3F5DA

Crystal structure of a protein of unknown function from bacillus subtilis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
193
structure length
193
Chain Sequence
LKKALFLILDQYADWEGVYLASALNQREDWSVHTVSLDPIVSSIGGFKTSVDYIIGLEPANFNLLVMIGGDSWSNDNKKLLHFVKTAFQKNIPIAAICGAVDFLAKNGLLNNHSHTGNFVYLWKDYKQYKPISSFVEKQAVRDKNLVTANGTAPIEFTNLILEMIDFDTPENIEKMMYMNRYGFYHFCDKYGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a protein of unknown function from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords protein YdeA
total genus 57
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3f5dA00
1GPMA 3ZJ5A 5DFAA 2AB0A 1UCFA 4OQ4A 1J42A 4WXYB 1WL8A 1CS0B 3F5DA 2GK3A 4P35A 3R74A 3UMMA 1R9GA 2ZUVA 4I2NA 1OX5A 3CYFA 3MGKA 3OT1B 3UK7A 2YWCA 2ISSD 4N12A 4P2GA 3UOWA 4MTCA 4UOZA 4B7AA 1GGEA 1PE0A 3PQ3A 3RHTA 4ENUA 5SY4A 3P9SA 5SY6A 4S0ZA 5K4AA 2VRNA 4Y1EA 4E5VA 2VXOA 4B2YA 4MGHA 1GG9A 3F71A 3FSEA 4GUDA 3SOZA 2VDJA 1SOAA 4GE3A 3ZR4B 1VCOA 4ZDIA 4L8FA 4AUNA 4ENQA 4RKYA 1VCNA 1KA9H 3BWEA 4B40A 4ENTA 1P80A 2WJZB 1QVWA 1M6VB 2ZUSA 3L7NA 2YWBA 3P9PA 1G2IA 1VCMA 3CZ9A 2W7TA 3GRAA 2YWDA 1JVNA 3TTXA 4B5KA 4HCJA 4ZGGA 3D54D 1IZZA 3P9RA 4OFWA 3M3PA 1BXRB 1FYEA 3PQ6A 3PQ7A 1S1MA 1I7QB 2ABWA 3WFZA 4AULA 4L8WB 2XF2A 4L78A 3UJNA 1QVZA 1QDLB 3KKLA 3FIJA 2NV2B 3EFEA 3NOOA 4UNIA 2R1UA 4PXYA 5E9AA 1P7ZA 1I1QB 3B3AA 3L18A 1QF7A 1C30B 3MIIA 2R1VB 1IPHA 2RK6A 1JDBC 3N7TA 1P5FA 2V4UA 3NVAA 5SYAA 1Q7RA 4ADSG 2VPIA 1N57A 1KWKA 3R76A 4ENSA 4RKWA 4BIMA 1FY2A 2AD5A 1Q2UA 1GGFA 2R1TB 3P9QA 1A9XB 4LRUA 4Y0NA 4UCFA 5BV2P 4P5PA 3B38A 2FEXA 5JZOA 3EN0A 1T3TA 4I46A 1CF9A 4AJ9A 1KWGA 1C3OB 1T36B 3L3BA 4GE0A 2D7JA 2LXNA 1CE8B 3CNEA 2H2WA 1GGHA 2OR3A 3CZAA 3EWNA 4OGFA 2A9VA 5IP5A 4WINA 1T0BA 3UGJA 4Y1RB 2GHRA 3TTSA 4P34A 1OX6A 1PDWA 1GGKA 3PQ5A 4MNTA 1QWSA 2VKTA 1IZYA 4AUEA 3PQ8A 1PV2A 3L4EA 3OT1A 3NORA 4ENVA 5JZMA 4R7GA 2RK3A 3BHNA 4XLLA 4E08A 4LGYA 1GPWB 1P7YA 3NOVA 3PQ2A 2ZUUA 3EZGA 4L95C 3VU3A 4B31A 4ENWA 4Y1RA 2NV0A 3PQ4A 4K2HA 1K9VF 2RK4A 4AUMA 1U9CA 4N0MA 4OGGA 5LIRA 2ZUWA 3TTYA 3CY6A 1O1YA 3NONA 1OY1A 3SF8A 3TTVA 4D1YA 4ZDJA 1ONSA 2YWJA 4QYTA 4QYXA 1OX4A 3TTTA 3TTUA 3NOQA 4JQSA 3ZJ4A 3TTWA 3TQIA 1OI4A 4L8YA 4BFLA 1QVVA 1P81A 3EJ6A 4Y1FA 4ENRA 1KEEB 4OJYA 1GGJA 3R75A 1OX4B 4OIFA 1SY7A 4BTEA 2IUFA 1PDVA 1VHQA 3SF8B 3B36A 1L9XA 4Y1GA 2ZUTA 2R1VA 4ENPA 1I7SB 4UZSA 3ER6A 4UOQA 1KXJA 4L7QA 5SY9A 4ZDKA 4P36A 2R1TA 4I4NA
chains in the Genus database with same CATH superfamily
2Q6OA 3GROA 1P4HA 4EHJA 3T3NA 1J42A 5AJHA 5EWMB 1ND6A 3GVXA 4P53A 1U5BA 2EYUA 3BMQA 3I45A 4PS1A 1WBBA 1HL3A 1R6AA 5KQMA 2O2SA 3USCS 1KAQA 4IG9A 2AXEA 3L02A 1CBUA 1DAOA 1WW3A 2IODA 4QG7A 5I7OA 4MB0A 1QZUA 3NYIA 4L0MA 1DDIA 2XDWA 3ASVA 2WJWA 3Q6IA 4MO9A 1OAOC 3IR5A 1RMYA 4L4XA 5FV4A 2PT5A 4QDZA 3GOHA 4CNQA 4YDRA 1BKYA 4MYRA 4GVXA 2VJDA 5BN3B 1T1EA 3IMGA 1GRCA 4HD8A 2HU5A 5EXPA 4RHYA 1EP3B 4GGMX 4QYWA 1L4NA 1UZUA 3FYUB 4OQMA 2F3QA 3ZPXA 3SOZA 3TLXA 1M2OB 1JQ3A 3ZI7A 1AXGA 3L8YA 4XOIA 4S1OA 3TGPA 1C0EA 1TM3E 4LF9B 1G6Q1 2W6CX 5EIWA 3W6NA 4DPLA 1E7WA 4QJ3A 3OHMA 4G5FA 2ZS9A 1C0PA 3IV7A 3PBKA 3N2GA 4C7OB 4M88A 2YW9A 1T6XA 3AB7A 2C9YA 3IA7A 5KTMA 2P6UA 4G5SA 3HWWA 3P19A 1DT3A 1EXDA 1FJXA 3O4RA 3WL7A 3KTAB 5JH7F 3G3EA 1BKDR 4MV4A 4NJEB 4RJJA 4NMLA 2GSDA 3IT2A 3JYQA 1ORWA 1U5CA 3BDAA 1IRIA 2Q1UA 4LRXA 3KPWA 4BEVA 1U8EA 3SYLA 2KE5A 2WF9A 4AJ2A 2G4CA 2SKCA 4KX3A 4Z86A 4EO4A 3N28A 1XMIA 2C83A 1LQ2A 1H2XA 2Y6UA 1Y3AA 1IPEA 3JU3A 4YCBA 2OHXA 4RVHA 1NSTA 5DLDA 5H9VA 3X1DA 3PFKA 4P0TA 5KTRA 2HCRA 1A8PA 4EB6A 3LW8A 2OMKA 4GR9A 3AUTA 1Q6ZA 3R3XA 3RC3A 4ZYVA 3OVMA 4O5AA 3HJBA 1I3NA 5FLYA 4CI0B 2TYSB 2ZPAA 5HGJA 4Y67A 5D85A 3B3QA 3QFHA 4DA9A 1JBQA 1W0CA 3ZTWA 5M34A 4ND8B 3B5IA 1SC1A 4B4UA 4JLJA 1SRQA 2H1CA 2FFBA 1TM7E 5DW3A 1TK2A 4DT1B 5KOJB 4L95C 3DLHA 1JSRA 1FDTA 2BTOA 2GBLC 4LJ8A 4Q9LA 2YMQA 4YMVA 3URMA 2UXCB 1LVGA 1EDEA 3PL5A 2O50A 1FUYB 1A8HA 1OV4A 3BXXA 2PN1A 2R7LA 3L0IB 3N07A 4ITVA 1EP1B 1OY1A 3IEKA 4Q1AA 5ARDA 2N1BA 4H4EA 4Z53A 5LKRA 1YNSA 4CKXA 1P3JA 1G2OA 2PSFA 3LKDA 3O4HA 3WLAA 1TIBA 2GTPA 2WFLA 3AXTA 1WZ2A 1QIFA 1YDGA 4PVDA 3E3AA 5CGQB 3A6EA 1NZJA 1Z73A 4YN3A 4PNHA 4CCYA 2QRVA 3MWDA 1UC4B 3LQQA 4BNLA 2Q99A 4XGKA 4X66B 3ZNNA 3IPCA 2PMBA 3Q72A 1R0WA 1V8PA 1SU6A 4YMIA 2EP5A 4EAQA 3WLNA 5CPBA 1ZU4A 2E4UA 3HDHA 5DNAA 3DAFA 1PJ3A 4PHFA 3URKA 2ZVQX 5EUCA 3UQYS 5F3DA 2C58A 4GMDA 1CQXA 3O0DA 5EMMA 5BQ5A 2BJWA 1K4YA 2D00A 3SNKA 3X0DA 2VQEB 2XODA 5ADVA 3K0AA 3BMNA 4B82A 2HJRA 3H8JA 5ICCA 2X1LA 1U3CA 3RVKA 4EYSA 4OHFA 2Q3EA 3IFSA 1VKNA 3IP1A 3O7WA 1A9PA 1FXWA 2X6RA 4QSHA 3I58A 5E7QA 3DOEA 3WAKA 3KQUA 4HPWA 4QIHA 2QR2A 3B6MA 4RWZA 3L6RA 4Y2VA 3UHFA 3SIXA 2WPDD 1CC1S 2VPZA 1CRWG 3DA8A 3K3PA 2PE5A 1A9TA 1ZRMA 1ORRA 2VRNA 3ESDA 1CEYA 1SKQA 2BCJQ 2H4ZA 1K6IA 2DWCA 3LC2O 3ZXUB 5LQKA 3KPUA 3K05A 1G5IA 5CM9C 4JZKA 1AUPA 3KX2A 5I9IA 3NXSA 4FZ5A 2WR8A 5AJXA 3TAUA 5KVSA 1WBDA 1IHDA 1SOUA 5JG7A 5MN5A 4YX9A 2D3TA 2YV5A 4BFTA 3BA6A 3JWGA 3AP2A 4MKGA 5CDTA 3QUCA 4BLQA 2C2GA 2V9ZA 1B15A 4C0QC 4ER3A 5C81A 1P45A 3ENWA 3KU1A 5JD6A 4B5KA 1JEYB 2JCSA 4OCZA 1U8AA 3D54D 2QX8A 3S5UA 1E7RA 3WGNA 3WA7A 5J2UF 2HA2A 5DTJA 4P08A 3PWKA 4BNIA 4DCGA 3K9GA 3FNHA 5L3SA 3IAEA 4GKKB 1CUGA 1SC3A 1VFNA 3L7DA 2WM8A 4NESA 3HNRA 1ZN9A 4WZAE 5AI4A 4WJZA 4AZ3B 4ZU3A 1CEQA 4MUKA 5SZIA 2AG1A 3JRXA 2ZI7A 1ATZA 3LPMA 1FMTA 1BSVA 1HTWA 3GJSA 4REMA 5FEUA 3KEFA 3WLPA 3KSAC 3MHPA 4O2LA 3V4FA 5ESRA 1I2DA 3EF3A 3K5IA 4EDFA 2ZAIA 2JVIA 2DH5A 3TN7A 4FFNA 1T4CA 3ROXA 2F67A 4MS3B 1ZGBA 4OU4A 5DYGA 4F21A 4BJHB 1ZK1A 3AWIA 1A9XA 4EHFA 3KJNA 1JGTA 1SULA 3LW7A 1B3RA 3WIDA 1RQPA 4K6GA 4I66A 5B4TA 2V1UA 1F0KA 2NO6A 1E5LA 2XV1A 3FGZA 4E2XA 4JC4A 1T5SA 3OQVA 1CP2A 3QVOA 2CJXA 1P2SA 1VL2A 1QCYA 5AXCA 2W6IA 2WG0A 1PDOA 1PYGA 1PFYA 1UKEA 4Z7OB 1SMKA 4BFXA 3WB2A 3A1TA 3I3SR 4Z0NA 1E8DA 2LR0A 2JGRA 3U31A 4HL6A 3D59A 3CVXA 1DOAA 3M70A 4Q1BA 3QMWA 5JATA 5JXWA 2XMZA 1OIWA 4X45A 3BH7A 3MA0A 4KRYA 1TK3A 2QTWB 2WLTA 3GFSA 4O3FA 3RJ5A 2D1FA 4MMYB 2D5BA 3TRHA 1AQYA 2FE1A 3D7NA 1A2OA 4YH1A 5BWBA 3FW1A 3I9NA 5IXSA 2EG9A 5GZ3A 1GXSA 4IGAA 4BYMA 1K86A 1VIYA 5I9NA 1NA5A 4BTEA 1VGVA 1J21A 1LRJA 4HXGA 3TW8A 3MSCA 1CKEA 4FJ1A 4KVAA 5FUYA 5BMOA 1DXQA 4IAOA 2QVBA 4OXKA 4UHHA 5DV9A 3WV5A 4LIPD 4HYTA 4PTZA 3ZUPA 3DAOA 5SY9A 4JV5B 3ST7A 1EK0A 1I3KA 2CB9A 1IDN1 3PI7A 2BGTA 4FI3C 4TRJA 4L72A 3RR2A 4QYSA 1KEPA 5HVNA 4YCCA 4KSYA 1Y6RA 2EGUA 2O2ZA 1AS0A 1KK1A 4FU0A 4D46A 4BQEA 4AF7A 3K9BA 3OF2A 5BVGB 4Z3DA 5IJWA 1Y4SA 3CYFA 1V6AA 4ISCA 4ALKA 2C0CA 3JSXA 3DBLA 2HUPA 4YNBA 3E9EA 1QTQA 2FEWB 2P40A 3A6KA 3RPEA 1PEDA 4PLVA 3UMSA 3F6YA 2ZYTX 4B6RA 1R0BA 1IQUA 1X39A 3WTBA 1KAMA 3LFTA 4HLUA 4IH9A 4MUYA 4NP6A 3RSGA 2H9AA 4EUFA 5TQ2B 1TI7A 3QEOA 2AYYA 3JV7A 1UXOA 4BV3A 1SVLA 3QEBZ 3BEOA 2Z43A 5HUQA 3EDQA 5ILGA 4CIAA 2IC5A 2VBCA 3LA8A 3WGOA 3O9MA 3GDHA 2NO5A 2VJCA 1VMEA 4MV5A 1KI4A 4OGWA 3WFIA 3GRAA 1EWTA 3DS8A 2QLLA 4MVJD 2FF7A 4HCJA 5AQ1A 5L3VA 2YJTD 1D2RA 4CODB 1L3CA 1TMOA 2B2NA 2CDNA 3ZVMA 3F6CA 5L7WA 4DUZB 1R0RE 3GJ3A 3HNOA 4C76A 5KDOA 1U28A 2Z2JA 2BSXA 4JA2A 4CZ2A 1NKTA 4IXNA 2AXQA 2OEPA 5DX1A 4DDMA 4LWOA 4OAQA 3BMOB 1SK9A 5CB6A 4KR2A 3BB4A 1QORA 5B2FA 2PUAA 1OXXK 1ZJ4A 3DPUA 1BH6A 1I0IA 4RA6B 4CFZA 3NHSA 4G0PA 2CLIB 3TZEA 1MRSA 1JT2A 2OQRA 3C6QA 2BLNA 1KRWA 1XTTA 3AF5A 4C6HA 2OV8A 5AHOA 1CF2O 2N75A 2POQX 3G8DA 4WKOA 2VWPA 3KAPA 1Q83A 5CHEA 3WQRA 1WZNA 1DP4A 2JH3A 4ILEA 1Z39A 3S40A 5FXMA 2D1TA 1QUEA 1VKZA 1OLSB 2QX7A 4GECA 3ZDCA 2HR1A 1R4MA 2F90A 4G1VA 4OQZA 4ZT2A 2XQJA 4ZO7A 4JC5A 3CLRC 4ZI7F 5FUXA 3CUSA 5HZMA 1UJ4A 1W87A 3A14A 3C3BA 1PO7A 3FUVA 3M9WA 4DMUB 5K8UA 2YN2A 2YV1A 5E2BA 4BMVA 1TTPB 5ECDA 5CW2A 3TE6A 5GADl 2FMKA 2FGKA 4RY2A 2DY0A 2A1TR 2FTKE 1NBHA 1XALA 5DHUA 5JS1A 4N0MA 1XMVA 5KKAA 5LA6A 3TTYA 2G7ZA 3EQ6A 4DW8A 3ISJA 2CL5A 1JR3D 4HB2A 4G41A 4QFDA 1VBNA 4BO1A 1YQEA 2OC4A 1S4MA 1HO3A 4PTLA 3DULA 3T7AA 2R6AA 3PDIA 4ED9A 4HEA6 3WBFA 4ND2A 1H8ED 5DX8A 4DDKA 3MJTA 3Q5GA 3EX7C 5AOAA 1NMYA 1Z06A 4NPAA 3EQ2A 3D0OA 4IMPA 1ESMA 1JHZA 4O4HB 5EXTA 3AEUB 3EBOA 1NMQA 3CX3A 4Y2HA 1DCFA 3F3SA 2E4XA 3KWMA 3WKCA 3B1VA 2Q5EA 4O2AF 3QMMA 1Z5UA 3RFTA 3E81A 5AR1A 5KREA 5J1SB 1UQRA 3KAKA 2BM8A 4LOJA 5KINB 3NAMA 3O8LA 4N5DA 4RELA 3QITA 3ROPA 4IIJF 2P6RA 3C5HA 4N4AA 3Q3EA 1R9GA 3P2OA 1LNQA 2QTRA 3BCSA 4UBLA 3SP1A 3LHKA 2VF5X 1Z13A 2CEAA 1L7VC 2TRSB 5JI3E 2D6FA 3OJWA 3NMUF 3E48A 4UHFA 4HDQB 2GHIA 1Z2OX 1C1YA 1HDIA 3Q9SA 5LA6F 2P4QA 2JVJA 3TLKA 3DLAA 2AZXA 4F1JA 2I22A 4X1KA 3E1KA 1Z5WA 5D2CA 1W7AA 1XDWA 5ALPA 1C9NA 3STYA 1UK8A 3LVFO 3K70D 3B9QA 4QUIA 1GNSA 4R5HA 5FOXA 3RRXA 3F71A 3HXPA 3QX9A 1IE3A 2PMCA 1X1RA 2RAPA 3M1LA 3M33A 1V5GA 3ONFA 4ZI7A 4CDMA 5KOHB 1PG0A 1SKUA 1XZAA 4R1NA 1KSHA 5JANA 4FDUA 1PK7A 5JUWA 4M9SA 1JFVA 1PGPA 2G40A 4PBTA 3GFTA 5C8VA 3FGPA 4XCQA 2Y2UA 3TW4A 4PFJA 1FYEA 2YMPA 2R7KA 4DQDA 4DQ0A 5IVPA 3MHTA 3MBKA 3HJGA 4RO0A 3S2GA 3KR2A 3TCKA 3WBJA 5JD5A 2DFLA 4DMHA 5MF6A 2PUFA 4JEUA 4GP6A 3AVPA 3WNZA 3ZOZA 5LOVF 3OBBA 5AH0A 2NPFA 4PNEA 1WPXA 3K8ZA 4AU1A 4EX7A 2FDCA 4QUHA 5HS4A 3HA7A 5DOZA 2DR3A 4O2BA 4IG4A 1VOTA 3OZTA 2XCLA 3MXOA 5F2EA 3JZMA 1M1NA 5EMLA 1E4VA 2HIGA 2XR1A 4TV8A 3WYDA 5IDWA 5AVYA 4CG2A 5A0TA 1SHTX 3KWLA 4U7GA 4DY6A 4C87A 3TI9A 3HB1A 2XKKA 2YFYA 4F04A 4XOUA 1O96A 5CURA 3WBKA 1XI2A 3TD2A 1KWGA 3O83A 1VIDA 1Z9BA 4JODA 1KYWA 2A30A 3KT0A 2YQ5A 3GLUA 5IAGA 2FZ4A 3UT6A 2NQ8A 4C08A 2DZDA 2ZIVB 4JSYA 4QECA 2EFDB 4U7FA 2ZE8A 2PK3A 4OM7A 5K3OA 3U7HB 3AUAA 4JKIA 4D9FA 1TEVA 1Z3CA 2H16A 2HY7A 3LAWA 1TLTA 3QNWA 4YQEA 5GONB 3OJEA 1PJRA 1X7XB 5BN5B 3TLAA 4CL8A 5BV8A 4KQ9A 5LA6B 2PEYA 4B71A 5C51B 3W2HA 5C2JB 4OK6A 5CXUA 2MJLA 2XH8A 4UNSA 4RH1A 1JW9B 1SCBA 5I9BA 5KTPA 3SZOA 1X0XA 2PBLA 1O1YA 3HR7A 3PIIA 3R6TA 4BAUA 4LJRA 5EJIA 3NP9A 5CU7A 1QHNA 4AP5A 3AEQB 2PLWA 3V1UA 1QS0A 5U9CA 3JQ6A 4DMFA 2DCUA 4B3DA 1EK5A 3OIGA 3VSDA 4BFLA 1BRTA 2YYAA 4ZI5A 4F4JA 1MG5A 1KIAA 4UUBA 4DLWA 1FFYA 3BMCA 1C9YA 3NTUA 4OYRA 3C5CA 2A9RA 4DLKA 4IQGA 4Y0VA 2W2KA 4DV0B 4A6DA 2EQAA 3BFVA 1W46A 3ECSA 4UBNA 4LRTB 4D0LB 3R5XA 4R8MA 5JS7A 3V55A 4IVNA 4DLXA 1X14A 1JSZA 4OX9Y 1SPBS 1V3QE 4I4NA 4O1HA 4XQ0A 1C1HA 2W2TA 3TVDA 2QMQA 5HJ7A 1V5EA 3HA2A 3JQ7A 1SRRA 1GFZA 2DBYA 3G2JA 1KC3A 3LZCA 2DYKA 2Q3DA 4BVBA 2ZUVA 1X1BA 1KIMA 1NP6A 1U1CA 4ECEA 5JD4A 1TO2E 2FMIA 2PGDA 4YO7A 4CU5A 1R5OA 1ZQ9A 3L0SA 4ZAXA 3KHTA 1DG9A 1L7AA 5ALQA 1WDTA 3GV0A 4MKXA 1RHKA 3FYUC 4GMGA 3FYDA 4QICA 3LCJA 4KO8A 4L8LA 1SCUB 4UUOA 4DL9A 1RQ2A 3NW9A 2UU9B 3KZVA 4WEOA 4IR7A 2IUUA 5LUAA 1FSSA 5AI9A 4AWAA 1ODSA 2JFOA 2NUTB 3LA6A 4MWTA 3ZLUA 4UDXX 1TEXA 5T6MA 2ONZA 1J1UA 3RTBA 3FNFA 1Y7TA 3RWBA 1X7ZB 1ISPA 1ZI9A 2OK7A 2YV4A 1W5FA 2PKQO 3Q5DA 3IAS1 1BYIA 2FQXA 4II3A 4OUDA 5KNDH 4XSHA 1M8FA 4EQ6B 1U4SA 2R85A 3QV1A 1N5KA 3NRJA 4TMKA 3HFSA 1KY2A 4H15A 4IKPA 3F46A 5ENZA 1NW4A 1PR0A 1KFJB 1VLJA 1TYEB 2YC4C 2WZDA 3U6BA 2P6NA 4O29A 1TADA 3PDJA 2XNHA 1IJEA 3CWZA 3DE6X 2QPAA 1PW7A 4DGQA 2IH4A 3W2TA 3NT5A 5T4BA 2NMVA 1W96A 3AFMA 1I30A 3G0BA 1YJAA 3ZDDA 2QAGC 4AJOA 2AHOA 5B55A 1MJGA 1MGOA 3C4QA 4BO2A 4DLVA 2BIFA 4RA9A 2PLRA 3O9ZA 1NW8A 3BBLA 3DZIA 1N5OX 1RHQA 4RV4A 3C3WA 4PCAA 2AG0A 2Y1GA 1C30A 2J4FA 2B8WA 1QK4A 2JIDA 2TMKA 3BM5A 3EZYA 4MUHA 3GLKA 2QMYA 2EQ5A 3OOHA 1ZSNA 4D4KA 4URWR 3MJ4A 5KCZA 2HPAA 5IEBA 3ZGLA 3B20A 3P0HA 4OQDA 3V97A 4KIFA 3D6AA 1PFKA 2EFEB 3O8QA 1KSFX 2WMDA 2H48A 1T5OA 3E53A 4BE7B 3EMVA 2F43B 1Z0FA 1G8SA 2D74A 3JQAA 1RBZA 1Z3IX 4RE5A 4AY4A 4B74A 3TLJA 2A84A 4JBYA 2LZ0A 4KPFC 1R0LA 1EG7A 3LBYA 3E0XA 3KT3A 4OQQA 4CIDA 2P4SA 2R7AA 1WCXA 3FCAA 4HNAA 3NEYA 1JHDA 3TZCA 5K8CA 1L5VA 3I53A 3I9MA 3PEFA 4FONA 2VUIB 4P86A 4Z4FA 2ZS7A 2JZNA 1ZMOA 4GWGA 3TTTA 3H5TA 3TG2A 2PV0A 4KQKA 2HO5A 4F1WA 3Q88A 2Z5VA 3KSZO 1LK7A 2JD1A 3MWLA 2HHAA 4WXRA 3RTEA 4IZHA 3W77A 1IM8A 2ID9A 1XZMA 3ITKA 3QEAZ 2HT6A 2PO5A 4GMXA 1ECBA 1GHTA 2CNOA 4HQNA 2AE2A 5JJ5A 3JASA 1AXEA 1BWQA 2OBFA 1RC0A 3CMCO 3MINA 3U09A 3N2YA 2R47A 1AQNA 2HWWA 3E05A 1ZWLA 3TAHA 1ODJA 3Q8MA 2P7HA 1AKWA 2ZRCA 4G8DA 3ZVLA 1C7EA 1Y8RB 1J90A 5IMSA 4XWTA 3TJMA 1XT6A 3F2IA 1BMQA 1PR5A 1XDDA 2IOFA 2FWPA 1W30A 4YP5A 3AZPA 3CVYA 3VSEA 2F8SA 3MFYA 1D2CA 5I47A 3V3KA 4MVJE 1IZ8A 1L7BA 1XDBA 2YBDA 3GAZA 1Z82A 3FA2A 3L8EA 3NBZC 1GGEA 2PCLA 4AG6A 4ETNA 4MW0A 3F5FA 5KQSA 3EWIA 5LQNA 2H00A 4HR7A 4M37A 4F1KA 2E49A 1ECCA 3DFFA 3OA0A 1YIDA 4XWGA 2HGZA 5D5HA 4AJ1A 4C2BA 1RRFA 4FBLA 5E1OA 4XVQA 2C5LA 1IULA 2G1JA 3FOWA 4JK3A 1YDFA 5LOVA 2H4HA 3UWSA 1E3LA 4BNNA 1M75A 5B30A 1OWMA 2GK4A 4QBFA 1SKYB 1VIMA 1YNOA 4JSTA 5KYKA 4EG4A 1UBOS 1Z33A 4CDNA 1ZU5A 5AK5A 1JEAA 1P7CA 1MAHA 3O38A 1V8ZA 4YI5A 5F52A 3V32A 4D9HA 3EEQA 4BMCA 2DX7A 2W22A 4ZGGA 1THGA 1KJIA 3IS3A 4FYIA 3TLZA 3AWDA 1OU4A 3DLIA 3PQ7A 4ARUA 4F6RA 1ULUA 2QI9F 2XYGA 4QGBA 4XIFA 5CT5A 3PG5A 4DXHA 1J6UA 4YS6A 2XWSA 2VJMB 2GNOA 2R8OA 4FLMA 4M9XA 3OSZA 2FG5A 4PG5A 5EWJA 2D06A 2RGUA 1DJOA 4WECA 1ULAA 5JS6A 2I8AA 1CY7A 4CL2A 1W48A 2CXSA 2R1VB 3L0DA 3WGKA 3ZS8A 2XUFA 1QKIA 1NOIA 2I9PA 2QAGB 4LHZA 3WLIA 4EVIA 3QPBA 2CJWB 1EFVB 1L4KA 4LV5B 2GPBA 1RS0A 1HNNA 4P9NA 4MR9B 1SVOA 5KSZA 1T43A 4NG4A 2FG6C 1EVKA 1KMHB 4JQCA 4QGAA 1WTAA 4P93A 1OBVA 3HCWA 5JNTA 1YB5A 1KDOA 3AINA 1RQXA 4F85A 1OI2A 1LPOA 4Y2TA 4LX8A 4F2HA 5DBIA 1CIPA 2ZT8A 1MQAA 4MVJH 1K88A 2J0UA 4I9FA 3T3DA 3KZOA 1TGYA 3JQBC 1E1MA 1I4DD 3K1YA 5JAQA 4DNOA 1E6WA 4XKJA 5C1OA 1E9EA 4EA7A 4YMWA 4LYHA 4XE5A 2R8ZA 5BMVF 3L0PA 1DELA 1IQRA 1G7CA 1KJ9A 2B2XA 2GN2A 3QYPA 3V8VA 3S2UA 4KKVA 1DJPA 1GAQA 3FVVA 4OBBA 3PGJA 3QF4A 3STTA 3WWYA 2R25B 3CE6A 2J5RA 3JR7A 3JD0A 2OBLA 3PNPA 3DMYA 1GPDG 4NU0A 1FK8A 2XXJA 1ACMA 1EE9A 3C39A 3USES 2GCOA 1ZM4A 2C99A 3PVSA 4G1BA 4ZCTA 4GICA 1A72A 1FXWF 1FDOA 2EBUA 3HKBA 4L4RA 4YXWA 2B8TA 3ZLBA 3GLIE 5DP1A 1O94D 1KFKB 1KU0A 4LYJA 3OO1A 4HBZA 1AUQA 4Y6RA 1F17A 3I1YA 5G41A 3GLQA 3IAM1 3RBZA 4MMZB 1TMYA 5C5CA 2X0NA 4WLFA 2C29D 4E2FA 1L5YA 3ZBPA 1E2EA 5DRTA 1L4FA 2QF7A 3MINB 4EJ0A 2Y99A 1F6DA 4LGVA 6REQA 4PFQA 4YEDA 2VHYA 5FHQA 4FSHA 2QN6A 5EIFA 3TL6A 5FQNA 1M76A 1P1HA 5LFAA 1ILEA 1FLNA 1Q91A 2HLDD 1QIGA 2W6OA 3EY4A 1YU6A 3B1FA 2V4ZA 4URUR 3KQQA 3RV3A 4YPVA 5K8LA 2OENG 4HZGA 1TYBE 3AJEA 7ABPA 5BWNA 3S2SA 5ESXA 1I4EB 1Y1RA 2KX7A 4BNVA 5DLQC 1M6VA 2VJLA 2QEQA 3NC1C 5EL0A 1JDJA 1T6NA 5K0TA 3H5AA 2WOJA 1PTJA 3NG1A 4CVNA 3ZYZA 4CEHA 3CRNA 1RYNA 3O0TA 4MIEA 1EFVA 1VE9A 3VBEA 5CMLA 2V7XA 1WQ4A 2OZLB 4IWNA 4M76B 1ZKDA 3HU2A 1HLPA 4MCHA 1DSSG 3JPYA 1HDOA 2YWHA 4XGRA 3SIPA 1QGAA 1RRVA 2OBBA 3GZNA 3KJQA 4TOIA 5A0FA 3TXXA 4PYIA 3H42B 1EFPB 1SCQA 4YMLA 3CR7A 4QHYA 3TEJA 3HVKA 4H1VA 4TZ6A 2Y6VA 4H7JA 1ZEJA 1ES9A 1R4ZA 1USGA 2C9ZA 3EJWA 3UAZA 3GJXC 1C7RA 1E61A 5THKA 1XVTA 2JPDA 4MV6A 3WO1A 3L0YA 1Z7BA 1U1FA 1EWYA 4HAXA 4DCTA 4OFWA 1ZHOA 1M6YA 3K2QA 1LQUA 3PQ6A 1G19A 4TTAA 3ZQUA 2ABWA 4CV2A 5BQOA 1WUYA 1QH8A 3DM5A 1UBHS 4QBGB 2OWDA 5F4ZA 1O6ZA 2NUBA 1TF7A 2PLAA 3H87A 3H99A 3LFHA 4X20A 1ZCZA 3KQWA 1FF9A 4Z7JA 2WYOA 3AONB 4RPIA 2C04A 2C9DA 4YV1A 1E7MA 2Z6QA 1T2NA 3MPOA 4FSXA 1LVUA 5EWMA 2GYUA 3RTAA 4IQ4A 2HN9A 4GBJA 3W7BA 3FMFA 3ZHXA 4L22A 1JLLA 2W83A 4ID3A 5U4XA 9ATCA 1CPYA 2QL6A 2XUJA 4ZC8A 4L0CA 4LX0A 2GPWA 2DQZA 1MQ8B 1CF9A 1FX0A 2QLTA 4IGEA 3PT9A 2PS1A 1UBFA 1B0ZA 2R6DA 4ZCPA 3EDCA 3T61A 8AT1A 4YJ2A 1NNLA 5ELXA 3INYA 2XB2A 3IA2A 1P2DA 2OY0A 2VT7A 4MPDA 4WI1A 3VFDA 3WYBA 2GETA 3U4CA 4H4CA 2WT9A 2ATIA 2ZTHA 4AUKA 3ONEA 3UHOA 3HY3A 3I2HA 1UDCA 1B1AA 1NVVR 1O5IA 1C3LA 3KOOA 3LIIA 3JD3A 3OEED 4KFTA 3BHNA 1E2FA 2J31A 2CNLA 2PGNA 2JLAA 3C1UA 3RUIA 1RWQA 2CW5A 4RADA 2VZ8A 1KKLA 1WOYA 2ASVA 3RO7A 5JAIA 4RF3A 1E20A 3EW7A 3D8UA 4NCHA 3MRVA 2NYVA 5HCIA 3QU2A 1OQAA 3ZZ0A 5TGDA 3P2MA 4OP3A 5KYUB 1CIVA 6LDHA 3N0TA 3H4TA 4YJGB 4RS3A 4GLJA 4FS8A 1UL1X 4I1PA 1TJYA 1E1NA 1HT0A 2XVYA 3BSFA 3CLRD 3CX7A 3B48A 1TUBB 4N8SA 3I4FA 2F43A 2GNPA 1PU2A 2FETA 2PUHA 4RMNA 2JHFA 3ENZA 4LZNA 2QZSA 3QMPA 3BMCB 2YZKA 1M1UA 2V7WA 1M2WA 3N8KA 1THZA 3A1SA 1F8GA 3BIJA 1BVHA 1U2GA 2NSHA 1ZUNA 4NIMA 5FA6A 2JFVA 4BMDA 5GOZA 3ZGXA 3B6JA 2IV2X 1SCJA 1NT4A 5CA0F 1PG5A 3OLYA 4QXQA 1XLTA 4KV7A 1DXOA 2NOAA 2VJOA 5E2AA 1PWXA 1CUCA 2QV7A 4UFNA 2BFFA 1TA9A 4TKVA 1DLIA 3G2HA 5AI8A 2BMVA 4I9NA 4OHPA 2C7RA 4K6FA 4F6RB 4C7XA 2J3DA 3EYWA 5HSGA 1I6LA 4UOEA 3LUDA 1TC1A 4HFJA 3WMFA 1A77A 2OBXA 3RKSA 4XUEA 2ZJ5A 2FN4A 4G9GA 4KN9S 1QO9A 3P32A 1N1EA 2EZUA 3OP4A 3GN1A 4E5KA 3ZZ1A 3L2OB 2H7VA 4GUDA 3QH4A 1H1DA 2BR4A 4FC6A 4EY3A 4QL3A 5IFKA 4JOQA 4Q18A 1Z6QA 4HNGA 3OZBA 2RHJA 3L7NA 2FWJA 3GWZA 4HEA1 4JKOA 4N5HX 5ALJA 1APBA 3NTXA 4RENA 4GP9A 5E7MA 2C94A 2OILA 1ZD5A 4FN5A 4FR0A 5DN6A 5HTKA 4DB2A 4Z4CA 1RJFA 1SD1A 2OV6A 4ZQBA 4BP1A 3E1SA 3NQ41 2C3UA 2KWIA 4RL4A 4TXNA 2PX8A 4WK6A 4CG1A 5THQA 2Y93A 5AW6A 1V26A 1ZH2A 3G8CA 4IFIA 4ND6A 1P7ZA 2XECA 4OLJA 1USVA 1R16A 2BE9A 5DWDA 2X4LA 3RG2A 2P0AA 4I7EA 5IASA 2B9VA 1RAFA 3UB4A 4BZZA 5FOUA 1GL9B 4FKBA 4B0PA 4BQNA 5K6TA 2QTVB 2Y1LA 1ZJYA 1H6DA 3ULKA 3SC3A 1ENYA 1AXRA 2RJOA 3O3NB 4WBXC 1KOJA 3A1NA 3U4QB 4GPEA 2ZBRA 1B6TA 1R66A 2HV8A 1L8LA 2GZHA 1NJFA 1UZMA 2ADFA 4KZKA 4LE2A 2ZRAA 2DHRA 1FNCA 2GEJA 4XFDA 3HYLA 3DZGA 2M9MA 2GBLA 1D4OA 1SUCA 3L5OA 1GEEA 4LJ6A 4E11A 5LJLA 2WWYA 3P27A 3LYLA 1ORVA 1L5GB 3SQXA 4MYCA 5I7VA 1NW7A 1U2SA 3CLSD 3IUMA 5G1OA 4D8WA 3C6KA 1OOEA 4LDQA 1YZNA 2O2DA 4ZYTA 4XLLA 3THWA 2NP7A 1JDUA 4O4JA 1DPFA 2QAIA 1QQ7A 2O2IA 2ZYHA 5THXA 4BNJA 1OH6A 5G4LA 3ICQB 4I55F 2G9ZA 1GN9A 2Q6TA 1HZZC 4LHVA 3U3JA 1XNRB 4KNVA 2Q6IA 1IBLB 4LNUA 4TL9A 5JXJA 1Q5PA 4H7KA 2UDPA 1X0VA 2V4MA 2ZUWA 2CNNA 2BTQA 1YDWA 5EFZA 5BXYA 3RRMA 3CBGA 4BRSA 5LZ4A 4Y2YA 3K5PA 4CEJA 1E77A 1G66A 3QXJA 1KY4A 4DKJA 1HGXA 1GIAA 4IJ5A 5HQJA 4A2PA 3DMTC 4QLAA 3CU5A 3GDFA 2ZR7A 5M3BA 1WCYA 1GZDA 4GOND 3D8HA 3VH4A 3NEAA 4U7HA 1QYRA 5C1DA 1YMVA 4JJZA 2GD0A 3ILSA 4NBLA 4OJYA 1G7TA 3O1LA 1XVLA 4O4HA 1ECLA 1N7GA 2VSXA 2ZFUA 3T35A 4N3AA 5I01A 2YR0A 1M6NA 1G6HA 1NBOA 3DH0A 1LBIA 3H1BA 1H94A 3BH6A 4INZA 4U8HA 5TX7A 1DT5A 3NYRA 1FMLA 4E1BA 1T91A 3HYRA 2Q6KA 3LHSA 2XQFA 3K72B 4E94A 4O2BF 2IHUA 3G8AA 4BFSA 5CBPA 3N9IA 3EF1A 4HDNA 1S2LA 3BXEA 4PZAA 1I2MA 1NE7A 1N2EA 2NO4A 1M54A 1YR2A 1WAMA 2DTEA 2ZSKA 3M81A 2VYVD 4LVOA 4RIEA 3OCJA 1QIMA 4XLTA 2ZOSA 1GAEO 5JQGA 2BH2A 5EZSA 1T13A 3UENA 1E4EB 1RWMA 1YZGA 1DQRA 1EJ2A 5IJAA 2ZUFA 1GKKA 1WEKA 3SVLA 1TJPB 2IPXA 1JXQA 3CCBA 4KDRA 4MWCA 3L0BA 5CTJA 1U0JA 5CYGA 1AGRA 2KS6A 4N82A 4XW2A 4LJ5A 1MOZA 1TPZA 1CY0A 1XZCA 4GGPA 4S0ZA 1KTIA 2Z6AA 1CF4A 5BR7A 1L4GA 1Q16A 3K5HA 1E58A 1O96B 4HZUB 1JBKA 1RMTA 5IBQA 5JADA 3NVDA 3ZR4B 1DC7A 3SYMA 1VKJA 2IYSA 2JATA 3D4LA 3GRKA 1MQ9A 4HQFA 2L17A 2QWXA 2XE6A 3MXTA 1B4DA 1IAVA 3WLFA 4JGGA 1UK6A 4GBGA 4KDCA 5G1PA 2BGWA 4DR4B 1MJGM 2ZT5A 1GUDA 1L8AA 1H42A 4BVLA 3YASA 1KK0A 1WHTA 1AQJA 2XXAB 2C4NA 3TLEA 4RDXA 1VMIA 1HSZA 1QGED 4WNCA 2YWFA 5AKKA 4D25A 2GR9A 2Z08A 2GGSA 3N3AC 5LMUB 1O3YA 4WZBE 3U62A 4Q03A 4HWTA 3S99A 5JCOC 4TV8F 3ZG6A 2B1JA 1JYEA 2J33A 4DA8A 1VL6A 3GRPA 3ZWAA 1N25A 4D3SA 1OU0A 2I03A 2WIDA 5F4BA 5D5QA 4DYHA 1JDVA 3C45A 1SGWA 1I3MA 3ZK9A 3EXG1 3F7TA 1AT1A 2NVBA 3OLWA 1PF7E 1RXCA 1U7ZA 3Q3IA 1MNAA 2ZZKA 4LOAA 8GPBA 1W93A 4YFVA 1TM4E 2OCAA 4Q3KA 4FN4A 5G3YA 1GD1O 3M89A 1CJTC 1HE5A 3QLJA 3KYCA 3PEEA 1JMKC 4JOSA 1L9KA 1P9LA 2WMYA 3ORQA 2CHVA 4N40A 3O75A 2A57A 4NYJR 4QVGA 1HX7A 1J8FA 1RMQA 3ONDA 3F6PA 2GCIA 1Y1LA 1D07A 1U11A 1X38A 3SIWA 2J45A 4CKZA 1ESZA 5JQGF 3GUZA 2I7CA 5DK4A 3ROGA 1GWNA 4JUCA 4DLSA 4PYKA 3ROTA 5IJ9A 1HYEA 3FMIA 1ZLYA 3FZEA 3C8HA 4QGHA 3OTWA 1EEHA 1WMDA 5E7JA 2A8YA 3LNTA 4L6AA 1E4EA 4V0SA 4ZANA 3TQTA 4COOA 4B7ZA 2OLJA 2HQSA 1ZZGA 3VTKA 3WL8A 4XASA 4CIWA 3EGWA 1JKIA 2WUWE 4W5WA 1KEVA 2P3OA 4JI6B 3HYCA 2O5RA 2SHKA 3A04A 2ZZNA 1LSJA 3J81A 3TTUA 1D8AA 3V80A 4N7RA 1YVUA 5JI2E 1TU3A 2G80A 1PGJA 2Z5FA 2D59A 3BFKA 3DV9A 4IOMA 4JUIA 1P72A 3F49S 3MQ2A 3SJBA 4HNQA 4B44A 2H1FA 3RI3A 3BUSA 1JB9A 5J1TB 2WM2A 3AFOA 3I6QA 1V1RB 4C6SA 1YQTA 1VBKA 3E58A 1P2VA 2WHYA 2ZJFA 3OA2A 5DI3A 2X8BA 4L6CA 4XYMA 4LBZA 3B2NA 3PD7A 2W90A 4R1TA 4AICA 3QOWA 4I5GA 2CLHB 2F00A 3RYTC 1O9HA 3PD1A 1R4MB 1QG4A 1Z2NX 4ZRMA 2JS7A 1OFVA 2R84A 2B69A 2V3WA 4R2LA 3C6MA 3Q3JB 2Q50A 4D9KA 3H11A 3GPCA 5BWCA 4DMRA 2NWQA 3G02A 3M4JA 4JLAA 3BB1A 1CQWA 5FFFA 1OZFA 2YQZA 3W34A 1FQOA 3OH8A 4EBFA 3GLGA 4HPJB 4RSGA 3RFVA 4LF8B 4MP3A 2CD9A 3DBRA 5ESWA 3WVNA 1Z4LA 1HTBA 1H6CA 4KRGA 3P9SA 1PL6A 2RH5A 4YJHB 1P73A 4TZ0A 1ZGHA 3OEHA 4HWRA 2ZRGA 3THWB 3E18A 1TEZA 4W1RA 4N49A 1X8KA 5KHLB 2CLFB 3DLTA 1NSFA 3ONVA 5SZJA 2XVXA 4IRXA 4MUJA 5AVXA 3FOCA 2GBFA 1TQ4A 4J1TC 2QIOA 1T9AA 1JFFB 2UYQA 3KSDO 4L8GA 4WKPA 5EE1A 3A28A 1EAYA 4QQNA 4UBJA 1TEHA 3GFRA 1JVNA 4J1TA 3FCSB 3DTVB 3FWZA 2VHJA 4EHHA 3ZWMA 4ESHA 1KI6A 4L8WB 1B76A 2LIPA 2QL9A 3QJGA 4QOFA 1ACLA 2VXBA 5DGTA 2FR8C 2NYUA 3ZBUA 2I6GA 4W5NA 2D13A 2FGJA 4RZUA 4IMRA 1K63A 2G06A 1PSWA 2FSVC 4UW9A 5E3JA 1ID8A 2P3QA 4WVFA 3LG2A 3M5DA 1Y1PA 2HRZA 5FPSA 4UJ3A 3A7EA 4XX0B 4Q0MA 2NGRA 4B3MB 2WKQA 1XQ6A 4Q24A 4ZOBA 1T36B 4IS2A 1QH9A 4NECA 6NULA 3WYCA 3ADCA 2FSSA 621PA 3I1FA 4TWIA 3FZNA 2F3PA 4UHBA 3ESQA 1Z0UA 1JLLB 2R8XA 2C7GA 2CXRA 4CPDA 1G5TA 5EIHA 2ZYVX 5DYWA 2XDAA 3MBIA 5DBOA 3OT1A 1FQKA 3AO0B 5IBPA 3NH6A 4EKYA 4I2VA 3K30A 4UE6A 3OPQA 4XSVA 3HCFA 2N1MA 2ZUUA 3CW8X 5ALTA 1VI2A 5C80A 5I51A 4XD7A 1QIHA 3GL9A 1C3EA 1Z34A 2PEZA 3AHCA 4MMXB 4NE7A 3W3AD 1X1DA 4W5RA 4K3VA 4JT4A 1BXRA 2PQ0A 3DYIA 1E2IA 2XF8A 5CNKA 2QJTA 1FRNA 1FUUA 4FMDB 4LCJA 3T7IA 1NWCA 4EB0A 1XQYA 3HXQA 2V3CC 4ZFNA 4ZDJA 3IOYA 4D82A 2QY9A 2G70A 1DKRA 1FPMA 2EEPA 3KQSA 3LP6A 2BZSA 5EIEA 1LV8A 3QOFA 1TYCA 4PFKA 1IG3A 1FS5A 1KEEB 2JJYA 2YL2A 3EXG2 1XRRA 3KXPA 4FINA 2YZGA 3BDVA 4O4JB 5ERGB 1GFWA 3WSTA 5D87A 4NCNA 1SFRA 4TUYF 1KR2A 4WFJA 5ALZA 3UUEA 1EMDA 1ZR4A 1GLNA 4G5QA 5KWSA 3U3MA 3M82A 5BYJA 5KU7A 1F1JA 4H7DA 1MC1A 4AT1A 2BH9A 2JLVA 3ME5A 5E6RA 3UC9A 1KQNA 3F5MA 4GR4A 4NX2A 1TTTA 3UK7A 1NTOA 2GK3A 1EWKA 1W88B 1WUJS 1XMSA 2AMYA 3E4CA 4I2NA 2A0FA 3SC6A 1NUPA 3UIEA 3UMGA 3WGUA 3FDZA 4CCWA 2R6GA 4AYXA 5F7XA 5B58C 1EFKA 1JS1X 3RFXA 4CG3A 1H2RS 3BFXA 3VZCA 4Z9YA 1X1SA 3EVNA 2BMWA 1ZL2A 1K8QA 3QVXA 5E95A 1MZPA 2ZI4A 3CNBA 3R7SA 1Z6AA 2F2TA 1GT91 4GT1A 1R8SA 4L5BA 4X6XA 4C6TB 4CWAA 5KQPA 1NT2A 1C5KA 2VDMB 3L84A 4KX5A 3WQQA 2PGAA 4EF4A 1Y3FE 4C89A 3WGJA 4EBBA 4RLSA 3O26A 3EC1A 1E1QD 1HUQA 1SBYA 2QTZA 1JYFA 1Z28A 3RT9A 4XEUA 1WZCA 4N1AA 4BTLA 1NJGA 5BUSA 2B94A 1UC8A 3MJHA 4IHJA 4ZO8A 5CFRA 5CITA 1FU8A 3R0VA 2PL1A 1HV8A 3HQ4O 1AQIA 5E8JA 1L7QA 2OD7A 2RGCA 3CLSC 4UEOA 3QOYA 2OXRA 2RKOA 4XB2A 3UV3A 3D43A 1N6RA 1K5HA 4G0NA 1YF3A 4CGZA 4BKPA 2XGSA 5G0TA 1B6GA 1ORHA 1TDJA 1QQ5A 1ZOPA 4NCKA 3WK7A 1JQDA 1GSHA 3MJRA 4BO5A 2YCBA 1IZ0A 2Z3VA 1O08A 5DM4A 1C4OA 2O0HA 4HVTA 3PUXA 3A4YA 5AVJA 4L5IA 3KB2A 4QBHA 2C0QA 1K97A 1FPQA 1Y48E 3CW9A 2BTEA 1WPRA 5JECA 3TXYA 1ODKA 4N47A 5C7IO 3QP9A 3ZWNA 3MJFA 1QHEA 4ZJZA 4RVGA 1RC8A 5CFLA 1E6UA 1QHGA 5A3JA 1CUEA 4O63O 3LHDA 4HWGA 1YD7A 3HVUA 3IOBA 4UULA 2O8CA 3Q4GA 3KSBC 4DRZA 4NDAA 5BN3A 1CY8A 1AM4D 3GMDA 4B3BA 4GEGA 4J90A 1ZK3A 4XIJA 2ONYA 4TTVA 1P0PA 4WCFB 3L8MA 4DSUA 1ZEMA 3W3AA 4NJOA 3G5UA 4ZTZB 1O4VA 2C98A 1IYZA 2LBPA 1KP2A 1VKHA 1G5RA 4RPGA 1OROA 3QVGB 1WDWB 4EK9A 5EI5A 4IDEA 3PF9A 3G89A 3ESYA 2X77A 1JA9A 5EHGA 1PI3A 3Q8WA 4IWXA 2ASEA 5CT9A 1P1BA 4JXJA 3ND7A 4CHGA 1M34B 1P2UA 2BAGA 1TUBA 3NHAA 5LBTA 3ROZA 2HMVA 3G9UA 4D57A 4BO7A 5B6IA 5L8VA 2YHSA 3PLNA 1HFEL 2GN0A 1NBWB 4DIOA 1F3OA 5ER9A 3C43A 3RVNA 4PZ0A 3GLGE 4A8JA 2FSPA 4CMAA 3KEQA 1QBKC 2MSDB 4ZODA 3QNUA 4OMFG 5GWXA 4LI0A 5DCUA 3UK1A 5E6RB 2V5UA 5H59A 5CA0B 2QP3A 1C1XB 1JHUA 1YOBA 3BTOA 3IJRA 4D8YA 3MT7A 3ABSB 4J3NA 3WRYC 2O52A 1RABA 2X86A 2C7QA 2ZSHA 2NW6A 1JA0A 3ADPA 1XCPA 3D02A 4Q3AA 4BLUA 2Q7OE 1B0AA 4II2A 4ZKDA 5FTMA 1YZFA 4A27A 1VI5A 1ZINA 3CO5A 4LY9A 4CMGA 3QFRA 3CB4A 4NABA 2CYBA 5F98A 2XAUA 5CDFE 3JWEA 3EK2A 1RHUA 3EXHB 4R5MA 3PFGA 2WDZA 4D4HA 1H2EA 4M3NA 3HPRA 5C9ZA 1TGVA 3L6EA 4I55A 4P54A 1JEYA 4KOAA 4NJEA 1L3IA 2HWXA 4L27A 1SXGA 4S12A 2XZOA 1A8UA 3JQRA 4N03A 4BNDB 1UF9A 1HR0B 1ZESA 4LDZA 3ZD8A 4KO1S 5KPJA 4K0KB 2IYQA 3F5QA 2AT1A 3F5SA 4MJ7A 2CC2A 4DVGA 1JF8A 1W49A 3WGYA 3IPXA 5GIOE 1CJSA 4CQNA 4HUJA 1PR4A 2VDNB 1M1XB 4MRSA 1G0OA 4S2UA 3RAJA 4BS9A 5JJBA 4FFBB 4GZ6A 4IUYA 3UQZA 5CDSA 1WMFA 4DBZA 1NUHA 2V8BA 1FL9A 1C8VB 2COUA 5IMBA 5JEEA 4QQRA 1UEXC 4JGBA 5F1OA 4PHGA 4BGVA 3QE0A 4WDRA 5KC9A 4B79A 3DCJA 3DZFA 3GCDA 2XGJA 4DYDA 2DEUA 3FIUA 1AZTA 1JU3A 3ZDYB 2RIPA 2CD7A 3AUKA 3CF2A 5IKPA 1JDBC 3AHHA 3N7TA 2WF8A 3EZ9A 1EKXA 1KARA 2BZ0A 3OZVA 1TO6A 4MW1A 1Q14A 2PRIA 5KAPA 3T1NA 2EG5A 3RJZA 2AFIA 2PFGA 1NBMD 2FWRA 1R6XA 1CG6A 5JCZA 3SI7A 3EN0A 2JGNA 3FYUA 3TNDA 3SR3A 5ALEA 5H3HA 3O74A 3RREA 1MW9X 1K66A 3FN4A 3L41A 1DO2A 4GI5A 5J23A 3HP4A 3CRW1 4L2IA 3WQBA 2YZ7A 2GHRA 2B4TO 2RAFA 2WFLB 4MNTA 4CCSA 1GT6A 5HM8A 3UMFA 1A96A 1Y6FA 3DDSA 1EVEA 3LQYA 4PGAA 3QQPA 4PZLA 2ZVJA 3VVMA 2WF7A 5AIBA 3QY9A 2FW7A 4KN8A 1Y6QA 3KR9A 1FB5A 2PKQP 1RXSA 3PPIA 1HQYE 1D1QA 1JRLA 3QEMB 4GNRA 3QVTA 4J7CA 3TIVA 1H5UA 1N5JA 4FIZA 4BWFB 4E7OA 4XWAA 4JYBA 2XB6A 5CGZA 2IUEA 2O6HA 4HAVA 4TWRA 2Z8ZA 4R98A 5A1JA 5JJIA 3R9XB 1T10A 2DWPA 4M1EA 4WOJA 4OHYA 3TPCA 1L1QA 3FHOA 3KZCA 4E2YA 1RBQA 3FFBA 1W0KA 3E8MA 4UU0A 3JAMA 3ZJ4A 3A05A 1G59A 1LF0A 1BN6A 2NX2A 4XB1A 4U7JA 1L5NA 1KI6B 4U63A 2VQ3A 5DK6A 1UJCA 4H3KB 3A27A 3G59A 4M2LA 5A05A 1KZ6A 2VDUE 3ABRB 5LBIA 3OQPA 3HXLA 4K9DA 1YB2A 1IXKA 2CLSA 3NFRA 4Z2YA 2WVAA 3LO8A 4EM6A 3M6UA 5JSFA 5F1KA 3PFNA 3W90A 5MGBA 1PR9A 2OBNA 3NEPX 4GZ5A 4DHWA 1XXLA 4H27A 1UWLA 5IK2A 4DCUA 3LT5A 3ZEAA 1C80A 2WYWA 1SVWA 2REQB 2Y77A 4PCLA 1CLUA 1D04A 2MMCA 4KQCA 1HYQA 2EZ4A 3BXZA 2BP7A 2JFXA 2MU1A 2JCYA 2VAPA 3CIFA 1V3UA 4TWAA 5K4HA 4PQGA 3KJFA 3PX2A 1R4NA 4IGKA 4KIGA 4QTYA 1YVPA 4EWLA 4ZHQB 1VZ2A 2ORWA 3BE8A 2P9YA 2FSGA 3OTOB 1V48A 2IJGX 2H07A 2W2VA 4KEAA 2Y1KA 4RTQA 5M29A 1GKYA 1RLJA 1BCRB 3KXLA 3BL6A 4L3OA 2F48A 2NXWA 4I6GA 1CERA 1YMQA 4WTOA 3I01M 3PC6A 4I50A 1SZPA 1A5TA 1QYCA 3T5AA 3OX4A 1JXMA 5I4IA 3M6FA 3PPVA 4LCBA 2JI7A 2CGEA 3QENA 1I32A 3W79A 2O5EA 3A4MA 2P2ZA 2FKNA 4D9JA 5HUJA 4XVUA 3V2GA 3T9AA 1KU6A 5DXJA 5FR2A 1G2IA 1AQLA 3SQNA 4ARVA 4OLHA 4YT5A 1TB4A 2EL7A 3I6BA 2FY8A 5F9HA 1JR4A 3G13A 2J9GA 3DDWA 5JSZB 3THXB 3I2FA 4OHXA 3K9QO 1GP2A 3PZBA 4DQLA 2Q5HA 3KKLA 3NPAA 5BMVB 2UXBB 1T35A 1EBFA 1PNQA 4DCNA 3V34A 4D3XA 3HVIA 2P9QA 1E2GA 2B30A 2BFCA 2X3UA 1FYWA 1ZD9A 2E89A 2JGIA 4IW3B 4LFAB 4YGYA 4WBNA 4MDYA 3IUEA 1N32B 3UBTA 1NR5A 1QO7A 2BRUA 4I3GA 1WQ1R 1NVUQ 1OLXA 2MDTA 2XYPA 3AETA 4JQOA 3MAGA 5EIAA 1K6EA 2C9BA 2VATA 3KZNA 4J4BA 2QU7A 1EFCA 1RZUA 2HA7A 3VM6A 5K5EA 1EXVA 4XQEA 1C81A 2JDID 2J67A 4J9UE 1GG5A 4CQMD 4H7FA 3L43A 4ALNA 3UMYA 3C97A 4XX0A 2FXVA 1CR0A 1PWEA 3KUUA 5E3IA 5J59A 5BQ3A 4UAVA 5JTTA 1GGKA 1M2KA 3LMKA 4HDMB 3I76A 4EJMA 5A5EA 5TEWA 1WY5A 1U0GA 1E0DA 2W43A 2HRBA 2YOHA 4EYQA 2VK8A 1JEQA 2XQKA 5H81A 2PYDA 2DHEA 3QVLA 1GZ3A 4WFIA 3HRIA 4PNZA 3WKAA 2FMTA 4RKFA 1OXUA 3ESCA 4QVKA 1JKJA 2JL1A 5L45A 3BXGA 2Y67A 5DIZA 3EFOB 4D6YA 1JKFA 3DT9A 2NV0A 3HR8A 2CFOA 1W8DA 5IDYA 3M6XA 3H4IA 3FYHA 1UUFA 4XD7D 3GGOA 2Q6VA 4OJMX 4HTFB 1T9BA 2BM0A 2QMHA 1IEXA 4MRVA 2MCFA 3ILHA 2G28A 2JGDA 2PD4A 2EDCA 3GFBA 4ITUA 4LDPA 2RHLA 1C3JA 3E61A 4YJHA 4RFSA 1O77A 4RDIA 1V4VA 2ETXA 1RZRD 2LKDA 3BIFA 1Z4QA 2PNFA 4IDHA 4YCLA 1ARZA 5DHQA 4EH1A 2B4KA 3GX1A 4W1SA 3ETLA 3D7RA 2RG7A 3LY5A 6YASA 3DLPX 4QQFA 1QLHA 1YMUA 4DNXA 1HEUA 3PP8A 1LTKA 2I6UA 3R3ZA 1B43A 1W35A 2CXPA 2J9FB 4RKEA 5HJ2A 3SHTA 3TW0A 3OPYB 1IWBB 3EAFA 4LECA 1IXSB 1J8MF 1GZVA 5C34B 1DTEA 1VLMA 3DR3A 5HA5A 1MP0A 1Z8DA 4RHCA 5H5JA 4EA9A 1T9KA 4QM6A 3GLGB 3TR0A 1U0EA 3PUYA 1A76A 2FH5B 3E9MA 2IXFA 1DGQA 3BULA 1KGSA 2LP4Y 3NHPA 2IIPA 3QI7A 4RA9B 3AR6A 4BFWA 3UICA 1XLTC 3A3OA 2EAUA 4LSGA 3RODA 3IDFA 1IWOA 4G0YA 5TVKA 4TL6A 6Q21A 4J0DA 2XPCA 2W2LA 3WYEA 2YOGA 2YZNA 3DCNA 1VJGA 5IKOA 1XD2A 1T34A 2DPLA 3ZCVA 2YXLA 2WAMA 1JXOA 3UEOA 3WAJA 2VEDA 1QGZA 1M66A 1TJ4A 3CUEF 3MUFA 4GOJA 3T7EA 3VHXB 1VCNA 4ENQA 4MV9A 1UAYA 2KSQA 3FCOA 2WJZB 3TR6A 1VRVA 4HDCA 1VCMA 3JR3A 4PSVA 1UH5A 1SXJA 3S81A 2NTNA 4A36A 5FDFA 1E2KA 3IVGA 1NFRA 1ZL0A 4HUQA 3BKXA 5EPOA 3IPLA 4M8IA 4TV8B 3WS7A 4DSTA 2GA8A 1PZXA 3K6RA 1NTRA 4MYHA 3O9VA 3RLIA 3WZ2A 3TSYA 2V7UA 5AOCA 4LFBB 1GKIA 3LCMA 5K8IA 4A0HA 5CLFA 3K4QA 3S2YA 3UWPA 4E3ZA 1ISJA 2OGSA 3A70A 3ND6A 3R23A 4DM3A 4DLBA 1NASA 1NLYA 5EWLA 3WBBA 2XUZA 3O4VA 4UU7A 1RLTA 2CE2X 3D4OA 3GFFA 4B0OA 1UWKA 4DA7A 3FAZA 2O3QA 4PQEA 1XDUA 3WP1B 3FD8A 3VVBA 4B32A 4AP6A 1TTHA 1KH1A 2P5YA 3R0ZA 2DQSA 4G5OA 5JAHA 3FZYA 1Z6TA 1I14A 2VDKB 2F6RA 2P6PA 5DLYA 3S1AA 4Z4IA 1KPHA 3HJTA 4GM1A 5KYYB 1LZKA 5CBKA 2BEUB 2DUMA 1JDSA 1J2RA 1IZYA 3WJ7A 4OQXA 3Q7SA 3UUGA 1CZLA 4RTRA 3S1AB 2XCTB 1PX0A 2OCXA 1JKJB 1XHEA 2PS9A 3CNHA 1A1SA 4PPFA 3VR4A 4QWMA 1ZVQA 4BKUA 1G3MA 3DW3X 5C4MA 1GYRA 1M0WA 1M2VA 1O6BA 3HKCB 2C03A 1PUIA 1JUDA 2XT0A 4X24A 5FR1A 4O2AA 4UKDA 4LA4A 3DOIA 4A03A 3Q11A 4LY3A 4BLSA 4CKEA 1MXFA 3TGWA 2ECPA 1RFLA 2IU0A 4CM4B 2AK3A 1CQPA 4RPHA 1N77A 1G8FA 3HZHA 1I24A 1SIUA 2ATEA 3H13A 1P62B 4IH4A 4JJ8A 4NOMA 4QYXA 4V39A 3DZ8A 5SZHB 4DPMA 3GDGA 1OZ0A 2RG1A 1R50A 3F4KA 3QUQA 2G1PA 3GFVA 1G2PA 5JRDS 2WIKA 2JJ2D 3D7MA 1YQ9A 3DWFA 4ASUD 3E2PA 2DUUA 2H2DA 1GR0A 2L42A 3ODGA 3IIEA 3SXPA 3ER8A 4K1XA 3L8DA 4H2DA 3O3CA 3P20A 1D5WA 1Z18A 4X6YA 1Z4PX 2ZREA 1ISRA 2QXTA 3JALA 3KP1A 4P36A 3VQTA 2WEKA 4PXYA 4D44A 1KYIA 2H1OA 4KLZA 5C53B 3QXXA 2J3KA 2BKEA 2QHXA 5E9QA 2RE8A 2C7PA 5AXBA 2ZE6A 4MW4A 3BJIC 3T5BA 4A0GA 4YAGA 4O3MA 1F60A 1GVNB 3GK3A 2C78A 4YRKA 1WU7A 4EW6A 1EGVB 4HN9A 4TSFA 4U1RA 5LNK6 4Y2GA 4CW7A 1C1DB 4B4OA 2A5LA 4UHDA 5C46F 1Q0QA 2EP7A 4JP8A 2EKPA 1MQSA 3C1OA 2W9XA 5AVOA 1CUYA 1UZLA 4NBTA 4CETA 3OWOA 1KYVA 4MTLA 1O95A 3A9SA 1QV6A 3QELA 1ZY2A 1RJGA 4GOLD 4MUNA 3EA4A 3ZC3A 5AKYA 1DI0A 4YR7A 4KXYA 3F9RA 4TKZA 4J3FA 2QRMA 3MS7A 3B7WA 5JY1A 3ECAA 1D7OA 3QE3A 5L4LA 5D1NA 3A4NA 4I3FA 5EMHA 3ZY3A 1P80A 5L51A 4B8ZA 1QG6A 4B45A 2O1WA 5BSTA 2RGXA 2ZB3A 4RZHA 1L0BA 3V48A 2YINC 5CA1F 1S1MA 3L4JA 1DO8A 1FVXA 4J4HA 2XDQB 4MV0A 3ZE0B 4AULA 4AXBA 4JFRA 4AS2A 1IM5A 2NVUA 2YJNA 2VP3A 2W6JA 4FNMA 2OT3B 4LJ9A 4YT2A 2PBFA 1SKAA 2QTCA 3F4BA 1MW8X 4JU9A 2V7GA 5DTEA 3VC2A 2A5DA 3G17A 4RM3A 2XX3A 3Q85A 1O0BA 2XZLA 4N6GA 1C8KA 1OYYA 5L7TA 1VJ0A 1M34A 2K5UA 3M49A 5ALSA 2VJNA 3B85A 2QZ4A 4BZPA 2WQ7A 1G98A 5JPDA 4B87A 4QYIB 2E2WA 2YWEA 4YJFA 1K08A 2AF3C 2A1TS 2IYRA 4O8ZA 2QX4A 2WFMA 3WZLA 3K1AB 3BHJA 1ODIA 2QYOA 2ZTLA 3HYNA 3ZE8A 1TYAE 3NUGA 4N8DA 3U4QA 2CSXA 5AOVA 1T2AA 2HFJA 2VHEA 3KO8A 1MAWA 4REQA 4GLLA 1KIFA 2IOFK 4WCFA 1CUUA 4X0EA 2ZXUA 5F2NA 1REQB 3ZIAA 3QHPA 5E4YA 4JBNA 5ALKA 3X3HA 1U2EA 2X14A 3PB3A 3WWPA 2XBUA 4CKBB 1O97C 1UR5A 1F5SA 3HDGA 3SSMA 1WVIA 4BCBA 5TJ9A 2B35A 4MRRA 2HRRA 4PRYA 1KMCA 1JIQA 2OCYC 3WGHA 3H2SA 4GSYA 4HN4B 3IL2A 3M6WA 2GXUA 4DQUA 1TZBA 3ID6C 4JUFA 2A1IA 4URXR 4GOOD 2H7XA 1FTYA 2XOXA 1YQDA 1VMKA 3EPRA 4K1LA 1BN7A 4BFYA 5AM0A 1L2TA 2YOFA 3BJEA 1P4JA 1SCDA 2ZYWX 4FYXA 5EJFA 1W2WB 1PYDA 3UHAA 121PA 2XB4A 4PX9A 4F8YA 1QGYA 3MCZA 2C8LA 1OI4A 2PH3A 4G1EB 2I62A 4BNGA 2ODEA 4BNDA 1QQTA 4FLFA 2HLHA 1NY6A 1E64A 1PDVA 3MTJA 1QE3A 4KXMA 2WHPB 1IWPB 2HM7A 1N8TA 1X7GA 2QJWA 3MUEA 4B2PA 2YBEA 3PD0A 5EPUA 5J58A 1J09A 2I2DA 3SDZA 2O8FA 4RTSA 2ROQA 3AYZB 1HL7A 2KJQA 3GUYA 5BWLA 3ZJTA 1W4AA 1ZGCA 4PYMA 1Z2DA 3COYA 1YR3A 5CXQA 1T4GA 1WW8A 1UK9A 5DRYA 5I8WA 1RC1A 3ZI0A 3H0EA 3JAWA 5AVUA 4BGIA 3OMLA 4UM7A 1EK1A 2PU7A 4UTVA 1XQ1A 3P2IA 4KP7A 4ZVNA 3T9DA 3M4NA 5BQFA 2OP0A 3AUYA 5JCJA 4LKRA 3LPLA 3I23A 3T9BA 4LS3A 5KTKA 3RHTA 1IB0A 1L5MA 3HV0A 2WT4A 2ZVDA 2RHRA 4P80A 5ARBA 1BMFD 2H2FA 1R4NB 2X0IA 1N2SA 4C06A 3UAGA 1A3CA 2BP7B 3GMSA 3PQEA 1WKVA 4FD3A 9GPBA 5ADWA 3MRXA 5LIPA 2I2BA 3IEXA 3NRCA 1OFHA 3PKZA 4MUGA 2I1VB 3QTBA 5ERXA 3RJTA 3SK0A 1U2RA 2XQGA 4BNKA 2X5KO 2DU8A 4A1FA 4ZOLF 4KFSA 5LQMA 2X5JO 4M0DA 2P4HX 2QW0X 4KU4A 3VYRB 2H54A 4C0HA 5B53A 5K7SA 1EFHA 1E1QA 1SU7A 2WB4A 3T5TA 3F6BX 1K7SN 1OTHA 1TD1A 3H9UA 1NDQA 3X2FA 4M6WB 5LQUA 4RQTA 4QNMA 1K4MA 2Q21A 5AJVB 4E5MA 4UAUA 1K4KA 2Q0SA 3CBQA 1XJ0A 4PFSA 4NC9A 2P9EA 2VXYA 3G82C 3M6IA 4GU5A 4JEMA 3IAM6 4FGSA 5DP2A 1JHVA 2FN3A 3RM3A 2EHDA 3E1GA 4JJIA 4YAIA 1C9JA 3SX2A 1L7NA 5TMPA 1AD2A 4YJ2B 1IK4A 5K03A 3BB3A 5CHYA 3NNSA 3UJHA 1KEEA 3PR1A 1PVOA 2NUAB 2FR8A 2I4IA 4EYOA 2JHAA 3KR0A 2IP4A 3ZQ6A 3OCXA 2N47A 4IUBS 1OWPA 5CRIA 3WWCA 2H1WA 3AL3A 1DVRA 3INTA 3PXEA 3MJEA 4EB3A 2GFQA 3E7PA 3R6DA 2ADMA 2OWEA 1OAOA 2ZAYA 4GE0A 3J7AC 1E5XA 1RCFA 1IH8A 2VH1A 1JR2A 4OM8A 4TRNA 2FN7A 3T4XA 1BAPA 1Z5PA 2HAEA 4N0QA 3KOMA 1S89A 1M72A 3C41J 3IVXA 3EC7A 3LY8A 4RCZA 2H8GA 4O25A 2WSMA 4KAAA 2GKOA 3MAJA 3ETNA 4WXMA 1W4LA 3T3MB 2ERXA 4D42A 1LDBA 4DCCA 1DLJA 2ZRFA 3BVPA 4TXMA 2B9EA 1JE0A 3K9FC 2XRFA 2JLQA 3AJRA 3CZRA 1GZSA 4MP8A 3OPYI 5EFOA 1BDIA 5DNDA 4ARAA 2IELA 3GFOA 4RWEA 4EL0A 5C32A 4NZOA 2HADA 1AK9A 1SVMA 1JHAA 1F0YA 3DEHA 1MABA 1VE1A 4L9AA 4CM6A 4JBHA 4C5AA 5KSPA 3AF0A 2DBZA 2OMEA 1FDIA 3FWNA 4FP9A 4ZK6A 2VTBA 2VYFA 2VAXA 3BMNB 3GDOA 2QD3A 2QVCA 3GH1A 3NOQA 4J1SA 3AHIA 5CEFA 2VJMA 5EJEA 1YIAA 3MELA 4OUKX 4FQ5A 4C5BA 3HBLA 3GXBA 4BC1A 2QT1A 1V3VA 3HUTA 5CAEB 3TSWA 4R0MA 5EIBC 4KQJA 1IN8A 1Y3IA 3Q7RA 4UTZA 2FQWA 2X1HA 2R5NA 4C0JA 5IAOA 4PSUA 4LOLA 2LWIA 1Z4JA 3PYLA 3ND8A 3E3OA 4C4ZA 4OBWA 1G2QA 3M0EA 3I01A 1AY0A 1RR6A 2IEZA 3L77A 2AVNA 1U9JA 2YRXA 4FFDA 3X2EA 3KQLA 4M1YA 1C4XA 5CX1A 3BTVA 3I09A 1DBIA 1EWQA 5CEJA 2JANA 2WUDA 3ZLJA 3OZSA 1LBHA 3QW4B 3TQRA 2ISSD 8LDHA 4RF2A 3WGZA 2XYQA 3EXHA 3REOA 1L4UA 1Y37A 2HX1A 2MSCB 3NALA 4HLDA 2Z4SA 4AMVA 1M0EA 4AS1A 2FUEA 4B35A 3BWVA 3QJYA 4WN9A 2X8AA 3C7AA 1NXQA 2Y0EA 3T0FA 4RTPA 1ML3A 4LI3X 4FMCF 4F5YA 1HLGA 3LGAA 2R4QA 4B1FA 5KVQA 2WP8J 1VJ1A 3UM9A 1BA3A 3EG9A 4YHHB 2HA5A 4PM4A 1Z0AA 1TKAA 2Q9BA 2FVYA 2X1VA 4I50F 4LY0A 1N92A 4N7BA 3UH1A 3E3NA 3CEPB 4XTRA 2VUUA 1XLVA 3H83A 2O7RA 1RSZA 5EJ4A 2NZ2A 3UPUA 1ZOLA 2FPKA 3OC0A 2Z0MA 3PRHA 4G1UC 1FUEA 1YDEA 4MKFA 3N58A 4FVTA 5C3UA 3IP6A 2DWQA 5KJEA 1E79D 2FPMA 3GARA 3QBEA 4Z4QA 4X60A 4D8VA 3GRCA 3UJNA 2CBGA 1Y8AA 1UIRA 5K3BA 1GVHA 4YP9A 3LXMA 3FLAA 3G7UA 4BMOB 2XVMA 3KV1A 1LV7A 1SC4A 3H19A 5BRNA 3PJFA 1EM6A 1NDUA 4U02A 3SFVA 1E1LA 4MPJA 4LPKA 4GNKA 4ZU1X 2HMWA 2FZ5A 1CUHA 2LPMA 2H2AA 1N57A 4V02A 3V1TC 2O7VA 3F78A 3OZGA 4BIMA 1C0LA 2WABA 4AMZA 1MPXA 1ICIA 4AYTA 2FFQA 1DQZA 2JEZA 1ZCJA 1EHIA 5DSXA 1KKMA 4TM7A 3PE4A 1LH0A 1VHLA 3A9RA 1NKVA 3N8DA 1FLAA 1OKKA 1BOFA 2JZCA 5SZKB 4W7HA 4YXFA 4BVKA 3IXLA 1YRWA 3D64A 2AKAB 1P2GA 2NU9A 2IZ5A 3PQ5A 3QVWA 3ZXYA 1CFJA 4ZMRA 5JXHA 2ORYA 4KQ6A 1V9SA 2D0PB 2H1IA 2HNAA 3R8CA 1FQWA 4TSKA 1U3VA 4FFOA 5FLEX 5FJJA 4TV9F 5D3QA 1NQWA 3ZWQA 3MSXA 4BVGA 2DFNA 2QD2A 4GOMD 5J2UB 2A0YA 4R9RA 1NY5A 1L4HA 2AEFA 3REFA 5C8YF 3N6RA 2MSNA 2V0NA 1Q17A 4C2AA 1LDNA 4I81A 4G1FA 2ZE5A 5REQA 2NQ2C 3HKCA 4P5DA 3TUIC 4BB9A 4MUAA 3ICEA 2QX6A 1V9CA 2YXDA 2MMGA 1GR1A 5JSUA 4FFPA 1QF6A 3TQQA 3WOVA 1J20A 3HCDA 5FNVF 4L15A 5CJJA 3S7ZA 5AVWA 4I14A 3KVRA 5F3WB 1BC5A 4P3YA 1UODA 4W6QA 2ZCUA 4YTEA 1XSEA 2GBGA 4JBXA 3RD5A 5CFZA 1OBCA 3DQPA 3BX1A 3CQ9A 1OREA 3FCYA 4CR6A 4J0IA 2R8BA 4KSCA 1I01A 4JYPA 3VSCA 3C1AA 2RD2A 5I7HA 4V0LA 2DUNA 2JGLA 3CNOA 1N2BA 1CNMA 1CZNA 2FW0A 1JILA 4G4JA 1RYYA 5CPFA 3ROQA 4XVHA 3U4DA 1KK2A 1A04A 2C3MA 3DZJA 4ZYXA 2P35A 2EERA 3PEVA 1UBNA 5BNWA 2VCEA 1DEOA 3VYWA 3RUEA 3SDBA 3C48A 4PSDA 5KQLA 2RGWA 1QBGA 5GZ6A 3MOGA 2D1QA 2XB9A 2AC7A 4N12A 3PHHA 4PN7A 2C4VA 4CN8A 1PE0A 4YO8A 2WFAA 1AKNA 4K6MA 4L76A 4AJ4A 1FYFA 2FOXA 3P4XA 3QXCA 5H0IA 4D3FA 1NV9A 2YDXA 4LDRA 4CTJA 3HP1A 4C9BA 2VXOA 3L1UA 3COWA 5CDGA 1WOMA 1P4AA 3VHXA 1BJKA 1NRXA 1DRKA 4IEFB 3K4HA 4BJ1A 4C3VA 1MO5A 4DJFC 4RKYA 3VH3A 1NF2A 4RNDB 4C0WA 1M2EA 1R74A 1GY8A 2BFOA 4Z0PA 4HP8A 4DEYA 1KE2A 2E0IA 1SBCA 4JAVC 1T5BA 2RAVA 3ZW8A 2PVSA 3H04A 2J87A 3BGSA 4BFCA 4MUMA 4MUXA 1OFUA 3BH0A 1FFBA 3TRDA 1U9ZA 4RJTA 4GL2A 4KE8A 1OXBB 3NOOA 4C07A 1E9VA 4DHEA 5HKAA 1RW4A 4L75A 3T4UA 1P44A 3DXFA 4BP9A 2FLVA 1TA4A 1TVMA 2QTBA 3FDFA 3HHEA 4UTRA 3WNDA 1DZ3A 2QN1A 4RAOA 4ZQCB 4ZT3A 3FPHA 4F4DA 5JVDF 1ZK0A 2UZ1B 2HYDA 1QF9A 1QGUA 1UKCA 3HMQA 1W4RA 1BDJA 2CLOB 2ZIXA 3ORYA 4KE6A 2D0DA 3KSRA 3Q1KA 3R76A 1L4LA 1Q2UA 3DW1X 1W47A 1A9XB 4G5YA 3RCBA 4Q7JB 4ZVOA 2TSYB 1NG9A 3K9CA 1P1IA 2OOKA 4TV9B 1E0KA 1DXYA 1E3JA 2PH7A 4KMOA 4RY8A 2ENWA 4U8GA 5CVDA 3BMQB 4Q7QA 5TC4A 2ACEA 4LJLA 2DHCA 1QOZA 2H2WA 4BKOA 3EDRA 4R1SA 1WO8A 2QXYA 3IOCA 3ITEA 4LE1A 5DN9A 4F7WA 4YCJA 2A4KA 2G5GX 2Y27A 4HQ0A 4IDFA 4LOHA 4NAHA 5IX8A 1PJCA 5K8TA 2Q49A 1RNLA 1DKNA 1ONNA 4RK0A 5EZ5A 1M2VB 4EUSA 1N9ZA 4QO8A 4MDHA 1Q21A 4TQGA 4D4GA 4OATA 1XWWA 3PNBA 3IRUA 3QA9A 3VU8A 2CCGA 2VNHA 2XCIA 1FFDA 1N3BA 2P5SA 2X8JB 3PLAE 4REQB 1ULSA 1KZ1A 3A3NA 4ZI7B 2Z1DA 3V4RA 2RI1A 1AUXA 2DT8A 4MV1A 4FFSA 4HNSA 3GBPA 1GYQA 4AK9A 5FYDA 1RIFA 3MTAA 4PHTA 3B6EA 2Q5FA 3LUPA 4CV0A 1ZZEA 2PWZA 3EH2A 4K2AA 1XRSB 3KKNA 3HU3A 4OD0A 4R2IA 5LPNA 2GJKA 2R00C 3U40A 2IBMA 4PICA 4IP0A 4PZYA 1NP3A 2WD9A 2YFQA 4Y18A 4RTLA 2HPVA 4FB5A 3A31A 2ZETA 4RHTA 1RPJA 3FPEA 2JF0A 3X44A 5J47A 4Y9TA 2Q4EA 1WG8A 3STUA 3HUEA 4DSZA 3K0BA 3P9IA 5AKJA 4JLMA 1VLQA 2QN2A 2WTNA 4CM9A 3AZQA 2PZEA 1W4ZA 3MLEA 1F2UA 2O2XA 5L3ZA 2RJNA 3ZJ5A 1Z25A 1EESA 2OCDA 2I1WA 1JTVA 3AI1A 4B6QA 4EHNA 4FEAA 4WBNB 5A5DA 1NVAA 1XU4A 3CM0A 1KZ7B 3FB4A 4LZOA 1FDRA 1T2EA 2Q3BA 4DMKA 1B8OA 3S8YA 2XRZA 2CKMA 1XTQA 2NO0A 3MQ4A 2NZWA 1HE3A 4TYWA 3QNMA 2WD7B 4J0EA 1TIKA 3GRRA 1AVTA 4XPZA 2A5GA 1XD2B 4JLOA 5IVKA 4DILA 1Z56C 1LBQA 4PO8A 2P69A 3PITA 4E2ZA 5BOSA 1Y63A 1F3LA 4ZYWA 4TV9A 2PWPA 4RJIA 2YASA 4CQMB 4LQCA 3TZLA 5EP4A 2PX6A 3BTSA 1U98A 1Z6GA 1NXSA 3IBYA 4IBOA 4ZZ3A 1JV2B 3W2IA 3ZXSA 4CQMA 1QVWA 2VL7A 3QVUA 4M86A 4DLPA 1AKVA 1KVQA 2YJ3A 1O8CA 3AKCA 3H5RA 2GILA 1X7YB 3VR6D 1LLUA 1VJRA 3EGCA 3EVZA 4YJ3A 4KV9A 1Q1QA 3DTTA 4WESA 4D3DA 5TDHA 3L79A 3JQ9C 4EPXA 1XNQB 1VA5A 3IQGX 2M1XA 2WDPA 1K7EB 4FHGA 4X7MA 2QP4A 5ICMA 4I4LA 4MQBA 2QTMA 4EAAA 4M9UA 4WY5A 2REQA 1ENPA 1YZUA 4HRVA 3HDTA 4XRGA 1T3ZA 3ETDA 3GI1A 3K0FB 3EIWA 1MO4A 3EVTA 5D6NA 1YQWA 5E9JA 4L4YA 5G1NA 5JH7A 1GGFA 3SSAA 2E6UX 4C0LA 3AB3A 3VNVA 1QZTA 4Q3EA 4QU0A 5DNWA 1N2XA 2J6BA 4DLNA 3MJCA 3A9VA 4YQYA 1SOMA 4PX2A 4EFLA 3T7CA 4GPIB 1BWRA 1EQ2A 4I4CA 1BMDA 3B9RA 1QRDA 3HKEB 4IV5A 4BP8A 4CV3A 4P22A 1F7VA 4M0FA 4B7CA 1BXGB 5SYNA 3VPDA 1PD0A 2IH2A 3ZHSA 3LC0A 3DMRA 4GI1A 4MR7A 1IOWA 4OQLA 4GSKA 1OTXA 4BTVA 5HPYB 1U8UA 2V5VA 1SIOA 3ZZMA 5I6DA 1TVKA 4MHSA 2JEYA 3A6LA 3TE7A 4CGYA 4AKIA 1KR5A 4Y2XA 4PAWA 4EMTA 2GRJA 2C5GA 2PZGA 2QD4A 3EUAA 4AUMA 3ABOB 4JT2A 3FF1A 3LLSA 3PHCA 1JAXA 4AZVA 4F9EA 2BFCB 3WLOA 3FPSA 2O3UA 4RLFA 2JCBA 4RTNA 5JY6A 1TK9A 1GTSA 2ARKA 4RDCA 4TTSA 1FA9A 1TVEA 2WG1A 2PUDA 3QWBA 1Q20A 3PXXA 3ZS9A 3ES9A 1U8TA 3RVMA 4OLFA 4XUCA 1UP7A 3U7IA 4GBMA 3H84A 2Q8PA 4FYVA 2GXQA 1J0CA 4J0KA 3SF0A 2AW5A 1E9CA 4RXTA 4WE3A 5LC1A 3NBMA 2YX1A 4B9AA 2VPQA 3SLRA 1U2PA 2HF2A 2VDVE 2R96A 4K86A 3NIBA 4QEKA 3A4LA 4QREA 2ZIZA 4WK2B 2L69A 1JL3A 3IBCA 3PGMA 5KPDA 3OIWA 5DPMA 4RULA 2IYVA 3KALA 1B16A 3T7RA 4BFVA 3O82A 4AG5A 3UANA 1PNVA 2VG8A 2DFVA 2M6RA 1F8XA 1FDWA 1PTJC 2AC2A 3OCWA 2B25A 2WD7A 3BD9A 4OG2A 2EF0A 4R40A 3VU9A 1DWUA 3ZD9A 4DR7B 2YXBA 4AJPA 3KUDA 5CP8A 2Q5QA 2YHAA 4NK5A 4YPOA 2WWXA 3SZMA 4JI8B 1SG9A 2JDIA 3BD7A 1CUWA 2HIAA 3FUCA 3GEPA 4E5VA 2YNMA 1S01A 3PS9A 3IPAA 3EBPA 1N2HA 1XUOA 2XADA 2Z1MA 1T0JB 2PUBA 3C16C 2IIVA 2NTJA 3QBVA 3IIMA 2QRUA 4PS0A 5ERYA 1AURA 4MWOA 2ZU6A 1SQGA 4OREX 1J0DA 1XV5A 2UUOA 3DYVA 5IJZA 2ZJAA 1A9RA 3LM8A 5IH7A 2GN6A 2W7TA 3IQEA 1Q77A 2Q3FA 4MPTA 3R7WA 4JXXA 2CEKA 4L0DA 1I94B 1D2AA 2H2GA 3ND9A 4OQNA 4EPTA 1ODFA 4W99A 1HDXA 3B53X 3NAQA 2F3UA 4CLRB 5LD2B 4G07A 4H60A 2FPOA 3D6TB 5ALFA 1TFRA 1A7AA 3MWGA 2XMRA 1I0ZA 3FM9A 4NNJA 4ZICA 4N76A 6REQB 1U1IA 4BMZA 1TO1E 3I2KA 4PBSA 2Q3JA 4JI2B 3L7BA 4IZ6A 1PQUA 1LPMA 2F1JA 2GKGA 3MGGA 1Z88A 1Q1NA 4N39A 1QKJA 4CMIB 4ETWA 1U3TA 2HPZA 5A4FS 3FFAA 1E9SA 1K7YA 3ZU2A 4GRIA 3FXAA 3VKHA 2HJGA 1IEWA 3CRZA 4A2WA 1H1LB 4R71A 4RLQA 4LUCA 3ZZTA 2X0JA 2IOHA 2MYPA 4AVYA 4MWSA 1MFZA 4YMHA 4LK2A 1DEHA 1DBPA 2GPSA 4Q6WA 2AX3A 5HIKA 1UWVA 1FFHA 5GTDA 2CK3D 2ECKA 2YYYA 3BRWD 4NI5A 4NPCA 4QOHA 4IEEA 3OZFA 1BOOA 4AZWA 1NVTA 3ORSA 4JUAA 3RVJA 4NYMQ 4QAJA 4XGNA 5IK2D 1RACA 1E63A 4YRBA 3FJOA 2CN1A 4R1MA 4Y1RA 1ZUHA 2IEGA 4HDMA 5FPPA 1LSOA 1WNFA 4J2HA 4BJ3A 1RLOA 4MQFA 5ALMA 2R8PA 1ZCFA 3N8IA 2CKDA 2QTVA 2FMHA 2EU8A 1CUJA 3D81A 4NJMA 4Q1EA 5LDHA 3UJPA 4C5CA 2IDMA 1KBOA 2OYSA 2ZJ7A 5CJPA 1ADYA 1T9GS 4K5QA 4DUGA 3EPHA 4LG1A 3HI4A 4H3VA 4R01A 3OIYA 4B4KA 4Q3NA 2ZRMA 2JJ1D 3KG2A 2H11A 5D8DA 4YCSA 3H16A 5AVVA 1G8YA 2OZLA 1XEFA 4PGHA 2B5OA 2VSOA 1WULS 2ZSEA 5D84A 1U9IA 3ER6A 4MWEA 3HA5A 3A1DA 3E84A 2YZ2A 1XXHA 3FPAA 1D2NA 1MOQA 4H6PA 5E4JA 2OO5C 5CFOA 4KPEC 3CPSA 3KT6A 4X65B 1UMDA 1I3CA 2F9LA 2JGJA 2QUKA 3IQXA 4AY6A 3JQPA 4CR8A 4LTDA 2AQ8A 3NO4A 1SXQA 3UJDA 5I4KA 1NVBA 2O14A 4H35A 2J8ZA 2HBZA 2IYUA 2WWRA 1S8FA 2YWCA 2OG1A 2AWNA 3RANA 2C20A 4D98A 2GJSA 4K9QA 2FZVA 3DKIA 3SSNA 1NVWQ 4PPYA 2H1SA 1II9A 2Q4BA 5J9FA 5LR6A 1W1IA 1WSBA 2QD5A 2WSSD 2IF0A 3MT0A 2JJ1A 2VJPA 2O3SA 3FJYA 4R9NA 5KJ6A 2AI1A 1KH2A 1ST3A 4C3ZA 3BSYA 1O7JA 1UPTA 4XJVA 3RBXA 4EG5A 1DJMA 2NXEA 2INGX 5KI6A