3F4KA

Crystal structure of a probable methyltransferase from bacteroides thetaiotaomicron. northeast structural genomics target btr309.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
254
Chain Sequence
NNTSIHDFDFSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of a probable methyltransferase from Bacteroides thetaiotaomicron. Northeast Structural Genomics target BtR309.
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 87
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3f4kA00
3C3PA 1WXWA 4C4AA 3PB3A 4CKBA 1XJ5A 3SSNA 4MWZA 3DTNA 1YFJA 4QDJA 1VIDA 3HCFA 3G2OA 2PKWA 4RVGA 4RTRA 1KP9A 4CTKA 4EKIA 4K6MA 3JWHA 2R6ZA 3I58A 3O7WA 3OZSA 2AOTA 3TR6A 1H1DA 5FULA 3KPJA 3QOXA 4GUAA 5K09A 5EZSA 2PWPA 3PLAE 2XVMA 3BGVA 2FHPA 5CVDA 1KYZA 2H1RA 4YV2A 1FJXA 2ONYA 3LDUA 5DSXA 4XUDA 2EFJA 3TKYA 4HGZA 2ZTHA 2ZSUA 2YQZA 3HP7A 4KVZA 3SXJA 3U81A 2ZBRA 1RJFA 2PWYA 5F2KA 4V0QA 2IH4A 2P35A 3A4TA 4ZTBA 5DPMA 5FADA 2Z6QA 3ORHA 4RTMA 4HG2A 1R00A 1G8AA 3BXOA 3UJAA 4YUVA 3HNRA 3B3FA 5DX0A 2EG5A 3X0DA 1DCTA 5DX1A 1SKMA 4P7JA 4O29A 1JG4A 1SQGA 2PJDA 3A25A 1KIAA 1KPIA 2GPYA 3O31A 2GLUA 4IV0A 4ER7A 1RJEA 5C0OE 3HCCA 2VDUE 4FR0A 3EVZA 2WA2A 1FPQA 2AOTB 1RI4A 4OA5A 4QQKA 5BW5A 4FZVA 2GS9A 3IYLW 5E8JA 3B7PA 5BW4A 5LQNA 3A27A 3BGDA 1FBNA 1P91A 3AY0A 3LHDA 4CWAA 3OPNA 3GXOA 4GC9A 3OU2A 3OCJA 3GRRA 4EKGA 4E2XA 5EPEA 1RI3A 2JHAA 3DOUA 3ELDA 1TPYA 1QAQA 2VDVE 4AZSA 5HIMA 1ZGAA 3CCFA 2JH9A 5K0LA 5CCXA 1WG8A 3UJ9A 4DCMA 3O4FA 4ISCA 5GIPE 2ONZA 3OU6A 3T7RA 4AZWA 3P9IA 1I1NA 5CIYA 1UWVA 2VZ9A 2I6GA 3PT9A 2BH2A 2Z6UA 1P39A 3A7DA 4P7GA 2IFTA 3AXTA 4RTLA 5HEKA 5HIKA 3G8BA 5DXAA 3FYDA 1ORIA 1I9GA 3CGGA 4RVDA 2NXCA 4E2WA 5K0JA 10MHA 5DXJA 1YB2A 2C7OA 5EGSA 3P9NA 3ER8A 2ZWVA 4PIPA 3BKWA 1JQEA 1SUIA 4M7RA 2ZFUA 4RTKA 1JG2A 3H2BA 2G72A 3LECA 3LCCA 2HV9A 5HZMA 1KXZA 3HA5A 3E05A 1R6AA 3HVKA 2CKDA 3I9FA 3R6TA 5EG5A 5DM4A 1XXLA 1NBIA 4HRAA 1BC5A 3ANXA 4C03A 3SVZA 5M5BA 3QOWA 4LWPA 2OBFA 2WK1A 2HWKA 1N2XA 1JQ3A 3P9CA 4F86A 2YVLA 5DTRA 4YMHA 2AN5A 3BT7A 1G60A 1O54A 2Y1XA 4EVIA 2P40A 2ZZKA 2IH5A 2UYQA 2ESRA 3LSTA 1NE2A 3C0KA 4RX1A 5T67A 5BP7A 1MHTA 1IM8A 2PX5A 2P3QA 1RJGA 3CJQA 3EGVA 2AS0A 5FHQA 3UJDA 2PY6A 1X19A 1EIZA 2PX2A 3T0IA 5FCDA 3UA4A 4KW7A 2YUIA 4IWNA 3Q7EA 2EJTA 3M6UA 3KR0A 2AR0A 2OYRA 1EAMA 1T43A 4FSDA 1SUSA 5F2OA 2ZBPA 5EMMA 3KPUA 3P9KA 5P8WA 5CCBA 4ER6A 2A14A 3BWMA 3KQVA 5EC8A 4AZVA 1IY9A 2BR5A 4ER0A 5DM1A 3HA3A 2AZTA 4RTNA 2QRVA 1M0EA 3EVBA 2PX8A 2AVNA 1VLMA 1PJZA 2IGTA 3HCAA 5E9JA 5T64A 4AZTA 1SVUA 3EVEA 4WVLA 3I64A 3EVGA 4E70A 5EHGA 3SM3A 3GRZA 3M6XA 3LCVB 4E2YA 3NWBA 4OQDA 3BUSA 2O0LA 4MIKA 3FYCA 1PRYA 2IIPA 1D2CA 1NV9A 2HNKA 3P71T 5HFJA 3TFWA 1KPGA 4C06A 4QQNA 1AF7A 3PS9A 2YXEA 3SX0A 2AVDA 3K0BA 5FQOA 2H11A 3FTFA 3FTEA 4POOA 2JJQA 4DQ0A 4IV8A 3HM2A 4A6DA 2V74B 3FRIA 5G02A 3DP7A 4R05A 1VQ1A 5E8RA 5DRTA 3BWCA 3DUWA 2G8NA 4RTOA 3NJRA 4C07A 1XDZA 3AWIA 1ZGJA 2C7PA 4ER3A 2R3SA 3JWGA 3LGAA 1JG3A 4B17A 5KQRA 5H02A 2IBTA 4X1OA 4PONA 4QPPA 3CJTA 3EEOA 3HCDA 4GQBA 5EEHA 2IP2A 5LSAA 4FT2A 4RVFA 2NXEA 3BWBA 3REOA 1N7JA 1NT2A 2JHCA 1ZKDA 3S68A 4PYNA 1BHJA 3P8ZA 1WZNA 2Y1WA 2B2CA 3C3YA 5KQSA 3FUTA 3TKAA 1RI1A 2P8JA 4GOMD 5HIIA 4M36A 1BOOA 2NNWB 4HH4A 2FK7A 5ERGB 1KHHA 2CL5A 1P1BA 1YZ3A 4X60A 2KW5A 3UJ6A 3HCEA 7MHTA 1VP3A 5EQJB 5C9ZA 1RI5A 5ICEA 4XCXA 3LKZA 2BZGA 3BWYA 3EGIA 3A26A 3M6VA 5LQCA 5DTMA 1XTPA 2E5WA 3UWPA 3RIEA 2P3OA 2EX4A 2ERCA 3KQWA 2O06A 3KQMA 1XDUA 2YXDA 3VYWA 4UOEA 2JH8A 5LQKA 4IKPA 5DRYA 4DKJA 1TW3A 3CVOA 2ZWAA 3DMHA 5K0NA 3K6RA 4QTUB 4V0RA 3WSTA 1G6Q1 2AOUA 4DM3A 4BLUA 1X1BA 3C6KA 3TQSA 4DF3A 1JG1A 5LR6A 1KYWA 3FRHA 5DLYA 4FSXA 5LQRA 3I5UA 3ERCA 5GINE 2AOVA 4RTPA 4AUKA 5F2NA 2VDWA 5EMKA 3FUVA 1TW2A 4PYLA 1NKVA 1EG2A 3G8AA 4YV1A 3UZUA 3HTXA 3TLJA 5CVVA 2PGXA 4E31A 5ICGA 3Q87B 3EMBA 3OU7A 3FPEA 4FS8A 1KR5A 2ZBQA 3G2PA 1HMYA 3LDFA 4KIFA 2ZIGA 4P7FA 2B78A 3QV2A 4DMGA 2VS1A 3OE5A 1G8SA 2C7QA 3KQYA 2B25A 4OX9Y 2YTZA 1YF3A 4LECA 1VP9A 1L3IA 2OB1A 2P3LA 3DLCA 5EKUA 3HCBA 2Z6AA 2PSSA 5K03A 1ZG3A 5JUWA 5FWAA 1NBHA 3JWJA 1G38A 1G55A 3DXXA 3T7TA 3M33A 1MJFA 4DCGA 4L7VA 1SQFA 3EVFA 3GGDA 3NVKI 4PGGA 2IH2A 2CMHA 1O9HA 1QYRA 4R8SA 2F8LA 5CM2Z 4HTFA 3MCTA 1EQAA 5K0BA 1U2ZA 3G2QA 3MAGA 5DM2A 1AV6A 1M6EX 4CKCA 5CUQA 5E9WA 4XUCA 3UBTA 2ZZMA 1L3BA 2O05A 1B42A 4X63A 4EMSA 3R9XB 1NW5A 2PT6A 2JHPA 5K8VA 3LCUA 3NDIA 1N7IA 2XYQA 3EVAA 3MGGA 3KQOA 3EGEA 2QE6A 5KYGA 2IPXA 3FUWA 4KDCA 4KWCA 4MQ4A 5HILA 1WS6A 3GO4A 2P41A 5E9QA 3TPZA 3P2EA 5E1DA 4F84A 2IDKA 2ZIFA 5EIFA 3PX3A 4KRGA 4H0NA 2NXJA 5GWXA 3THSA 4CKEA 4CTJA 1QZZA 2ADMA 1F38A 1X1AA 1XDSA 3KPWA 3B3JA 4PYQA 1AQIA 5EZQA 4U7PB 3D2LA 1INLA 5K0EA 3NMUF 5CVUA 4BP3A 3VC1A 2ORED 5FUBA 3MTEA 1Y8CA 3CBGA 3KQTA 4X61A 3G7UA 4RV9A 5EKXA 2B3TA 3UJ7A 1R8XA 4GF5A 1VPTA 3A7EA 3HVIA 4LG1A 1WY7A 4FP9A 5CVEA 2FYTA 2I7CA 1DUSA 5DTQA 5E2BA 5FWDA 5LQAA 5K05A 3SSOA 3E7PA 3KQPA 1XCJA 3GRYA 3GNLA 3NWEA 1KPHA 4Y30A 4C05A 4E33A 1NW3A 2BR3A 3BZBA 1VL5A 3P97A 3ME5A 3GU3A 1NV8A 1XVAA 1ZQ9A 3C6MA 4BY9E 5GM2A 2NYUA 5DT2A 1NW8A 3TMAA 5FHRA 4EQZA 1D2HA 3JWIA 1M6YA 3EPPA 5ICCA 4RVHA 3DLIA 3P2KA 5U4XA 3OFKA 4YV0A 2P7IA 2HMYB 3B5IA 3P2IA 3V8VA 4E2ZA 2XBMA 3FTDA 4M38A 5T6BA 4NECA 4ER5A 4R6XA 2PXXA 2UYHA 1JQDA 1L3CA 2AN3A 2OZVA 3G2MA 5ICFA 3DMGA 3KR1A 3VSEA 4BP1A 8MHTA 3GIWA 4RTJA 2QRVB 4PYKA 5EEGA 4C08A 4G56A 4PYOA 4X41A 3DR5A 2BM8A 3BGIA 3FPFA 3KPVA 3TRKA 2GH1A 3LPMA 3KPYA 3OZRA 3KQSA 2UZ4A 3MB5A 2O57A 3E8SA 4PWYA 4GEKA 4OQEA 2G70A 2Q41A 3B89A 5KVAA 3V97A 3OE4A 1HNNA 5GOZA 2K4MA 5LQJA 4QDKA 3TM4A 1ORHA 2ZIEA 3EVCA 4BLVA 5DWQA 4RYLA 3NTVA 2N47A 4CXMA 1ZHFA 2FRXA 2HTEA 2HR1A 4ATNA 1NW6A 4YUYA 3FZGA 3ELUA 1JSZA 4OBXA 2P7HA 2OPBA 3LDGA 2ZCJA 5EMLA 4R6WA 3NVMB 2NXNA 3FTCA 5K01A 3VC2A 3SSMA 1R18A 2AOXA 2PXAA 3MTIA 3OZTA 1WXXA 1YUBA 4PGHA 3HVJA 3UJBA 2OY0A 1NW7A 1VBFA 5EMJA 5FA5A 3DULA 2I62A 3B3GA 3HEMA 4OBWA 3MHTA 3LBFA 3RW9A 4C04A 1AQJA 4HSGA 1BKYA 4GOND 5EIWA 4GC5A 3M6WA 5D1HA 3GDHA 5HIJA 4RTSA 1RI2A 5IH3A 2BR4A 3EVDA 5KS2A 3LL7A 1RJDA 4KIGA 3SMQA 5FQNA 3AXSA 1OR8A 3LKDA 3MERA 5DM0A 3GRUA 1QAOA 2FCAA 2XVAA 1UFKA 5CVJA 3ER9A 4QVKA 2JG3A 5LQUA 1JSXA 2XYRA 2NP7A 3L8DA 4WXHA 2GA9A 3PX2A 4YUWA 4RTQA 5MHTA 2YR0A 2FK8A 1EJ6A 2IDJA 4HC4A 1JTFA 3GJYA 3RODA 4MHTA 5EOVA 3TOSA 3IV6A 1L9KA 5E2AA 4YMGA 3KKZA 2B9EA 3IHTA 4PYMA 2PX4A 5HOQA 2GB4A 3FUUA 1O9GA 2AOWA 3IEIA 3OFJA 4HGYA 4A6EA 4EK9A 2BM9A 3ELYA 3PFGA 2OO3A 1Q0SA 5GM1A 2AOUB 2PLWA 4PYIA 2IBSA 2LD4A 1V39A 2CWWA 3FPHA 4PINA 4RWZA 2OXTA 3UJCA 4GBED 1R74A 2OKCA 3G88A 3KHKA 3FPJA 3R3HA 2DULA 4PCAA 3G5TA 5B1SA 1Z3CA 2I9KA 3DH0A 4U7TB 5K0CA 4BLWA 1F3LA 2PBFA 4M37A 3PTAA 4LWOA 3T7SA 4E30A 4FT4A 2G1PA 2YXLA 2EJUA 3R0QA 2FPOA 2UYOA 3EEYA 1FP2A 3PVCA 4QTTB 2QYOA 3KU1A 3DMFA 2QM3A 5E1BA 3SGLA 3PFHA 3KR2A 3LX6A 2VP3A 3GRVA 1UIRA 2AN4A 2C7RA 3CJRA 2PV0A 1IXKA 3KQQA 4MTLA 3CKKA 4PCLA 4JXJA 5K0GA 5FA8A 1JR4A 5BXYA 3LBYA 3MCZA 3FPGA 1I4WA 3ID6C 2CMGA 4XUEA 5DX8A 2ZW9A 3G5LA 3SR4A 2QY6A 1SG9A 4HTFB 2ZLBA 5K0FA 3M70A 1L1EA 4P58A 5DSTA 3DXYA 4YUXA 1X1DA 1JTEA 2V7EA 3GWZA 2G71A 4Y2HA 5E1OA 1XCLA 4PNEA 4DA4A 1DL5A 3FUXA 2DPMA 1R8YA 3BKXA 4R8RA 3NW9A 3KR9A 2XYVA 2GAFA 3DXZA 2P1DA 3E23A 4OA8A 4YUZA 4QPNA 3ELWA 5EVJA 5IKMA 1D2GA 3G89A 3CC8A 3THRA 2ZVJA 3M4XA 5GP1A 3UFBA 5GIOE 4F85A 3I53A 3AJDA 4RSRA 2ZZNA 4P7KA 4E32A 4QVGA 2NP6A 4PYJA 4PIMA 2H00A 1YFLA 2ZULA 9MHTA 5D1NA 3HA7A 4Z2YA 1P1CA 2PVCA 2O07A 3MQ2A 3UJ8A 4KDRA 3GCZA 4GOOD 5CD1A 1EJ0A 3HVHA 2PXCA 3NDJA 4DZRA 2UYCA 4AX8A 4FGZA 2OB2A 1Q0TA 1VE3A 5EHIA 5FTWA 2YX1A 3TM5A 3EMDA 5C1IA 3F4KA 2WA1A 1QANA 3R24A 1QAMA 5E1MA 1FP1D 4GOLD 1X1CA 3UA3A 1YZHA 5JR3A 2PT9A
chains in the Genus database with same CATH superfamily
1D4ZA 1EWVA 2ZR7A 3C3PA 1WXWA 3Q0IA 4BE4A 1CB7A 4PRLA 4D96A 1P5JA 3ORSA 5DNUA 3IDZA 2X22A 2J6BA 4KFUA 4KN5A 1M1NA 3N2GA 1NQWA 2R6ZA 4HGPA 3L8HA 1CR1A 4ZV4A 1N5IA 3BICA 1XDGA 4G25A 2R8RA 3F67A 3K1ZA 5I9SA 3L9XA 3ZG6A 4KMSA 5DSXA 3A14A 4HDOB 3HP4A 3PFNA 4YAJA 3RARA 3T9AA 4Z5XA 1XTBA 3LT2A 3NXKA 4HLUA 4NYIR 1ULHA 2GRUA 3RJMA 1A96A 4AL4A 4MWGA 4FEYA 2YINC 4B8YA 4KQ2A 5IDQA 1NDQA 3S1AA 1DLIA 5F1PA 1R00A 5BNTA 3T9FA 5FPTA 1G6KA 3OOJA 5BMOA 1RTKA 2R97A 2DBZA 3D1JA 1JR3A 3FHLA 4HWTA 4YJ2A 4FFWA 1DPFA 4Q03A 3AYXB 3GRAA 4ESOA 1DCTA 2BUCA 2GFHA 3AR2A 4O29A 2GR9A 2GPYA 4YDHB 4C76A 3EISA 5KSYA 2L69A 3ZDZB 1EIWA 3F6EX 3EDMA 4MQBA 3ZHCA 4C6SA 3FR8A 4IW3B 4L6IA 5C34B 4NBKA 1M73E 3WV4A 5ENZA 4N01A 2FN7A 3BGDA 4HB0A 1GGHA 4ENTA 1P91A 3GZNB 4NONA 4RZXA 4HRVA 1D4AA 2QNRA 3JTEA 1T2VA 2Q2QA 1E5DA 3BG5A 1EUDB 1G9TA 1NOKA 1X8JA 3PWZA 5K99A 4UNNA 2VNHA 3TIXB 5JMWA 4Q7MB 1WG8A 2HF7A 1GD1O 3O4FA 2QJTA 4G8JA 3RF7A 5CNJA 3B48A 4RF5A 4AZ3B 2I2FA 2RAUA 4QTXA 2HBYA 3G17A 2A5YB 3QU5A 2REBA 2BH2A 4DG5A 2WNIA 2FJ0A 4P7GA 1CDOA 1P81A 1KU0A 4MS4B 3WRWA 3G8BA 4RKRA 5HIKA 4EYOA 1T3GA 4QSHA 4FD3A 3VVBA 1VPLA 2PUDA 1REQA 3BE4A 2C7OA 5EGSA 1EGVB 4M0PA 1MH1A 2BC9A 2ZJZA 4X8LA 3BKWA 4M8KA 1SUIA 2HEGA 1UKVY 2C8KA 5F7ZA 1J09A 1JG2A 4RAQA 4RTKA 2OV6A 3MHTA 4IDFA 2G72A 2DBVO 1ZH0A 5CLFA 3CN7A 2D0PB 4F1WA 1QGOA 5NULA 2G63A 1RYZA 1GPBA 2ODPA 1KK1A 5LMCA 2B98A 4JNKA 3CPHA 4JC8A 1RRVA 4HVTA 4RA9A 1R0SA 4OQXA 4DADA 1FIUA 2WK1A 2GXAA 4JQYA 1HDYA 3RRNA 2BFAA 2YFHA 1E58A 1G60A 3EQ6A 3OCXA 3JQBC 4D98A 1RYFA 4GGMX 3LLMA 2P40A 1WMDA 2CJPA 4HMQA 3ZBQA 5ALXA 1M5RA 4C1NA 3GPCA 3QHQA 4IQGA 1QR2A 1P7PA 4HQ0A 4YBRA 2JK0A 5A0TA 1REQB 2HHCA 1CP2A 2W90A 2J3IA 4K9PA 3QPWA 1X19A 4DNFA 3T0IA 3CPSA 2JJMA 2B6HA 1ZIPA 3JAMA 4DZTA 2AR0A 2FPLA 2OP1A 2O7VA 1VPWA 1N8KA 3E22A 3MWYW 4OG2A 4PZPA 2UKDA 2HU7A 4RHTA 1U0BB 3I45A 3F6BX 2FLWA 1T5TA 3CLHA 4JMPA 5EIAA 3VO9A 5JH7B 1CEEA 1DXYA 2M2IA 3CT4A 2B8JA 4TLCA 4MLCA 2ZT5A 2O8EA 4JGIA 1VSUA 4KXWA 4Q66C 3RVSA 4CL3A 4MULA 1VE6A 2OFWA 3AOGA 4DLXA 4WBNF 3WWOA 2C03A 4PLFA 1A97A 1CYDA 1WQ1R 1XVVA 3HDJA 4I9FA 4E70A 2VHWA 2C8JA 2C4VA 3P2YA 4RS4A 4E2YA 5CFOA 1EDOA 4OHBA 1USKA 1W8DA 3OAAA 4Z49A 1ZXLA 4N18A 1VRCA 2YXBA 2XQGA 2I78A 1DOHA 2IIPA 3GGPA 1D2CA 1KGSA 1NP7A 2HNKA 3UC5A 3T3HA 4WXYB 4CQNA 4CLHA 2VYQA 3KJNA 3I5YA 2IOQA 2BZ1A 1PZEA 1IUPA 4QGSA 2YHBA 4G1MB 4R2IA 2JJQA 3DS8A 1O57A 2X1VA 3D7LA 3E22B 4IV8A 4GYJA 1OBCA 2ZDQA 1DBVO 3ZIDA 4QG7A 1Y5NA 1DTWA 1QFYA 3AC0A 4M54A 4RSGA 1DQRA 2BGJA 4ZCPA 4BO9A 1AURA 4NMWA 1URPA 2HCFA 5BSRA 3K8OE 3SHOA 2XTJA 2R3SA 3VJKA 1U1IA 4Z4EA 4RSHA 2A9KA 1CZLA 7ADHA 3EAQA 4FNAA 4M8LA 4LXXA 3L0CA 5CYOA 4YMLA 1CZOA 1TT5A 2ZU6A 3ORQA 2XCLA 2QMYA 3A31A 5E7MA 4HXFB 1LK0A 2BTQA 3SFZA 3WBFA 3ZDCA 4EPVA 3ESDA 1BHJA 2J7PD 3AX6A 1C9JA 4ECAA 1JWLA 3C3YA 1IJFA 2IYQA 2UVPA 4KQJA 4F7WA 5IMBA 2O3UA 5KOJA 1KAOA 2NNWB 4JKOA 3UT5B 3PNMA 4DIOA 3GZTB 1A9SA 4KVGA 4UEKA 3ZX5A 5AVVA 4RXMA 2BFOA 1JSLA 2X14A 4JVLA 4L51A 4GS5A 4QNNA 1ECCA 1HWYA 1NMEA 4X60A 4XB2A 5KDLA 4JR1A 2VDNB 4KMMA 5C9ZA 1RI5A 1FMTA 3ESXA 5IG2A 4L07A 4MA5A 3ZD8A 1ENPA 4MTCA 5CXUA 4P22A 3EGIA 5IS2A 3A26A 4AJLA 2W22A 3E4DA 4Z3DA 3WSWA 2CHEA 3TLYA 1WMSA 2WAAA 5EUQB 2Q3HA 2QTBA 2YZMA 1U0TA 5EFOA 1YL7A 3CVOA 1WSBA 1KDVA 5DLQC 1TT5B 3P9XA 3UW1A 4QZVA 3QPAA 4JUBA 4ZIRB 1UUFA 3MWGA 3PWKA 2V59A 1L4LA 3FRHA 5DLYA 5JEDA 1W36C 3RC8A 1PUIA 1YE3A 2SKDA 4IIBA 4D9BA 1OX6A 1T3TA 1FMCA 1WU7A 2GJ9A 3E0QA 4U7WA 4FINA 4EG5A 1C4KA 2H52A 3F71A 2I4RA 1OTYA 4JBXA 4OIMA 3TNLA 2J87A 1NKVA 2WWFA 4OP2A 1PL6A 4I0WB 1R4MA 4Q6BA 3H1PA 2EC5A 4OHWA 1XL1A 1JR2A 3NHMA 1VSQA 5E95A 4FFOA 2JI7A 3DLCA 1V3QE 3MVEA 4DB4A 3DEJA 1IZ7A 1X1TA 1R5NA 4BFVA 2D6FA 4NYJR 3R7WB 1JDTA 1SU8A 3QFTA 5IBPA 4IQ0A 1MIOB 2XCQA 4B3XA 4NP6A 3L6RA 2MCFA 4ZKEA 2DFVA 4OQFA 1LC0A 3FIJA 2PMDA 4R8SA 1EWKA 1G6OA 3WJ1A 1GGFA 5K0BA 4E13A 2N3ZA 4EGJA 4XIFA 3T9BA 3JZMA 1J97A 2QZ4A 1M5TA 3MUNA 4NZMA 4O5AA 4AK9A 5L4NA 1T3ZA 2GN4A 2GHTA 4EIWA 2QL5A 3I9OA 3TSOA 2IDMA 4CQMB 3BX1A 4HLQB 1AS0A 3BORA 1E3WB 4AM8A 1R4MB 2NUPA 4XDYA 2OQVA 3TLGB 3P96A 5KYGA 3DW3X 1T4GA 1IU9A 5B3KA 2V6GA 3IUMA 3VJRA 1X14A 3BCRA 3TD6A 5JXWA 4JU8A 1G66A 3D3EA 3CZCA 5E4JA 5KWJA 2FWAA 2QMUA 3S1SA 1P4JA 1M34B 2QBYB 2NU6A 5EHNA 2HFJA 1XJQA 4UUMA 3E9YA 2VPZA 2DFKB 4URYR 3BD7A 1TYDE 3UQYS 4DV5B 3MTEA 4DMMA 1ZMTA 2JIRA 2C94A 3IQIX 3PXDA 4P98A 5G0VA 3VSDA 1ZZGA 3N0VA 2RMKA 2ZIWB 3E58A 2J3QA 2YRXA 1GA4A 1TCBA 3X1XA 1G7TA 1RBYA 3PIIA 4R1UA 5C3MA 4DYVA 3Q1LA 5JZ9A 4P4LA 1W5BA 4B5LA 1E3LA 2O2XA 2H07A 4X24A 4LYGA 4ALNA 3VR4H 3SSOA 4OSPA 3B38A 2QLTA 4MR7A 3MBIA 4X1YA 5AOCA 2BR3A 2QMOA 3P9YA 1T1EA 1VL5A 3UW3A 3WGZA 1HDGO 1WUJS 3BB3A 4P4TA 2ZS8A 4B6JA 2E5FA 2F7SA 2H1VA 1VCIA 3D7MA 5FHRA 4FKMA 3D6UA 4DC0A 2JIOA 3OFKA 2PU5A 5K3FA 1JFRA 3FFAA 1OFTA 2EEPA 3RFXA 3CWCA 3IIKA 3MXTA 4RNDB 4WL0A 3V8VA 2MU1A 5LXTB 1QP0A 2JI4A 4IDQA 4BKOA 1EQUA 1KVQA 1NF8A 1W4AA 2FG5A 4IEIA 3JQEA 4M55A 3FH0A 4R6XA 5CVTA 3TUJC 4G0PA 1GTMA 2OAGA 3C48A 3TTUA 1C30A 2NUAA 2W2QA 1ZW6A 3PDCA 4EUSA 5IHXA 3CVXA 4CN8A 3DF7A 4OFZA 4CLRA 1JWBB 5EJ6A 1JKIA 3R7FA 1XZEA 3LFTA 4AG3A 4DQXA 3TRKA 4AFNA 2Y1LA 1N8NA 3IVXA 1TEHA 3C3CA 3LUBA 2CF6A 2AXEA 4K6KA 4NCHA 3WL4A 1Z0IA 4ALLA 3WDKA 1TA0A 2ZIUB 1W85A 2CDBA 2Z1NA 3DBLB 3VV3A 3DCJA 4AMZA 4MQLA 3L1IA 2YHSA 3B89A 5LA6A 3IGFA 4PZDA 2GCIA 3V97A 2P65A 3DFFA 3K2QA 2MSCB 1I6MA 3WLMA 1FDOA 1K8ZB 1WZCA 1UQRA 2H5LA 3ZDBA 2HMSA 1ORHA 2R84A 5D3QA 5BV8A 3VHXA 1JIVA 3RYIA 1P9NA 1GGKA 3H3JA 2IXGA 4YEDA 1PBNA 1U7WA 3BE8A 3FPSA 4XE5A 2HR1A 3GELA 1YCDA 4DR6B 2I1WA 3N6RA 3LDGA 2WAOA 1IQPA 2Q8QA 3I3SR 4M22A 4FFDA 4RK5A 4WGGA 5K01A 5MN6A 3TQTA 4A0FA 2ZJFA 4CLRB 2QTNA 3CCBA 3QLUC 2YJGA 1WXXA 4IJWA 5LD2B 4CLOB 1QSGA 2WJZB 3JYNA 5JS8A 1B00A 2RG1A 4F3RA 3HEMA 3B3GA 1AKUA 3H1EA 1PR3A 3AVXA 1ZK3A 3DYIA 5GGXA 3O8NA 2PYZA 4ZDWA 1CSEE 1JRLA 1NHWA 1PGOA 2RK3A 4FI3F 3WGGA 1U3UA 1NF9A 5KS2A 1XQ1A 5FQNA 4LYHA 1Q3TA 4BWVA 1CUJA 3ZWDA 1XNHA 3VHXB 1FFXA 5CVJA 5HM8A 3JR7A 1N6PA 3IXLA 2NIPA 3INTA 3FPAA 2LDXA 1ID1A 4DMFA 1GGEA 4KO8A 3RYHA 1FXSA 3V1LA 1I24A 3HWSA 1LS6A 1F8GA 4OYYA 1A76A 1EVJA 1BG6A 2J3EA 3A28A 1VJGA 4M1WA 2YJNA 4QEKA 3PPXA 3TLCA 5IK2D 1DEOA 2BEVB 1L4NA 4HWPA 1U7DA 3U7HB 1EK1A 4IZOA 3R75A 3ZVKA 2X3YA 1VRVA 1RHJA 3OFJA 4IJUA 3RS8A 2FWPA 2R0QC 4BB5A 3BBLA 3JZAA 3W3AH 4HI0E 4IHKA 4F9EA 2YWFA 2IBSA 1P61B 2W98A 3KD3A 2W6PA 4L16A 1L5KA 1GPLA 1NLMA 1WKBA 2RIRA 3GJSA 3NFYA 4B6EA 5BWLA 2CHVA 4C20A 4G5OA 4FZJA 1P5FA 4RF4A 4NBRA 1LVUA 2I9KA 1H0KA 1BH6A 2VDWB 1I3MA 3E53A 5J2TA 2GEFA 4R7ZA 3T41A 1F3LA 4BLWA 3JATA 4H7FA 4HNGA 3M3DA 1WTCA 2BEWA 3O94A 4WSOA 3U09A 3VPCA 3WFZA 4BOYA 3QEAZ 4KXYA 1C3LA 1VDMA 2QYOA 1PYOA 5FNVA 3SGLA 1F8XA 4AECA 4YR7A 5JROA 3S5JA 4RZIA 3RAFC 1ZEMA 1M8GA 1E6MA 1F60A 1UK9A 3HHEA 1IOVA 1MKYA 1QG0A 1KFCB 2PV0A 3HKBA 2I34A 2HFKA 4PLPA 4WOCA 2ODQA 5A4DA 4AXBA 2RHDA 4HQNA 5L40A 2G0NA 1OIXA 1YJ5A 2X13A 1XXHB 4QYMA 3ESZA 1NX9A 1BX1A 3F5MA 2GPNA 3AF5A 1XRSB 4KAFA 1YNOA 3HY4A 4M1QA 3UO8B 3RYFB 3M83A 3W0LB 2D5LA 3LHKA 3INGA 5FX2A 5LZ2A 5J2TB 2L42A 5DTQA 2W83A 2XNDD 4TTRA 3LZDA 3P27A 1L8OA 3W1WA 4S04A 3ZNPA 3GT4A 1KETA 4GKJB 4E5SA 1LLFA 2F59A 3ELWA 2QIOA 4HY3A 4JA0A 4YN3A 1V9SA 5FNVB 1J5PA 4O6VA 1LX7A 4DRXA 1J8DA 1AHPA 2BP7B 4A23A 4F96A 4Z4CA 1IHYA 3HKBB 3VR5H 4PW0A 5BMVA 1WUYA 1P7ZA 3WKDA 3UGKA 4HX5A 4DAOA 2V0NA 1SCJA 4D6XA 3W7VA 4KDRA 1MRNA 5AIAA 1EJ0A 3GMSA 1BS1A 3O9MA 4HB3A 2CCJA 4DB2A 1MMFB 2RE8A 1P7CA 1C9YA 4WDQA 1VE3A 1BHQ1 5FTWA 4D3ZA 1Z6XA 3ENWA 3CF6R 3P2JA 2QX8A 1IY8A 2WA1A 1B0UA 1X7GA 1Z74A 2R87A 1RC1A 1QG4A 1QAMA 2VVTA 3EBLA 2FMFA 4ZI3A 2OEPA 5KZMB 1XROA 3Q40A 4ZVSA 2HJGA 1JL3A 2DWCA 2R1VA 2QYTA 1JW9B 4G8CA 4QHTA 4QASA 2HKIA 1M2VB 1NLZA 3GA5A 5AESA 4JBHA 3TLZA 4CKBA 5DW0A 1ACLA 3ROGA 2Q3LA 2O2DA 4DIMA 4KXLA 1Z4MA 4JXKA 2OAP1 1DAGA 3RKUA 2IH2A 1FTQA 1NSYA 2WICA 2Q9CA 3LP8A 4GQIA 4EFKA 3Q8WA 3OMWA 1IBKB 3NOVA 1X9IA 4U2GA 1T36B 2WY2D 3T5AA 3Q3CA 3E9EA 5JXGA 3TTTA 4BQIA 2QW8A 1P1KA 5IEBA 1E7WA 4MS1A 4WQMA 1P8AA 2X5KO 1MXHA 2ZRMA 2XKAA 1PJQA 3OZXA 5CB8A 1ULBA 4S1TA 3GFPA 1DJNA 4Z6KA 2W00A 1DSSG 1HTBA 2L19A 3MBKA 1AKYA 1NP6A 1P77A 2GDZA 2H2HA 2YJ3A 5DISB 2D5IA 3NONA 5BSTA 3A4TA 4EY5A 1XYGA 2BGLA 1F2UB 2XXBA 1CYEA 3ORHA 2OCIA 4G5RA 3MUEA 3MC1A 3K94A 3R0IA 2R1VB 4KQGA 1NBAA 4TKVA 5B55A 1CJKC 5JD4A 1H6AA 1O08A 4B75A 3H5OA 3GPLA 5DX1A 4P7JA 2OFPA 1X1QA 1PR9A 1RKVA 1TFRA 3A0UA 3HXKA 3QZUA 4Y1EA 2I80A 2RI1A 3HCNA 1M2OA 1RXSA 5A4IS 1YD7A 4HQOA 3L7IA 1FSFA 2Y8EA 4JB8A 4MGIR 2COUA 1NW4A 1L7RA 2KYRA 3H8VA 2QG9A 4H7JA 3DMTC 1EXMA 2AQKA 2HM7A 4N49A 4R2XA 4UFOA 1BMDA 1KQ3A 5J2UA 4OHOA 3IVMA 4JLUA 3IVCA 1WUIS 4QRDA 4E4TA 3WE7A 2X0KA 5DBEX 1WKCA 4D56A 3DTVD 2W2NA 4V0OA 2AMFA 1RI3A 4HHEA 5IC6A 3BTVA 5E4YA 4O08A 4ZAYA 4ZI7B 2PZAA 2PMCA 2SECE 4PM4A 3AG6A 4CV2A 2VOJA 3QYFA 4QXQA 2HDHA 1SA0A 4V2UA 5TF0A 3D3JA 4DCTA 4GRDA 1NN5A 3UJ9A 2VDQB 3KXKA 4MVWA 1T5SA 5T4HA 5IP5A 1I1NA 4O0MA 5EIOA 1OJLA 2ZI9A 3PTLA 4A7PA 2E5LB 3KJFA 4GL4A 3G2IA 3BWXA 4QREA 4JU9A 1M6VA 5JZBA 3TF5A 1HNXB 5AKLA 4OHZA 3ZGNA 1BROA 4ARZA 4DV2B 1CIVA 2QZSA 2COKA 1YMVA 3H19A 4L8GA 2OK7A 3PR1A 4RVDA 1EWRA 4R7TA 2J85A 1YB2A 3C15C 2CFSA 3EIOA 3FRJA 3Q41A 4C21A 1BMFD 3LLVA 4AN4A 3N58A 2QTTA 3SZRA 4UEJA 1T4CA 4OLHA 2W4QA 4QPDA 1AO3A 3H9BA 4FE7A 2HSGA 3SN6A 3ZQ6A 2PGIA 3QY9A 2QXUA 4B09A 1X8KA 4AWBA 5FOQA 4KCGA 4CRWB 5HZMA 2YWDA 3RVQA 2J0QA 5EPUA 1R6AA 3HVKA 4BPRA 2DLCX 3MJDA 4F3TA 1QGUB 5CGQB 4MI1A 2IHJA 4ENVA 1QRDA 4TKLA 3U6KA 4HRAA 4ZGGA 3BVPA 3B1FA 1DG9A 2VEOA 3B2EA 4OHRA 2FZ4A 1XKXA 4NDZA 4RZUA 1TVEA 5KNBH 4MJ7A 2CXNA 2IZ1A 1CRPA 1NUAA 1IHDA 1P0QA 3OJLA 2EW8A 2Y1XA 2XYGA 3FTQA 2FW1A 4ARBA 3H9GA 5CA0A 3EW7A 4D9KA 4EVIA 5G53C 4UXHA 3UWOA 5KX5A 2CSXA 4KACA 4ARZB 4CIYA 4V39A 1US8B 2FWJA 4RIHA 2Z3ZA 4MVJG 1BHSA 3SC2B 1AHNA 2P0EA 1BU5A 2ZYIA 2O2JA 5C4MA 3WKCA 2WYOA 1T4CB 1Q0ZA 4NARA 1LPAB 4DNXA 4J0IA 4Y1GA 4ND5A 5CW1A 1GPYA 4G4GA 5C53B 1SXQA 4O4HF 3EWIA 3S29A 3ABRB 4AKEA 4YDRA 2Y9PB 3AQIA 2FN9A 3KBOA 2YBDA 3KPUA 3DQPA 3P9KA 3KQVA 4NK4A 4B84A 1PV4A 3TDKA 1JN0A 3L1HA 1SUDA 1QZUA 2GQ0A 4DUGD 3EVBA 2OAQ1 1OLSB 3GL9A 4P3NA 5DGHA 3BE6A 1E7QA 2BFFA 4AYWA 3OI7A 4AMUA 1BGXT 3PA6A 5TMDA 3PBKA 1AD2A 4Z8XA 5EXPA 3VYUB 5KX5B 2DE0X 3CR7A 4LAFA 2JGIA 4G84A 1CRZA 1U0HC 2H1IA 3AY3A 4LE0A 4XD7A 3W34A 1FA9A 5MGNA 1A7AA 2EHJA 4Q3OA 4PTLA 5HFJA 1IH8A 1YVEI 5D7NA 3CXRA 4EENA 1VKJA 3JQDA 3LLUA 3NALA 1IRXA 1Q74A 1QR6A 3COPA 3N7AA 4OCZA 4E46A 3BHIA 3ED1A 3HYTA 1M8KA 1GZUA 3IO5A 2FPGB 4LBWA 3PHCA 3ZGLA 4CFZA 5A5EA 4YRBA 1UMKA 5D2CA 4NG5A 2XNKA 1ZPDA 5FUWA 4EELA 5TQ0B 3SEQA 4GOJA 1JHMA 3IMFA 4NR0A 1ZGJA 2Q1WA 4OBEA 4UHCA 1IN5A 3Q8MA 3ZD6A 1U1DA 5JO0A 5BW8A 3A9CA 1EU1A 4GH5A 1JR6A 2FEWB 3AUKA 3MMZA 3PLRA 1RPJA 2EFHB 3I6QA 2Q3DA 4JOCA 2A2ZA 3FTPA 4NE9A 3U39A 3VR2D 5JSZA 4UDYX 5FUQA 3WHIA 3GGOA 1ZHHA 1J33A 3L6EA 1RYHA 1M1YA 2H4WA 1W0JD 2GD0A 2DR3A 2CLMB 2PZGA 3QUSA 3KOUA 4R9RA 1L7NA 1QO9A 2Z4SA 4KI0A 5ERGB 4PAWA 1U81A 1CJBA 1LZKA 3MT7A 1EKXA 5ED0A 4E7OA 4Z4QA 1NULA 1EX7A 4XYGA 2JFOA 2DBQA 5JAMA 7MHTA 1G5HA 1R0ZA 2GPJA 3BGSA 5EQJB 4CKBB 3BK2A 3HBJA 3VMFA 4JUDX 4MIEA 3BWYA 2E2WA 3M6VA 4HYYA 4QODA 5HRAA 3U31A 4URXR 2RHCA 2E37A 1JVBA 2P3OA 2J0UA 4JWKA 4MLZA 3AF3A 2JPDA 5SYNA 2OO7A 1NMZA 2VAXA 4BV9A 1TT7A 3JQCA 4DSUA 1ZD3A 4BVFA 1JZSA 1A0OA 4Z2AA 3IPAA 4OH7A 2NZ8A 1OUMA 3PHHA 4M7WA 1MV8A 4V0RA 3SKXA 1FNSA 1HT1E 1WPRA 3WZMA 1KYWA 2ZJ8A 2QS9A 3V8NA 4DBZA 3WV5A 3UMYA 1Q7BA 2C61A 4EITA 1LLCA 2DPGA 2XVZA 1M1YB 2MIIA 5AM0A 2XB8A 2OHHA 3GEGA 1BQ3A 1YULA 3GJ6A 4QUKA 1L4EA 4PXYA 5F33A 3V1NA 4CEJB 5CVVA 1GLGA 3UNXA 2OZLB 4UCQA 1LUAA 3TW8B 2FFJA 3HRIA 1E62A 3CNOA 3NASA 421PA 2HIMA 2PS0A 3FYUA 3QE2A 3DGFC 1FQJA 4KMRA 2O6LA 2VBFA 2WWXA 1Y4SA 3DOOA 1G63A 2IE8A 4JX9A 4JASB 1ZG3A 2XAAA 3KUDA 4RAOA 3EEBA 1WB4A 2FOXA 1YK1A 5KJCA 3K0SA 5ITSA 3CIFA 3CSUA 1JZQA 1Z5WA 2X58A 4MWSA 5I8PA 1AZTA 1LNSA 1CIPA 1JIUA 3ACBA 4MW5A 1TQDA 3CMCO 4N5DA 1VJTA 1FXWA 1XN1A 4V3CA 2XT9A 1MU0A 4MV7A 1UBCA 4CG1A 3T15A 1DADA 2BGNA 1CDZA 5JDIA 3SFVA 2Q27A 4JI8B 3MGGA 5I9BA 3T1NA 1FYEA 4LXQA 4TUYB 1BEUB 2RSLA 3HXMA 2J9ZB 3SX4A 3QGMA 4W5JA 4UU1A 3W5CA 1NRXA 3A0RB 4HAYA 1C1XB 5AKHA 5IAJA 1ZN7A 3GO4A 4UMVA 4ED9A 1E79D 2V3VA 1I2ZA 1E59A 3P2EA 4TLAA 2XD4A 4JC4A 4CEHA 3IEXA 3KEFA 5TVGA 3ILYA 2PS1A 4EM6A 4H0NA 2ALJA 2ZP1A 3KALA 3THSA 2EP8A 5DB4A 4HAIA 4J0DA 2QEQA 2WHPB 4NDAA 1W2HA 2PGLA 3W79A 3KQLA 4EA6A 4TWIA 3SICE 1WP9A 2Z5FA 1HSZA 4RY8A 4X61A 3G7UA 4ZOBA 1NNEA 4N40A 5CYPA 3KCNA 1VPTA 4J16C 2GOYA 4XB6B 1N4AA 1XTRA 5CHEA 1WY7A 4ID3A 2I0FA 3OEWA 4J1SA 4Y2TA 3WRYC 1WXHA 1D07A 1Z68A 1EWQA 4M60A 1HKUA 3R44A 4OJKA 2JLYA 1RJ9B 1U1CA 2BSAA 1SHZA 2I3AA 3H5IA 2ZSBA 3C6MA 3O3CA 4DBVO 1KC1A 1ABBA 3FOCA 3ZY4A 3AZPA 3JWIA 4IS3A 1O97C 3EXG2 3GV0A 1GDTA 3VC7A 3OCZA 3CWZA 5E6SA 2XLCA 3RNOA 3DMRA 4GE0A 4IMJB 4WA7A 3HABA 3A1WA 3N70A 1PK9A 1ZL2A 2NU9A 5JO9A 3SIWA 1O3YA 3AGPA 4JZYA 5E3JA 3TTYA 4OJNA 1G3RA 3TRHA 3V9PA 4IV5A 1IEQA 3F7OA 4Q4JA 5JZOA 3AIMA 3S2YA 3QFRA 2VHYA 2XGMA 3IT0A 5FR2A 2IU4A 2BM8A 4CEIA 2EW2A 1SJ9A 4A8JA 3KPYA 3BJMA 1NQXA 5BSGA 2CE2X 4D9GA 2BJWA 2XZTA 1ST3A 1UM9A 4Y2UA 2VI5A 1RP7A 4XIYA 3ZV3A 1PNVA 3OE4A 3WAKA 1C9KA 3RBAA 4D9HA 8ADHA 3EPKA 4C0XA 1ZOSA 5A71A 3CV3A 2HWUA 2PDAA 5E7QA 4D6YA 2C88A 2ICAA 1A7UA 2IJGX 2XDQA 4FGSA 1AB5A 1SIUA 3U3OA 3WK9A 4ETMA 5I8WA 1VCHA 5ALEA 1Z6YA 2C5HA 5AHWA 4ISBA 1DJPA 2NU9B 2DWPA 2OAEA 2HUPA 1M0SA 3FCEA 4TVOA 5KYVA 3L8MA 1V43A 4FDAA 1O6FA 3SC4A 3FPKA 2N9UA 3IP3A 1QLHA 1YZFA 1GNPA 3PUWA 2H1LA 4YRLA 4ZEMA 5JTTA 2AMVA 4ZYTA 5JXJA 4M7OA 4AXXA 3GFFA 2PCJA 3EOBI 4CF4A 1JSRA 4HSGA 1JLMA 3FCOA 1KI4A 4FXOA 4P38A 5FB3A 3IR7A 3PIRA 2HYIC 1IE3A 1A4RA 3A6KA 1Y6RA 2W2XA 3DKRA 4IEFB 2WU0A 1FTWA 4BFUA 4CZ2A 1Q21A 1WLSA 4B3FX 1QBKC 1EK2A 3S4YA 2DRIA 4QUAA 3S99A 3F73A 3W06A 2R1UA 4QECA 3UG7A 1U2DA 4M53A 1JSXA 2QZPA 1G8KA 1W0KA 4GVLA 3HHPA 1Q0QA 3KWJA 4IIVA 4L5YA 5KSPA 4YUWA 1XD8A 1ZK1A 1Q22A 4JJGA 2VNSA 1HA3A 4Q7EA 1PAUA 3UK0A 3DV0B 2CV1A 4YMGA 2WUWE 2QRQA 3C7CB 4WASA 3SKVA 4N48A 1JQ5A 2R86A 4P3XA 1MJGA 2JIQA 2MOKA 4G01B 3DLBA 1GVNB 2OO3A 2XGSA 2FMUA 3CS3A 1QB8A 4RD3A 3U19A 1TZCA 5EIHA 3BH6A 3RSQA 3I9KA 4R8VA 3CSDA 1YOVB 4RWZA 1B1CA 5ALSA 4ZMSA 2KLHA 3CY6A 9GPBA 1SCNE 2UUPA 1U0GA 2IPMA 4HNAB 2YNMD 3SXUA 4EGFA 2PUAA 4Q9JA 4NCXA 3S8MA 1AT1A 5DLPA 3PTAA 2PZ8A 2RCYA 3KZ1E 1SK9A 1PV2A 3ND9A 4QOJA 4JENA 4LCEA 1VIYA 1YACA 5D86A 3GLFE 5HR5A 3RSFA 3UB2A 1TRKA 3A1UA 3D4OA 3KOYA 5CLHA 4OLAA 2WQ6A 3K4QA 1DRUA 1YASA 2CB0A 3KETA 4HDMA 3FBWA 4CR7A 2J32A 5M29A 1JHAA 3TSCA 4CM1A 2O2GA 4RSMA 1FTNA 4YT2A 1UJBA 2ECQA 3FXAA 2WV9A 3CH7A 3W5VA 4ZOQI 1AHHA 1T1JA 2V58A 3LXXA 3ZY6A 2TYSB 4DCNA 1YZVA 1IN4A 4LVNA 5GJVC 3S2FA 1Q3KA 4BNKA 1H9CA 4WCFA 1LPBB 1ESZA 3I1IA 5GONB 4K0KB 1DJMA 1H5UA 3VFDA 3VR6H 2ZLBA 1JHQA 1LBEA 1GEEA 1G8JA 1NKSA 3EK2A 1H65A 3DXYA 3EXAA 3SXUB 1E20A 1NLFA 2VHCA 3ODGA 1D2MA 3AESB 2DUJA 3MD0A 2FSVA 3Q3HA 4KXFB 5E1OA 2EOAA 4BUJA 1DL5A 2DB3A 4BTLA 4D82A 1QTQA 1SHTX 2FLKA 3PQCA 1NI3A 1SUFA 4LJKA 2V3CC 5M7EA 4PZYA 3K1YA 4UAJA 3ILSA 1N2ZA 2GPTA 3G89A 4LXYA 2V4MA 3CC8A 2IPNA 3PSAA 5H68A 5TC4A 1L7PA 1XG5A 1THMA 1XCPA 1X86B 3OUZA 4HDMB 1GSIA 3CF4G 4KIUA 3C1AA 4J9VA 4DQKA 4C7MA 4KXQA 2C82A 5JY1A 4NFLA 4HQ6A 5G0WA 1OKKA 1KI8A 3SLKA 5IVHA 2YV4A 2NTJA 1XMPA 3L6DA 3SBOA 3L77A 3KKEA 1OLXA 4CDRA 3RG8A 3BRWA 3GCZA 4PV7A 1UKBA 3AM4A 1UC8A 3O75A 4HGRA 4MUAA 4RL4A 3REQB 4Z7JA 4CKZA 3H5TA 3LC2O 4W63A 1UBSB 1HF3A 1B7GO 1NYTA 1PL7A 2JI6A 3CTMA 4M0LA 4O2RA 4FYVA 4QAQA 1V47A 5C1IA 3UEOA 4DXHA 1ZGZA 2QV7A 3AH8A 2QGZA 1GNRA 2MSKA 3LBIA 5CT8A 2CT8A 3IBCA 2DETA 2J5RA 1QHGA 2A9QA 3EZ7A 5DYTA 4KUEA 3CLKA 4D3FA 2NLOA 1Y3AA 1NASA 4FCCA 4J0KA 5AJXA 4A0RA 1E1CA 1K5HA 3W8RA 3PDIB 1Z45A 1VL0A 3IAFA 2YC2C 4DMRA 3GLHA 3USZA 1EZZA 3UXHA 2NTYC 1BAPA 3LPNA 4TWBA 1MEEA 2ZM5A 1JHUA 2AOTA 3HI6A 1J00A 5T3UA 3PLAE 2PWPA 5IKOA 3SG0A 4HJXA 3SIPA 1SKQA 2X19A 5HCNA 1OVGA 3ETNA 3LDUA 3RFVA 2ZRNA 3ONNA 3CONA 1QDUA 3L8GA 1NVUQ 2F1OA 4NC9A 4KVZA 1Z0KA 3NATA 5C1DA 4MUBA 2H65A 1XZKA 5GJBA 1E7YA 1TKAA 3NYIA 2NPFA 1CZRA 3A37A 1ZLXA 3NOXA 3ZWVA 5J4LA 2O8DB 3CKMA 1ZGBA 1CETA 2R751 4ETIA 1Z33A 1SQ5A 4YUVA 3RS9A 3KKLA 2NSLA 3LHFA 2PZBA 3LPDA 3N86A 4Y9DA 4UXIA 2DHQA 1FNMA 2PJDA 1U3VA 4YRNA 3WGUA 4MOWA 5CH3A 1AKVA 3OX1A 1M6NA 5E3IA 4C0LA 1TJNA 5J3JA 3GLHB 4RLFA 4CV0A 4MYSA 1XRPA 1DBPA 1QGAA 2NO7A 3R4VA 3SHQA 4C7KA 1PJRA 3MG9A 2AOTB 2Z0MA 1PWEA 3DCYA 1L7BA 1RVDA 3LNTA 3ZXXA 1EBFA 2AEMA 4LC0A 4WFQA 4J90A 5CFMA 3L5KA 5GVRA 1OI4A 4HCJA 4MUXA 1K97A 1YR1A 2IXTA 3EMKA 5A1JA 3GMTA 4CWAA 1CV2A 1GZ3A 4TOIA 1I7DA 4LHVA 3R5SA 4S24A 4L4YA 3VZQA 1WZ2A 3ZLBA 2ZAGA 4WZAA 3DOUA 5EY5B 3QVUA 2ZXUA 3H2JA 4DR1B 4FYHA 3I32A 5AT1A 4J0GA 1XHEA 3D6MA 4D4GA 5IXSA 5JJCA 1E2UA 1Y8QB 1XD2A 2HADA 4OOEA 4R16A 2PLRA 1IWPB 2VJDA 4D8WA 4Y2JA 3I4LA 2WILA 1LQUA 3GZJA 1YV9A 1RXEA 2VXOA 4MGHA 2WF6A 1I30A 4IOLA 5GV7A 2Q2NA 4UHHA 2C2XA 3FLAA 3QQPA 5AJZA 1U2RA 3ZLTA 4EA9A 1Z18A 3ZWYA 1A7KA 3OT1A 1P2BA 3TE7A 1GN8A 3MQ4A 5IT9A 1WB6A 5BRNA 3KL4A 3O92A 2QTFA 5KBYA 4JOQA 5DIZA 3EZYA 1FU4A 1U3DA 2WNHA 3OJFA 5CPFA 3V6LA 1HLFA 2Q9BA 4BC0A 2GNPA 1PR4A 1XTVA 3FLEA 3IRVA 3K0FB 4KWTA 4AO7A 3MGBA 1N57A 4UKDA 3PFBA 3GWGA 2Q45A 3HH8A 3R6TA 4NE2A 4L3OA 4DREA 2VUSA 2XF8A 4BDTA 5A4MS 1KRXA 1DQNA 1J2JA 2ID9A 1CY4A 1SG0A 2WHEA 3C1TA 5AWFC 3J81A 2IEIA 3HBNA 2E18A 1WSDA 1MC1A 4KQ9A 3OESA 4F86A 5CDYA 1E2BA 5IAAA 4BNZA 3QU2A 5L7YA 1VZ2A 1I2BA 3LUFA 1WB9A 4JYAB 2ZZKA 3C45A 3FVQA 3L43A 1FRQA 4QWMA 1GCOA 3O9VA 1CG6A 2ESRA 2DOKA 3LSTA 3QXHA 5AJUA 1NI4A 1RWKA 3TEMA 4RX1A 2XB6A 3G9UA 4IIDA 5BP7A 3OT1B 3ABIA 5FHQA 2MT9A 4ZCLA 2G07A 3TOCA 1E0KA 2QTAA 1OFVA 2R9VA 2WSSA 4CI0B 4QLOA 3I4CA 4G89A 4DQUA 4PG8A 1A4XA 1U0FA 2ACWA 2P0AA 5HPYB 1CZUA 3STWA 2FQ1A 2RI0A 5DI3A 4WCDA 2VHUA 5C37A 4I8DA 1Z37A 2P79A 3A06A 2VNKA 1X7HA 3S7ZA 1G21B 3BILA 4Q4DA 5AVKA 4GLLA 1MOQA 1CY0A 2FPXA 3HA3A 3T12A 1M0EA 4L1KA 2GXUA 2PX8A 3IXQA 1Z5OA 3NEYA 1HYHA 4N6NA 1Z08A 1UK8A 3L07A 4MQ6A 1ECPA 2I7VA 3RRBA 2HSWA 1YJQA 2VQFB 1N2IA 1JUDA 3D3KA 4S1NA 2J0VA 4GMKA 1DV2A 1C1HA 2DWQA 2O7SA 3I0ZA 4N8EA 1NBMD 3F8TA 3C8HA 2BFDB 3IV9A 2PH3A 2QTGA 4KLZA 1X15A 2XKJE 3EYWA 3MGKA 5DN6D 2JGRA 4LFBB 1WABA 4AQYB 3V3KA 5I47A 3FMIA 3PS9A 4YJFB 4L8FA 1CEYA 1S1CA 5KVQA 2HA3A 3GAFA 3I5AA 4G09A 5DI3B 3R20A 3TSZA 1QDLB 3NIDB 1KXJA 1QOQB 3KLPX 3SNKA 4A6DA 1XMQB 2GM4A 4NZPA 1C3OA 1L4HA 3V4PB 1AH2A 4R01A 2H5EA 1UT8A 1XDZA 1XJWA 1JP7A 1VKOA 4ER3A 4OLBA 2QSYA 3DBOB 4MR8A 1XWWA 3W9UA 1KH3A 5A5GA 1QU2A 2EHDA 1P5RA 5KWSA 2UVQA 3REOA 1UK6A 3LT0A 1C7JA 3HUUA 1EFTA 4HNQA 4OY3A 3V2IA 1AOXA 1PNOA 2HNBA 3GFSA 1HYGA 1KDPA 2CN1A 2H1WA 2NYAA 4LWQA 4NJMB 2IHBA 5AUQA 1GA6A 4BZQA 1MAVA 5G0UA 5A06A 2ZYAA 1MB9A 2ACEA 4FI3C 3VVMA 4HF7A 4QBGB 4YCAA 1M8FA 1NPYA 3TG2A 2D1FA 2XV1A 4N5HX 4YMTA 2IGBA 4HNTA 3RVJA 1JI0A 4TV9A 3UJ3X 2KMLA 3D6FA 3AB7A 1QE3A 1Z4JA 2JA1A 1AGYA 1HE5A 2AFHE 2YMLA 3D1VA 3GUCA 4MR8B 1Y0BA 1E1LA 1KQOA 2X0NA 3KQWA 2O06A 3ZE8A 4D0LB 3V7FA 3CMMA 4QU0A 3DLHA 3HSSA 5E4FA 2H48A 1PR0A 3KC2A 2AOUA 5D01A 3RVOA 5FI0B 4BLUA 4F4JA 2ZRCA 3PVSA 1UMDA 1ZIYA 3LQYA 1YJAA 2Z8XA 4F72A 2XD9A 3HZHA 4R9UC 3FDIA 4Z7NB 3KL2A 4IIYA 4M9CA 5AKXA 5JV5A 1N1GA 1UDWA 4M9SA 1V7PC 5EMKA 4UHBA 5K0ZA 1HQCA 1MJHA 2V7UA 5EXSA 3ICVA 1Z83A 4PPGA 3KJXA 4N76A 5EJIA 1GUBA 1M72A 2I4TA 4MJLA 2FEMA 2TMYA 1DKNA 3OU7A 3UGJA 1DIBA 1TQHA 1THZA 2ZBQA 1B6GA 2ZIGA 3RYCB 3L4BC 4K46A 1SU7A 1NUHA 1KQPA 2QHXA 1ECGA 4G9EA 3WWEA 1T2NA 5L7TA 4HDKA 3VYTB 1G1AA 4TV8F 3LDHA 1KDRA 3M0EA 2QVCA 3H7IA 1ODTC 5EYPB 4AUEA 5L45A 4E88A 3A2LA 5AVZA 1GIAA 2A3RA 3D8NA 4CW7A 1BXGA 3CNBA 5JI2E 1YE8A 1FS6A 3M33A 4YAOA 3FNQA 5LXTF 1SVNA 3RREA 2HREA 4ENRA 4ZOLA 1DAOA 4W8GA 1LS1A 4Z1OA 2BAGA 2P27A 4Y9UA 3MAGA 3OA2A 3TI7A 5E9WA 5LJLA 2DQYA 1V11A 3DSRA 3IR5A 5BWMA 1P2TA 3PQ7A 3B78A 3H2IA 4B7UA 2XDYA 4EMUA 3EVAA 4ZT4A 3U3MA 2IHNA 4JYZA 1X7ZA 4OK6A 1XTKA 3QWAA 5TY0A 1OT5A 3A6GA 3A3KA 1N3LA 3U60B 4R8LA 1CF9A 1P1RA 1X2BA 1JWAB 2H4JA 3MUFA 4BNMA 3FDZB 2RH4A 1ZJ5A 3I2JA 3DMYA 3MRSA 4CHTA 4PAMA 3T7JA 2C07A 3EAGA 1W4BA 3RO7A 2Q0HA 2Q3MA 1XMJA 1F7VA 2VJLA 3JARA 1IVSA 3PCRB 3N2NA 3C87A 2D1SA 3BMOA 2A0KA 2FSSA 2MMCA 3WOVA 1B3BA 4FOSA 4ND8A 3RFFA 1J0BA 1KYIA 5FV4A 2YXNA 5DCLA 1V11B 2E4ZA 4W9NA 4DLYA 4RV9A 4Q4HA 4QO8A 5F7OA 4IL5A 3NAGA 4I5EA 4YTEA 4JLJA 4FP9A 5CVEA 2R7KA 4H6WA 2FZVA 2GHIA 5KTOA 1KO8A 4PSAA 2IYFA 5DBFA 3BH0A 4CT5A 3WK7A 3EZ2A 2FR8A 5LQDA 1LTQA 9ABPA 1CJTC 3K2IA 3BZBA 3M3HA 3OIUA 2RKOA 4NZOA 1CZHA 1H42A 4OQQA 1Y4DE 4EQZA 4S05A 4CLEA 2EKLA 2I2WA 2OD7A 3DPSA 1FSPA 4TYWA 2RK4A 1RHMA 1Z5PA 1NXVA 2PBRA 3ISTA 4X7BA 1YZQA 2HMYB 2VRCA 3EXHA 2QVXX 1CE8A 2QDKA 2WR8A 1CFJA 2XMRA 2FFQA 2XMZA 3LT5A 4E2ZA 2VPIA 1X9GA 4D5EA 1XVIA 3USCS 5A2QA 1ODJA 2PXXA 4NF2A 4IJ6A 3SQLA 4CIDA 1XRJA 1SULA 1Z6AA 2OHOA 3IODA 3Q11A 4RLSA 3OUTA 3JWEA 5CP8A 2QRVB 2R6R1 4QHSA 2AC2A 5IW8A 1MQAA 1NFRA 3GRFA 1QCDA 1ZCZA 4KR7A 2X5XA 2P9TA 4RPGA 1APBA 3F4BA 2Z8ZA 5BN5A 2PA3A 4DMUB 5KNDH 4JJ7A 1YIAA 4KHZA 4NMHA 4WBSA 4ZD6A 3EEQA 3SM9A 3ZWPA 1HDIA 3V8BA 1V9CA 3VRHA 3QJ5A 5JXIA 3OURA 2LKCA 3UHJA 5JATA 1VA5A 1TOAA 1JDBB 5JISA 1LPMA 1YB6A 2ZS9A 3RT7A 4AW9A 5MFZA 4XVCA 1YBAA 2IYZA 2ZIEA 3ZTWA 1ZN9A 4NHEA 5I7OA 2J41A 2CDAA 3J80A 1XPJA 2AX3A 2VCYA 3G2NA 5B7PA 1ZGCA 1UWKA 4BQQA 2CD7A 3P9RA 3GUZA 2HLDD 3QVJA 4K87A 4EW6A 5JARA 2ZSJA 2H0AA 1NAIA 3AINA 1J06A 4IDDA 2GO7A 2PBZA 4JIGA 1STOA 1UBJS 2OCKA 2QN2A 1GZDA 4TWZA 5B1EA 5FUVA 5GAJA 2B8NA 3KUUA 4EJMA 3DL7A 3TBHA 2Q4RA 3G0DA 1TK2A 1SK8A 2HMTA 5BN5B 5AK3A 3G2HA 3LI2A 5JS2A 1EB9A 2CXHA 1DWPA 1HT2E 4EKYA 1DG1G 2UU9B 2K7ZA 5HIJA 4O1IA 4RK1A 1FDWA 2BR4A 3NO4A 4J0JA 1RJDA 4FYIA 4IDOA 4KIGA 4BFYA 3BQ9A 2V7QD 5CVCA 4GQAA 4X7RA 1OR8A 5I8ZA 2VUHB 1RYDA 3SHVA 3QTLA 4AG6A 4MKHA 5CLIA 3D7KA 3W9SA 2BFMA 3A2NA 5BR4A 4JB2A 2C0QA 2FWMX 1U8AA 1YONA 3ZU6A 3L8DA 4YJ3A 1XE3A 3Q7PA 4KQ1A 3PX2A 4W7SA 2PKYX 2JAPA 2V7WA 3UKOA 3W1VA 4DHEA 3W6NA 4U5QA 2QF7A 5CITA 5ALWA 2JCGA 2HU8A 4Y2VA 2VHJA 3CVYA 4JT4A 4EKNB 3WX0A 4MQFA 1MT3A 4JV5B 1J21A 4CMKA 1QPGA 4LSZA 4PYIA 4YJHB 3FPHA 1ZW1A 3L7JA 3N7UA 4K6OA 4GDMA 4TMZA 3UJCA 4GBED 3G88A 2QQFA 4ZVTA 3KD2A 2OHVA 1YDHA 3ITNA 3VO2A 1DTSA 3QX7A 2JGJA 3B5JA 3K5IA 3ECAA 3H9JA 1W1WA 2P9QA 1PCXA 4KKXB 3PVCA 3CVUA 1KY2A 4IYRA 3IEMA 4MHSA 3HDVA 1LPSA 4YJ3B 3ILVA 3NTLA 2XADA 3JYOA 3PGMA 1A7JA 4JVOA 3K9FC 3LX5A 3A10A 1KQNA 3NYRA 1AGXA 2AUNA 2HO4A 4KR6A 1JLKA 3BRCA 4ESEA 1BKDR 3TOXA 1UDAA 2X5NA 5BXYA 4MQFB 1Y9AA 4M1YA 1E98A 3DL4A 3KFVA 5LQMA 5M04A 3EF0A 3PYXA 4C1BA 3G5LA 4PRZA 1EUCB 4UTRA 4RGVA 4TMWA 3RSSA 5CB6A 4HWGA 1BHO1 3AHDA 3ADOA 1BS2A 1U8CB 1H8HD 4Y2HA 3I9V1 4D8UA 1KFEB 3SYKA 5IFKA 2YWHA 1Y7LA 3GD5A 4GNRA 3KOWA 2GAFA 1VBKA 1YB5A 3ASUA 3ND8A 4LJRA 5BOSA 3OKFA 3K09C 4W8HA 1C0LA 3M5PA 1VLQA 3H99A 4UUAA 4BVAA 4IGAA 1GHTA 1T0BA 3M4XA 4K8RB 2EFEB 1OMOA 2IHUA 4DLLA 1HBJA 5ECYA 5BURA 3R0VA 1JLSA 3NC4A 4OP3A 4H60A 4L4RA 4GI2A 1PGNA 4RQUA 3CQ9A 3BC1A 5J5CA 4F9FA 1DJLA 1PDWA 3UATA 5ILGA 4RELA 4GHWA 1FNNA 1NVVR 1TDJA 4I4TA 2NNLD 1PK8A 4A03A 2ECOA 1VCNA 1DFIA 3NTOA 1G20A 1MQSA 1COWD 4C5BA 4ZI7F 2QRLA 3DBIA 5C7IO 1C9EA 2VDKB 3FJYA 1XZAA 4GOLD 2EF0A 3AVTA 2QK4A 1G2OA 3I30X 2PT9A 1ZD1A 3Q6NA 5DGTA 3ENKA 4MVJP 3S2UA 4Y6OA 3T9DA 1AXGA 3PB3A 3THXA 2DUNA 3T7KA 3DTNA 3RJ5A 4QDJA 1MFZA 3ZC3A 1IBCA 4MS3B 1QIEA 3G2OA 4C6HA 1YR3A 1KP9A 1ZU4A 4KLCA 3ANNA 1A5ZA 4WXRA 2KM1A 4W5QA 1EX9A 3COYA 4QLAA 3EASA 2AYYA 3MK31 3SZLA 1H1DA 2Q5HA 3TR6A 4A26A 4BJ3A 5KAPA 1UFOA 2QRNA 2R68A 1A77A 3B1WA 2Y99A 4OLJA 3O2QB 3QLEA 3V4FA 3TLAA 2ONYA 4AJ2A 2OESA 4YQYA 4Y1RA 5FBQB 3ZQJA 4D4HA 1JALA 1FJ2A 3CUUA 2PE5A 3HGTA 4BMVA 2QTMA 2X6QA 3KB1A 1SBQA 2EW1A 4CKWB 1FYXA 1S3FA 4Z9XA 4ZTBA 3ZE6A 3TDMA 1THGA 2V4ZA 3AETB 4JQSA 3L4KA 3F4LA 3FYTA 3AY7A 4O4IA 2BV3A 3LC1O 1FP4A 1H3NA 3PDUA 3B3FA 2BFPA 1JDUA 2AN1A 2JLAA 3I39X 4DC9A 4TSFD 3DONA 2HJVA 4E1VA 5JAPA 3RADC 4BJ6A 3X2SA 4AY2A 1U0RA 2X8AA 5JJBA 1A5SB 3KWMA 3T9CA 2ODAA 1U3WA 3I12A 1U8XX 3NAQA 3TR5A 4EP1A 1VE7A 1RI4A 5BW5A 1M54A 2WG1A 2Y27A 5JCPA 2WPDA 4Q00A 1UKCA 4HBZA 2R6CA 5COQA 4RVSA 3T3EA 1OC2A 5A3RA 1U02A 3DKVA 3DFKA 3FAKA 3GXOA 2C2MA 1MJGM 1L5SA 3MLEA 1IHXA 2XR1A 3TOVA 1JXQA 2V4UA 5J5AA 1CNMA 4LHZA 4C0KA 2BKUA 3PXGA 4AZSA 5KOIA 4DCMA 3KYBA 2QVZX 4O4IB 3RU9A 3URMA 2F90A 1XQ9A 7YASA 1UKAA 5IPFA 2AKAB 3PT9A 4LNUB 4ZV9A 4ARVA 2F55A 1NM5C 2PHZA 2A1TR 5TS2A 5HJ5A 5JQGF 2ZBEA 1SR8A 3DF9A 3F5QA 4Q9IA 3GEEA 4MQEB 4JOSA 4D79A 3PR3A 5TRTA 2JD2A 1L5FA 2RJ3A 2QPAA 3K53A 5K6AA 2XHZA 4G4SO 2XMQA 1JBEA 1TKCA 1SBHA 2MINA 2X8BA 3QBDA 2WFLA 5F3RA 1YMQA 1C81A 5DE3A 2OSBA 4LW8A 4XARA 3RTEA 4DPKA 4A5OA 1OASA 2V98A 4YGYA 1KS2A 1T2UA 3F8SA 1CJUC 3LRPA 4MRNA 4ZAZA 3VPGA 2YV3A 4IG9A 4EHLA 4R84A 3LOQA 3IPYA 5F78A 5EG5A 2JLXA 2BISA 1PLLA 3EDCA 1F06A 4C03A 2O4UX 1L5HB 5FOXA 3W6OA 1GR1A 2RHLA 2O50A 2QLNA 4DV0B 3VA7A 1BVHA 4C0HA 1GZHB 4DFDA 2VTKA 1NRIA 1FB5A 2CBZA 3OFVA 2HHAA 4L57A 3I1YA 2QYSA 4DDTA 1E6LA 3ETGA 3PCXA 5KQGA 3R3UA 1OB2A 3C0KA 3DMNA 5DU2A 1SUWA 2FW7A 4TRMA 1I51A 3BPSA 3F9IA 3WA7A 4OXIA 1RJGA 4F2GA 2EWVA 4QOIA 1JFTA 1XA3A 2I2BA 4Z9AA 1D5CA 2YWJA 4I1YA 4C4ZA 4DLWA 3EIHA 1NXWA 2EQBA 2SHKA 2AB0A 2WQZA 4BLPA 1IY0A 2O9JA 1EFCA 3T6KA 3C5EA 2A92A 3KX2A 3ZHTA 5F9MA 3BWMA 5CCBA 1FU7A 4DCSA 3ASZA 1IY9A 4XVUA 3UYLA 1Z2EA 1IEWA 5SZJA 5INTA 3BIXA 3UHPA 5IAEA 1E9EA 1RXWA 4QX6A 1OLUA 1CUFA 4WKNA 4L27A 5AFSA 4R7GA 3EULA 3DDHA 1ONOA 5E9JA 3VV2A 2I4IA 3AEZA 1Y8ZA 5BVGB 1Y9EA 4NLLA 1BEZA 1LI5A 3C74A 3KEGA 2PU7A 5HF5A 1M2EA 1I6LA 1D6NA 2HLNA 2H7CA 3BK1A 4ML3A 3ZDQA 4DYDA 2XRFA 3AF2A 1MA3A 3FNIA 3OLXA 4Y0VA 4YQZA 1G3QA 1DWUA 3TFWA 4B74A 4EW1A 3IA7A 1PR2A 3MJHA 3Q6MA 4H77A 4JKYA 4KYIB 3VU0A 1B1AA 4LF4B 4LZAA 1ZD4A 2Z58A 4H1WA 4XI9A 3FTFA 1Y8AA 4LQDA 1JX6A 1KKMA 1O87A 1WVIA 4KB5A 2WKSA 3VNSA 1TCUA 1ZH8A 4TT3A 1YVDA 3JQBA 2R6DA 4K88A 5DRTA 5ADVA 3AWIA 1Q7RA 2AK2A 2ODWA 4MUEA 4MVJA 4X00A 3SSAA 1MB0A 5JNVA 2QL7A 3WTBA 2ZRBA 1FMJA 1NQUA 1UBOS 3E2MA 2V0CA 3MPUA 2GEUA 1Y9JA 1G3IA 1OAAA 4QXAA 1Y6FA 1U0EA 4KRXA 1L7VC 2FVYA 1PQYA 4OHXA 5EWMB 1OWLA 4B43A 5TGZA 5KTPA 2JHCA 1TX4B 1YIOA 1NURA 2CE7A 5TB5A 3V1MA 2O4CA 3V00A 1XX6A 1ZM3A 4UATA 1UC9A 2EG9A 2FWRA 5KQSA 3BSSA 4DLVA 1WE2A 1U4OA 2F00A 2FJPA 2VKQA 3QBVA 1JE1A 4LOHA 4Z9FA 4DJEC 3C98A 3CW8X 2HPHA 5IK2A 3CH4B 2P1RA 3DP9A 3LYUA 4OXKA 5LIRA 1SC9A 1UM8A 3FAZA 4TUYF 1ISIA 1QYCA 1SEPA 2YMMA 4ILEA 4PQFA 5LMNB 2QN8A 4B83A 2W70A 3FHOA 2C2OA 2ES4A 4B7XA 3HADA 1NOJA 1U80A 3NRBA 4XQEA 1NVXQ 3GVCA 3M49A 4XCXA 3DZIA 3GFQA 3AHEA 2J7KA 4WKBA 4L22A 3UWPA 2VDPB 2I2AA 2EX4A 3E9NA 3PKZA 5FYDA 1KJYA 2QLFA 2VK1A 2YXDA 4YRCA 1QV6A 3R76A 1F14A 3L0YA 2R1ZA 2ZRHA 1AU9A 5FF9A 1HI9A 2PSEA 3V1YA 3W4IA 5A9RA 3DMHA 1L5QA 2P2YA 4WY8A 5BV7A 4QYWA 1P2FA 3TQSA 1A50B 5DYIA 5ITZA 1IVNA 4FSXA 3BFPA 1L4MA 1EJ2A 5ABPA 3IUBA 3EF1A 2LZ0A 1I10A 1ZUNA 4P53A 3SYLA 4NU6A 3PXCX 2K5UA 1BYUA 4PYLA 4PXAA 5I7FA 1Z5VA 4NATA 2GJKA 5IRCD 2Q6TA 3T9EA 2EZ9A 3WBJA 1UXOA 5IABA 1CWUA 3EMBA 5G41A 4UJ5A 1QVZA 4D9EA 3BJZA 2PXHA 4G8BA 1GFIA 1XZIA 2C97A 2LIPA 3IS3A 2H92A 3PI6A 1E9BA 3QV2A 5JCZA 3GLGE 3DT6A 5JW6A 2IYAA 3RIGA 3GVXA 2QD2A 1D9ZA 4WFKA 1IHUA 1KK3A 2N0SA 4BJ1A 4Y6LA 2O3TA 3HKDB 2R47A 1NBHA 2H31A 1ISRA 3EGXB 2VJAA 3IE0A 3IILA 3CFYA 2HA5A 2NSYA 1FFWA 3QUCA 1XQWA 4Q18A 4L7VA 3NBYC 3COJA 3H86A 4UCXA 1O9HA 3SOPA 1SCBA 2F8LA 3MCTA 5AI6A 2OWEA 5D3ZA 5ITZB 5B5SA 3F6YA 5BNWA 4XUCA 2ZZMA 1TADA 1WY5A 4ZQCB 3G0OA 1XVTA 5IYZA 3R9XB 1DUVG 3TOZA 1SXJE 4DA0A 1GCUA 1YQWA 1CUHA 2F1KA 3LCUA 3GDWA 2ISQA 3GPDG 2Q9UA 4OAOA 1ESNA 1Y8RB 1YH3A 3KQOA 2AZDA 1ACMA 4DV3B 3C6ZA 2EF1A 5HE9A 1GQSA 2QE6A 4JJKA 5E6UA 3FNEA 2ZUWA 4IXWA 1HG0A 2JLQA 3LTNC 2FP4A 5ALVA 1I0LA 2J31A 5AO9A 2VAWA 4Q7JB 3RUFA 3PX3A 1N6KA 1YFKA 3O9ZA 2WZQA 4EMTA 2ADMA 3KKNA 3KV3O 4KSYA 4KWHA 4I8IA 4Q21A 5AKJA 3LQ2A 4DNPA 3WGIA 4KPUA 2E87A 5CT9A 1CQJA 1CX9B 1JTVA 1VE1A 2G7MC 4GGPA 3E5HA 4R31A 4YDSA 3H11B 1TUBB 3IO3A 2IEAA 1QO0D 3JRXA 3NGXA 3O1HB 3S2IA 2HTFA 2PRIA 3OPQA 3G3EA 2PWAA 3PF8A 1NMYA 4OYLA 3E3NA 4L5CA 1EFVA 4YS6A 3JAKA 2HN9A 3GRYA 5F98A 1KPHA 1H2XA 2Y66A 3CZQA 5G1OA 2G88A 2ZYDA 3G6KA 1M8PA 1U5CA 1DBRA 2G04A 1R5OA 1SMKA 4MITA 2XOXA 1TA4A 5DT2A 3GPIA 3TMAA 4HGNA 4AS2A 4QVIA 1D2HA 4HYEA 4QE3A 3PNSA 3HKEA 1VGVA 5EWLB 1B2RA 2C83A 5U4XA 1W36B 3IJRA 3D3WA 2H85A 3B5IA 3SZMA 3C5CA 3MM4A 5HOEA 3QVSA 1SRQA 5DXFA 1ELOA 2XJ9A 4DSNA 4A92A 5KC8A 3KLNA 2BH9A 1CQJB 2COEA 2YMPA 4XIJA 4ZT5A 4AQ7A 5CBKA 1QV7A 2CVHA 1WDWB 5CLGA 2ZYGA 3VBEA 2XUPA 1GFZA 1XN4A 4GMHA 3ZWMA 1JBQA 3C8UA 1Z2DA 4ZRNA 3RU2A 2VUIB 4G0OA 1EFVB 2QA5A 2A4KA 4IF4A 5JT1A 1T9GS 1IIBA 3LPMA 3KQSA 1PQUA 4MCJA 3TO5A 2Q4TA 2OCGA 3AFGA 3OQBA 5AQEA 2G09A 4CDMA 4UEWA 4HV4A 1ML4A 2LCIA 4HWSA 1LDGA 2ZTUA 2P9FA 5EQDA 2AW5A 3UICA 1GTG1 1YQQA 3EIEA 5MDHA 3HKEB 3OC0A 4B71A 3D3WB 3OC6A 5HX7A 3R5JA 1MPXA 13PKA 2Q5EA 2N47A 2QE7A 2YYSA 3GBVA 2JBAB 2FRXA 5K0SA 4JI0B 1YZUA 2GK3A 2B0JA 2FSIA 1R8SA 4HDRB 3GCGA 3PV0A 1Z9BA 4ZQHA 2HCJB 3AFIA 2XB9A 1AUOA 3IP9A 5DYGA 3ZE7A 1W9HA 2C4UA 3MTIA 3GBPA 5MN4A 4CMEA 2VJCA 1X3SA 4R1LA 1S2MA 1ID8A 4UZEA 2JGAA 1GXSB 3R74A 3T7DA 1G2QA 2GZ1A 2I62A 5TQVA 3VNAA 1J2EA 2HDNB 1JEDA 3B2QA 2B7CA 3I76A 4PQEA 1BMFA 1DHRA 4GRIA 2FF7A 2W4MA 3VDRA 4NZNA 2RHBA 5AMXA 1MORA 5KPJA 2WQ7A 3UV3A 4QUDA 1PS9A 3O4VA 4ZGBA 4C0QC 2BGIA 2XMDA 1NR7A 1P7YA 2MSWA 1LQ2A 4PC1A 3UWMA 3VJLA 4C0BA 3SMQA 2IYEA 1N2CB 3K5HA 3NNDA 1MAHA 2VBCA 4X3CA 5AXCA 2HD4A 2IQIA 1G98A 5FFMA 3ZDRA 1QAOA 2UXDB 1R0BA 1U0LA 4DLRA 1XFDA 1CIJA 4HDAA 2HX1A 3D8UA 3HA2A 2YZ7A 2D1TA 2F3TA 2PS3A 3TD9A 4YCMA 5AVOA 1GL6A 5G4KB 2G5CA 3STUA 2Z6VA 1XT6A 3ER6A 3P4YA 3AVWA 5ALRA 2Q4OA 4DQDA 3I6YA 1THTA 1R12A 3M82A 3AM3A 1LVHA 3G68A 4FS3A 1QE5A 3KSUA 4D45A 3MQFA 3KRTA 4Z1MD 4MDFA 5CT4A 2PO5A 3TNFA 2H1SA 1TF7A 1SBCA 4Q02A 1AXEA 1I2DA 1JPNA 4GAEA 3ZD9A 1KEUA 1KYQA 2XB2A 3HJFA 2IOHA 2CXRA 1GZVA 1Q0SA 2ZTSA 4YRDA 4I46A 1Z13A 3RHSA 3FWNA 5ILQA 4Q9KA 1O4WA 3EUAA 4DM7A 4HDSB 3U7FB 3JPYA 3K2EA 4RETA 3QXXA 1OV6A 1SBIA 4Q15A 4EPWA 2XCOA 4U6NA 3DBHB 3I6IA 4B87A 3NFRA 1RLJA 1DKOA 2O8NA 1E5XA 5ARBA 5KJ6A 1L8XA 3QVGA 2GASA 3OHSX 1KJIA 1CQPA 1HDZA 3SMVA 2VP3A 4DUGA 3IPCA 1J9ZA 3GRVA 3QWBA 5IJWA 1T1RA 4LJ7A 2AXNA 4LVOA 3IR6A 4N5LA 1L7MA 2G17A 2RFLA 3NHWA 4RM3A 3RRYA 1SCQA 4AMVA 4Q7LA 3K70C 2JKZA 2W0MA 3IXMA 1AKNA 4JFRA 4B9EA 4QOHA 5KUTA 3T1TA 2H2FA 5IM4A 1I4WA 1EQ2A 5DX8A 1KARA 4F2WA 1VCMA 4X0EA 3B82A 5A3QA 1MRSA 2Q7OE 1U0OC 1L1EA 4YUXA 2HSZA 2OT3B 2IX3A 3D0OA 4MW9A 3HYSA 3DQZA 4QJIA 1T8YA 2B30A 3JYHA 1Y3BE 5BT9A 4DLPA 5IJ9A 5FO1A 1ZKMA 1XEXA 3AU9A 1S6YA 5IULC 1FK8A 1LCIA 2PL5A 1G7SA 3HR8A 1WHSA 3I2IA 4QDUA 1D2GA 1J8YF 3VUFA 4RHCA 3WKAA 1Q1EA 2R5WA 4C0WA 4F06A 1W88B 4NK5A 2CNNA 5ELXA 3VX4A 1EVKA 3UMSA 4UBMA 2AXQA 4QNRA 5CFPA 5JYEA 1IPFA 2IP4A 1XZLA 1UZAA 3VR6D 1RXYA 4LHYA 4MR9A 1OH7A 3MQ2A 3SY8A 2IF0A 1DBIA 4ZEOA 1FUEA 4CCAA 4WW0A 3FCAA 3NDJA 1DOZA 4MQUA 1K5GA 1W0JA 5F1OA 2BRUC 3W2GA 5HKKA 5KIAA 1DRJA 4DQVA 3T61A 1VB3A 3LG2A 2C57A 1PWXA 5EHIA 5IJ0B 5J4KA 3AIIA 1JG6A 5T4FA 1JFVA 3EQ8A 2W2MA 4LHWA 2GN9A 5AOBA 3PHIA 4H17A 3S2SA 1FDRA 4PZZA 3SK0A 3VTAA 4BO4A 1XEXB 4LPKA 3NT2A 2B4AA 2FRVA 4GWGA 2ONKA 4FFPA 4Y2RA 3NVAA 3P32A 4B7AA 3T4UA 4TUYA 5HS6A 4L0QA 4GEGA 1QFXA 1GQRA 2NZ2A 3KYJB 5DEIA 1EBUA 4K6MA 4EKIA 4F3YA 1GQQA 2JAQA 2FUG6 2R60A 2QRGA 3IAEA 4P83A 4BO0A 1HOXA 2BIFA 2DUMA 3BAFA 3FVTA 2XODA 4G07A 2WJ3A 4MUIA 2P2GA 2PQ6A 4BBZA 3FSGD 4QTZA 1FRZA 3T7IA 5EN4A 2OHJA 4X1KA 3AYZB 4OB8A 5AKYA 1U8TA 1KNQA 4EB8A 3KKKA 4D4JA 4DLBA 1WLYA 2O14A 1GUZA 3ADBA 3CF4A 3ESYA 3EN0A 4P3OA 3KKOA 4BU0A 5DPMA 3MJTA 1F4LA 1TTQB 1YRAA 4BV8A 4D42A 3NGLA 5U1PA 3LWZA 2A9PA 2DFTA 1XWFA 1ORTA 1UDBA 3X1WA 1D1TA 3E3MA 5GVSA 3AOEC 4ZXPA 5BQOA 3KB8A 2Q1UA 2TRSB 1XZDA 1ZYUA 2ARKA 2Y77A 2YWGA 5L9AA 5IFLA 3PC4A 4LZNA 4PYRA 3K9WA 3HSKA 4XSVA 4ER7A 2ENUA 1ISFA 3NBUA 3IOYA 3EVZA 3NH9A 5G0SA 4OA5A 2GARA 1S5PA 1LVGA 1QYDA 1V0JA 3IVRA 4P81A 4P86A 1PZMA 4MJ3A 4RVUA 4CCSA 4N3AA 1LK5A 5JU6A 3KFXA 3GRRA 2KWIA 2ZITA 2C58A 4MW1A 4PZUA 5IN5A 2Q49A 1D1SA 3FWHA 1P4AA 1P19A 4BV2A 3IT1A 4YQEA 2HO5A 1L5WA 1ZGAA 3CCFA 2JH9A 3WNCA 5CCXA 2ZB3A 3JQGB 1R4AA 3H16A 1J0AA 3OQ6A 2FU5C 4ISCA 2A8YA 1LX6A 2ONZA 1E79A 3CX3A 3K9LA 3PQ2A 5ULLA 3P9IA 1DI0A 3EFOB 1CERA 1T5HX 3UUGA 3ZWOA 2I6GA 4YXWD 1MW9X 2HGSA 4JBIA 4O33A 4GBMA 4IDGA 3RKSA 2EKQA 3F98A 4UTZA 5REQA 1C7IA 3E7WA 1IDOA 2FMHA 2NXCA 1SBNE 1SNYA 3BXFA 3GGJA 4FC6A 4UVGA 4E2WA 1JR3D 2G8LA 2YVKA 4NEQA 1O96A 3MYRA 1S3SA 5DHUA 4DDWA 5LU8A 2DZDA 4A0QA 4JLSA 7MDHA 1Y5IA 3LCCA 1FW8A 3HA5A 3A8TA 1V9LA 3JQAA 2HK9A 1U2EA 4LDJA 4P33A 4BFLA 5TLSA 1PP4A 2WTEA 4JJZA 4YXFA 1WD5A 2OBFA 4ZHQB 1X92A 4PSKA 1JHOA 1X42A 2AIRA 2ONCA 3C5VA 5KQPA 3QP9A 5DTRA 3DMTA 2IU0A 1DOAA 5FWXA 1JGTA 2JLZA 1Q1GA 4FZ5A 2JZOA 3FPLA 1XTQA 3OSUA 4PXSA 3B1YA 5REQB 4OP1A 2BHNA 1NIPA 1XZPA 5LB2A 1II8A 4TXMA 3VKVA 1F1BA 1CLUA 1H69A 4AZ0B 4DGQA 2PX5A 4QLBA 5I4CA 2AS0A 3KXPA 4JLBA 4JX8A 5BRJA 1P3JA 2IYPA 2NVUA 2VDLB 2WTMA 2XEXA 2X0FA 5CX1A 1F5SA 1ORWA 2CUNA 4IDNA 4XSGA 5D5HA 4QBTA 4WE3A 3NHFA 4RKYA 4Z0TA 4DXAA 5JAQA 2H16A 5DGDA 3LTEA 5HRUA 3NLLA 2PMFA 4ZT3A 5F5XA 1WL8A 4LJ8A 4H3HB 3QSGA 2VNAA 3GAZA 3I42A 4LN1A 5KYXA 3HU1A 4Q39A 5AHRA 4FWTA 1P6XA 2A5DA 4YI3A 3SZGA 2D59A 4NENA 2YY5A 3NI2A 4LBYA 3OLWA 4LE1A 3LSYA 4TYMA 3U48A 1EFRA 2JIBA 2Q7XA <