3F4KA

Crystal structure of a probable methyltransferase from bacteroides thetaiotaomicron. northeast structural genomics target btr309.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
254
Chain Sequence
b'NNTSIHDFDFSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of a probable methyltransferase from Bacteroides thetaiotaomicron. Northeast Structural Genomics target BtR309.
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 87
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3f4kA00
5DX0A 1DL5A 2GA9A 3MTIA 4F86A 5ICCA 4QTTB 2DULA 2F8LA 4K6MA 5GIOE 4RTSA 2JHCA 5DSTA 4ER6A 1ZGJA 3P9IA 2OB1A 2BZGA 2R3SA 4CWAA 3LCUA 5EEGA 3DMHA 5GM2A 2IH5A 1Z3CA 2ZFUA 1SUSA 5FQOA 4PONA 2UYQA 5EMLA 2P8JA 1XVAA 4E33A 1ZQ9A 3GNLA 3HVHA 1VLMA 3KQTA 4F84A 2UYCA 3FUUA 3G7UA 2I62A 4YV1A 1JG4A 1TW3A 2Y1WA 3D2LA 3LDFA 3IEIA 3LSTA 1N2XA 1T43A 3SSOA 3A26A 4PNEA 2ZZKA 3HM2A 3G5TA 3C0KA 4PYOA 2IDKA 1XCLA 3MQ2A 2ZLBA 5DM2A 2PT9A 2OBFA 5KQSA 4C07A 4QTUB 4RVHA 3R3HA 3OE5A 3MHTA 1DUSA 3LX6A 1KPGA 2NXCA 1EAMA 5LR6A 1RI2A 3I53A 4RTOA 4NECA 4XCXA 3S68A 5LQJA 3VSEA 2C7RA 4PGGA 5BW4A 4A6EA 4YUWA 2BM9A 2YXDA 3EGVA 4FT4A 5FADA 3JWGA 2XYQA 4PCAA 5LQNA 3HA3A 3DLCA 5LQCA 3TMAA 5M5BA 4F85A 2G71A 1Q0SA 3P2IA 3MTEA 3GGDA 5E8RA 4LWPA 2P41A 3EVBA 3LBFA 3KPYA 1XDUA 3ELYA 4ISCA 4DF3A 4KVZA 4FR0A 2IFTA 1P39A 1BC5A 2B9EA 3CKKA 3HCAA 5E1MA 2P7IA 3KQQA 4HG2A 2AVNA 3DP7A 1FP2A 2PJDA 4MHTA 3A7DA 3QV2A 5E9JA 5HEKA 3FPHA 1OR8A 1EJ0A 2PY6A 4U7TB 3REOA 5EOVA 4AZWA 2NYUA 3FUTA 5DRTA 5KVAA 3KR2A 1PJZA 1R00A 1JG3A 1NW5A 1VBFA 3HCCA 3A27A 3LKDA 2ONYA 2FCAA 3O31A 4R8RA 5B1SA 1PRYA 2ONZA 5EKUA 3JWIA 1U2ZA 4YMGA 3EEOA 3G2QA 2B2CA 3CJQA 3GO4A 5DTRA 5FTWA 2OYRA 2PBFA 4RTQA 3LGAA 3KR9A 3FPJA 2PT6A 5JUWA 4OX9Y 5K0FA 1N7JA 5EEHA 4QPNA 4DMGA 3KR1A 5HIMA 3JWJA 1XDSA 4ER0A 4Y2HA 1RJFA 3EVEA 3UJBA 3HA7A 3NWEA 1KR5A 5GP1A 2PLWA 4RVGA 4R6XA 3T0IA 1WY7A 2WK1A 1NW3A 1YUBA 3TOSA 3UFBA 2IGTA 1KPIA 4DQ0A 4E2WA 1JG2A 4HH4A 3P9NA 1JTFA 5E1DA 4DZRA 3CCFA 3EMDA 4CTJA 3KQSA 3QOWA 1TPYA 5FWAA 5ICEA 5D1NA 3JWHA 5K03A 5KS2A 3LHDA 2AN3A 2ZW9A 3M33A 3RW9A 2OXTA 2C7QA 1RJGA 3I58A 3RIEA 3SX0A 2AN5A 4X1OA 3TQSA 4M37A 10MHA 1VQ1A 2PX4A 4RTRA 3VC1A 5LQRA 1JG1A 2GAFA 2P7HA 2IPXA 1RJEA 4XUEA 3THRA 4ER7A 2IH2A 3TR6A 2H1RA 2YX1A 3E7PA 1QANA 3CBGA 1KP9A 2WA1A 3DMFA 4EVIA 1NV9A 3K0BA 5E8JA 2GH1A 3NTVA 4CXMA 2I9KA 3KQMA 5DXJA 4OBWA 2IP2A 3BWCA 3C6KA 3FPEA 4QDKA 4X41A 4LWOA 5E9QA 3V8VA 5BW5A 1SVUA 5EC8A 1AQJA 3ER9A 4E31A 3MCZA 2EFJA 2Y1XA 5F2OA 1ZKDA 5DRYA 3SR4A 4E2YA 1BKYA 5CCXA 2FHPA 5G02A 5H02A 3SMQA 3NMUF 4IKPA 1D2CA 1WXWA 1IY9A 2P3OA 4WXHA 3GRUA 3SSMA 2IDJA 3I5UA 2HMYB 5HIKA 3OFKA 4GBED 3ORHA 4MWZA 2O07A 4PYIA 3P2KA 4RTPA 5EMKA 2AOTA 3DLIA 5GIPE 4KIFA 2AOWA 2ZVJA 5BP7A 4B17A 4POOA 3PT9A 4BLVA 3BT7A 4DKJA 2VS1A 2ZZNA 3FZGA 2HNKA 1HMYA 1QAMA 3EVFA 3E05A 2PVCA 2PGXA 4FS8A 5HILA 2G1PA 4Z2YA 1D2GA 1RI3A 2QRVA 3R6TA 5CVUA 3UJCA 4V0RA 5T6BA 1SQGA 3GDHA 2ZULA 4CKBA 3LL7A 5FWDA 3OZTA 3OU6A 3FTEA 4EKGA 3U81A 2GS9A 1FPQA 3E23A 4EMSA 1O9GA 2P1DA 3FUWA 3OPNA 2YR0A 5DM0A 3ELUA 3ME5A 3HA5A 3UA3A 2PXAA 1EIZA 4MQ4A 3EEYA 5E1OA 3C3PA 5C9ZA 2NXJA 3M6XA 5HOQA 3ELDA 3O7WA 2PX8A 3THSA 1G6Q1 2ZBPA 4P7KA 3GCZA 4HTFA 3T7RA 4DCMA 5K0GA 2O0LA 3DR5A 2HTEA 3KKZA 4AUKA 4YUZA 2C7OA 3T7TA 3UJ7A 3BKXA 2GLUA 1Q0TA 3UZUA 1RI1A 3UBTA 3TFWA 4GOOD 3CVOA 3OU7A 4KWCA 1JQDA 3A25A 4HGYA 5CVVA 3FTCA 1D2HA 5GINE 4PYJA 2PV0A 5CIYA 2AVDA 4FGZA 3DXXA 1G8SA 1X1CA 4O29A 3BGDA 4PYMA 5EHIA 4DM3A 1SKMA 2YTZA 1M0EA 3HTXA 5EHGA 2C7PA 4HC4A 5IKMA 1VP9A 4AX8A 1NW8A 3MB5A 3EVGA 3UJAA 1KYWA 2AOUB 2NXEA 2AOTB 3CC8A 1F3LA 2CMGA 4BY9E 2CWWA 2JJQA 2YVLA 2ZTHA 3BWBA 3FYDA 5D1HA 3ID6C 2BH2A 5HIIA 2FYTA 3I9FA 3TKYA 2OO3A 3KPWA 2YQZA 1QZZA 4KIGA 2AN4A 1INLA 3HCFA 3R0QA 2I6GA 4C05A 5DWQA 4DA4A 1JR4A 1SG9A 5FQNA 4RVDA 2QRVB 4BP1A 5LSAA 2XBMA 3ERCA 4YUYA 4EQZA 1KPHA 4EK9A 1YFJA 4FSDA 3EVZA 4LG1A 2HV9A 2HWKA 2KW5A 2A14A 1YZHA 4PYQA 2K4MA 3B3GA 5MHTA 3GRRA 2JH8A 4E30A 3BKWA 1M6EX 4IV8A 5K09A 5EMMA 3EMBA 4M36A 4RX1A 2HR1A 5IH3A 3HVIA 3FTFA 2H11A 3AWIA 3E8SA 3GIWA 3BXOA 1I9GA 3I64A 2YXEA 5CVJA 5EZSA 2IH4A 4WVLA 2UYHA 1B42A 4CKCA 1ZGAA 2EX4A 4YV0A 4E2XA 4GQBA 5CVEA 5BXYA 5DTMA 4HTFB 1BOOA 2BM8A 2B25A 5E2BA 5DX1A 5K05A 5LQKA 5K0BA 3LKZA 3RODA 2NNWB 1NE2A 5T67A 4AZVA 2FRXA 2PXXA 3F4KA 5HIJA 4R8SA 1WS6A 3HCEA 3G8AA 5CVDA 3TM5A 1RI5A 3DTNA 5C0OE 2ZWVA 4PCLA 3LCVB 4P7GA 2XVMA 1O9HA 2B3TA 3Q7EA 4R6WA 2JHPA 3DOUA 3CJTA 1SUIA 3FPGA 1RJDA 5K0NA 4PIMA 4QQKA 2EJTA 1RI4A 1FJXA 5JR3A 1V39A 1JQEA 2ZSUA 1YFLA 4JXJA 5EGSA 4E70A 4RTMA 1VE3A 1I4WA 1NW7A 3ELWA 4EKIA 5DLYA 3FTDA 3DH0A 2P40A 4E2ZA 1Y8CA 2GB4A 2NXNA 1QYRA 2BR4A 5FCDA 5CD1A 2G70A 1YB2A 2GPYA 3HVJA 3NVKI 3P9KA 2DPMA 4BP3A 3NW9A 3IYLW 2AOXA 1R8YA 2QYOA 3PFGA 3OCJA 3OU2A 4OA8A 5FA5A 1ZG3A 5HFJA 2XYRA 3H2BA 3EPPA 3KU1A 3SXJA 4MTLA 3BZBA 5DM4A 3PX2A 4ATNA 3DULA 4G56A 2VDWA 1ORIA 3ANXA 3BWYA 3KQOA 4OBXA 3PTAA 4HSGA 5K0JA 3HEMA 1G55A 1AQIA 3M6VA 3KPUA 2ZBQA 3B89A 2P3LA 1G60A 2FPOA 4AZTA 5FA8A 1JSZA 1VPTA 4U7PB 2PKWA 3AY0A 5FHRA 3GWZA 3VYWA 3R9XB 4L7VA 1P1BA 3BUSA 3GJYA 3EVCA 3CJRA 3EGEA 3P97A 2P35A 4PWYA 1NT2A 3TKAA 2Q41A 1G8AA 2ZZMA 3PB3A 5F2NA 3GRYA 1ORHA 1HNNA 1KIAA 1R74A 1UIRA 1NW6A 2OKCA 1JTEA 2B78A 3B3FA 4IWNA 3DMGA 2ZBRA 3MERA 2V7EA 2ZIEA 3NWBA 1KYZA 2ADMA 3LDGA 3TLJA 4E32A 4YMHA 1L3BA 1XDZA 2OB2A 1KHHA 2Z6QA 3BWMA 5EIFA 1MHTA 3MAGA 2VDVE 4C4AA 1X1BA 3WSTA 4UOEA 2AZTA 3P8ZA 2ESRA 5EVJA 5FULA 2VP3A 3KQPA 1X1DA 1XJ5A 3M4XA 4GUAA 4HGZA 1NV8A 2CL5A 2IIPA 3UWPA 1TW2A 3HP7A 2Z6UA 1NKVA 4HRAA 4PYKA 4QPPA 4XUDA 5DT2A 1I1NA 3OZSA 5K0LA 5EG5A 4AZSA 4ZTBA 4RTLA 1F38A 4XUCA 5LQAA 4FT2A 1NBIA 4KDRA 4BLWA 3VC2A 4IV0A 4RWZA 4X60A 1IM8A 1H1DA 1AF7A 2O06A 1VL5A 2EJUA 4GOLD 2V74B 3UJ9A 1X19A 4OQDA 4RTJA 3HCDA 4GF5A 2AR0A 1VIDA 3MGGA 3UJ8A 3G89A 2ZWAA 1XXLA 4C08A 3ER8A 3A4TA 4ER3A 2UYOA 2PWPA 3LECA 1EJ6A 3P2EA 1N7IA 1QAQA 2QM3A 4PINA 5C1IA 3GRVA 2G72A 1YZ3A 3NJRA 2YXLA 3R24A 4V0QA 3LCCA 1DCTA 3DXYA 4PYLA 3NVMB 4CTKA 3PVCA 2PX5A 3KR0A 2QY6A 4C06A 5K0EA 1IXKA 2I7CA 4M38A 1FBNA 3C3YA 4P7JA 1M6YA 1EQAA 2JH9A 5LQUA 2H00A 3SGLA 3TRKA 2CMHA 1NBHA 3O4FA 2LD4A 3TM4A 2VDUE 3AXTA 2XYVA 3GRZA 5EQJB 3EVAA 3B5IA 5E2AA 3KQVA 8MHTA 3G2MA 2ZIGA 1WG8A 2FK8A 2VZ9A 3PS9A 4LECA 5HZMA 5KYGA 1P91A 5ICFA 2OY0A 4P7FA 2EG5A 3PX3A 3AJDA 1BHJA 4FSXA 4MIKA 2FK7A 3HVKA 2P3QA 4OA5A 5CM2Z 1R18A 2O57A 3LPMA 4BLUA 2JHAA 3QOXA 4Y30A 3EVDA 4QDJA 3BGVA 1P1CA 3FUXA 3K6RA 4RTKA 1MJFA 4X61A 3M6UA 4GEKA 2O05A 3A7EA 4GOMD 4YV2A 3CGGA 1AV6A 4PYNA 1L1EA 3UA4A 1O54A 5T64A 2ZIFA 4GC9A 5EKXA 3PLAE 3UJDA 1L3CA 5DX8A 5EPEA 4C03A 2OPBA 2OZVA 2XVAA 5KQRA 2UZ4A 3KHKA 4RVFA 5E1BA 7MHTA 5DM1A 3FUVA 4GOND 4QVKA 1WZNA 1UFKA 3IHTA 4M7RA 1L3IA 3OFJA 1SQFA 4QVGA 4CKEA 1X1AA 1G38A 3M70A 1VP3A 2IBTA 3AXSA 1JSXA 2WA2A 3FYCA 4YUVA 4FZVA 5EMJA 3V97A 1KXZA 3B3JA 4QQNA 2PX2A 2E5WA 3DUWA 2JG3A 5GM1A 5DSXA 3UJ6A 5FUBA 1R6AA 3PFHA 3C6MA 4FP9A 2ERCA 3IV6A 5GOZA 5GWXA 2IBSA 4PIPA 3M6WA 3MCTA 5ERGB 4RYLA 1R8XA 9MHTA 5FHQA 5CUQA 5E9WA 3FRHA 4OQEA 1FP1D 3NDIA 3G5LA 2R6ZA 2YUIA 2CKDA 4P58A 3B7PA 4X63A 3KQYA 3KPVA 2PXCA 3L8DA 4KDCA 3G88A 4YUXA 4A6DA 2AOVA 2NP7A 1XCJA 5EZQA 2N47A 3NDJA 3FPFA 5F2KA 1UWVA 3Q87B 2ORED 4R05A 3HCBA 2BR5A 5DXAA 5DPMA 5P8WA 3X0DA 5CCBA 3KPJA 3P9CA 4DCGA 4KRGA 3GXOA 1QAOA 4GC5A 4RTNA 2BR3A 2NP6A 3BGIA 5K8VA 2Z6AA 3KQWA 4PGHA 1ZHFA 3LDUA 3G2OA 4RSRA 4C04A 3DXZA 3GU3A 2AS0A 1EG2A 1WXXA 3LBYA 2QE6A 5EIWA 3EGIA 3SSNA 3HNRA 2PSSA 5K0CA 3OZRA 2PWYA 3G2PA 4RV9A 3SM3A 2G8NA 3FRIA 2ZCJA 1JQ3A 1L9KA 5K01A 3P71T 4H0NA 4KW7A 3OE4A 5U4XA 2AOUA 4ER5A 3G8BA 1XTPA 5DTQA 3TPZA 3SVZA 5ICGA 1YF3A 3T7SA
chains in the Genus database with same CATH superfamily
2CXXA 2NTEA 4LSMA 4O2AF 2JVIA 4YQEA 2DULA 2G08A 4NICA 1P77A 4YJDA 3BTUA 2C04A 4ZVKA 1F60A 1IN7A 5A3JA 5ALTA 4JHLA 1JLMA 1XVLA 1MOSA 3VZSA 1R3UA 4EYKA 3OWXA 1NC1A 2UYQA 2JFXA 1WLYA 2P8JA 2WIFA 3DWIA 3RSHA 2F9LA 4G01B 1ESNA 3O95A 1AO3A 4LPSA 4R2XA 1JG4A 3LSTA 1E5QA 1N2XA 1TYCA 1DMRA 5H0IA 4JEIA 1GNPA 3RQSA 2IU6A 2H4JA 5F21A 1MT3A 2VJBA 4HLNA 3CB4A 3SMVA 5L3RA 1IDN1 4FDUA 2OBFA 4URYR 4I50B 1A9QA 1XMJA 2DUNA 3BL8A 4ZVTA 5JZMA 5LU8A 4AY3A 3PFIA 1S9HA 3DDWA 3BWEA 3CT6A 3R4CA 1QRTA 1VB5A 3KXKA 1PT5A 1KAGA 1PVVA 1QH8B 1QO0A 3AI1A 1A82A 2VVTA 2KS6A 5EYPA 4EUSA 2FPUA 4QAJA 1TTQB 2OBXA 3AQIA 1DDIA 3ZV3A 5GMOA 4S2EA 4UXHA 4G0ZA 5L3QB 5IC6A 1T5OA 2PUGA 2BBSA 4J1NA 1E18A 4MYSA 4PHTA 4Q1AA 4ZYZA 2Y0DA 1U1EA 4LWPA 3P9PA 4HLQB 1N3IA 4OXXA 3VRHA 3PXBA 1QHGA 2OILA 4X71A 2BZ1A 1B6GA 1QLWA 1EYZA 1ADYA 1X70A 5HF8A 4Q7JB 2AUMA 1BMFD 1XN4A 2M9MA 1ZRSA 5LBUA 3WRXC 1SUWA 4Y6GB 4LRTB 4RK0A 2R96A 2VPZA 3H6KA 2WICA 1J2UA 5JSFA 3A6PC 3O93A 3DMYA 1VG9B 3QV1A 4RPGA 4IIVA 5CDFE 2K2WA 9GPBA 2Q4BA 2FCAA 3GJTA 3ZHQA 4DMKA 3EA0A 1ODSA 1F12A 4UNSA 5BV1A 4ZN6A 1GFZA 2P79A 5DJ5A 2G8LA 4EF4A 1Y98A 2VRBA 1UF9A 4JJAA 4FMCF 3R23A 2PK3A 3PTLA 4BZQA 2Y76A 3L7BA 3K0KA 3ND9A 4XJTA 4A5SA 1JHZA 1QYCA 1J8QA 1RJFA 2XSZA 1FYVA 2O1XA 1N0WA 4V3BA 1Z7YA 2X8LA 2X9NA 1W93A 4YACA 5JLJA 3TZKA 3T0IA 3RVLA 3UB2A 5FOSA 5FPYA 3CWQA 4FFDA 1FDWA 3AKEA 3UFBA 4CV3A 4AG3A 1X14A 2B82A 2BV3A 2YXPX 1ZH4A 3WGNA 1UODA 2Y1LA 3NBYC 4GZ3A 5I7VA 1WUKS 3I1JA 2ZYRA 3LUFA 4KQ2A 5L6MB 1JPNA 3K0EA 1TPYA 5ALUA 4QXMA 3TNJA 1M5RA 1P31A 2B3DA 4DCJA 2JJ2D 3V2GA 1CUAA 4RELA 3R3XA 2OK7A 4G5OA 4U2CA 4AMUA 5F1OA 5LC1A 5GVRA 1LQ2A 1Z35A 2EERA 1CQXA 3LT0A 4HEQA 4KK4A 3L4BC 1LXCA 1BS9A 2H1RA 3E7FA 4E46A 4HN4B 2HSEA 4OQFA 3SKVA 1NV9A 4KCGA 2PUEA 1O97D 3VH4A 1L5YA 2CEKA 2OWDA 2V7XA 4EY5A 3GQBA 1D5WA 2BEUB 4CXMA 4Z4IA 1J1IA 3NOVA 1SUDA 4KI7A 1EGMB 2R4QA 3JYPA 1USKA 3WSWA 4R71A 5H9WA 1WHTA 3BEOA 1SULA 5BMVF 1YL6A 1DRVA 2FKAA 1ZONA 5LFAA 3K9LA 3NYRA 4KL8S 4EHNA 4BQSA 4QRHA 1UK6A 3G2LA 1K7SN 3U60B 3AEKB 5BSMA 3TZCA 1GAQA 1VKOA 1YRWA 1CUXA 2HRZA 3HBJA 4ZU3A 1XC7A 4LCEA 4Q0MA 5FKJA 4ZV9A 1H22A 2FHPA 5GVSA 1CP2A 4O2BA 5I7OA 1TZCA 2FPIB 1UMBB 4JA2A 4GL2A 1V37A 4XYGA 4RTPA 3TSAA 3O2QB 2QY9A 2FWAA 1WULS 2GR9A 5FTMA 1IXYA 2VDPB 4DLPA 3KEGA 4H0CA 5LP1A 1US8B 1TE2A 1DTWB 3QF4A 3WI7A 1FFAA 3V46A 1QAMA 3CW8X 3E22A 2C9OA 2O8EA 4PPNA 1HTTA 3ZWDA 3GLKA 4CJXA 4BP9A 1WSDA 4DA7A 3UPDA 4EEZA 1A5ZA 1QGED 4RLQA 4I5EA 2R62A 3TTWA 3SBXA 1Z7BA 3G9TA 3LC7O 4ZJZA 1AOXA 4O4JA 2B83A 2PZ8A 2ZRAA 4RA9B 1Q11A 1Y5RA 4N5NA 1U7ZA 3T3IA 4YN3A 3HI4A 3FJYA 2BDEA 2FR8C 4RY2A 5IU6A 1Z2NX 3C5EA 3VNQA 1XXHB 2R11A 2AEFA 1RP1A 1XF9A 4Q18A 2R79A 3R6GA 4G65A 3QA3E 1K7CA 1T9BA 1Z4QA 1P7CA 3LG2A 2AR7A 3LYHA 4UE3S 4JI1B 5A6SA 1XD2B 4PPFA 5HUHA 1AMNA 1E1YA 2HSZA 4Z7NB 2JKVA 1W85B 2JJYA 1YACA 2VT6A 3D7SA 3GNSA 4YAGA 3K6SA 1BWQA 1X3LA 1R0RE 3VMFA 4CMHA 3UBTA 2HSGA 2VPYA 5C8VA 3RTGA 1LH0A 2DTXA 4K6GA 4K9SA 4YREA 3N70A 1K4MA 4PZUA 4PYJA 1GV0A 1NLFA 1JJAA 2H4YA 3F4BA 5I4BA 3GPCA 4PYMA 1X1CA 1PNVA 2A9KA 2H18A 3I2GA 1GCOA 4G26A 1QIKA 2IPMA 4V03A 4WHMA 4WOJA 4XGQA 5ECWA 5AW5A 3VU3A 5JDIC 3SE0A 4J1TA 4UU8A 2QP4A 1BHQ1 1P1JA 2PDAA 1ZUWA 3KZNA 3MB5A 4WAUA 4C22A 4G0VA 3PDWA 4G23A 2CMGA 4I55F 4BY9E 3BH6A 1WMEA 3JQGA 3ZXIA 3IP3A 4B74A 4UATA 4B47A 1I2BA 1SXJD 2AB0A 4N76A 1FK8A 1P18A 5EPUA 3AY6A 4GYYA 1YHZA 4ZALA 2L17A 3NYWA 1UBFA 3T0FA 3DLBA 4IQ8A 1PX2A 2W2KB 3IV7A 2CJPA 1T3ZA 3KKKA 1QF7A 1BO6A 3D6TB 1PGQA 3BE4A 3BL5A 3AVPA 5DWQA 4EBFA 1X87A 1SG9A 3E03A 2AW5A 4UUAA 4IOLA 2GK6A 2XDAA 3SHTA 5DCWA 4AJ9A 3W9SA 3GEGA 2E48A 4QU5A 3QPBA 4CFYA 1BMQA 3EBPA 4KQHA 2YHSA 2OZEA 1LUAA 1UJBA 4INZA 2RJNA 2I7TA 1Y8AA 3NBFA 3GR6A 5B7QA 1TYEB 4DE5A 1KVQA 2AH5A 3KZMA 2C58A 4KPUA 4B34A 1FSFA 1SXHA 5JNWA 3ZWVA 2QTBA 4M36A 1KFBB 2NACA 1Y3HA 3I64A 5EZSA 4DLLA 2HXGA 4PRLA 1PL8A 1DWPA 1KDOA 1NUUA 2IPLA 1YE3A 2JC3A 4G2TA 4KXXA 1KAOA 1XRMA 4UHDA 4BJHB 3LPDA 5CVEA 3UG7A 4HTFB 1AM4D 3B9QA 3N76A 4ENPA 1BOOA 1YA8A 4ZODA 3WWEA 3MBOA 3N0XA 3A11A 3CRQA 2QRLA 1GSIA 1OT3A 1DKUA 5D5HA 5F64A 4ZYTA 3CN9A 1UMDB 1ZHHA 3V4PB 3K8OE 1DAKA 3RIHA 3VNRA 2QG6A 4PFKA 2F8SA 1FYXA 1ISIA 2B4AA 2F64A 1IRXA 3BMQB 4TKVB 4UNPA 5LA6F 4I4IA 1WS6A 4H7JA 5I7WA 1VE5A 4AY4A 1PJSA 4E07A 3MJTA 3PRYA 3WGVA 3N7UA 3QU9A 4X94A 1XPOA 4L9SA 1QONA 5CCEA 2EJTA 1XT6A 4MS4A 1L4BA 3CLSC 2IEBA 3IOCA 3RTCA 5JNUA 5DNAA 1EWYA 3TYXA 1SCUA 4JQSA 1OLXA 1I3CA 1SC9A 3INGA 4O3MA 4E2ZA 5LXTA 2I1QA 3CNHA 2ANBA 2QOEA 4U0JA 1FUUA 3SJBA 3GYGA 2VK2A 1H2BA 3MRTA 1C7JA 1QIDA 221PA 3M9XA 4M0UA 1Y1QA 2OMEA 4EG6A 1CR2A 3MHPA 1C4OA 3NW9A 3UCFA 1XAIA 1FRFS 3AF2A 2AOXA 2ZPAA 1WMFA 2X22A 1U98A 3R74A 1RLIA 1URPA 4RW0A 3U9TA 4M87A 4ABYA 4EZIA 4EKEA 3BDAA 1TECE 1N9GA 2I4MA 2C4MA 4X91A 2XMSA 3HBFA 4G56A 4RZUA 2EFCB 4M49A 3T5BA 4EO4A 1ZJJA 4AP9A 3QYAA 4TV9B 1DQSA 2NZVG 4MIOA 1VOTA 5AHXA 1LTHR 4O8ZA 3AF3A 4LF4B 2Y1KA 4CIYA 3PE4A 1ZFNA 3FKSD 1ZVKA 1ZJ4A 5KTYA 2PKWA 3WAGA 1X15A 1N2BA 3KXLA 4JT9A 3BUSA 2WB2A 1NKTA 2ZSHA 3CJRA 2P3SA 2Q2QA 4ZO8A 3WNQA 2W6ID 2QR3A 9LDTA 1U7XA 2JLXA 2O8DA 2ZRKA 5F2NA 3A6ZA 2WP0A 5F4BA 1A9OA 2GCOA 2ZI6A 2ZBRA 1YQGA 5IMBA 4ERXA 4I99A 5K3DA 3ESRA 2Z6QA 3BWMA 3QEMB 5FR2A 4F9EA 3VTZA 3WLJA 4HYEA 2DHRA 3A6DA 1O95D 4O2AA 4H27A 4V39A 4RKYA 4ZPXA 5KIAA 1SY7A 2VN8A 3CSUA 3PDJA 1ZESA 2DJ5A 2Q6TA 3OETA 3SQDA 2RGGA 4Z1MA 1P2BA 3WRVA 1PQUA 1PJLA 1TCVA 1VJGA 2QGNA 2J7PA 3DFKA 4H0FA 4PEVA 5DCLA 5AOCA 5TMDA 3K4HA 1R0KA 1OPRA 2PMKA 1AK9A 1CJBA 1U9ZA 1YO6A 3R7SA 1NATA 3ICPA 4LXTA 1C1HA 4LX8A 1OXTA 1OXXK 1D1TA 3FLEA 3MG9A 2PTGA 3PQ5A 4KE8A 4WE3A 1C2TA 2GZ3A 4OI2A 3TQTA 1XP5A 2QW1A 3A4YA 5F5NA 3RCBA 4QG7A 3KJGA 2ZIXB 3BCRA 1K8ZB 2E89A 1Y34E 4Q5IA 4ER3A 1E63A 3OVMA 3C3JA 4RABA 1XPUA 4G1MB 3P0EA 2G72A 5DLDA 5CNKA 3ZQ4A 1ZH0A 4BTLA 2E18A 3QKUA 1N4AA 1GGMA 3B5JA 3G0IA 4CIDA 3VH3A 4QG3A 5IYZF 1MO4A 2GKOA 5FTJA 4JVNA 1Y48E 2CJWA 3H5IA 1DAHA 1EQAA 1NG1A 1SC6A 2COEA 3TRKA 3L0YA 3LAWA 4RVCA 2CMHA 3PXCX 4GR9A 5BV0A 4XOIA 1F7VA 5BNFA 5KKCA 2E5FA 4JV5B 2CJYA 5AK3A 3KK0A 3FSEA 4Q3NA 2IITA 2Z95A 3L6UA 4DJJA 1N3LA 1J06A 4IYJA 4PR0A 3IBTA 1SCDA 3PRHA 4Y9RA 3AM5A 1DB3A 3HDQA 2OY0A 3OZ7A 1FTNA 1T0IA 1G21A 4UMDA 1JB1A 1NOJA 4IQGA 5COAA 5SICE 3C1AA 1E79D 3U3MA 4CHTA 1ND6A 4F4FA 1JVNA 4OSPA 3NGLA 2HRQA 2V03A 4KGXA 1V3QE 5C52B 2VWGA 4BNDB 1MQ9A 1JP7A 1ZC4A 2EBWA 1OTHA 3C3CA 5D3MA 3T1NA 1QHSA 3SIXA 4GEKA 2O05A 3OZAA 5H70A 3VR6A 3PQ8A 2BFMA 3DT8A 3ZQJA 1TT5B 2CGEA 2DWPA 4TMKA 2UKDA 3RBAA 4DLRA 1O54A 1KIMA 4IDQA 1MW8X 2XAUA 3D6NB 2MMCA 1Y8ZA 3MQ4A 1B93A 1E3WB 1JFVA 1KEPA 2HU2A 2WWIA 1YR1A 3ESZA 3FRJA 3KM0A 3IMCA 1VECA 3DW1X 3KHKA 4GGPA 3QI7A 4J0QA 4TMFA 4GOJA 5E1BA 3PLNA 1L9XA 2I7XA 5BYJA 1MG0A 1X1AA 2PNFA 1SKQA 5EY5B 1KZHA 3TNDA 5LQMA 2ENWA 1ISPA 5H3LA 1I6LA 3IAAA 4GKKB 4PX2A 2H31A 3P5BA 4WJLA 1WNTA 3KUUA 3U40A 2HWXA 2AYXA 1U6KA 3EJ6A 4MR8A 2VDLB 5T8KA 2PEZA 3P96A 2G82A 3GPIA 1SXJA 1TIPA 3M6WA 2RGEA 4RYLA 1V5FA 1LX7A 3EFOA 3A14A 3UXHA 4C7MA 4EFMA 1SCAA 2J85A 1P4RA 2AG8A 3PGLA 5LPNA 1WWKA 2IXGA 4LHEA 4BVAA 2HA4A 4CT0A 2JD1A 2D2EA 3PGJA 4FOTA 4L9AA 4YI5A 5DBFA 1SVIA 3ZCTA 3C6YA 5JCOC 4TL6A 3UF0A 4G5SA 4NOLA 1Z7WA 1QTQA 4L74A 4DY4A 1TO2E 1PHPA 4I5FA 3U9LA 3PF9A 4UREA 4U3JA 1CUUA 4MR9B 2FXVA 1N0VC 1Z4IA 1Q22A 2G9VA 2NGRA 3KYDB 1ZJYA 4OB8A 5G0UA 4F96A 4KBFA 2Q1YA 1LJ8A 3PE6A 2H1WA 3AZQA 4QDTA 3H9CA 3IEXA 1Z2OX 5IAAA 1QG0A 3O8RA 3EW7A 2WJ4A 4W1QA 1ZK2A 5K3FB 1ZM4A 4NENB 1L8AA 1NQOA 1Z6PA 2W0MA 1IQ0A 4N8SA 1FW8A 3OOYA 4OLAA 3U0BA 3N8KA 2FY8A 5BMVA 2VHVA 2C9CA 1E6EA 2AS0A 3O6VA 4KWIA 4X20B 3QEJA 3SX2A 1JDNA 1VBMA 4QOJA 2O1WA 2XUZA 4PXYA 2HF8A 2DLNA 4BTEA 4YXWD 2V3WA 3D8SA 4KXLA 3A6FA 4REOA 1QCYA 3TQOA 5JYCA 2B8TA 4Y9DA 3PV0A 4ESEA 4ZI7F 1RZVA 3HEAA 3AYXB 3U7RA 4GPZA 3IFSA 4M9CA 4WK6A 3V7FA 1LPMA 3DEAA 3SIWA 1W0KD 3T4PA 1M54A 3A0RB 1AGNA 1R27A 3P9XA 4GKAA 1ZM7A 3GMTA 5KQPA 1O8BA 5BN5B 4G9EA 6LDHA 2VP4A 2Y92A 2NPIA 3NP7A 5DSTA 4DDVA 4YV7A 2YYZA 2EW8A 2JDID 5EEGA 2OG1A 2B6HA 3EZXA 3TZ6A 5ARBA 1RKBA 5FUXA 2O23A 2EL9A 1I3LA 3B2QA 3LH5A 1E0KA 4Q37A 1CCWA 1ECLA 2C2GA 2PGIA 1CUVA 1GDHA 3KQTA 3DEHA 3OX1A 2I65A 3AVVA 2R7NA 3PP8A 4Q3AA 2YHAA 3I6QA 2C7GA 1C29B 1NJ1A 4HF7A 1I7SB 4P3OA 5F76A 1N1MA 1TUEA 3R8CA 4IUBS 1WCV1 4MV8A 1UBUS 4BX8A 2PANA 3GFQA 3H86A 4PLTA 4KSCA 4DNOA 3JAKA 3MZ0A 3CEAA 4RVHA 3RUFA 1E3QA 3AOEC 2DC1A 3E9RA 1YIOA 1AIPA 4P3PA 5LR6A 3AGQA 3C3KA 1ZMBA 5CX1A 2HMTA 4EJSA 1RE1A 1QOPB 4XB6B 1CZHA 1F48A 4QATA 3HV0A 1WETA 1CR4A 5IJ9A 3NHBA 1E89A 2YNMD 1RIFA 1PLJA 3O4HA 4MQMA 2VCHA 3PXAA 6YASA 1PTJA 1SCBA 4OVKA 3GFTA 4Y98A 4JDPA 3LUJA 4DNFA 5CR9A 2GUGA 2UZAA 3PA6A 1KARA 5THXA 3LCRA 4OI4A 5F52A 4DB2A 3O5AA 2X58A 1NYTA 3AX6A 4WN3A 3DE5X 3I3SR 4LXIA 1W9MA 2VXYA 3PIDA 4OK3A 4I55A 1NVVQ 3ANMA 4MS1B 1P39A 4JLOA 4LC1A 4OUKX 4YGYA 1IZYA 1A9SA 5JPCA 3TFOA 4KLCA 5A7GA 1PVOA 1UPFA 1RQNA 3A7DA 3I9NA 3FPHA 4BLQA 1EJ0A 3KXPA 2NUAA 5EA2A 4YJFB 4O5AA 4H35A 2WIAA 3WHIA 3RK4A 3HXTA 5REQA 4AWAA 4F8EA 4W99A 4DGSA 1GO2A 3JZIA 5KSYA 4B8ZA 1EP2B 3RF7A 1JG3A 1NW5A 3KKNA 4DFDA 2BZ0A 1ES9A 5FBVB 1K86A 3LX5A 2KBEA 1YGPA 1XTRA 4OGKA 4R0VA 2H1SA 2VWQA 3WOVA 4BMVA 1KXJA 4C4TA 2FUG6 2Y66A 2WM9B 3EEOA 2YZNA 1ZK3A 2DU8A 4ZKEA 1FDVA 2WWXA 4DMFA 4FEEA 1EWRA 3KR9A 5EUMA 2H08A 2RG7A 4FNAA 4ACBA 4B6QA 1MAVA 5LN1A 4DR2B 3Q7SA 3OM9A 3JWJA 3HXKA 4UPDA 3UJBA 3RRBA 1EUDA 3IO3A 4BJ1A 3JQQA 2BF7A 3PSHA 3O4RA 3SZ3A 2PBZA 3DWEX 3NVDA 4R6XA 4BX9A 1DADA 3AUSA 3DLHA 1MCZA 3L05A 1L5FA 3I9JA 1U3CA 3GMSA 4U7DA 2F3TA 2FMHA 3GLGB 2B0JA 1NPYA 2FG5A 5EN4A 3MT9A 3QWIA 4IDGA 3DAYA 1II0A 3IUBA 3BXZA 3AUAA 1LTKA 1KDVA 4HGPA 4LBZA 1MJGA 4PLCA 1NFRA 2OD7A 2J8ZA 3BULA 3EZ7A 3SX0A 4NCBA 3Q9LA 1KI8A 4M37A 3JZAA 4LF8B 2ZAYA 2YN4A 1KOFA 3VC1A 3DZ8A 4PF1A 1TEVA 4O4HB 3HU3A 1KS2A 4O4IF 2E4VA 2XDYA 3PHCA 4ZEOA 1VJ1A 1L7DA 2ZAIA 2HJSA 3E7PA 3JD4A 1ND5A 2BHRA 3HYLA 3N0VA 3TLCA 4YQFA 2O2JA 4XWAA 5D5PA 5JEDA 3VDRA 1T8SA 5G0VA 3REQA 3G2NA 3RSSA 2IP2A 3C6KA 2EP8A 1ZNQO 3L0BA 4GMFA 4P83A 5A0VA 1IJKA 5JQGF 1SVUA 5KSZA 2QVGA 1BRMA 4TZKA 4W9NA 4E31A 2VTKA 3P26A 1TAHA 2AFIB 2RJOA 2OBYA 2A0XA 2XCTB 1XNHA 5M7EA 5G02A 5E6RA 4WY8A 1BE6A 1IY9A 5JD4A 3IKMB 4I3HA 4D26A 3MK31 1QF6A 2ZBVA 2YRXA 4M0FA 2I6XA 1Q77A 2C94A 4RGYA 4QNRA 4JWTA 2ZSKA 4J0KA 3RS2A 3CGWA 3WBBA 3PT9A 3V2HA 1TJYA 3IPXA 1VJCA 3O9ZA 3EX7C 2RAFA 2K2QB 2QQFA 2OD2A 5AJHA 1HQYE 3ITEA 4HDKB 3U44B 1D9XA 3EVFA 2VHQA 3K2EA 4WLUA 4Y6RA 3ZIUA 4TV8A 2QP3A 1Y1LA 4U6SA 3UJCA 4XPIB 3OQMA 4ZA2A 1M2JA 4IZOA 2P2ZA 2QAIA 5F12A 1YNOA 2J3DA 2W2VA 4RIIA 1G6OA 4MWDA 4CM1A 3LVBA 5HP4A 2XWQA 1E20A 1E2QA 3ZE8A 2VDRB 4QGAA 4EAAA 3WFJA 2LTAA 1NN1A 3JQFC 1XCGB 4OJNA 4M2LA 4WCFB 4FMBB 3FWYA 1GL7A 2L82A 1Q2UA 5HOQA 3KKQA 1EDZA 3U4GA 1P4SA 4A8PA 1LNSA 4OXIA 3MOSA 3T3EA 1NVTA 2QLBA 4CQMB 1DRJA 1P60A 2VHUA 3I42A 3QYFA 1RI1A 4KE7A 4K86A 4OHMA 4BKRA 3QBEA 3OU7A 5C7OO 2YMQA 4EB3A 3NBQA 5FPPA 1ULZA 3RKSA 3A25A 2MSCB 1NVFA 2QQEA 1F0NA 1ODFA 2GHIA 2WM8A 2BKEA 2QUHA 4FGZA 3DXXA 3DYIA 2YTZA 1YDFA 5E7IA 3RYTC 1RJWA 3JAWB 4EEKA 4P80A 4BMCA 4JLSA 2P65A 1R5BA 1Q84A 3ZGVA 4CEIA 4ZFNA 1JAHA 2Q3FA 3EIFA 3UXEA 2AOTB 3U1BA 2RHRA 4PTLA 2QA5A 4M1YA 5JASA 4ENWA 4FDAA 5IYZA 1BROA 2BFAA 2I0FA 1PL0A 4DLAA 2FP3A 3LCMA 2ROQA 5C32A 1Z8HA 2J9XB 1LLUA 1VDMA 3FD8A 5CK4A 1INLA 2ORIA 4M9RA 4D9FA 1SWWA 4GIBA 2JAUA 2HA0A 4IHJB 2GPBA 2ZYIA 1E1CA 4CKBB 5TE9A 4ZEMA 1GD1O 3AG5A 4W7SA 3G9UA 3MD0A 4GU5A 4AMYA 2HZ7A 1U31A 3H8WA 3ANTA 2C8LA 2YS7A 2WMYA 3L46A 3RC1A 3RRZA 2C5GA 4WCVA 2XD9A 4ARZA 4RF5A 2MSLA 5DGHA 3JQ6A 4YK7A 2ICAA 2P8SA 1CJKC 3F3KA 1CUCA 3ZD7A 5GZ6A 1B42A 3TH5A 5FBWB 3CA8A 4C7JA 1TQ2A 3HDTA 3HC7A 3UOAB 1XXHE 3SJ7A 5C3MA 1DFGA 1H2FA 3BD6A 1KMMA 3K94A 1YZQA 1JPUA 4LGYA 1QVZA 5IC5A 1RHJA 2YNMA 2NNWB 2R4TA 4QODA 4R1PA 2OHXA 3ZEAA 1BVYF 1N2CB 2ZRJA 4GX5A 4RL6A 1IBSA 1W4CA 3HCEA 1QTRA 3HZRA 4P4UA 1JEAA 5FPQA 1QLJA 3DFFA 5FBKA 2ZWVA 4PCLA 3W4KA 4DIUA 4EIWA 1XEFA 1Q0TA 3L4EA 1F2UA 2AMLA 3DUFA 4HB0A 1RD4A 4KBGA 4JAVC 1Z6YA 3BA6A 1SUIA 3HO8A 1LFAA 3P1JA 4N6GA 4YJ3F 4XIGS 4AZ0B 4KNWA 4EARA 2B20A 4E70A 4JIGA 4NMWA 2HBYA 1KR2A 1VE3A 3IPAA 4AJKA 4KQEA 4RTMA 4PNHA 3E61A 2LDXA 4KPYA 3RBXA 3DL0A 3ZE0B 4IRMA 4L8VA 2VDOB 2MYPA 1I2AA 3RJ5A 3P9KA 4LEIA 3R5KA 1T2UA 1HOXA 4JEUA 2HOQA 2XWSA 4KAJA 1IEVA 3LXUX 1XK6A 3O91A 3PGMA 3P19A 3H2IA 2OGSA 3KAPA 2PAFA 5EWMA 1UFVA 3GFBA 4ATNA 1CQWA 3QA9A 3SYLA 3BWYA 1C3OB 2GDZA 1GPWB 1N6HA 1NW9B 1CQIA 2ZRBA 1V4BA 4GVPA 3WLQA 3ONVA 4S1WA 1DGQA 5HQ3B 2D3WA 5GJVC 3QEAZ 3TR5A 1E2PA 4I8DA 4BFXA 3TBFA 4KQ6A 4Q12A 4AZTA 3CVXA 3DE6X 3V3KA 1X7YA 1JSZA 4U7PB 5AD1A 2OBLA 3LRPA 3W78A 4F6LA 3LD9A 4J7CA 1PSZA 3VYWA 5KUTA 2F62A 1P1BA 3SICE 3IEKA 1S7GA 4CKXA 2VAXA 4CGZA 3N2YA 1QCCA 2DSNA 1QZ3A 2EBHX 1R66A 3CRRA 2PGJA 4RCZA 3RNLA 4I9GA 1OLOA 5HZGA 1HNNA 1RYDA 1Q83A 3S4YA 4A8JA 1ANKA 3L1JA 3DLPX 4LJLA 2R7LA 4N39A 3LDGA 4KQJA 3Q9NA 2BOVA 4ZI7A 3A1DA 3K0SA 3IAXA 1NI4A 2CD9A 3WIBA 3V48A 4TYQA 1ELOA 2GNOA 1SK9A 2ZJ2A 5JAQA 5LLSA 1JKXA 2O7SA 4P9NA 4U2EA 3GJ4A 3C85A 5FULA 2BAGA 5LP6C 3MVEA 4HGZA 1Q16A 2JCSA 4E4YA 4H7KA 4B85A 3M2PA 4QECA 4ZO9A 1P2TA 1BAPA 1NXQA 1LVUA 3VR0A 4UTXA 1N5JA 1VA4A 2HAEA 3W6ZA 3WK9A 5C2JB 1KYYA 3RHFA 3SVTA 2WYOA 1XU9A 4RD2A 2UUAB 3TTTA 3NKLA 5CCDA 4HDRB 2MHCA 3OMWA 4YAFA 4LOIA 4TL9A 2Q2OA 4PS0A 1JQ5A 1N4DA 1WUYA 3HRHA 1L5WA 3CZCA 2VDWB 2NT4A 3S29A 4BNUA 1QAQA 2QM3A 3ANYB 3OIDA 2FSSA 4G4SO 2XMQA 4ZVMA 3MXTA 5LCXA 5A2QA 3FOWA 2H06A 2JBWA 4P22A 1G5IA 4RK1A 1JGTA 2OQIA 3S2SA 4PFJA 2CVPA 2C77A 1W25A 2RK3A 1SBCA 2YOGA 4CM5A 4YXFA 3I0MA 4JP5A 3PVCA 2QNBA 2JLRA 2Z83A 3JPWA 4IOMA 3VTKA 4CTNA 4CUJA 1U9CA 1UFRA 2IEYA 4WINA 1R9GA 2O20A 2QL9A 3A2LA 1DPFA 4CIVA 3O4FA 3SKYA 1PUXA 2O8EB 2G83A 3GFRA 3T8YA 3GEHA 1TZJA 3M1AA 3LA6A 4NYJR 1M8PA 1X0VA 1GPMA 3W3AA 4C2TA 2OXCA 2HPAA 1F6DA 2HH9A 2HA7A 5I6DA 3AEUB 5JISA 2JNWA 4XI9A 1QP4A 4MIKA 2JAWA 3V2UA 1EUYA 1U0BB 3WWPA 3CBQA 3OY7A 1V0JA 4K6HA 3TDNA 1ISFA 5B6IA 1GFSA 1LI7A 1L0BA 2BGRA 2KMLA 4L72A 3VC3A 4BRSA 4NMMA 4ESVA 1OI4A 1RZRA 5CYFA 4UUOA 4OSEA 1YH3A 2H2GA 3JPYA 3EPHA 1YR3A 2YZ2A 1B23P 1EG7A 2VTDA 1AV7A 2WDPA 4LRSB 4ZOBA 1NXOA 2XNDD 4DBZA 5A5DA 4S04A 2M6SA 2WYIA 4C4OA 2XZOA 1LBHA 1JFFB 3K6SB 1RRKA 1Z47A 1BS2A 821PA 2ZIFA 5CDHA 4MVJI 5EKXA 2HHHB 3COZA 1JDBC 2VYFA 2Z9DA 3HEBA 2IZ1A 3N0RA 4U4AA 2J9ZB 4B3TB 4Q4JB 1YQWA 1MVNA 1TM4E 1G8JA 3QVMA 2AXQA 1RYNA 1U6JA 3CSSA 2Q9CA 4NU5A 4WASA 3DVRX 2J5RA 5B55A 4A0QA 2IJGX 2QDKA 1OF1A 5FWXB 5JS2A 2GM3A 1PV2A 2IYUA 3OTWA 4E15A 4M89A 3PU6A 1O6ZA 3QITA 4KQIA 3FYCA 2IUFA 3NUGA 1A7KA 4FZVA 4CCYA 1U3TA 3B3JA 2XGJA 2I2FA 2E6UX 2G67A 2PX2A 3K96A 2EIHA 3MPUA 5KI6A 4B9AA 4QU0A 3UJ6A 2QHXA 4XYMA 5BYAA 5JARA 3RU3A 1UKYA 2Y71A 5KAMA 9MHTA 1VIMA 1ID8A 1FC0A 3E3NA 2QAGC 5IUKC 3L8GA 3B60A 3TQIA 1IEQA 2HO5A 1HKHA 1HDXA 3D4LA 3FRHA 1V11B 1NQ5A 2NQ8A 2PZJA 4LC9A 5KU7A 2QG4A 3TJMA 2BFFA 2QIOA 3DEIA 4LNUB 4XA8A 3RUCA 1CF4A 1GT6A 4BO6A 2XHZA 2V0NA 3R0VA 2JA2A 3MUNA 4XVCA 5HM8A 1OT5A 4ND8B 4C76A 4BGDA 1MQAA 5K8CA 3S3TA 1VLVA 3ZZ1A 1ZM2A 5JBIA 3NS7A 1L5ZA 3P32A 4DIEA 3GJ0A 4DC9A 3OM8A 1X38A 4FOSA 4O4IA 4B1FA 2CVOA 4ZT6A 4DV2B 3FTQA 3UMMA 2GGSA 3WGYA 2FEWB 3EC1A 3QLJA 5TMEA 1BHSA 1X7XB 3X0DA 1E96A 1KKMA 3FETA 4GI7A 3Q0IA 3Q11A 1JLLA 2XVYA 5COBA 3AR3A 1EA5A 1LC0A 2WFZA 3TDKA 5TR9A 1ZHFA 4DG9A 1DO0A 1GQOA 3OE7A 1ICIA 5JQGA 1TC2A 2QX6A 4QRIA 4EX6A 1E3LA 4HD8A 4NFHA 2A35A 4ALNA 2YJ5A 3BFPA 3D0QA 3RTAA 3ZHTA 2V6BA 4KLZA 2COKA 6ABPA 1RFLA 2IYOA 4EB8A 3ESAA 3I3OA 1ARZA 3EUWA 1BE8A 2ZCJA 1D5CA 1JQ3A 2IYTA 4CDNA 4EVQA 1H2XA 5LNK1 3SPXA 2RBGA 3UJNA 1UBHS 3UPUA 1XTPA 3WIOA 1QOQB 4DYDA 3T7SA 2AJBA 3DZJA 4PU0A 3TTXA 3M83A 3I5XA 4JZKA 3U19A 1R6DA 5ERYA 3WGOA 2BZGA 2V65A 4ZGWA 2W6ZA 3N75A 4P4GA 2PKYX 1KEUA 3C74A 1T9KA 1FQKA 3Q5GA 5LXTB 4FHGA 3KZXA 2XEXA 4TS1A 1JEYB 1UP6A 3KKOA 5EMLA 3VO1A 3O9MA 4KH0A 1XDGA 1XA3A 5FYDA 5BWNA 4NHOA 2C03A 1TW3A 1V1MA 4RBNA 5BQFA 1PDWA 1CUSA 1WDKA 3DBLB 2CYCA 1UFOA 1Z88A 2DAPA 4EEXA 3HMKA 2ZLBA 3DLTA 4CZ2A 1BWRA 1R0ZA 2Q9UA 4G09A 4H3VA 1H8ED 1Q7CA 2FZKA 2Z9CA 3CRVA 5DM70 1RQRA 2BPOA 3MAJA 3HRIA 3NM5A 1KPGA 4TRJA 4MTCA 5TXGA 4JXZA 1K4KA 1C3XA 1Z6XA 2V4UA 2XJ4A 3I53A 3IQZA 4UKDA 1QQ5A 1ZVQA 4EGAA 2A0KA 4MNTA 3IRVA 1SHLA 4C3ZA 4RA6B 4A6EA 1N7GA 3ES9A 3C8ZA 1YMQA 1ONNA 4GPAA 4CDRA 3I9OA 4DQVA 4EYGA 3RC7A 3DEZA 1SUBA 3MJEA 2HREA 3PDIB 4D6PA 1ECPA 4XWYA 2DM6A 2Q7XA 3WLTA 5HRAA 4LKOA 2YV2A 3D81A 3P2IA 3UCEA 3NPMA 3F98A 3EVBA 1V2HE 3MT0A 4IS3A 5MGNA 3KPYA 5J63A 2GBFA 3LT1A 3ZWWA 1PG2A 3VSDA 4UDOA 1X8KA 4HB4A 4HJXA 3I83A 2WJVA 3DPSA 5JBNA 5CM9C 2P7IA 1XLTC 2VDNB 2AVNA 5IKPA 3CONA 2SCUA 3UH1A 4W9MC 3E9QA 1AO0A 3D3EA 5K0ZA 1KO7A 1VSUA 1XKXA 2ZREA 4YMWA 2FV8A 3S2ZA 3ZD6A 1QNLA 1RKXA 1PJZA 1WXFA 5KSPA 3RSLA 1Z6AA 3REFA 1P80A 1NE7A 1Y1PA 1XCBA 1ZD1A 3A27A 2R65A 4UNQA 2FQ1A 3V7UA 4WLEA 3RAJA 4F6CA 2NW6A 5IBRA 5CXXA 1NNLA 4UC0A 3CJQA 4J16C 4HXEB 3R7LA 3DAHA 2DJIA 3KSBC 1I9CA 2DYKA 1T5HX 3A3NA 5SZHB 2PVSA 3GC6A 1Q7EA 2YH2A 3H2SA 4M53A 2AF3C 2CK3A 1CC1S 1FX1A 1XDSA 4GPD1 1T4MA 4Y2HA 3SS8A 1C9NA 4AG5A 1WD5A 3HR4A 1GZ3A 5FDFA 2G9RA 3K32A 4JFAA 4EHHA 4XGRA 5BWCA 1IBRA 3DFMA 2F9MA 3RFVA 2ZB7A 4AZ3A 4XRGA 1R4NB 3CLTD 2B5OA 2GPAA 2C9YA 2CJWB 2M6KA 3T0GA 3QWBA 3CLRD 2AMVA 2O2EA 1PL6A 4URFA 4AL4A 4JI7B 1EUZA 1G3RA 1T36A 2ZCUA 4TMYA 2Q0QA 5EE1A 4CTOA 1Z0SA 3KWMA 3V55A 5AK4A 1CLUA 2EWWA 4BMNA 3L6DA 4FJ0A 1UOEA 4QOSA 3IBSA 5FWNA 3FMOB 5B4TA 3WFIA 1ODLA 2G04A 3EXG2 5LIRA 1RQLA 1WX1A 3K9CA 2O1SA 1JU3A 4DOMA 1XHEA 1XROA 4WOPA 2UUOA 4YJ3A 3QPUA 5C51B 5JRDS 3NALA 3QFHA 1JF8A 2VHWA 1Z0FA 1M7GA 2QMZA 5AW0A 4GVLA 3CO5A 3IDZA 4UCQA 4Q4DA 3IAS6 3D1LA 1FVHA 4KYUA 1QGUA 2D2FA 4WIAA 4DLZA 2R8EA 1DBRA 4OK6A 5EKTA 4CETA 3GLRA 2QEQA 5ADHA 1O7JA 4G6ZA 1ZKDA 1BKYA 3AC0A 3NMUF 1IXZA 1RQ7A 2E55A 1LB1B 2GCPA 2HTFA 2HMYB 4FMCB 4K7JA 1LBEA 3O47A 3GRAA 2Y1EA 4Z8XA 1SEVA 3IUQA 4KMSA 3GMDA 1Q57A 2VHEA 4L0CA 4NJOA 5MFZA 3PR3A 5BP7A 4QGBA 3FHTA 1OXBB 4ZVRA 2YDYA 1W2GA 1AZSC 1T3GA 2ZUWA 3IILA 4IZHA 1PJ8A 2HK8A 3K9HA 1UPBA 4Q4HA 4N0MA 2D62A 2E4XA 2A5FA 2PVCA 3BE5A 4JMLA 4AP5A 2YY7A 5FV4A 1JT9A 1MN6A 1O0SA 2DECA 2XDQA 3VZBA 1K1EA 1M66A 2B1JA 3GDHA 2HLDD 4HDQB 1ZD9A 4Q1EA 4US2R 4LC0A 2IXBA 1N2IA 4ZOLF 1KQ3A 4LISA 3GLGE 4KDEA 1XVTA 2XF8A 2MR6A 4GWLA 3NHAA 4KN6A 3RFCA 4BB9A 2IEZA 3AVWA 2QYTA 2RKOA 5DM0A 3TSOA 3R0IA 4JI6B 1QF9A 2JGDA 3EG9A 4E4TA 1J8YF 1DLJA 2FW0A 4MQ4A 1P3Y1 3KE8A 1JIVA 2IYSA 4OKIA 3F5MA 2FW6A 5JSKA 2YZ7A 4D25A 1A5BB 1W2WB 4FDTA 2VUHB 3EDCA 3LWZA 3THSA 2WHPA 3GCZA 3VKVA 3X1XA 4CIXA 3EXAA 1L8LA 1Z6QA 2CUNA 3FBWA 4NABA 1FYDA 2QMQA 4GPEA 3VR4A 2IYAA 4MW1A 1GNSA 1U80A 2D5CA 3AL3A 5EKSA 4ARVA 5AM1A 3P0IA 3KOWA 3MJ4A 3ZV7A 2VSYA 4FFSA 4KWCA 1KBZA 2TS1A 1N0HA 4J7AA 3I9KA 4TKZA 1SCKA 4LA4A 4CLEA 1JKJA 3U5TA 5CD9A 1MO5A 1TM2A 2WD8A 1G8GA 4Q9DA 1OIXA 4QOEA 2ZU6A 1B8NA 1PR1A 1R4MB 1ECFA 4ZXPA 4BO9A 1JAYA 1TQ4A 3CPHA 1NYQA 1SN7A 1HYHA 4L78A 2OCKA 3ECCA 3C7CB 2AFIE 1VPDA 4URVR 2YVLA 4LGMA 1HK7A 2A9RA 4UHCA 3AV3A 4L75A 4ZC8A 4DLSA 1YBMA 4IKOA 1RWVA 5FO0A 5EINA 6Q21A 3GJ6A 2AJ8A 3GT4A 2IPOA 4QUJA 4X85A 4L22A 1E2NA 1X9GA 1OCEA 2P6MA 2ZB2A 3CM0A 3E9MA 1Q3HA 3ZXXA 1XK7A 2F8MA 2Q5EA 3RVMA 4LJ6A 5DB4A 5LSAA 1H42A 2H1OA 4Z4FA 2O8BA 4FDVA 4JJIA 2P0AA 4FGJA 1ILEA 2HJHA 2XUKA 1FU7A 3G0CA 1QIEA 5DEOA 5DOZA 5ARCA 3TEMA 3I5YA 1DEKA 3NBZC 4GYJA 2PSHA 4DCOA 4FB5A 1SUFA 1U0LA 3WLPA 3FYUA 4UBOA 3DZFA 3EMBA 1SRQA 4UAUA 5LDGA 4D4JA 5FUYA 1NJ5A 1ZWKA 4P4SB 4DREA 1QX4A 2YXEA 3AJRA 4G81A 3HY3A 5A4JA 2I71A 2IL1A 3WGJA 3UK1A 2HCFA 1KZGB 2V6MA 1EKXA 2I29A 1GUFA 4E2XA 2CFTA 3FHJA 4H15A 1CUDA 1UKAA 1KSGA 2RHMA 1FFXA 1T0UA 1BW9B 1Q21A 3E9NA 3HB5X 4B3JA 1KEEA 1QU2A 2HK7A 1GRCA 2VYCA 1NU6A 2CLHB 4KLNA 1YAJA 1GTVA 5DE3A 4E1BA 1A69A 1D9ZA 1L5MA 2X5NA 1DQYA 2JFYA 4QDXA 1N0UA 3D0RA 4GRIA 5B3KA 2WZBA 3D6VA 2UV8A 3DS8A 2GEUA 3F4KA 5CW2A 1E1RA 2D74A 3QM1A 3AYZB 3K5PA 3NH9A 2I34A 2QTZA 3KO8A 1MJGM 1O9HA 1YR6A 2YC2C 3LYAA 3IPRA 2JHPA 3ORSA 1OE0A 2R5FA 3HYSA 3ZX4A 4CMGA 3E2MA 3FPGA 4BEBA 3FAKA 5I01A 4JJ6A 1T3TA 4TGLA 3U3ZA 2PL5A 1LS6A 1NT4A 1SKBA 4COKA 5A5VA 2GBGA 2PV7A 2GZHA 1UKEA 4OIMA 5BUCA 3FBTA 1E0AA 1MFZA 2GB4A 4Q3LA 2NUAB 1RXUA 2ZUDA 5BN4A 4EI8A 2DVMA 3JARB 4N3BA 1DO8A 1J5EB 4KRYA 3EPLA 4TYWA 3IX7A 4H17A 1N6PA 4PZDA 1KBQA 5FLXA 4IBOA 2YZKA 5LOVB 5G41A 2O19A 3OHPA 1FRVA 1ZG3A 4V38A 2JAPA 3H2BA 4CLOA 1EFAA 4C3UA 4JBIA 3BRWD 3IUJA 2HI0A 3IL2A 3QX7A 5L51A 3B38A 4RXTA 2A0UA 1PP4A 4HSGA 2DCMA 4JJFA 4KO8A 4UVEA 3ZJ5A 4XAQA 1IJEA 4FWTA 1AQIA 3O4GA 1KORA 4LQDA 2BFBB 4FYVA 1PG0A 1EGAA 1EUDB 2HMVA 4Q48A 1IIRA 1V8FA 4MLCA 3JSXA 1CWUA 4IHAA 2ZBDA 4NJMB 4M76B 1EFUA 3QVGB 3F8TA 3NC0C 2IYNA 3UICA 1CHDA 3IOEA 1V6CA 4BBJA 3UM9A 5CW1A 4DR5B 3B12A 2XTZA 2JJ1A 5KTOA 2QPOA 3TX6A 4YBRA 2IF0A 4JODA 3SHFA 3AL2A 1NRWA 2OKCA 3B3FA 5G1NA 4EFNA 3DMGA 3ESDA 1PNOA 4BZPA 5FBLB 3TG2A 1KYZA 1VI5A 1BD3A 3MLEA 1XLVA 4WUTA 5FEUA 3CVVA 3FWHA 1WE2A 2E4ZA 2OB2A 2OP1A 4HDNA 4L1KA 5EJ4A 3CU5A 3QNWA 3K72B 4JXXA 1PW5A 2VF7A 3FKQA 1N2CE 2BEJA 3IVCA 1UK7A 4GL4A 3P8ZA 4G4IA 1WOMA 3DOOA 3EPRA 3EXHA 3I9V1 3DBOB 4AIIA 4QT0A 3FN4A 1SIUA 1H1LB 5INTA 2Z6UA 3QKTA 5IT5A 2NXWA 3RYCA 1I1NA 4UUMA 5ECDA 3LRTA 3RUPA 5AUPB 4L76A 4ZQIA 3KB8A 2FQXA 4P4TA 1PGNA 1M0TA 4MR7B 1TKRA 3DE2X 1TUIA 2EFEB 4YP6A 1AE1A 1P2GA 4L4ZA 1KYIA 5CDYA 1WZIA 1AF7A 1YR7A 2N46A 1H23A 1YR2A 1VYUA 4MYTA 3HCDA 4M1TA 5CJPA 1KVSA 3JW8A 4C08A 1SC3A 5B7GA 4PLVA 1J07A 3BA1A 5CAEA 2NO1A 4ZYWA 2FR1A 4NIMA 4ZQEA 1KQFA 5I9MA 3F6YA 1L5HA 3HCPA 4BGIA 1U5BA 1NVVR 1VG1A 1ZWLA 1MO6A 4RGBA 3TGPA 2OAP1 1U7TA 3ROGA 4QBHA 4DEXA 3I09A 1DCTA 4RPJA 4CTKA 5AVQA 3KR0A 1VG8A 1ZEMA 3EEIA 2QI9C 2FB9A 3IR6A 5LB4A 4GM4A 4B2PA 4GKJB 3KB6A 3QFRA 5SYMA 1Z0KA 4TV8B 1LLDA 2XYVA 1B00A 3GRZA 3O3MB 4YJGB 5FBQB 4ZQGA 4I1YA 1E6UA 5E2AA 4D0LB 4BNGA 1F6BA 1WG8A 2BBWA 2QKYA 1VSVA 5ICFA 5CA1B 5KYGA 1XMQB 2D4HA 2JIDA 1N2GA 2AGVA 3QQPA 4ZHSA 3GRPA 5A2GA 4OA5A 4XB2A 5CIWA 3LPMA 3MWEB 2A2ZA 2X0IA 1XZAA 421PA 1XBTA 2NZJA 3QOXA 3WSVA 3T5GA 5AI9A 1LPPA 2HC9A 3K6RA 3FVTA 1BSVA 1F4VA 4X61A 4TRMA 3A7EA 4K2HA 4Q19A 3AHIA 4E1AA 2FPPB 1GPLA 3EIXA 5FUBA 1GZDA 3NANA 3JD2A 4NU8X 3OSZA 3QJ5A 1WCIB 3QPVA 5JC1A 2BFOA 4XLZA 4LRUA 2WZDA 3IQEA 3CS3A 1NOIA 2OYCA 4CIAA 1FXUA 1VMDA 1L3IA 1SA0A 3PHIA 3GF4A 4U9IS 4CM9A 5LMZA 3CX6A 2IBTA 1WDWB 3FTPA 4P4LA 4ENTA 5A9SA 4CEIB 3CLUC 2RCNA 3VV3A 3SG0A 2QRHA 5GONF 2XGOA 1NM5C 3U26A 5LIPA 4OAPA 1E3MA 3G85A 4MMZB 2ZB3A 1A4XA 2EGUA 3A4LA 4OV6B 2AFVA 3COJA 1KI4A 1S89A 2LDBA 3CIOA 2R6DA 3PT5A 3DOHA 1OB5A 2FP4A 2GPWA 1T2DA 2DLCX 3OZCA 1OLSB 1VCOA 2WJIA 4AN0A 3NWJA 3QFTA 1QDUA 3QBTA 2HJRA 3KV1A 4L9RA 3HP1A 1RYZA 1BQ3A 3EAGA 1G6KA 3H99A 3HKEA 2AYZA 4FI3C 3RNOA 3SXPA 2J9YB 3ISVA 5J47A 2MDTA 1ZY2A 2HRRA 3Q87B 1LJLA 4HDSA 3IE0A 4TSRA 1C1XB 2CF6A 5J2TF 3VHXB 4R16A 4OIFA 2OV3A 2HDNB 1ETUA 1SG6A 2ZJ4A 3GZ4A 1T24A 4AN1A 1VHDA 1IWPB 4KGDA 3OT4A 4GC5A 5ITZB 3BGIA 4C6TB 4G5GA 5H7XA 1AKWA 4L5YA 1YBVA 2YV1A 4WLOA 1M9NA 3G5UA 1B76A 2J0EA 3CNEA 4KRFA 3AI7A 1A77A 1M7HA 4RV9A 1F51E 1RCUA 2EOAA 4HLCA 4YT4A 4Q01A 3SZOA 2XRMA 4IX9A 4HB2A 1C7QA 3P71T 3LCJA 4IIBA 1UWKA 3M4ZA 3O9VA 3KOYA 1A5TA 3VZDA 1PL7A 2WU4A 3G8BA 3NUQA 5JWOA 2PD6A 1ZUD1 2O8FB 3ZWOA 4FHEA 4CIBA 3AR9A 3HNOA 2F59A 1YBFA 2QLFA 3GAAA 3GRFA 3ORYA 2OQRA 4ER6A 1ZMTA 2R3SA 1QRRA 2HWUA 4ZC1A 2ZUBA 1A1VA 4X97A 4OGLA 2VP0A 1RR6A 1SUSA 1TYAE 4MPDA 3R9WA 4L4XA 4LYFA 3WADA 5BSVA 5CA0F 4R9UC 4KXVA 3D43A 2J5KA 4P33A 4Q00A 1S1MA 4DV0B 1YOVA 1QDEA 2C2BA 1Q74A 4MCAA 4ZOLA 3BRWA 2DFNA 1W0JD 3USES 5KSOA 6ADHA 1JJIA 3QPCA 4ZIRB 4J03A 5BSGA 1OYOA 5F5LA 3ZKWA 4D4GA 4GDFA 3NVAA 1D0IA 2D1TA 4RANA 2ANCA 2BP7A 5E7JA 3TIVA 3ZDDA 5AHWA 1JG7A 1XMPA 4OGWA 1CETA 4FDMA 1QB7A 4BZXA 1PD1A 3NHRA 1LV8A 3AUTA 1EI9A 1IN5A 1JI0A 1W5SA 3U7QB 4IJQA 3W77A 5FUVA 4E6PA 3BMCB 1I5RA 1C5KA 1GA6A 3C97A 1LBIA 2ADOA 3CUSA 1DZ3A 3DGFC 3JQBA 4F4JA 1Z3IX 1NL3A 1GPNA 2IHBA 3KT6A 1A9PA 1M33A 3CXUA 5ALDA 3ABIA 5FWYA 5KYUB 3L0PA 1ZOSA 1Z7EA 3I8SA 2X0JA 3N5KA 2ODQA 4DJ5X 1Q0SA 3AV0B 1V8PA 2QT0A 2H1CA 4RIGA 4E51A 4IX1A 4HQ6A 4X3CA 1IZ8A 1T2CA 4ZJUA 5IUNC 4A2PA 5FB3A 3KVVA 3T95A 3WRYC 4JR2A 4IXTA 3L4JA 4K88A 5E1MA 4PZCA 3FG9A 3UHAA 3LP6A 4EPRA 3V1TC 2WB4A 3PHJA 4LOLA 3FTNA 1WXDA 5EUQB 3RASA 1G41A 1Q14A 3GH3A 3W3AH 4EDHA 4E0BA 1M5UA 2HQRA 1AQLA 1NVWQ 1Q0RA 5AKIA 3RUDA 2ABWA 4Y9UA 4R2JA 1TGVA 3EOAI 3DYVA 1B6RA 4X1YB 1SHTX 3W06A 4M60A 1X9IA 1PT9A 3BJZA 4C4XA 5A4AA 3AETB 2PBFA 3HY6A 3WBJA 4ITRC 6PFKA 5IAEA 5B2FA 3KTAA 2Q7OE 3PQ2A 4IJUA 3AR7A 1IB0A 1YA4A 3S0JA 3R0JA 2R97A 3RVJA 4BATA 1L4EA 1OYYA 5K3EA 3W5CA 4B8WA 1PN3A 1KR5A 3VGPA 4U2BA 1D0VA 2M1ZA 2P6OA 4R1TA 1T6XA 1M2WA 1U3VA 3RHZA 4EW2A 1YUBA 2J3IA 1KPIA 3LYLA 4UDYX 4FCWA 5EE0A 4DQ0A 5CBPB 4FUQA 1WB4A 3OQPA 1NXVA 3L0ZA 4M0KA 1TQ6A 3KQSA 5IPFA 2NSYA 2Q3LA 1K5HA 3HL4A 1WSAA 3IMFA 2VLIA 4RY0A 1E4EB 2Z2YA 3DBRB 4WK2B 1N5KA 1N6LA 5E38A 3VYUB 1NMZA 1NASA 4KGVA 2AN5A 1IOZA 1S2OA 1VQ1A 3TVYA 1I33A 4YHHB 3ZHOA 3DMTC 3E0XA 3AERA 2YYSA 4E94A 3U3DA 4KE6A 4NRDA 2XOKA 2ECPA 1PGJA 3WQBA 4MKHA 3FNQA 4CL8A 4C4ZA 4N03A 1J4AA 1Z5GA 2WZCA 2P2CA 4RF3A 1UJ6A 2G6TA 4GPIB 4OBWA 3FCSB 4XLLA 1T9GR 4EVSA 4HWSA 4GHWA 3ZCXA 2JKYA 1PR5A 1EHYA 3CF4G 5EC8A 3RU7A 4XFDA 1AQJA 1W36B 1N2OA 2OO7A 1NUAA 4CHGA 1UC4B 4ZEXA 3HWWA 3SOPA 1C30A 2VZ8A 3EOZA 5A5EA 5AKJA 3B6MA 2I4NA 4GSLA 1H9BA 1U94A 2WPDD 2TMGA 4O25A 4P8RA 5H02A 3KVNA 1ISSA 4GMHA 5F9FA 2HN9A 4F3CA 4IXMA 4UAVA 5AVJA 4D0GA 1GCGA 3WFZA 1J2JA 3AUJB 4FXOA 1DWQA 3V4OA 2X9QA 2WWYA 2VIIA 1U2GA 4PHCA 4B7CA 3BDIA 4B17A 4BFYA 4HY3A 4R4JA 4HNUA 3T5PA 4R8VA 5M04A 2BM0A 2P6UA 2ZZNA 2BGKA 3EXFA 1W88A 2XNSA 3JVVA 4U0KA 2PGXA 4ZVLA 2ZS8A 2G1PA 1QP7A 1D2GA 2V7BA 4B4UA 5JH7A 2BFFB 3DPIA 2YXNA 3MA0A 4NS1A 4CR7A 2BI7A 1KA9H 3ETLA 1RC1A 3GGPA 3PQ4A 5AW9A 3ROMA 4CLHA 2P78A 2GS9A 3GDGA 3U81A 4AN4A 4EMSA 4WBNB 3D4OA 3UTDA 1P9RA 3O2SB 1J8DA 2X76A 3RAEC 3K5HA 3E6AA 2DBYA 1FUEA 2V7GA 3ZS8A 4YB8A 5JYDA 2C29D 2AX4A 1EIZA 4RLHA 2PSJA 3BXHA 5E1OA 5L3SA 2FMTA 1SQ5A 4O4IB 3RV4A 5HDBB 4GWKA 4XJVA 1DV2A 1K4YA 2P9ZA 1M34A 3HR8A 2IOYA 2JIPA 5PGMA 2O0LA 3QNMA 1G21E 1JLLB 1O96B 2RHHA 3T7TA 3UJ7A 1C3VA 5A9RA 4UTVA 4GEGA 1PNRA 3H2GA 3HBAA 4R7GA 4KR7A 1JQDA 3JQ8B 4FN5A 4NONA 2JD2A 1I4DD 3K30A 4EHIA 1OU4A 3OCUA 3WYGA 1U1CA 4LHYA 5I8ZA 4X65B 3RD5A 1YRBA 4QYWA 1EX6A 3GVHA 2OM2A 5D01A 3O3NB 3RVNA 2FZVA 1U2TA 3W5VA 1TJPB 4ND4A 2O54A 5JTTA 4N40A 5I9IA 2C00A 1NUQA 4DV5B 2AF4C 1ZW1A 5ALQA 3G5MA 3GY0A 4XCQA 2FYTA 1I2ZA 3HFRA 1WRBA 1U1IA 1MIOA 5AVRA 4BIIA 2RGRA 3R0QA 4C05A 2R1VA 3LFUA 1OAOC 4HEA6 3PQ7A 5DN6A 5KNLA 5GZ1A 3STHA 4NTZA 4UNIA 2ONJA 1YCGA 3WQRA 1I80A 1AZTA 2A14A 1YZHA 1K27A 2IW3A 2WKPA 2K4MA 3LO5A 3N9IA 5DFAA 3LU1A 5TPZA 2H2FA 1EPUA 1W0JA 3IJ5A 1XTKA 2ZGVA 4Z9XA 3DOEA 4DPMA 5KYXB 3KP1A 1X92A 4J3JA 1VJ5A 4C1BA 2HR1A 1MGOA 2CCGA 5CBKA 1VMKA 1YFKA 2PKQO 3MTJA 4OP3A 5CB0A 1A50B 1TKAA 2WSBA 2C1EA 1DXYA 2EGGA 3IE2A 1X6VA 4FPXA 4YPFA 3P5SA 1CUEA 1U8TA 3RIXA 3P0RA 4HH0A 4YMTA 3MMSA 2VPWA 3G2JA 5E2BA 4F46A 5K05A 2WSSD 2H92A 4RS3A 2N1MA 1XQYA 3D0KA 3PYXA 5F9MA 1ZL2A 3A8TA 3D5TA 4YIHA 5IXJA 3U4MA 4YRNA 1QHNA 4TTPA 3OQBA 4ZOEA 2VBIA 4YWJA 1NVUQ 4AZVA 1YUNA 3NDPA 2LBPA 4JK3A 5A0TA 4FGKA 1KMHA 4UW9A 2XQGA 1AN9A 1S9DA 2WHQA 4UEOA 1FL9A 4XFJA 4NHEA 3EY9A 4YT5A 1LTQA 2PT5A 2XX3A 1NXXA 2FW9A 3NC1C 3H5WA 3RI3A 3VXKA 3Q85A 4ALIA 4DMUB 3ZJTA 3VOTA 3U1VA 1M8GA 1RJDA 4PHFA 5BNWA 2P9YA 1XWWA 3AHGA 4GBJA 5CDSA 1ZOLA 4E5MA 4BMYA 5GONA 4BB6A 3R7NA 3UC9A 4JLWA 5HJ2A 4YCSA 3Q10A 4YLEA 4M6WA 4EKIA 4DHWA 1IY0A 2AE2A 2I4OA 2FX3A 3WTBA 1GQSA 2OHJA 1ISGA 3MEQA 3ZXYA 3ICWA 2Q5QA 3AMVA 2W70A 1T8PA 4QBKA 4L5AA 2IOQA 1H5UA 2ZPTX 3H3JA 4M4SA 3T3OA 3FNGA 1IM2A 1W5TA 1NONA 3RFFA 5U4QA 3PUJA 1L5SA 4KO2S 4K1LA 4OA8A 4XIYA 2ZK7A 5FA5A 5BT8A 3QWAA 1KFCB 2VF4X 3E5HA 4XZ3A 2FSHA 2MR5A 3KU1A 4BO4A 3WS7A 2P91A 4XW2A 3TEFA 1L6IA 3Q7IA 4WZZA 1FYWA 4F4HA 2X8WA 1G19A 5K0JA 4YJ2B 1KDZA 2VJKA 5J2TA 1WCXA 2X40A 2QVBA 1GUDA 1AKUA 1Z62A 4CKCB 1IVYA 2C3OA 1YQQA 5HRUA 1AXGA 1NHGA 3V7YA 2KSQA 3SSAA 3W6OA 5G0SA 3GJYA 4UUQA 4N1AA 2J32A 3LT2A 3MXOA 4GMDA 4IKEA 2OHGA 2CHEA 5DTIA 3SC6A 5AXAA 2H54A 2AKEA 3ETEA 1RHUA 3FR8A 3EXEB 4M1OA 3KQUA 4XJSA 3CZQA 3D4PA 3X2SA 2B9VA 1QTNA 3G8YA 4LRXA 3CT4A 1DSSG 4FYPA 2SBTA 4IXNA 5KWSA 1A8HA 2OWEA 4Q9JA 3UTCA 5D6NA 1ZD5A 2CXRA 3HKBB 2OXIA 2C5EA 1W75A 4MWGA 1WY5A 1R4ZA 3DDHA 4UVIA 1Q95A 3WSTA 1YZFA 2V7UA 2W6OA 1XDWA 3OPXA 5J5CA 5TLSA 1USGA 4JJZA 3M4NA 4YJ3B 3PLRA 3SLGA 3ZNOA 3F6PA 5LKAA 3TLMA 3H0KA 4RTLA 3BJRA 3U48A 3ZLBA 1WDTA 1G8YA 3GLQA 3AUFA 4RLSA 3TL2A 4QZVA 2XQKA 1DG9A 5AVXA 1JXMA 1M3SA 2AC2A 3HVUA 1LU9A 2ON6A 1JEQA 4IV0A 4V0SA 3WLFA 1WZUA 4EQ6B 4YRBA 2ISQA 5CXUA 3KTDA 5F9HA 3BIWA 3ZOZA 4AECA 3O8CA 1OBFO 1E2IA 1RJ9A 1XEWY 3E9CA 4UCFA 1T2NA 5C7IO 2R9VA 2WE8A 1XXLA 1APBA 3COVA 2VHZA 4A1OA 5BXQC 2TMKA 3PFWO 1AF4A 2M32A 4GKBA 2XB6A 1TRKA 4FYJA 4J1TC 2V9CA 3JQRA 3OIWA 2Y1DA 2ZVDA 3OZBA 3H5VA 4CF7A 1SHKA 4LXGA 4MUIA 4XXHA 5F2EA 1QIGA 4BKPA 4K26A 2CNDA 2IEIA 2VNSA 1FBNA 3HN7A 3KCQA 3T99A 5ABPA 1EBFA 2H00A 3LBNA 3F8WA 4K9RA 2BFDA 1NBHA 1WSWA 2YZGA 2VDUE 3FGZA 2DKNA 13PKA 1G16A 1Y3CE 1ZITA 1XALA 3OJCA 4XDYA 4DT1B 3FMPB 3EGDA 3GLFB 3NEJA 2Q0SA 2EX1A 2BH9A 4KQKA 4JR0A 5EQFA 1GTMA 3GBPA 3GL9A 1JQKA 4MO9A 4DRXA 4FFLA 3HGMA 3KLBA 4FSXA 1MX9A 1P6XA 4H2DA 3WDMA 3TI9A 4NAVA 1KOGA 1X80A 4KMRA 1J1UA 1ETHA 1JNYA 1FP4A 3AFHA 4WSOA 3AFOA 4HFMA 2WJJA 5CEJA 3MQFA 2H1LA 5JAUA 5HIAA 2AN9A 3DCJA 5B37A 2Y1GA 1SKUA 1BA2A 2QP9X 4RY9A 2A94A 4ZAWA 4UBMA 6AT1A 1HI9A 1LNQA 2QRQA 3FPSA 4JC5A 2W2PA 2NIPA 1L1EA 3EXG1 2IV2X 5JNSA 2YY5A 3EZFA 4G5HA 4UMFA 2OFOA 3FB4A 2E85A 1EEHA 4MOWA 2OZVA 2D0OB 4MYCA 4OMFG 5JCJD 1JKJB 1TLFA 2HA3A 5BOSA 2LCFA 5DI9A 1J0BA 1RM3A 3VPSA 2CVHA 3TIXB 1Y7HA 4JYPA 4EUFA 3Q3JB 2VQSA 1MDFA 3O7MA 4YAOA 2N3ZA 4OLFA 1I2CA 3WB9A 1CDEA 3ICQB 1FSGA 3UMRA 3Q9UA 2PYDA 3G2KA 4LYEA 5BR4A 1U4SA 3WZMA 3U16A 2L19A 2O4CA 1J20A 2GCGA 3HDVA 3G9XA 3JALB 4YCBA 5ERGB 3SNKA 4DCVA 3KEQA 1UXOA 4IWXA 2MJLA 2Z1MA 3HZOA 1QP8A 3LLMA 2J6CA 4JBYA 4DV4B 3KUXA 3OEWA 4R54A 4P58A 4D8TA 2C4KA 4DAOA 4EHAA 2JK0A 4TZTA 4MDFA 1A9ZA 4D96A 2X4LA 1YI0A 5FFNA 4EAQA 4J94A 3GUVA 1MF7A 5LDDC 2XUJA 1FDTA 2VAPA 3BMNB 3P4UA 2GD6A 2I6UA 4FYIA 1ITZA 3KFVA 4B48A 5F3WB 3DF9A 4OUDA 3EQ9A 4A0RA 1YJCA 4UBIA 1VSTA 1Z13A 3AHHA 2R1TA 4WLFA 3GLHA 4WV3A 3G59A 1ZN7A 3KLMX 3MBIA 3F6BX 3QYJA 2X23A 3SE7A 5ESXA 3WLEA 2WSSA 5H1YA 4HGRA 1KEEB 3MJFA 1OGJA 3TR0A 3NTQA 3ZHVA 1W94A 2WG0A 3UC5A 4CV0A 1G5TA 1CRWG 1O6FA 1YNSA 2YHBA 3QH4A 4Q34A 2GXUA 1QIFA 3A6GA 1WXEA 1KSJA 3L7IA 3QVKA 3CKYA 1CUIA 3GJXC 2PCLA 1QOZA 4UU0A 3TIIA 2QN1A 4C89A 5E4TA 3PBKA 3FMFA 2ZAOA 1QE5A 3EEFA 3QHQA 3R4VA 5A4DA 5JMOA 4KW7A 4BV2A 4ER5A 1RWPA 5CLJA 1T0PA 3KFLA 5JI3E 2ZUEA 5ICGA 1TT7A 4F86A 1VMIA 1IFXA 1YC5A 2OCIA 2X7XA 3SLRA 3RIMA 3W4IA 3IUYA 2JHCA 1NLYA 1Z68A 5CFNA 1MR3F 1SH7A 2AFHB 1NBEA 2CJXA 3SZGA 4DCCA 4AT1A 3ZGOA 1O97C 3I2HA 5SY9A 4K87A 4IEFB 2OPHA 2A84A 2CNKA 4M3NA 5FQOA 4D98A 3WLNA 3UKJA 5HPYB 5IVKA 4G0PA 2ST1A 1W36D 2AT1A 3C1UA 2XMRA 3WLMA 1O8CA 2D13A 4LCJA 4DKJA 3E5MA 2IEAA 3Q6NA 2R8BA 3E2PA 4CODB 3ZDEA 4LMPA 4QEZA 3MS2A 1FDSA 3CINA 4HPWA 5ALYA 5CGQB 1CE8A 1Y3DE 2WFLB 4HQOA 1IC6A 5K7SA 4JA0A 1FA9A 3KT3A 3OZEA 5JS6A 1T0HB 1R0LA 1HDRA 3I72A 3ZWQA 4DAEA 5IULC 1BNCA 1Y42X 3OX3A 1BIFA 2BC9A 3B6KA 1HL3A 1QKJA 2VP5A 2G06A 2NO5A 1A2QA 2QTHA 4C0KA 1RPTA 1M7BA 4FILA 1OFGA 3VR5A 2YXDA 2DRIA 3CV3A 5H68A 3K70D 1AZLA 1D03A 1S4QA 1CUFA 2DFDA 2NSDA 2PX6A 3A1VA 4JP2A 4WOBA 3TW8B 4EA9A 1YCFA 5KQLA 3L1VA 4LMBA 1XFAA 3EBLA 1U8EA 4QYTA 4F92B 3VJRA 4NYMQ 2YWGA 1G2PA 5DDIP 3WRWA 1U0SY 4HDNB 4NBUA 2QE7A 4WVFA 2VRCA 5ALGA 2YXBA 3H05A 2IFTA 2GFIA 2Z2KA 1H0RA 2JGFA 4M9ZA 1A8PA 4Q3BA 3EXHB 3CZ4A 3NOOA 4IUDS 5HEKA 3ABRB 3H1BA 3FUTA 5HK8A 5JJIA 1CUZA 2EZUA 3FBGA 4BWGA 1DKNA 3GV0A 3D3WA 3QE9Y 1FCJA 2OEPA 1HDEA 2LUOA 4FCCA 2ACWA 3LUPA 3O31A 4R8RA 3RJ9A 3D8RA 3K4QA 1NVDA 1PRYA 2ONZA 4ENSA 3OKFA 2F1JA 3GO4A 4BZZA 1TA9A 5JPDA 2LP4Y 1JR2A 3HO1A 3IDFA 5CAEB 1P5JA 4RKWA 1W5AA 5K0FA 4DMGA 3THOA 2F2TA 1H6CA 5D3KA 3ZY5A 4CG0A 5JI2E 3UUEA 4MKXA 4WJZA 3NWEA 2JZCA 2TSYB 3U5ZB 3P2JA 5EJ9A 1WP4A 2ZWMA 5IJ0B 4HNRA 3L0OA 1SXJC 1EHIA 3IBCA 3QHAA 3R9XA 1ZC3A 1IEXA 2YASA 4QLBA 2FPWA 2F8TA 4XCVA 2B7LA 3DBHA 4H31A 5G0TA 4CTJA 4PWZA 1JJ7A 3D7LA 2BI4A 1XELA 1KU6A 4JLUA 1EDOA 3EQ7A 1VPLA 1UZNA 1BRTA 2N9UA 2LZ0A 1DEXA 3U17A 3MTAA 2O3SA 3BTVA 4IGFA 5TEWA 3TQSA 4M9UA 3U4HA 3MILA 3EWAA 1S8OA 3E0QA 2CV1A 2GAJA 4RDIA 4GMXA 4UAJA 2Q07A 2IV7A 3ZK7A 2HK6A 3J81k 2R0QC 4EB6A 3R09A 2DT8A 4AM8A 2P4SA 3I61A 4JYMA 1W9HA 3VA7A 3ZLUA 3CR8A 3IVGA 4W82A 5C18A 1OXUA 1A96A 3A2NA 3C14C 2NPFA 2CXSA 3UK2A 2I9KA 3OLYA 4YECA 2LNDA 2W6PA 3FDJA 1E66A 3F67A 4QUAA 5JCOA 1OPXA 3UGJA 5T57A 3FNFA 3NIWA 3AEQB 1AMUA 1PZXA 1W76A 2ERYA 2YC4C 3EW9A 3NKFA 4RK6A 3ZXSA 2A59A 1RTKA 4DCPA 2ZRPA 5AFSA 3Q1KA 2XUAA 1XZFA 3KKLA 1LZLA 4TKUA 4A5OA 4YLYA 5DRYA 4I19A 3D7RA 4I4CA 3JRXA 3LX4A 1RVV1 5AWFC 2CFOA 2CMFA 2QF7A 3KWFA 1CEEA 1WXWA 1KFEB 1SA0B 3F46A 1PZNA 1TB4A 4ZZ2A 4AS2A 3ORHA 4L27A 4UHEA 3BAFA 3IB3A 1O57A 4J76A 4IAOA 4JVLA 5ILOA 4B6SA 3QRWA 4CMJA 4EW3A 3P27A 1YB7A 3BILA 4U02A 4C21A 4Y67A 4CMCA 4MAFA 4HH3C 3WNVA 1OFTA 1DKMA 1W4ZA 2ZM6B 3H2KA 1YZTA 4JL6A 4LV6A 3R5XA 1YKGA 4FKZA 2F55A 1DIOB 2ZM5A 3QLUC 4KVFA 3H83A 5JV5A 1CS0A 2BGTA 2GVZC 2OCDA 2VJMA 4Q9LA</