3SVZA 4KIGA 3REOA 4V0RA 2XBMA 2UYOA 3Q7EA 5H02A 3EGEA 3MAGA 2CL5A 3KR9A 1N7IA 4KWCA 1EJ0A 1NW5A 3LDFA 3LGAA 4ATNA 4E32A 5K0GA 2Z6UA 5EVJA 3BWBA 2PWPA 2AOUA 1HNNA 2ONYA 2ZVJA 5K0JA 4FP9A 4RYLA 3TPZA 3TQSA 3SSOA 3C0KA 2LD4A 4C4AA 1P91A 3AJDA 3MB5A 2XVMA 4BY9E 2Q41A 4E30A 2B78A 5FWAA 1YFJA 2GA9A 3FUTA 3LBFA 4GEKA 2NXNA 3GWZA 3OE4A 5ICCA 2ZFUA 5F2OA 4RTKA 2R3SA 4BLUA 1XCJA 4GUAA 3NVKI 1QANA 5HIKA 3O31A 4RX1A 5FHRA 4EKIA 1VL5A 2PVCA 3KQQA 4RTRA 3LPMA 3PFGA 5DT2A 3VC1A 4E2ZA 3EEYA 1INLA 3ER9A 4RWZA 4FSXA 4R8SA 1RI5A 1VLMA 3QOWA 1JTFA 3A27A 2Z6AA 5MHTA 3KPJA 4A6DA 3B7PA 4EMSA 4E33A 1AV6A 2PV0A 3RODA 4PIMA 1BHJA 1RJEA 2AN4A 3G7UA 5K0BA 3EVCA 2FYTA 3BWMA 3EMDA 4QPNA 4F86A 1SUSA 3HTXA 4PYQA 4CTKA 3NWEA 2ZZNA 2JHPA 3O7WA 2IGTA 4BP1A 4R8RA 4PINA 4K6MA 1YF3A 1D2HA 4CWAA 3HA3A 2PX8A 3C3PA 4WVLA 3FPGA 3JWHA 3FPEA 3OZTA 3UWPA 1RI4A 2P7HA 1ZG3A 5IKMA 1N2XA 2XYVA 2BM9A 3KPVA 3KQSA 3FYDA 1PRYA 2ZBQA 4KIFA 5EIFA 5EZQA 1F38A 1WZNA 1WXWA 4M7RA 3FTEA 3LDGA 1VBFA 4LWPA 3MTIA 3DH0A 5FHQA 3S68A 4C06A 4E31A 4DF3A 4CTJA 1NKVA 5E1BA 3KHKA 5LQCA 3EGVA 3NWBA 4X63A 2KW5A 1MHTA 3HNRA 2ZIFA 2PX2A 1EQAA 3GO4A 5FA5A 2PX4A 2O05A 2YTZA 3B3FA 4HGYA 3PTAA 1NW3A 3EVEA 3ER8A 5CVDA 3R3HA 1YZ3A 1D2GA 3OZRA 1YZHA 3BGDA 3JWJA 4HGZA 4LWOA 4NECA 4O29A 4PYIA 1SQGA 4GC9A 4BLWA 2CKDA 1M6YA 3HCBA 5ICFA 3NTVA 5DM1A 2EG5A 5DRYA 3HCEA 1YUBA 2R6ZA 3DOUA 5F2KA 5P8WA 2OZVA 4P7FA 3P97A 4DKJA 4HTFA 3TMAA 2BR5A 4GF5A 3P2EA 3LBYA 2GB4A 2P3QA 2ZIGA 3MHTA 4KDCA 2ZCJA 3OE5A 2O07A 4BLVA 1D2CA 1L9KA 4UOEA 3LDUA 3FPJA 1TW2A 1NT2A 3KQPA 3UJAA 3SM3A 3RIEA 3G5LA 4PYNA 4ISCA 2YVLA 3ELWA 1JG2A 3EVZA 2C7OA 2IP2A 4ER7A 3CGGA 5KQRA 3PX2A 4WXHA 5DXJA 1BOOA 5EMMA 3V8VA 2O57A 2NP7A 5DM2A 3GNLA 1WY7A 3PLAE 5HFJA 1DUSA 4GC5A 3DUWA 5LSAA 5EHIA 5LQUA 1DL5A 1VE3A 3NVMB 4YUVA 2PJDA 3HEMA 1XDUA 4FS8A 5FCDA 4ER0A 5GWXA 2GLUA 3BZBA 1AQIA 2V7EA 5CVUA 3BKXA 4QVGA 2Y1WA 1TW3A 2OO3A 3G89A 1QYRA 5HIIA 1AF7A 2PY6A 4KW7A 4E2YA 3ELDA 3OZSA 2AVNA 5LQRA 3P9IA 2HWKA 3PB3A 3KU1A 3QV2A 4E2XA 5HZMA 5T67A 2JG3A 1L3IA 4FZVA 4RTNA 4RTSA 4OA8A 2AOWA 2PSSA 3V97A 3FRHA 2V74B 3DMFA 1NW7A 1SQFA 2E5WA 5EMLA 4DCMA 5CCXA 2A14A 1XVAA 1NBHA 1NW6A 2HV9A 3DR5A 4XUEA 3TLJA 4C04A 3IEIA 3DXYA 3P9KA 1N7JA 4HTFB 1QAMA 1NW8A 2BR4A 2HR1A 1I9GA 3GCZA 5CVJA 4HH4A 3G88A 2PXCA 3B5IA 5KS2A 2AN5A 3C3YA 1VPTA 2P3OA 5EG5A 2AOXA 2ADMA 3HA7A 2NP6A 1P1BA 1OR8A 2YQZA 5BW4A 4PGHA 4GOLD 4F84A 4YMGA 3UJBA 1RI2A 2CMHA 4QVKA 3PVCA 2EFJA 3LL7A 4YV0A 3H2BA 1R8XA 2C7PA 2XYRA 2PGXA 5K0CA 5E2BA 2P1DA 1VIDA 2VP3A 2NXCA 2P8JA 3GDHA 5EEGA 3X0DA 4ER5A 2G70A 2AZTA 3BUSA 4OQEA 3HVHA 5DX8A 4PYOA 5FQNA 3UJDA 3TKAA 7MHTA 3G2OA 2IFTA 1XJ5A 3GRUA 3IYLW 4RVGA 4RTLA 3L8DA 3M6UA 4QTUB 3HM2A 1EAMA 3UA4A 1B42A 5BXYA 1WXXA 3UJ9A 1F3LA 2HNKA 4X1OA 5DTRA 5FADA 3T7RA 1G60A 3GRZA 3ORHA 3JWGA 3DTNA 4LECA 1MJFA 3TRKA 2G1PA 4JXJA 3LCUA 4OQDA 3NW9A 4IWNA 1XDZA 3AY0A 1XXLA 2CMGA 3HCFA 5EQJB 4AZSA 3BGIA 4R6XA 5T64A 3KQTA 3MTEA 1NBIA 3BT7A 1O54A 2I62A 2IDJA 2ZIEA 1XDSA 3C6KA 3GU3A 1R8YA 3AXTA 1RJFA 4HRAA 5CVVA 3E7PA 5DM4A 5E9QA 4RSRA 2DPMA 2HTEA 3BGVA 3KKZA 4R6WA 5K09A 3KQMA 2P3LA 1ZQ9A 3SSMA 2I6GA 3DULA 3FPFA 2O06A 4PYLA 5F2NA 2AVDA 3FTCA 3T0IA 2FCAA 4R05A 3NJRA 2QYOA 3HA5A 3EPPA 3KQYA 3CC8A 2UYHA 3A4TA 3DXXA 1X1AA 1Z3CA 5GIPE 4GBED 1L1EA 1KPIA 2JH9A 1NE2A 2GAFA 3HCCA 3LKZA 5CM2Z 5DXAA 3UZUA 4B17A 2JH8A 2P40A 1NV9A 3VC2A 5K8VA 5KVAA 2UZ4A 9MHTA 4AZVA 2QM3A 2G72A 2FPOA 1ZGJA 5CCBA 5LQAA 5C1IA 2IH4A 3FPHA 1X19A 3M6XA 5LQNA 3PX3A 2XYQA 2ZWAA 5ICEA 3KQVA 4C03A 2WA1A 1XCLA 3BWYA 4XCXA 3MERA 3HVKA 4FT2A 4MQ4A 5FA8A 4RVFA 1KYZA 2ZLBA 2WK1A 3E23A 3HVJA 3T7SA 4RV9A 1P1CA 4ER6A 4YUYA 4RTOA 2PT9A 4U7PB 4C07A 5GP1A 5BP7A 3T7TA 2VDVE 2P7IA 5FTWA 5E9WA 4DA4A 5E9JA 4RTPA 2IH5A 3KQOA 1R00A 1KPHA 1M6EX 3PT9A 1G8AA 3CBGA 3MQ2A 1RJDA 3M4XA 5DX0A 1O9GA 4DQ0A 4HSGA 1G55A 3FUWA 5DTMA 4BP3A 3LCVB 1VP9A 3P2IA 3OU7A 5EHGA 3CCFA 3D2LA 3A26A 3TFWA 3GXOA 3IV6A 4RTJA 4PCLA 3LCCA 3LSTA 1FP1D 3HCDA 4OA5A 3G2PA 3GRYA 4FSDA 4Y2HA 3TM5A 5JUWA 1IM8A 1R74A 2N47A 4E70A 4CKCA 1FJXA 5LQKA 2AR0A 1R6AA 2H00A 3SMQA 1EJ6A 1X1DA 4OBXA 5DWQA
chains in the Genus database with same CATH superfamily
1OFHA 2H5JA 4S1NA 5ITSA 3DDNA 1GPNA 3CURA 3RIHA 2J08A 4QUAA 2WVHA 2JGDA 4P08A 3OO0A 2JFZA 4KQ1A 4AUKA 2PO5A 5AOVA 2Q4EA 4ECAA 3UAVA 3ROXA 3AZQA 4MWTA 4ZAVA 1OH5A 3SHFA 1JJBA 4ZANA 2C2WA 1B26A 4ZYTA 4XWGA 3GLSA 3M5CA 4TLEA 3PZRA 4WY5A 4BNYA 4XAQA 5CDSA 4RU1A 3C97A 2ET6A 2H1FA 2OGUA 1E9BA 2Z2KA 3FMGA 3IUQA 3O4RA 3Q5EA 3SZGA 3PDWA 1NLFA 3FBTA 1HYGA 4J6FA 1TKBA 3FPAA 1VRCA 3S3TA 3JTMA 1SIOA 1YR7A 4MO9A 5FAXA 5LM3A 4US1R 3AQIA 2ZRCA 5ALXA 4KIJA 4U7HA 2WZCA 5IN5A 4MAAA 1CB7A 3EOAI 4NK4A 2DR3A 1PNVA 4E5KA 5BW8A 3ME5A 1JXAA 4P3NA 1FVHA 4L9WA 1Z34A 2VJPA 2YVAA 4Q6BA 1QIDA 1SUIA 3W9YA 5PNTA 5L3SB 2A1TS 1PEKE 1QTNA 1QB7A 3AKCA 1M54A 4V1CI 3QU7A 3VYVA 1UWCA 1SXGA 2OHGA 4A4DA 3GT3A 1SBNE 4YAUA 5B6JA 3HE3A 4X8HA 1GDTA 3Q10A 2OGTA 1P44A 3CW8X 4IIBA 5A3JA 3RO7A 4PAQA 2XUKA 2VDRB 4K9LA 8ABPA 1FJHA 1Z37A 4AZTA 4X8MA 2XR1A 4IJ6A 4DLTA 4Q93A 1X42A 3H04A 3DVRX 1MFZA 2HZ7A 1IUNA 1CJTC 4OQFA 3U13A 2ZJAA 3L77A 2J6IA 4YCJA 2JARA 1EP9A 4N01A 3ZS8A 1P2BA 2IH2A 5CR9A 3ET4A 3ZS9A 4UBOA 2YHSA 3LK7A 3ROPA 4WHMA 1GOTA 4KPYA 1H9CA 1F6BA 1FVFA 4PYJA 3A9WA 3I2FA 4PGGA 4UW9A 1UIRA 4GICA 4Y2PA 4B3RB 4M22A 3LBNA 1KP2A 2HUPA 1V39A 1JYSA 2PH1A 3PCRB 2XODA 3PFFA 3GZ4A 4M49A 3DD1A 2TECE 4OJKA 1EUQA 1A69A 1VE7A 1WSDA 2COKA 2O7QA 1PIWA 2BFWA 3CW2A 3G8YA 4OGLA 4X8OA 4XASA 4MV3A 4BO7A 3CUYA 4OKSA 1P19A 4INOA 5K3FA 3FUVA 2NO0A 1UDWA 2BFCA 1JG4A 2AI1A 2NO5A 3EULA 4W99A 4X45A 4X3CA 3P2MA 5ERGB 1CUVA 3TLMA 5KNCA 3WHIA 2DJ5A 3A4IA 2CLOB 3HBAA 4RJLA 5D51S 2O3QA 1DCKA 1E9EA 3AUYA 5B3AA 3T3PB 2ZWVA 1DQZA 2N1BA 3IXQA 1MO3A 1E6WA 2LIPA 4XWTA 1NJ5A 3FUXA 3W2FA 5FT9A 1C4XA 2AFIA 1F8GA 3H1GA 1TO2E 2B0JA 4I19A 3EWSA 2VWGA 5FBVB 4HLCA 2XVXA 4PLGA 5F64A 3RTGA 5I7WA 1BDMA 2VDWA 1Z6TA 3GRVA 4W1SA 2OCIA 1RZUA 4XYEA 1LVUA 2BTQA 2V45A 4CN8A 5CB8A 2VR1A 2WSBA 4ROTA 2P8SA 3L7DA 2J07A 1SVKA 4A3SA 1E7YA 2BMDA 2HY7A 3NIDB 2CBXA 4CDRA 4IV8A 1G8SA 1M8KA 5IAAA 3DDUA 2D5AA 2VWPA 5JO0A 5CX4A 1YNOA 3LYLA 4MAFA 3AX6A 2G4LA 4C7KA 1ZOOA 2PZGA 2R8ZA 1S4QA 1VDMA 2XUGA 2YL2A 2P9TA 4HNQA 1HT2E 2NVWA 3FD8A 2BMFA 2FX3A 1NW4A 5ECDA 4R16A 5G1PA 5K0EA 1BXGB 2PXXA 5BQ5A 4BB5A 1KK2A 2EV9A 2Y05A 1MOQA 4IJMA 4RLHA 4LJ6A 4RJKA 4U2DA 1QZ3A 2HA5A 3U4AA 2PGIA 3QF4B 2J8ZA 5IBCA 2IS6A 4WGGA 4HYTA 4Y2UA 2ZJ0A 2X0KA 4Q9JA 3RKRA 3BWCA 3C8DA 3ZVRA 2H5IA 3W4IA 5BR1A 1RYZA 5KEIA 5GM2A 2HFJA 2J3HA 1KQNA 3LG2A 3R0QA 1Z2DA 1R0ZA 3ON5A 4P7GA 5KMGB 4JIGA 3JD3A 4UOQA 1KDYA 3BILA 5FX2A 3C4JA 4WZBE 4AJLA 4UTPA 3VKWA 1WQ1R 2WMOB 1G98A 1H4QA 4KB5A 4MKXA 3KIPA 4AWXA 1LLDA 3HEBA 4Q19A 5BYBA 2CXPA 1QQBA 3FTNA 3TIVA 3VZDA 4B1FA 2ZGVA 3AESA 1KYTA 4G1VA 4HFNA 4YXWA 1U2ZA 2Q4BA 4Q3NA 4CJXA 4NZOA 1MPTA 3I1YA 4JP3A 1Q50A 1VL8A 3H4TA 4UPDA 2YOGA 3W3AA 3GMDA 3ZK9A 1KK3A 3ZH2A 4CCAA 4NZNA 4O33A 5ALIA 1YJXA 3HUDA 4MUBA 4NWIA 3J80A 1KH2A 1CQPA 2BHLA 1JF8A 3CONA 1K7CA 5JBNA 5KUTA 4INAA 3KUCA 4II7A 4D02A 2XA9A 1LJUA 2RJ3A 3VDQA 3FVQA 1QOZA 1Z5UA 3A2MA 5KHLB 2WB2A 3ZGXA 3ZE7A 2HU7A 1C1YA 2DUUA 1FS4A 1K3UB 3O8DA 4NESA 4OHPA 1T1JA 1CIVA 4JT8A 1BE6A 4YRNA 1K0FA 3RSOA 1H2BA 2PFGA 2VS1A 1H2EA 5BV0A 1KJNA 3WYBA 2XSZA 3HNOA 1LBHA 4I1OA 4ID3A 3QKUA 3R7WA 4H6WA 2DC1A 1CUHA 1SZPA 1U8CB 2VZ0A 3B36A 2QRLA 4MRMA 1WB5A 2I2FA 3QOFA 5CMLA 5THQA 4O4LB 5BSMA 2ONYA 5EXEA 2YFKA 3B6EA 3HB4X 2XEDA 1E2MA 3ICVA 1NT4A 1ZJ5A 3M1YA 4FP9A 4O3FA 4QOGA 4S3MA 4RYLA 4RESA 3TPZA 2IEBA 5ARCA 1FDVA 4D4IA 1KORA 1ZEJA 1T3LA 3HDQA 4IOMA 2PIAA 3EOBI 1DBWA 1EH5A 2ZFUA 3KZVA 4RD2A 5K4GA 2IWHA 2Z2XA 4UU8A 4RORA 2W6ID 3Q9UA 2R11A 1W5SA 3PC2A 4HS9A 3ZYCA 4UZEA 5KNDA 2Q0SA 3H0CA 1KEEB 3E22A 3VC1A 4KN9S 3H2YA 4IZ6A 3LGXA 3QOWA 4DV7B 1XEWY 4N5LA 5LZ7A 3C16C 2I6TA 5A5EA 4FYYA 2VTEA 2AN4A 3G7UA 3T35A 4B3FX 2NVUB 4QPNA 1DV1A 4HF7A 5CYOA 2FW8A 3OWXA 4LQLA 4MI6A 4JI7B 2GQ0A 3ESCA 4J0KA 3RTBA 3SHWA 4H4EA 2XUPA 1UFQA 1X94A 4PSUA 3C7CB 1YF3A 3HA3A 3W6PA 2EEZA 4ZDWA 2W48A 4FXOA 5TQ2B 3T4EA 5EIXA 4NBRA 5AKHA 1AKYA 1LDYA 1Y9JA 2ZYGA 2WQZA 5IW8A 2W70A 1OT5A 2DR2A 1RI4A 3W5VA 2R1VA 5C8VA 3QKRB 3IQIX 4NCKA 2F3QA 4EG6A 2C8LA 3NCTA 5JPDA 4HAVA 3MCUA 2PZBA 2YYYA 3OPXA 1E1RA 4I55A 1ZH2A 4TWRA 2G1JA 1KJJA 2A2ZA 3DEYX 1G19A 4F9EA 5AVYA 5JNVA 4Z1MD 4TMVA 3A2KA 1J1IA 6Q21A 4UBKA 3DH0A 1MXHA 3QE4A 3NKLA 5EXDA 4QECA 1CUZA 4NV3A 2Q3DA 2F43B 4XWKA 1S1MA 1KYXA 1LS1A 2AFIE 3B9RA 3KHKA 1HZJA 3D6NB 2Z1NA 1HEIA 3UXEA 4HEA1 3W9UA 1YS4A 1EVKA 1B8UA 4Y9TA 4CIWA 4YDQA 4O2BB 5AW9A 3RVBA 4LJYA 1N5RA 3UOAB 5IFLA 2NTNA 2NAPA 3L1JA 1LWOA 3R4CA 5FA5A 3WNQA 2J9FB 4DR1B 4TMTA 3WGNA 3K09C 1S5PA 4CLRA 5FEMA 3EVEA 2V5VA 2WFZA 4KXMA 3ZJYA 1L5NA 3B9BA 3NUQA 1HH4A 1PSWA 4X94A 3SNHA 4N65A 4XX1A 5BOSA 5P8WA 3DOCA 2PYIA 2YFHA 1B8NA 1RCFA 3ZZMA 2PSEA 4YR9A 4KE8A 5CTAA 2AEJA 4LTNA 2I6QA 1EK2A 2AXPA 2OKGA 3JQ7B 4K2AA 4MS1A 5LMNB 1X15A 3SBXA 3UOGA 2UZ1A 4AMYA 4EG8A 1RLTA 4TKZA 1ADYA 3TVTA 3WB0A 5KQMA 1T34A 3AHEA 4OJTA 4R1OA 1W4ZA 5JSZA 3UJAA 3ZWXA 4FYKA 1VG8A 3DF9A 4M88A 2X7HA 1JU3A 4GMDA 1UPTA 5LFAA 2H9YA 1OA0A 2I2DA 2YVLA 4TROA 2ZTUA 2IP4A 4PGAA 2IHNA 1PYOA 1K9SA 2X8WA 2COEA 4X62B 3ZXSA 5DTJA 1P5FA 2EHDA 3KEOA 3QFHA 1E2PA 2R6JA 2OL4A 5GWXA 5JD4A 4N3CA 3TSZA 4MYTA 1LBIA 4AKSA 1BDIA 2BI7A 4QVGA 2FX5A 1P2VA 1PWXA 2D0OB 2YIMA 3T12A 4A8JB 4BQRA 4C0KA 4PICA 4TRRA 4U2FA 3UV7A 4N82A 4AJEA 4Z6KA 3IERA 2Q2OA 2Z58A 1C3OA 3VX3A 3PFNA 1D3AA 4R9SA 4RGQA 4WCFA 4ZK6A 1U0NA 3CINA 1UC8A 2PCJA 4DDTA 5CB4B 2IZZA 2OYSA 2PSSA 2UVQA 3QEKA 3LLCA 4I9UA 4QICA 1YIAA 4ZVRA 1BTOA 4OXYA 1NYLA 2E5WA 4KXVA 1ZM9A 4U2KA 3F2VA 1CP3A 1U0LA 3K3PA 3G0GA 1QONA 3SFVA 4G0QA 2ZUUA 1KJ9A 3PQ7A 2NPFA 5JAIA 3OF3A 4IDNA 3AVTA 3AWDA 2IK8A 3THWA 3BJEA 5HQJA 1VHDA 4R1QA 3UAGA 1R5NA 4FMCF 3HLKA 1QLJA 2JIZD 1LNQA 3GUZA 1S2GA 1AE1A 1ZNQO 3BEDA 4BVKA 4HDRB 1G8HA 2IZ5A 3KSAC 1J8QA 2JCBA 3C7TA 1NLZA 3ZHBA 4YAOA 1BA3A 2XUFA 4PHTA 3ZHCA 3PR1A 4WNAA 3H75A 5E2BA 1C3EA 1YDEA 1RC8A 3GCDA 1IAVA 1L7NA 1JZTA 5DP2A 2O3UA 3QUBA 3F5SA 1JBEA 3S7TA 3TL3A 3UY4A 3IBYA 1TE2A 5FQNA 2ZRJA 3SFZA 3LUHA 2BV3A 2G0TA 2OG1A 3HO6A 1OAOC 4ZICA 2XCRB 3BD8A 3ROMA 1G7RA 5EKTA 7GPBA 3GFBA 5EXSA 2CXXA 4YMLA 4BXOB 1H2HA 4RAOA 4KR9A 3E8MA 5LD2C 4G37A 2FNAA 1WOMA 2FN4A 4BNJA 1I3LA 2HNKA 4FYWA 2FR8A 1R6DA 2OBBA 4RKWA 5BN4B 3PC8C 1YZKA 3CIOA 4LECA 1PK9A 3BFKA 4OQDA 4QYMA 1WUYA 4CF7A 1IZZA 2WHXA 1XXLA 2CMGA 4Y2JA 1UFRA 2OBYA 2BEJA 2Q9AA 4HI0E 4QHTA 4G36A 1A5BB 4AL4A 3KLPX 4ARBA 2DHRA 2ACWA 2J5XA 2BE9A 1TU4A 4OLFA 3ABOB 4XJTA 1XELA 3C5VA 1PYGA 3DLPX 4JJ7A 1N9GA 2FW6A 1LB1B 2Q50A 3G2KA 4B48A 3CUKA 4V0KA 4EECA 4KP7A 2HBZA 1ID8A 4K8OA 1FEZA 2X0IA 4UHFA 5J2TF 4L07A 1KU6A 3NT5A 3PXCX 1M2VB 4H2DA 5KSOA 5ALWA 3T0IA 3RVQA 1UJMA 2CV1A 1ECFA 1RZRD 5IWCA 1CEYA 2CLIB 3OTWA 3CR7A 4ITVA 1CY2A 1FFEA 2JFGA 3WIDA 3A4TA 4RK6A 2GUWA 4FFPA 3CCCA 4XJVA 3NALA 3BMCA 1SXPA 1M1YB 4XDZA 3RYIB 2FPOA 2JLCA 3OZAA 3L0SA 4K1XA 4ZAGA 3H0EA 3RBZA 3M6XA 4OBEA 3R5JA 3KQNA 1YVRA 4KR6A 2VPTA 2XYQA 1UJCA 3OCZA 3NAMA 1JKXA 2P2NA 1U0BB 2JJ8A 2VJBA 1WNFA 3GLVA 3KLOA 3VZQA 2I03A 2ZPTX 2CKMA 1M5UA 5EXPA 1I4DD 3HSSA 3WG9A 1U1CA 2VDNB 3D3WA 1XTIA 1DIRA 2X5OA 3H1TA 1GQRA 1PWHA 4PC1A 1T3SA 1YSCA 2G06A 3PUWA 4QGAA 2PT9A 2VBGA 4KH0A 1L5VA 4FBGA 5G1NA 3TI9A 5BP7A 4L7QA 5DDIP 2ZWMA 4D9EA 4EHKA 3WLSA 1URPA 3DUFB 3L6UA 1DKUA 2WJGA 1W76A 5DBIA 5DGIA 3GRPA 1EFVB 3PT9A 3HDHA 4N8SA 1I4OA 2WJVA 3KT8A 2IZ6A 4B5LA 1DQSA 5I3ZA 1BWQA 2ZI4A 1XD9A 3L0IB 4V0SA 3LBAA 5BV1A 4A26A 1VP9A 4PRLA 3HXPA 4K28A 1PDOA 3QVGB 1FXWA 5L3SA 3G68A 2XNCA 3OOJA 1HE8B 3QVLA 5E4YA 1AKQA 2AN9A 3KOOA 2HD4A 4TMYA 5K0ZA 2RI0A 1QS0B 4J91A 3SF8B 4JNCA 4NU0A 4HVAA 3DVAB 3KHSA 4QYTA 5B7NA 1U8ZA 1XNJA 2N47A 3ZG6A 5BSWA 4ZOLF 1WULS 1P7PA 3U49A 1Q0QA 2NT4A 1EVZA 1R6AA 1T3TA 3FE2A 4A16A 2F9LA 3K70D 2W2XA 1O08A 2FWPA 2ZYWX 1R9JA 1QRSA 1E6MA 1YRBA 2JW5A 1I3OA 2GNOA 3ANNA 3DMPA 3WV5A 3MD0A 3V1KA 2AQ8A 1NR5A 2ZRPA 4JI2B 3BGSA 2RGRA 5H0IA 5TPZA 3EGWA 3DJFA 2IOFA 1E60A 5I7VA 1RPTA 3B6IA 1KBQA 1AOXA 3PFKA 5TRTA 1WDKA 2JLQA 3DV9A 4L51A 5DNEA 3SSAA 3THSA 4DLWA 3HRHA 1N2HA 2FSUA 5FFMA 5IJXA 2QXUA 5HA5A 2O0MA 3KXKA 2ZTHA 4DCUA 2EIHA 3HN2A 3HJRA 4QTTB 3GZNB 4U6SA 4AO6A 3EXHC 3M4NA 4HAOA 4MQ5A 3VNBA 4AKTA 4YR7A 5AM0A 4CIAA 1V9SA 3KO8A 3N53A 2AD5A 2CVPA 2C4MA 3TDMA 2HWXA 4RPHA 3B7WA 3H2GA 3CEPB 1RQRA 4DW8A 5CT4A 3KAPA 4LHVA 5EUMA 3L5KA 4Q3AA 1DNPA 5ERXA 3OEEA 5F12A 2C3PA 3RS8A 4EGAA 3SWWA 3K30A 2K2WA 4ALJA 2B4KA 3W5HA 5ALRA 1BKYA 4GP6A 3LC2O 1V25A 4CRWB 1RJGA 1ZC4A 2AWNA 3ZU6A 1N0UA 3IB6A 3UA3A 2UYCA 3OX2A 3BS4A 3K9GA 4KWIA 3E03A 5FOSA 4ZREA 1K3TA 1U8XX 3Q7TA 4GG1A 4PSDA 4FKZA 2ZPAA 1H2XA 3KZ1E 3OU6A 1Y5MA 4EGFA 2X23A 4KPEC 1TYDE 4FYXA 4MNTA 1HDCA 2BZ0A 1L3CA 4DREA 3GX1A 2IH5A 1IJBA 2RH9B 2X2PA 3KJIA 2PX5A 1BROA 2PQ6A 1CJVC 5GMOA 1L7BA 1WV0A 2D4HA 2PKQP 3W6ZA 2ZYIA 3HZZA 1RXWA 3PICA 1CQZA 1UKZA 5CURA 1YC5A 2ZXFA 3GARA 3N6VA 821PA 4I8IA 4HX5A 5BUSA 2O7VA 4W7SA 1R15A 3AM3A 1H1DA 2OORA 3I8XA 3UQYS 1YI8A 5CDHA 3FGNA 1QFXA 3LQYA 2IXTA 1QXSA 4OD0A 2YUIA 1FUUA 2PBRA 1KBZA 1OYWA 3IUBA 1XI2A 4NG4A 1T2VA 4J29A 4K2HA 2PLWA 4JASB 2WU1A 3N3AC 1QOQB 4LXHA 2F1RA 1YB2A 4QU9A 4DLBA 3QUTA 4EJMA 5TQVA 2H08A 4EEZA 1WLSA 1YASA 4EO7A 2FPLA 4OI0A 3MJHA 4MJLA 2KI5A 3PXUA 1Y6QA 4MLPA 5E1MA 4M86A 1H0HA 3TAXA 4YRSA 3L8HA 1Z6GA 3CJQA 3RFXA 1G3RA 4N5HX 1ZVMA 2BFAA 5EPEA 3JQDA 4MP3A 5DLPA 1ZJ4A 2WJ3A 4GX1A 4ND7A 1HI9A 1QKIA 5FQOA 1BU5A 3QI7A 3ZGLA 3H9EO 2X2EA 4GUDA 5JFOA 4D26A 1KGSA 1HG1A 3DZIA 3KB6A 4HAWA 4WKPA 3B82A 5CNMA 4DCCA 4DQDA 4CXMA 1FMTA 3KPUA 3C15C 3UMGA 2QJTA 2R66A 1BN6A 1TF2A 2WDZA 4B3GA 4AKHA 2FW1A 3G1UA 2OV6A 3K71B 3N07A 4WBSA 5F78A 1P1HA 2XTNA 3LQQA 3LWNA 2FETA 3EZLA 3ZIAA 3NV7A 2HV8A 2A9KA 2N0SA 3HCNA 4RVHA 1PW7A 4U7FA 1WXGA 1X87A 3AR9A 2FFHA 3BD6A 5C9ZA 4EBFA 5DFAA 4E14A 1MNQA 4IJQA 2ADFA 2WD8A 1UWVA 2XNSA 5HHTA 1VKNA 3AIIA 4NS1A 4WKGA 1OBFO 2E37A 2JLUA 4NARA 1MT3A 1QLHA 3H3XA 3PJEA 1PG5A 5THXA 3MN1A 3A10A 3G5TA 3WKEA 3TSYA 5D1NA 3VR4H 1GNTA 3TOZA 4YRCA 2E5FA 4KZKA 1O9HA 4H9GA 3N1UA 4OTZA 1J0AA 5CIQA 3RR2A 3BTSA 4QPPA 2VXCA 3NDIA 3S55A 1MOSA 4PPGA 1MHPA 3JQAB 4YRIA 1XOIA 2AGVA 2OM6A 2XT0A 1I3CA 4PHHA 1JLLB 5JNTA 1MEJA 2W90A 3VU1A 1TZMA 4ZMRA 5EQFA 2CN1A 4NTZA 3LY9A 4O4LA 1FVOA 3AF4A 3DEIA 3OQNA 2JIOA 4J90A 4LF5B 3WQBA 4JFRA 4JR1A 1JDJA 1CUWA 2EGUA 1J8VA 1O0SA 1NRXA 2IYAA 5K0NA 2DJIA 4QPCA 4KQIA 2FZ5A 3STXA 5A5GA 1WW2A 2I67A 2J0VA 4BNTA 3RHSA 2IZ0A 5BSGA 4B3XA 2FEWB 2HPZA 3LYAA 3WWZA 3IAM6 1KZ9A 3KU4A 1E94E 2QTNA 4NZYA 3KR0A 5EIHA 1BX0A 5JSHA 1U0SY 1XA0A 2MWMA 2XD9A 3QE0A 3E05A 1MX3A 2ODTX 3ED5A 3JD4A 1X1SA 3WIUA 3OPYB 1DDOA 2WKQA 5K99A 2JAUA 4K40A 3MWJA 3NTQA 1T6NA 1I7NA 3ADCA 1G5PA 4WESA 3VI4B 4EVSA 2CLDX 2NVUA 1Q95A 1L5ZA 2RGWA 4K9DA 4OXRA 3RSSA 2D0PB 3QUCA 3C1UA 1JLSA 2VUHB 3WMRA 1DKOA 1E20A 3T3GA 1DO8A 5A02A 4QGHA 1QRTA 5DLEA 2JFPA 2ZR0A 4YJ3F 4B9AA 3SGLA 2IYNA 4V02A 4UM9B 3HCOA 1L5SA 2ZI3A 1OMOA 1VMEA 2ZIXB 1PSZA 3L07A 4HWTA 2CV2A 1E3DA 1W1WA 1R10A 2AT1A 2GWHA 2OV4A 3Q3HA 4GPIB 4ND3A 1XRQA 1WQ3A 3REOA 3RASA 4AY2A 2FV8A 4HPJB 2IPLA 4J1TA 2X8JA 3VV3A 4BJ1A 4EY3A 5KOJB 2PWPA 2A9VA 2JHFA 1PWZA 2WIBA 4PN7A 2V7TA 4XEUA 3VR4D 5HRAA 2E4ZA 4I3GA 2OT3B 4BY9E 2Q41A 3OCCA 3T7KA 4HFRA 4E30A 1YFJA 3FUTA 4IKEA 1Q57A 3GWZA 2F43A 1T6ZA 1BWRA 3ZOKA 2IUEA 2R3SA 5HJ5A 5ITWA 2WJWA 1JQLB 1RAHA 4RGBA 4GUAA 5ADUS 5BNTA 2O8BB 3STVA 4F9TA 4A2QA 3CO5A 4O2BA 1R7RA 2G88A 4G4IA 1D9XA 4ZQBA 3MG9A 1A3CA 1Z74A 5AH0A 1EUDA 1PL7A 1XCOA 1YB5A 4BC0A 4EHIA 3HYLA 2E4UA 4S1VA 1I33A 2Q5OA 5FP0A 1AK2A 1XZJA 3DT9A 1CS0B 1QFZA 4II2A 4L5BA 3A1TA 3UV6A 3RK4A 4US0R 1RRKA 3OT1B 3JVEA 3WWEA 4V03A 1YCDA 4DMKA 5FNVB 4HWRA 3MPOA 4UTZA 4LVNA 2ODWA 5JMOA 5T5QA 2P2YA 4LFAB 1M10A 5IEJA 4ZCIA 1A97A 3JQ7A 1WX1A 1XCBA 3AZPA 3PGMA 3UANA 2R4QA 4M98A 3RFFA 5IK2A 1EUZA 3EQ2A 2D0DA 3JQFA 4NLLA 3TQIA 1FTYA 1Y3CE 1U3UA 4AX4A 3HBMA 4E08A 2XYVA 1D8TA 2AJLI 3DC7A 3GA7A 3KPVA 1OHHD 4WBNF 5ADVA 1TYEB 2BGNA 4CIDA 2MCFA 1WMSA 5ER9A 3TPFA 4AKEA 1CY4A 2O3SA 2D1SA 3QVOA 4TT8A 5IZCA 2ERXA 2NQ8A 4WPGA 3NYRA 4E31A 1NL3A 4PC3A 1AQ6A 2R48A 4O0LA 1U7XA 4RY9A 1PQPA 4LF4B 2O5RA 2B0CA 5A0TA 1I5OA 1KI7A 1ZBDA 5JECA 1RRCA 2O05A 4BJHB 1GZVA 2GCGA 2ARKA 2Y0BA 1ZH4A 1SBQA 3X3HA 4MUHA 1T36B 3PTAA 2P9YA 3LUDA 5G0WA 1GPBA 5FL3A 3RARA 3A6GA 2XCUA 3P9XA 3PHCA 4HH0A 4LV6A 4LWOA 2IY9A 3WIEA 5ALVA 1Y1LA 1W46A 1IXRC 2X4DA 4O4IF 2HW8A 4X8LA 4DWJA 4NQZA 1OWNA 2VHEA 3KXLA 4I0WB 2QN2A 3GFQA 2OCDA 3V2HA 1XMOB 2CFOA 2QW8A 3QITA 4KN6A 4L4ZA 3GGCA 4MWEA 3GMSA 4PO8A 4JFAA 1XT6A 2QLFA 1EBBA 4QLBA 1PQWA 2ATVA 4O1HA 4XIYA 4AY3A 5A5VA 3STUA 2PA3A 4O2AF 2R1ZA 4QQFA 1D2CA 1IN8A 3PDIB 5T7BA 4HDRA 5KOIA 3EDYA 4FCTA 3CRRA 2VVTA 2Q3LA 2Y92A 3ANYB 5IPFA 1U04A 1Z75A 4YRPA 1RQGA 1S89A 4U9IS 2O0KA 4W1PA 1PGPA 3P9RA 5FOVA 2E48A 3V8VA 3KZKA 5DM2A 2VZEA 2W2PA 4KL8S 1CUSA 1DUSA 1Y37A 2XECA 4RWEA 4LZWA 3IXLA 4PAOA 4B4OA 5TS3A 4ZDJA 3HJHA 4M54A 3H1BA 2H4FA 4BXOA 4P8RA 3QX7A 1WMDA 4D81A 4K26A 4DLLA 4YCCA 1G5QA 5A2QA 1GG9A 1TPZA 4GWLA 1ZL0A 2F3PA 3B5JA 2QMUA 3D8NA 3K9QO 5HZMA 5JHGB 5BSEA 4HYQA 3ZIUA 2PNFA 2YICA 5B6PA 3GDOA 1L5HB 1DOHA 5HBGA 4GPTA 4JSTA 3ES9A 5EE3A 2C3YA 2CHQA 4DCMA 1LDNA 2A14A 3F9CA 3G8DA 3H84A 2I9PA 4MVXA 2AJTA 3QXHA 1HKHA 1TL7C 1YCHA 3B1KA 3GLHB 4HTFB 3JU3A 2VWHA 4ENUA 4E5PA 4XYLA 3AR6A 3MFYA 1Z4LA 4RGVA 1AD2A 2HRBA 4XJXA 1OZHA 1EEHA 5EPOA 2H7YA 1OWMA 1W96A 3I9JA 4XWAA 4GMGA 4AN4A 4W5TA 5JJKA 3L7JA 2QYTA 2XDYA 4L74A 2X9VA 1HZZA 4I36A 1KVTA 5BNIA 3OESA 3VPXA 2WTNA 3AUAA 5IKEA 1C7FA 4Q02A 2CNBA 3IVCA 2OCKA 5K3AA 2PG3A 1RE1A 1M1YA 5LPNA 4WXMA 3ENVA 3HVHA 2O59A 4DDMA 1MA3A 1SCDA 2Q3BA 3WGQA 1DWPA 2ADOA 1FRVA 3G2OA 7MHTA 1KVRA 1TDJA 1O96B 1Y9EA 1SC3A 3H6HA 4RVGA 1OLSB 4TTVA 3MWFA 5B1HA 4A0GA 3HM2A 3JRNA 4JYMA 1B42A 5EJEA 5BXYA 1NM5A 4N3GA 5AUOB 5FR1A 4XEHA 2OCAA 1KO1A 3EXHB 5I4KA 4C2UA 2DG2A 1CR2A 1Y8AA 3N2YA 3DTNA 3RG2A 2G77B 3UH0A 4EPTA 1OUMA 2QR3A 3S1AB 2PX6A 1XYGA 4RLFA 3PR3A 1ODJA 4PXSA 1G59A 4LAFA 3AF0A 2VHJA 3FI9A 2VJYA 2OD9A 2NO4A 2I62A 2RGDA 3O21A 4V24A 1M1UA 1H5QA 4UAVA 2WIKA 1YJQA 1EFVA 3FVWA 2WNIA 4H0CA 1I24A 3NZEA 4RSRA 4NZ9A 3M34A 3TTWA 3VSCA 1ADFA 3DV2A 3GLQA 3R20A 4PC6A 5NLLA 3FPFA 4TTRA 3R7DA 3SSMA 3VHQA 4B81A 1K2WA 4D9JA 4TVBA 4H77A 4LCEA 2H4JA 4TV9B 4J1NA 1C9KA 4IIEA 4ZOEA 3HA5A 1SUAA 1UJ6A 3JVIA 2J9RA 3CC8A 3KQYA 1SHZA 3AR7A 3DXXA 4GLFA 4WTOA 4B0PA 2CLCX 3L92A 4PHFA 4GDFA 4IGFA 1QS0A 4N9QA 1O97C 4B17A 1E98A 3KT3A 2A59A 3IAUA 1XX6A 3LC1O 5ALOA 3RYHB 3SF8A 3R41A 1NXOA 4KI7A 4TQUS 2O5EA 1ZUWA 1VCNA 4BLOA 1XD2B 1ZM4A 1GITA 2QDXA 4OM8A 3NU1A 3RJTA 5MN5A 3U60B 1X19A 2QZ4A 2XQVA 4MW1A 1AKEA 3LE8A 3PX3A 1S3IA 3ZXUB 4XRGA 3DCNA 2VSYA 4CMEC 4F3NA 2OFWA 3V4FA 3F7TA 4BMYA 4PS0A 4FMDF 1FC0A 4L76A 1V8PA 3INTA 1NF3A 4N8EA 4QBHA 2NSLA 2G40A 2C8VA 3ZD8A 3GQVA 3Q72A 1NXSA 4U2CA 2JCGA 2FSIA 3AOGA 4NKRA 3RM3A 3VVCA 1VIVA 1W6RA 1TKAA 1YNSA 3K1TA 3KWJA 4C0HA 1MAAA 3K5IA 3R7NA 3BTUA 2IYUA 3I05A 2R7KA 5BQFA 3IHLA 4MPJA 1MGOA 1KEKA 4PNPA 1N36B 2PR7A 2NZXA 1H2RS 1KMMA 3CLVA 3UCEA 1E6KA 1XMSA 5CYPA 3SJAA 3UHOA 3GBSA 5DTMA 5LQMA 1V7PC 1V7ZA 4OF4A 1O95D 1AA9A 1PGQA 1IG3A 1NZFA 3FHCB 1C9MA 1A95A 3GXOA 4EM6A 2OC9A 3MRXA 3PFIA 2EQBA 3KJHA 4QX6A 4HDQB 5AJZA 4LRQA 3VSAA 4B4WA 4EG3A 3T1NA 4YMTA 5BSFA 2FSVC 1I1QB 1AN0A 2A5FA 1YAJA 4ONEA 3HCDA 2QORA 3OTIA 3G2PA 2JB9A 3PC3A 1YKGA 1SVLA 1XLTC 2BONA 2O0JA 2REXB 4HCJA 4M7PA 4DQXA 2J48A 2WM2A 2VRCD 2ZJYA 3NHZA 1NFFA 3JVUA 2BFOA 4D4KA 1JQJC 1FSZA 3JQGB 4FCVA 4U8GA 1YRHA 5I3CA 3OJLA 4L5YA 4EHFA 1EBFA 1M73E 3WIOA 1NQ5A 4FCCA 1CR0A 4PONA 2MYTA 3F6PA 2DFNA 2VTDA 1GUYA 4UBJA 2FWIA 2VDKB 3OZWA 3F5QA 3FFTA 4DIUA 2G0AA 1QTIA 1FCJA 2XXAA 1D6SA 2GZ1A 2P79A 5TEVA 3EXFB 1QNFA 2PUJA 2EDAA 3FCAA 4IPTA 2R87A 1JVSA 3NWJA 2PK3A 3KR2A 5ECWA 4B46A 5A0FA 1TJ4A 1H1TA 2JJYA 1EJ2A 3I12A 4EJ6A 8MHTA 2IXBA 2IEYA 4RIIA 1QP7A 3OHPA 2IOFK 3M70A 3EWAA 3R4VA 2WDPA 4LC0A 1K9VF 1KMCA 1Q7EA 1THMA 3U7JA 4LRSB 2I2AA 1QK4A 3DOIA 2C5LA 3RC1A 5IXSA 2H7CA 3HKBB 5K6RA 4TYYA 5DLYA 4WLEA 4FHZA 2PCLA 1GN8A 2P5SA 5CP8A 3AKYA 3DTVD 1T2EA 2QA5A 1P81A 4MOWA 2AV6A 3HCAA 1W0JD 2FQYA 1PJRA 2A5JA 2QY6A 3PNPA 4YB8A 1E8MA 1U9YA 4KVZA 3TQFA 4MW9A 5IAGA 5IKOA 4DXAA 1NR1A 3P9YA 2ZM5A 1AUVA 3ZHTA 4NAVA 3MTDA 5ER6A 1KNXA 1U02A 4LJRA 2DT8A 3ROEA 2FUG1 5M5BA 3W77A 2JAHA 2PL9A 2VRBA 5FL7A 1BEUB 2ZTLA 5HIAA 3AHCA 3DAGA 2RARA 5A5FA 3EGOA 2NYAA 3B3QA 2XIJA 1C29B 1M1YE 1O6FA 1PJLA 3MGCA 4PLPA 2BIFA 3UMYA 4YP5A 3EVBA 4IHJF 3SC2B 4ZQFA 1FMJA 4C07A 4HNUA 3NT2A 4OMCA 4CKEB 1WG8A 5C3UA 1X8LA 1XQWA 4KIWA 2D3TA 3OD5A 4IIXA 3LZDA 4UVGA 2EJTA 1FYXA 3DW1X 3PUXA 3EGCA 4OB8A 3ECSA 3LY5A 3IP1A 1R18A 3LVFO 4EFMA 1D09A 4RL6A 1Z2AA 5DSTA 1P1JA 3RT1A 1T43A 2AMVA 2HMSA 4U2BA 2ZYTX 3VZCA 4O0MA 1GG2A 1PS0A 4D4LA 1XHFA 5JJBA 3QEBZ 4EQZA 4QHSA 1ZUD1 3SXJA 4RTOA 3RRZA 4RF5A 4INZA 1AH2A 3PFCA 4U6NA 4I5FA 3AONB 2B1RA 1ECBA 1A8QA 5DIZA 2ZAOA 5JSFA 4HAXA 4IZIA 3K8QA 1BCSB 5AHWA 3HP4A 3NANA 2C4HA 4FLFA 1GM5A 1QQ5A 2I7DA 4JBLA 5E1OA 4Y2YA 2ZIVB 3ZW7A 5F7ZA 5IM4A 4QDXA 2KS6A 2I6XA 1X39A 4GVPA 3W05A 3WXBA 2QUJA 1CF9A 1AS2A 4BQSA 2AOUB 5SYAA 4M36A 1GU7A 4KO1S 3UICA 3DMTA 2YWBA 4CMCA 4FJ1A 5KNBA 1KAMA 3BIFA 1YWGO 3TLGB 4TQAA 5FD8A 3S0JA 2W93A 3DKIA 5DYTA 3TX6A 5HGXA 5LJIA 2OZKA 3RIXA 1XRJA 3F6BX 1A9SA 2EATA 5EFZA 1E92A 1KEWA 5G0UA 5CXUA 1VE9A 1DG1G 2G6TA 2ZULA 3OZVA 1MB0A 1XMXA 3CVWA 1BVRA 3GOHA 4RPIA 1CUBA 1G9XA 1OW3B 1FDSA 3HN7A 1ETHA 3IV7A 1JIIA 3KCQA 1GPLA 3QWAA 2H7XA 2QPOA 4GFDA 4GI2A 2F9FA 1TF7A 2GPJA 1BVUA 3GLUA 4JLDA 5BWCA 2W6JD 4FK8A 2FG6C 4ZC1A 3UT0A 4FWTA 2HSWA 2I7CA 3WNDA 1W581 5HWSA 1KDOA 4GKJB 2HX1A 1NVVQ 1DKMA 5GINE 5COAA 1PX0A 1ZMRA 4LPKA 1OYVA 4V2IA 5J40A 5B3KA 2DE0X 1M67A 5G3YA 4EX6A 1Y48E 4RXMA 4I4IA 2XDQB 1DFGA 1ISHA 1SCUA 3DONA 5H7XA 3M3DA 3ITDA 3DZDA 1HDEA 4KN5A 3BK2A 1L8XA 3EF0A 4UM5A 1JDNA 2JJQA 5D3ZA 4R3WA 4ED9A 4P5DA 1H66A 2HJHA 1FJ2A 1KYWA 2ESRA 2NV2B 4UUBA 5FFFA 3FOWA 1U3GA 4DJFC 3RYCB 1Q1GA 3I52A 3PPXA 4BPRA 5KOJA 1J0XO 1I51A 2G7ZA 2Y99A 3V2UA 5TVKA 4I46A 4PWYA 2NYUA 1T4GA 2ODEA 4RZXA 4PCUA 4CTOA 1ULZA 2IOQA 4D0LB 3DMNA 3DP7A 4N49A 3RHFA 5B30A 1Q14A 1IPFA 2FR1A 1EVLA 4L4UA 1Q0TA 4JUBA 1GKYA 2I3DA 2VRNA 3CX7A 4JBIA 4BCBA 4U1RA 1W85B 3DFUA 1R6TA 2NPOA 3CRW1 4MHTA 2O8BA 1QHXA 4PFKA 2W0MA 2XE4A 1JU9A 3NV9A 4K81B 3A3PA 4G1FA 3ENZA 1LNZA 3A1DA 1R8SA 5DX1A 2AG5A 1A7JA 4HQ6A 1PR4A 2C2ZA 3JD2A 1ISFA 1B0PA 3R3XA 1N7GA 4JLOA 2CUKA 1L5LA 1CS0A 1Z35A 1T2NA 1VJTA 3EVAA 4ZDKA 2PKXA 4GO1A 3H65A 3OT1A 3LUCA 2FMTA 1XA3A 3ZTWA 4NS4A 1QCYA 2UYGA 3B6MA 3NIBA 1JHPA 4XIJA 5FNVA 3V1TC 3QVJA 1CG6A 4TM7A 1FA9A 4EUFA 1A1SA 2GX6A 4ZU6X 1Z2OX 2YW2A 5CNKA 5KVVA 2AZDA 4K6CA 2G3YA 3WNCA 3AF2A 2W2LA 4YT2A 2HK8A 3DGEC 1XGKA 5J4VA 5JS1A 4A27A 2F1HA 1TLLA 3QIAA 1NW5A 4QUEA 3L2OB 1BS9A 4RJIA 2C4TA 2FB9A 1Z08A 2O9JA 1GGEA 4PPQA 1HNNA 4RQTA 2FLKA 2QAGB 4Z4GA 4RXTA 3HRIA 2YJGA 1NVEA 3COWA 5BPHA 3I6IA 1L5QA 1P1KA 3ZPXA 4B8ZA 2GBLA 1DADA 1I32A 4AP5A 2WZQA 2Z4TA 1C9JA 4XLTA 4ZCMA 3N59A 2D54A 1XTKA 2E3JA 3NUZA 1NWCA 2GCEA 3R3SA 3S4YA 2H1CA 5C8YB 2J0SA 1AU9A 5AI5A 1LLCA 3LKBA 2VHYA 3KJZA 4E2ZA 4MGEA 2RG1A 1MLDA 5HX7A 3H9JA 4N48A 1JTFA 3ZLVA 1T36A 1Z39A 1G2PA 3JATB 2FEAA 4CN9A 4DA8A 5K8TA 5MHTA 1YOBA 3AEYA 1TKRA 1YGYA 2QSUA 2V1XA 3THXB 4GRIA 1KL7A 5BSTA 4LDQA 3WLOA 1PWEA 1Y6GA 2PS1A 1JLRA 1SCKA 1T8UA 1V43A 4BQIA 1T26A 3BSSA 4H27A 1YBFA 2JCYA 4PYQA 2WHEA 3TW8B 3ZE8A 3ZY3A 5B4TA 3OX3A 4N0PA 1ADCA 1NJ6A 3DKVA 3PKZA 5KYWB 3A0RB 2KX7A 3MQFA 3M4JA 4ENVA 1QHIA 4CBVA 2BMWA 4NMLA 3PF8A 4ND5A 4DARA 2O8FB 4LJKA 3IBSA 3FG9A 4P92A 1YS2X 4Y8VA 2I0FA 2OBLA 3TOXA 4R8MA 3X43A 2IDMA 4XVHA 1T25A 4GKBA 3WJ7A 2WICA 5IT9A 2E85A 1T5IA 1K75A 3FYUC 3OIWA 3PF9A 3H17A 1XE3A 1AS0A 2DPLA 3K0FB 3KZXA 2WSSA 4LW8A 3V6LA 4YYEA 1T1EA 2CXNA 2EFEB 2I80A 2N1MA 4IIJB 2O54A 3D0QA 3OOSA 2ZR7A 3MTIA 4C4PA 4R2KA 4GBJA 5FHQA 2JBWA 2MYPA 3S2ZA 4L0MA 4ZV7A 3SZOA 3R5HA 2NTEA 2ISCA 3J81k 3E3MA 2OQ2A 3BCRA 4KREA 4GP9A 4OHUA 3QU5A 1X0XA 4BO1A 1IHUA 1Z06A 4B5KA 3X1JA 1ZD2P 3CY6A 5AVQA 4R0MA 2DKNA 3ER8A 1E9AA 4N54A 4FHDA 3OZRA 4IJKA 1H5UA 3G49A 3E7WA 3QU4A 3VISA 3VJLA 1U0EA 2Z09A 5C8DA 5CEEA 1U9JA 4XIGS 3KOXA 3P45A 3EPKA 1ID1A 1RZ3A 4LXTA 4YHBA 4G9BA 4HGQA 1F48A 2BC9A 3ZWYA 4CDMA 4JUFA 2OO5C 3GLHA 1TC1A 2FMFA 4HTFA 2ZSHA 2YNMA 1ZNXA 4NABA 4C1NA 3TRDA 4NENB 5KJEA 3PLAE 4DYHA 2B4TO 3LUGA 4U39A 4CMIA 3MHTA 2GN2A 3OO1A 3SAJA 2ZSKA 1YVEI 4JAVC 1M2EA 4W8HA 3LFTA 4IGEA 4EA9A 5B7QA 1T9KA 3FPJA 4KR2A 2JIPA 3REFA 1QJCA 3RIEA 3ZNOA 1L7VC 1L4NA 3OLVA 4MB6A 2JI7A 3ZKWB 2WU0A 521PA 2OWDA 3ZGYA 1R37A 3W3ZB 1NXTA 4V2UA 1C7JA 4V0OA 2AMJA 3ACDA 3H2JA 4YBZA 1G18A 4XLZA 2AKAB 4L9SA 3DZHA 3MLAA 2UYHA 1GKIA 3L9WA 1ZCJA 2QRGA 1NA5A 3QVMA 4H3KB 2ZRFA 1RE0A 1O0CA 2PQ0A 2QW0X 3F98A 4HNTA 1O96A 2V7EA 3A6EA 4TZ6A 1OLSA 2PO7A 1JHMA 3FSEA 5HMMA 4M9RA 1TADA 3ADBA 1MF7A 2W83A 4DVGA 2CDNA 2WEKA 3QV2A 3WQSB 1SOVA 2BPOA 3DFFA 5AIAA 5T67A 5TGTA 4RTNA 2PGDA 3V1YA 1YOVA 1CULC 1NHGA 2FOIA 5A3QA 4WJLA 4XR4A 4AMZA 2ODBA 3S8EA 3TLJA 1ZHOA 1SVNA 4RH1A 4URZR 2E9SA 5CEFA 2R79A 3F9RA 4JXXA 1QHHB 4Y2QA 1J33A 1NUAA 2R1TB 3H8JA 3HYCA 2CWDA 2XMZA 5HFAA 2HR1A 4DAOA 2EKLA 1IHOA 2FZEA 4MJXA 5HUQA 1E79D 2VDLB 3B5IA 3QVUA 4UDOA 2NZ2A 4UU7A 1J09A 2VH2A 4B6JA 3RQSA 1EYZA 4EWLA 3Q1LA 4XQ9A 2ID9A 1PE0A 3GPDG 4AMVA 1D4FA 4HYYA 1OKKA 1G16A 4TV9A 1NASA 2CYAA 2W8ZA 1XMIA 4LYYA 4BBZA 4KFCA 2A0KA 3NYIA 2P30A 4RE5A 3U4QB 1UPFA 1IUOA 2EFJA 4XD7D 4L8VA 4AP9A 2FMKA 2XYRA 3JZAA 1N2CB 1P1FA 2ID7A 4FKMA 3ITNA 3RYHA 4MYCA 2Z2YA 3GDHA 1GCOA 3KPJA 3WRYA 4MYRA 2JI9A 1XD2A 3JRXA 3OKAA 3WMEA 3VRHA 1DKNA 3RUIA 1NKSA 3H6KA 2Y1EA 3B1ZA 3PUIA 4IBOA 1LFDB 4IEEA 1ORWA 4LBWA 4LDAA 1KJQA 4JH0A 4OJNA 2HCTA 2QLNA 4Q4AB 1HE4A 1Q7BA 4AN1A 4S05A 1Y81A 3H3JA 1Z7BA 3DLBA 3K0AB 4N0DA 3D4LA 5BT8A 3HB7A 2Q8NA 1WKVA 1QFMA 4FC7A 2IY8A 5LA6B 2QWXA 3W5DA 4ZVPA 5ADHA 1RXEA 1NC3A 5JZSA 4A36A 1YJBA 4MWDA 3MTEA 1VKHA 4KK3A 1TEHA 1HY3A 2ZIEA 4CE6A 1C7IA 1V71A 2WM3A 3ESDA 2SCUA 2V58A 4JP8A 4R0NA 3G82C 2J32A 3ZY6A 2DSNA 4CIYA 3HFJA 5SZIA 1HLDA 3KKZA 3ZLBA 4AJ9A 3BRCA 1OB5A 1PN3A 4XB2A 5FPKA 2O06A 2H06A 1QO7A 3OLCX 1Y7PA 4GPAA 1UPUA 3FFAA 4MITA 4RFSB 3VC7A 3DE7X 2V7PA 4R9UC 4YFVA 1U0FA 3ZCXA 2H4WA 3SS8A 3UWDA 3LY7A 2J3QA 2R9VA 5BXQC 2ZIAA 2R6CA 4P4SA 5DXAA 4BVHA 1VLJA 3NYWA 4EMBA 3IIJA 2TMGA 4IIYA 4LMAA 4YREA 2G72A 1KMQA 4W9NA 1L7OA 5DO9A 4TTIA 3DS8A 1UP6A 4F5YA 3JQGA 1LPNA 2ODNA 3EUFA 1YQGA 2DTDA 2OSBA 3EPHA 3HGTA 2AEMA 5EINA 3DAPA 4QHYA 4RW0A 4L5AA 4MWOA 1BKDR 4OUDA 1REQA 1XV5A 4XYBA 3RFUA 2QVCA 1JJFA 2VQDA 1IL0A 1C8BA 1DQPA 1FP4A 1M2WA 2WK1A 4KV9A 1FB5A 2GJ4A 1DP4A 3EXFA 4TV8B 4O8CA 3LH5A 2RHLA 4V1CA 1EA7A 1OVGA 3ZHYA 1A71A 3VHRA 5C1OA 3A4VA 3SQLA 4WFQA 1GUFA 4N7MA 5C4GB 3ZV3A 3T8YA 4MVCA 2V3WA 3Q98A 5E9JA 1M72A 1VSTA 3I34X 1X9IA 3PEFA 1LDGA 4HEQA 1X7YB 1G8AA 5AUQA 1WSAA 5EIEA 3UAYA 3ZTTA 2JFNA 2BGMA 3DBLA 2IRWA 3A58B 3DV0B 3ZY2A 4DXHA 5LMZA 1KE1A 5I47A 1Z18A 2EBWA 4CG3A 2XB2A 3HKBA 3P2IA 2VJOA 1E2IA 3Q8XB 4DMMA 2I4TA 4KODA 4PZPA 3D3EA 1AK1A 4HRXA 4QAJA 3E48A 2BGLA 3D7MA 3GLHE 5BYJA 5DNYB 3ICQB 4BEBA 3H9UA 4FE7A 4WKOA 2OVFA 4PAMA 3RU9A 3C6QA 2EQ5A 2CYBA 2AMYA 4Y2HA 2OG2A 4BATA 3BRQA 2BHRA 4M8KA 4P2BA 4C0WA 3L41A 5BNWA 4LXXA 3HSYA 5J9FA 3PRYA 2AR0A 4ML3A 2JFXA 4PLCA 4UAJA 2IEDA 3F73A 3LPDA 1EHYA 4NI5A 3UG7A 1GAEO 1WCIB 1UM9B 4RD1A 1B1CA 3B53X 3PCXA 4D0GA 4WY2A 3MJCA 3MQ4A 1ORRA 1T15A 4XFKA 1COWA 3SC2A 2PXAA 5AP9A 5KYGA 2J5BA 4XPZA 5ILGA 1M9NA 2C2YA 3EMBA 4O2LA 4CKEA 2GT1A 1TAHA 4B7CA 4LYEA 1V16B 2EG9A 1NULA 5LQJA 1KQGA 1Y8QB 2VAVA 4IRMA 1LSSA 4I1UA 3F4KA 2W4MA 4I66A 4RANA 4YMHA 5KDLA 1RXSA 4OXIA 4CM9A 4Q4JB 2JFOA 3M6VA 3GFSA 1PDWA 3B1XA 4YP6A 1Y1TA 2XV1A 2FPXA 3URMA 3LAWA 2GZDA 4TXHA 3G9XA 4JENA 1XU4A 4EZIA 3MF4A 3P0HA 3D8RA 2HJSA 2MSCB 4AX8A 1TCBA 2WTXA 4DCJA 2WINI 4EHDA 2QTTA 4E03A 5CB4F 2Q1SA 2ZBFA 3WOVA 2HQ1A 1FLVA 2JGJA 3KEQA 2XUOA 5A5DA 4G5HA 2IBTA 3K0BA 3CG4A 1KQOA 1C1DB 2J3JA 3ABSB 5GTDA 2AJDA 2LCIA 4ZCQA 4WBXC 4MO2A 1L5YA 2VL7A 4IM7A 4CKCB 3KOMA 5KYXB 3NATA 2I33A 2KBEA 2C84A 3BL5A 1KEZA 2DYKA 1CEQA 1TGVA 1U8AA 3DWFA 3R3YA 3TLGA 4DSTA 2OP1A 4MRNA 3WC4A 4EDHA 1JG1A 2AUMA 2FN3A 4AURA 2B7BA 4JOSA 4IQ4A 5DCWA 4YY3B 1VPWA 4LQDA 3NWPA 2QV0A 1W88B 3W79A 1IMOA 1DZIA 3I0MA 2IF0A 1Z6YA 4JL6A 3BXPA 3OCXA 4HXYA 1HX7A 1I13A 1MOZA 4I81A 3WFZA 4D43A 1TJ5A 3DC2A 2Q99A 3NVDA 5JNRA 4TLLB 5FPSA 1UCFA 5CAEA 3DL4A 1FF9A 1L3BA 4IG4A 2CJXA 4JR2A 4G8DA 4PFQA 3W5AA 4IDOA 4O1IA 1FW6A 2QX4A 2A5DA 3BCSA 3WK9A 4IILA 1E59A 1RYDA 2MR5A 2W2KA 1EK5A 4MKZA 1EA5A 1Y8RA 2QRVB 2F9MA 2TS1A 2ZTSA 3F5DA 1ZCBA 1C1XB 3BMOB 3UHPA 3VTAA 4AT1A 3ILSA 1ZBQA 2XDQA 3LGSA 1R4ZA 1FFYA 1DCFA 1GZDA 3KALA 3V8NA 1JUDA 4KE9A 3DDZX 4DZRA 1AQJA 3H7AA 2XJ9A 4R81A 1EDOA 3SHTA 2JGNA 3CRZA 1VRVA 2J4CA 3F3MA 4HUQB 3KYJB 5IVIA 3O1JC 3W2TA 3LHKA 3RYCA 3CHYA 4J4HA 1ANKA 3ETLA 1KBOA 2B7CA 1BU8A 2PT6A 3GQBA 1RKBA 4OHKA 4CNBA 5K8UA 2J5QA 5B55A 1LJLA 4YQZA 1TM7E 5CH8A 3SC6A 1KP9A 5JJLA 2VYCA 1HMYA 1K8XB 1H8HA 1W2WB 1XEXB 2QG6A 2Q9UA 2Z9DA 4I7EA 4KPFC 2Q21A 3AV3A 3I5XA 3B6KA 2XUZA 3IEKA 3IPRA 1RKXA 4UCFA 3K1ZA 1UBOS 1MX9A 2ZSFA 4WUTA 5MFZA 3QLVA 3IP6A 3CZ5A 5EUQB 5K7SA 3LVBA 2PH7A 2Z57A 2YOFA 4IIGA 5J43A 3I83A 4OQMA 3FW1A 4D9IA 4EZBA 1RI1A 1LC0A 1VKZA 4TMWA 4W4TA 1FMLA 4B47A 2OUKA 4UFNA 1UP4A 3N2GA 2XX3A 2XOXA 4PSKA 4F85A 5DNCA 1VSUA 3L8ZA 2GBPA 3L0CA 4QRHA 1N5DA 5DASA 4S2EA 1YS6A 2KSQA 2O20A 3S6JA 3QYPA 5IARA 5L4SA 2A92A 5HKKD 3KDAA 1M2KA 1TPYA 2O2HA 3LHDA 1R27A 3SI7A 4WIAA 1J8MF 1LZLA 4P22A 2POCA 3P19A 3LDAA 5ALGA 1RMQA 3OZUA 3E7FA 4EPWA 1K4MA 2OLKA 2Y4OA 2HEIA 3QQ5A 1P29A 3ILHA 3SR3A 3GK3A 1PKEA 3VOBA 4G4SO 3ZLTA 4D8YA 1F4LA 2RGNC 4TMXA 3VSEA 1YRQA 4CMAA 2GOYA 4FWBA 1VJDA 1GGMA 2QAGA 2Z08A 3VTZA 5E0KB 3A9TA 4BFCA 1QE0A 4DMLA 4F8EA 5CBPB 3AF1A 4P58A 4Z4QA 4JJFA 3OZGA 2QRUA 4IICA 2IYSA 3OPMA 4OH7A 1FP2A 1VFNA 2YV5A 3VNVA 1DC3A 1A9PA 3OCJA 4IO1A 4XPIB 3U9SA 2FG7C 1G6Q1 1NDQA 4HZIA 1YMUA 4ZIRA 4QEKA 2HH9A 4LK2A 4REOA 4W9MC 5C8YA 1B8VA 3EXEB 3RABA 1Z5GA 3MSCA 2JHCA 5D5HA 3AVWA 3L1HA 3O1LA 2O4UX 3EXIA 3LU1A 3Q3CA 2FK7A 3KJNA 1DTWB 4AW9A 4D44A 4NH4A 1WOYA 3OX4A 1WF3A 2ZXUA 3THXA 1WCWA 2YXDA 5E1DA 5DYGA 2PD3A 2GK7A 2PD4A 4TT3D 1MH1A 5COQA 1IZ8A 4P0TA 1F7UA 3JQPA 1P6XA 1ESZA 4M38A 1Z8NA 2ILTA 5AXAA 4MV7A 2AD1A 2XMRA 2QPLA 3KSZO 3OY2A 1V4NA 2R5NA 4MYSA 4Q3DA 4Q5IA 3TNDA 4AU1A 5KYWA 2ZBRA 3KSDO 5CD1A 1Z8HA 3DHVA 1MCZA 2LRHA 2OM2A 3VPHA 1Q5PA 4DS3A 1LK7A 4EGJA 2O8FA 3KZMA 3G0OA 1XDWA 2WPDD 2AC7A 3OFND 3Q7EA 4V0RA 3WLHA 1EU1A 1SZJG 3FTPA 2CGEA 3MAGA 2X5XA 1HQDA 2Z5LA 3O4JA 5JQGA 3NJ8A 3L1VA 4M53A 3AY7A 1EFPB 1S2NA 1SOUA 1V45E 1Q19A 5EVJA 4BZXA 4UAUA 5E6UA 4ZHQF 2WILA 3FOAA 2G1KA 2IU4A 1UFVA 1CP2A 3W78A 1ZM3A 3GY0A 1GZHB 1WPGA 4AZ3B 1TU0A 3K0FA 4C4SA 3R0XA 1N6LA 4C4AA 2BFMA 2DETA 1P91A 3MMPA 4IIJA 4BVJA 4NULA 2A33A 4EO9A 3FA2A 2JD0A 4RJ2A 1Y7LA 4YH1A 1QYCA 1L5OA 4K87A 2M1XA 2BKUA 5LOVA 4RACA 2DWUA 1LI5A 3FUCA 3QGMA 3ZDBA 3FBWA 4OGFA 4KFUA 3V7UA 1VL5A 3PWZA 2GXUA 3VPSA 4M7OA 1LDEA 1BDBA 3ER9A 2Q7XA 4EZEA 4BEWA 3W9BA 2O14A 2WHRA 3JQRA 3OVMA 1NMXA 4UEQA 1SIWA 3DEZA 1HLPA 2GNAA 3UMVA 4X90A 3CH4B 1I4TD 2RFLA 5FI1B 3WP0A 3WGKA 4OFXA 2ZAYA 3E5RA 5TV2A 1NI5A 1TMOA 2R8PA 3ROFA 4E7OA 4F12A 2HMAA 1B8PA 2DQYA 2HCJB 4BWFB 4CTKA 1NLYA 1SGWA 1Z4QA 1T2FA 2AZMA 2OESA 3FNQA 3FOZA 3A6KA 2G5GX 3DE6X 2HA2A 4MLCA 4B33A 3HS3A 4KMRA 2PX8A 3TW0A 2IYQA 4DLAA 1EFCA 4XVCA 3KKOA 4YAIA 4E51A 4XOIA 5JXJA 1PQYA 1UT8A 1BH6A 4J16C 3CU5A 3JXEA 3OI7A 1EFUA 3ZKWA 3BHIA 2IOYA 2ZWPA 4X20B 2XWSA 4D0RA 5JEEA 1JECA 1TT5B 3I2HA 3W7VA 1ESMA 2RGAA 4G63A 4FJ2A 2B9VA 3E84A 2R2AA 1THTA 3W90A 5EJ5A 5TLSA 4YT4A 5E3HA 4A7PA 5DHTA 4ZV4A 5JFGA 4LDRA 1IOZA 4R5HA 4DC0A 3ZDXB 2P2SA 4HS4A 1NURA 4OK5A 1TI7A 4M6WA 1RWKA 2NO1A 3ORSA 4PBSA 4HN4B 1RQXA 3TXYA 1A76A 1G5HA 1Z88A 4D1YA 3QKWA 3U1TA 5I8PA 5KDOA 4XGIA 5TMPA 2BDEA 3ZBQA 1G2IA 1XK6A 4PTLA 4UMEA 5ICMA 3OPQA 1CJMA 2HEGA 2O23A 1D2GA 5BR7A 1EXVA 4G01B 1R0KA 3I4CA 3EA0A 1IK6A 1O6ZA 2G5PA 4ZVMA 3NTVA 4ACBA 2EG5A 1SZCA 3HCEA 3FDJA 5DRYA 5TNXA 3RJ9A 1SB9A 1XA4A 1JXQA 4UD2A 3DL0A 4CI9A 2JLBA 3FPSA 2R1TA 2MSKA 3SF0A 3K5WA 5GVRA 1FYDA 1CQWA 3GELA 1MQ8B 2C2XA 5TDHA 4JBGA 3GP8A 1CU1A 4KDCA 4FR5A 4WUVA 2VG8A 2VQEB 2Q0HA 1UJ5A 3U3ZA 4BLVA 2GXAA 1ZD1A 4TOIA 4BV9A 4PG8A 2Q5IA 1NI4B 1CDDA 1FFCA 1R3DA 4B8WA 3TLKA 4ENRA 1DFIA 1PG2A 1XJCA 5BYKA 4YQEA 2XJ4A 5JSKA 4B3MB 1G5RA 3A04A 5DIFA 2RJNA 4C5AA 3T3OA 5K3CA 4FNAA 5DXJA 3LL4A 3PPVA 2PPLA 4LJ5A 2NP7A 1V35A 1WY7A 3PEEA 4GC5A 3LPCA 3VR4A 4D8VA 3D4BA 1DL5A 1UJ2A 1VE1A 2NZWA 5DEOA 2C9CA 3EGXB 3GGGA 2CV0A 4X6XA 3BZBA 1CEXA 4Q4AA 4DWWA 3W2IA 2C07A 2NO7A 1QYRA 3E5HA 2I1QA 3M1LA 4Q3OA 3K0AA 2QTZA 4B2YA 4WOJA 2GWRA 4IDDA 2V7GA 4F2WA 1W19A 3A05A 2O3TA 4D3SA 2WV7A 1V3VA 3ZQKA 1XB2A 2XMGA 1JPJA 1UBSB 3IEPA 3R9XA 1GSHA 4M83A 2CCGA 5EMLA 5ENZA 4MVJI 5IZ4A 1LBTA 1PT7A 4R01A 2EJVA 4ESVA 3BEOA 1CLEA 3OJCA 2QBYB 5D2CA 1NW8A 3M5PA 4JUIA 3LWDA 1U2GA 1G41A 3N70A 1NU6A 1ST3A 1XQ9A 4H1WA 1ICIA 2UVPB 2VHTA 1A2BA 3FNEA 3LXMA 2OHVA 2I7TA 5IBPA 3RROA 1YRLA 2D5CA 4GM0A 4NHOA 1KAOA 3HA7A 3BMQB 3CLRC 3UWKA 5I9IA 3HHEA 1FNSA 2B1QA 3WBFA 4QVKA 5LN1A 1K7SN 3P5BA 2NQTA 3ZK8A 3WOHA 3QX3A 4BL5A 1AGYA 1ZC3A 4XDYA 3P2OA 4TN1A 1QDLB 5EEGA 5CXSA 3WL4A 1GQQA 4XARA 5ELXA 1A8HA 4WKNA 4NE7A 3AYXB 3UJDA 2IGBA 2A0YA 4M1QA 4Z5XA 1KRWA 3CF0A 5DVZA 2IFTA 1N6RA 3UF0A 1HE3A 3R6LA 2D00A 4R2IA 1BJRE 2R7AA 3N2KB 1EAMA 4ZI2A 5KVCA 3OIUA 4KSCA 1ABEA 3QNMA 1MFPA 3ROKA 5FADA 4I1VA 4ZT7A 3T1VA 1W5EA 2FPPB 3V4OA 1QHNA 4ECEA 4M8SA 1L7XA 4OAQA 3IJPA 4RDCA 1HUQA 1QHYA 4JB3A 1U9ZA 3L7LA 1UMCB 3L5OA 2BZSA 1XZMA 3A6HA 2RK3A 4KOEC 3B5EA 3O26A 5JDIC 3AXTA 4FINA 1CUJA 4C6TB 1X7YA 3ANTA 1MV5A 4X97A 4OX9B 2WABA 1KS2A 1Z2EA 2OVBA 3KV3O 2DFKB 4LHYA 4Y6LA 3ST7A 3DV0A 4BBAA 2I6GA 3RKSA 4S1WA 4H18A 5FTJA 5K6AA 4JHXA 3AM5A 3AETB 1DQNA 1X8KA 3KOUA 4DV6B 2ANBA 4EPRA 2VATA 1D9ZA 5JYDA 1SCJA 4QTYA 4UNPA 4Z3KA 5EZ6B 5IJ0B 4E5MA 2D7DA 2GAFA 1TU3A 3BE5A 3OD1A 4Q82A 4B2PA 4GSLA 1XNQB 3VR2D 1QNLA 2QN1A 3PSHA 1IN7A 2OCPA 2XGGA 4N39A 2IS2A 5D8DA 5LQAA 4CF4A 3B1WA 4EG0A 4ZVOA 3CWQA 3QJ5A 3FLEA 3HJCA 3UKJA 3DZCA 1BFKA 2ZIUB 3H9GA 2A7XA 1CD5A 3OUZA 1VB3A 2YUTA 2ZT6A 5GZ3A 1XNHA 2FGKA 2HRZA 4G4GA 3ZE9A 4MRSA 2OBMA 1I1OA 4KR0A 2FZCA 5AFSA 1Z6PA 3K9LA 3WJ2A 1Q83A 1O97D 2RB4A 2Y76A 3HO8A 4ER6A 1FY2A 4EIWA 3OCWA 2Z95A 1JXOA 1PL8A 3TMKA 3UK6A 3G2JA 3HUTA 4EJSA 1VGVA 3N8IA 4EUNA 1Y8QA 3OQIB 1O4VA 4JJAA 1EK1A 2IVFA 1KPHA 5JLJA 3ZVLA 5TE9A 2FWAA 2JRCA 1EFRD 2WG2A 3MQ2A 4P2GA 4W82A 2CSUA 2XB9A 2HTFA 2H5LA 4I2NA 4LZJA 5IDWA 4BO9A 5KAMA 1H3EA 3OOYA 5DK4A 1FUYB 1V5FA 2FN9A 3ZU4A 2Q3FA 4BUJA 2UUCB 3DW3X 2PL5A 3TINA 4OBBA 2HLNA 4NU6A 2GXSA 4QBFA 1UR5A 3G2HA 5CW1A 1QTRA 4G0XA 1Z0ZA 4IAOA 4C2AA 4Z49A 1Z0FA 3VJMA 3EXG1 1ONNA 1O6GA 5L40A 2O7NA 4CV0A 1XSEA 4CQNA 3GFVA 1XNRB 5FBKA 1NMZA 3I9LA 1PFKA 1RXCA 2HU8A 4EKEA 1FSPA 4OG2A 1PX2A 1ISPA 3ILYA 4QC2A 4ZXFA 1VXRA 4NBLA 5FPTA 4C01A 4CKCA 1IOLA 3CVJA 5I8WA 5IVDA 3C5CA 1RFLA 4LRXA 2R97A 4IVRA 4MVYA 4DADA 2BJVA 5M7EA 4M1EA 4IS3A 2IHYA 1PSDA 1N2CE 2SBTA 2ZYRA 4HN2A 5KC8A 3PXXA 3NIWA 3PS9A 5K01A 1QH0A 4FX5A 1SEVA 1W88A 2XNDA 2NXWA 3DWGA 4IKPA 4L6IA 3PNYA 1YONA 1EX9A 5KIAA 4MK4A 1DRVA 4RS3A 5G2OA 1DMRA 2GHQA 2RHHA 1QR6A 1RLMA 2BM8A 4JVMA 3LKDA 4LG1A 1ZVKA 4JU9A 1YKSA 1Q3TA 5J47A 4EOGA 1U8TA 4PZDA 4U7TB 3WAJA 2VF5X 3I01M 3L4SO 4I1IA 4X1IA 3MCTA 2EXXA 1C1XA 2Q2WA 5KSZA 1UH5A 1MR3F 1V37A 3G2QA 1U7DA 1Z16A 3FHLA 3KTOA 4GGPA 4O5OA 5FJJA 4QUJA 5T4BA 3W0LB 3VH2A 4EA8A 4ZYUA 2O7RA 3BJRA 4EAQA 1TCVA 4HUQA 2HIHA 2XZTA 2WF5A 4OHOA 4OLAA 1AHHA 3E9DA 3OJXA 4EYKA 1NI3A 4IDAA 5FBLB 2BEWB 2CMKA 4P82A 4IFBA 1JEEA 4CLDA 3BF7A 1QAOA 2XE6A 3N39C 5KJCA 4TSKA 1GLNA 2RGBA 4BRZA 4MW2A 4F8JA 1T91A 2EFGA 1K63A 3D7KA 2AQHA 4JEIA 3SEQA 2V3CC 1KDZA 4M89A 3VSBA 1NBMD 4RQUA 3MELA 3VTKA 3KKQA 5FJIA 1KOGA 3T7EA 4FW9A 1ZRSA 1EP3B 2QIPA 3AWIA 4MYHA 4NEQA 1DS6A 3RGWS 3VZSA 1TVKA 5E6SA 2XH8A 3QY9A 5H70A 5FUBA 1YZGA 3LBIA 1FDRA 3I2GA 3RI3A 3N86A 2V9ZA 1E7SA 4M9SA 3ZNPA 2SHKA 3ZUPA 3AHDA 5HW0A 3RLIA 3FX2A 5D87A 1P0FA 1SC9A 1A9XB 1YS9A 2BH9A 2RHBA 3ND6A 3RHZA 2I1LA 4BE9A 4LSGA 2YWCA 5B58T 2C78A 4MVJH 3TZHA 4DR6B 2WHYA 1U1GA 2GPAA 1JFFB 2QPTA 3ONWA 4MTLA 4TTTS 4YS6A 5LR6A 1B6SA 5E2IA 1KF0A 1DHTA 4UNQA 1CE8B 4LOKA 1V6CA 3FYTA 1KI6B 4K0RA 1UWLA 4PXYA 4CL2A 3E4DA 2JFVA 5THKA 2DLCX 1ZICA 3T06B 3L0ZA 2ZRQA 4HLNA 3UMSA 2CL0X 1CJCA 2WA2A 4WFKA 4BKMA 5HK9A 4TRNA 1PR0A 3UWSA 2PWZA 3KM0A 3F4BA 2DLNA 3LZ6A 3E2MA 1I0ZA 5IBQA 5I7HA 3CRVA 3B3GA 4IGAA 4AG6A 1G3UA 3N87A 1JNXX 3NHWA 3U7RA 3II6X 3V4RA 4X61A 5ALQA 4E5DA 3NTOA 2CFIA 2J0UA 5FEUA 3A4NA 1VSBA 2NU7B 3WXMA 4NBSA 1SQ6A 2OB1A 1H3NA 5NULA 1SWVA 1SU6A 4NBKA 3WLQA 4XPIA 2GETA 5DYIA 2QX8A 1Z2CA 1JDBB 1JR3D 2Q8PA 1KFKB 1G3IA 2KYRA 3EXEA 1NBAA 3FOBA 4L08A 1RYBA 2P0AA 2ZVPX 3CQ9A 4XQGA 4EQ6B 5J2UA 4WKBA 3V7NA 1IJFA 1ZUHA 2H1SA 1KYQA 1RXYA 4G4SP 3IAS1 4C89A 4J3JA 4PZZA 3ZI7A 3Q8KA 4TLBA 1Z62A 1Q91A 4M1SA 4PCVA 5G0SA 4NCBA 4FZ5A 4DR4B 5L3VA 1A82A 3TW4A 3V1NA 4M46A 1DEOA 2FWBA 2ZYHA 3AVXA 2P9HA 5JCXA 3ZJVA 2XOKD 1YBMA 4NYMR 1MX1A 5DOVA 2WUFA 3PIIA 4M0CA 4ZAZA 4EF5A 5LKRA 1ULHA 1JW9B 1Z6QA 2BCGY 4RJJA 5IC5A 4OL9A 1TRHA 2EKDA 4DC1A 4NOKA 5C0OE 3N3BC 3FGOA 3D0OA 4EENA 4C7MA 1K97A 3E3OA 4BASA 1OI7A 3ELYA 3R9WA 1W5FA 1SQ5A 1ZESA 3VR5D 2OOSA 3DTVA 3C3XA 4JR0A 4G8JA 1YBAA 1QIGA 4BGVA 3FZEA 2H0QA 3TZCA 1P7ZA 4DIMA 1HF3A 1JVNA 1APBA 1U9IC 1T29A 2QF7A 1EPUA