3F62A

Crystal structure of human il-18 in complex with ectromelia virus il-18 binding protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
GAMVETKCPNLDIVTSSGEFHCSGCVEHMPEFSYMYWLAKDMKSDEDTKFIEHLGDGINEDETVRTTDGGITTLRKVLHVTDTNKFAHYRFTCVLTTLDGVSKKNIWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin 18 binding protein
publication title Structural basis for antagonism of human interleukin 18 by poxvirus interleukin 18-binding protein.
pubmed doi rcsb
source organism Ectromelia virus
molecule tags Cytokine
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2008-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f62A00
3A6CL 1MPAH 1RJYA 2X5PA 4HT1H 2HKHL 3OV6A 4OD1L 4F15C 2FZ3A 4LCWA 5EU6A 2DD8H 3PGCB 1I3RB 2IPTH 2VLJB 1FVCB 4KK6C 3QDGD 4MA1C 4HF5H 2FB4L 2JB5H 4FQIL 4NDMB 3MGOA 3BIBX 5GHWL 2XFXA 3E2HC 5D93B 3O2WL 1WJ3A 2AK4A 2KQNA 5JZ7D 3WIHH 2ADFH 3ZE1F 5CEZH 2HVKA 2XNAA 3ES6A 4M5ZH 3OAYK 4XXCC 5J4MA 4PLJC 4KC3B 2CUIA 3VXRD 4MZ3A 1ADQH 1KN4H 1D9KA 4G6FD 1VSCA 5L0QC 1N0XL 4OGZA 4QYOA 4XPBH 1K6QL 4TTGA 4P59L 4BK4A 1KTDB 1CYGA 1CFVH 1I9EA 2AK1H 2ENSA 3H9HB 4I9WD 4WHTB 1MCJA 4G9DB 1X7QB 5D7LB 5C3TA 1Q8MA 4FTVD 1RUMH 2NY6B 1DSFH 2IAMB 3KPMA 4J23A 1JMZA 1EHAA 3FT2A 3SDXB 2HLAB 5CIPA 1JZ5A 4EVNB 3ZE1E 3MJ9H 4KAQL 2HT3C 4NQEE 2XN9E 2WBJD 3UTSE 4LASH 3TCLB 2FHBA 4IS6A 3MNVA 2CPCA 3KPSA 3W9EB 3WKNA 4YUEH 1N5YH 1W0VB 1JRHH 5D93C 4HZAA 5AD0B 5E2UL 3QPXL 3TN0A 2YUVA 1J18A 3OPZL 3KLHC 3IDYB 3I50H 4OLEA 2VDLL 4FXGB 5E2TH 1FAIH 3MGTA 3MV8B 5JOEA 4PJ5B 5ESVA 2W07A 3CX2A 4XNZB 2Y7QB 4BKLA 3G5XB 3ZDXF 2CLVA 1ORSA 3QUXA 5IKCA 1GGUA 4NRZB 2WK2A 3VFOB 3BMWA 4UTBH 1T3FB 1TVBA 4G8EB 4OZHA 5E99H 5AZ2H 1SM3L 2A9ML 1A6AA 3B2UC 2CKBA 3HE6A 3QDMB 5EH1A 2NY6C 2IAMC 5C09A 35C8H 3MLTA 4LLVA 3X17A 5JO5B 4EBQH 3BFOA 4YHPB 3AMLA 4KTDL 4X7DC 4JJ5B 1IEAA 1IQWL 3DXAE 3MLRH 1OP5H 2EE2A 1QLEH 4QRRD 1VACA 4X6EA 1EHNA 3MJ8A 3DMMB 2OK0L 4WNQB 1HWHB 5JW4Q 4H25B 3RUGA 3ZDXE 1MFCL 5JORB 3U4BL 3IDYC 4JY4A 1A7PH 4X4YB 3VCLB 1VDGA 4ZFGL 4EKXA 1DBAH 4KWUA 5DGRA 4CU7A 1X5YA 4XH2A 1LNUB 2G9HB 1U3HB 3CFEB 1H3GA 3EFDL 4R9HA 2ATPB 4XNZC 4P2QB 3N85H 3L6FB 4H26A 5DEFB 4ZO8A 3NIGF 3BN3B 1MHHA 3LIZL 4HIXL 4K3DH 4TUOA 4XMLH 5GRVL 3F58H 5K59F 3O2DH 1Q0YL 4P57B 4X6CA 2BXZA 1M7IB 1VERA 4HWBL 4RMVA 1F2XK 1AE6L 4GOSA 1L0XA 2PETA 3VWJA 2W0FB 4N5ED 1N7MH 1IJ9A 1KULA 3KJ6H 5E00B 4BFGA 4QKXB 2EXYC 3PWLB 3QFDB 1DL7H 1BOGA 1UVQB 1U6AH 1KCSH 2HT4C 2OL3A 1HINH 4K8RL 1GGIH 1KNOA 4G6JH 5D7JA 1UB5B 2VDKH 2VQ1B 5FGCE 1U93B 2R4RH 3NIGE 1JFQL 3SKOA 2HJKA 2Z4QB 5HHVL 1XR8B 2LQRA 3MLWH 2QQLL 3S35H 3A67L 5C07D 1I9RL 1U3HC 1FSKB 3DX8B 1UACH 1RZ7L 1O0VA 4FS0A 4UAOC 5F93C 1KC5L 4G7VL 2BHZA 5KZCD 3RZCD 2BSSA 1MI5E 4HEPG 4C58B 5HYJE 1DZBA 4IDLA 4PYGA 3KPNA 3SY0B 1UKQA 4YGVB 2P5EB 2O26U 3Q5YA 4Q74A 3RJDA 3WS6C 1PZ5B 4B50A 2Q76B 4MA3B 1T2QL 3INUH 3LSOB 4KDVA 5HD8D 2NY1C 3A0OA 4R8WH 4TUJB 4BSVA 2Q3AA 3ZO0A 1RZIA 1E28B 3BE1L 3EOTL 3MRGB 1G1YA 3RVWD 1B6UA 3JUZA 4D3CL 2R2EA 4IRZL 1WBXA 1T0NA 1I1FB 2HTKC 4Y4HD 3ESUF 4PRID 5HHOA 3U48A 2F58H 3G5YB 5FM4A 5C0BE 3WLBB 4ZSOA 2QADB 2Y5TA 4OSUL 4U6XA 1HHGB 3BH8A 5F1OB 5FYKE 1N4XL 2QHLA 2RHEA 3ARGB 4OF3A 1FSKC 1UJ3A 2QHRH 2XTLA 2IH1B 3ARDA 4PJBB 1ZGLP 2KZWA 5E7FA 1PDKA 3REWB 4X5WB 3WNOA 5DO2D 3CPLA 5AYQA 1P1ZA 3IAQA 3S4SG 3SO3B 4LL9A 1CD1A 3KHQA 4HXBH 2HG5A 3P9WB 3TO2A 3VFPA 1KPVB 4N1CA 2HRPL 5JUEH 3EYSH 1T6WA 3OKNB 4UT9H 4Y4KB 3WHE1 1KELL 3HRZA 4KRPD 2VN4A 1NMCB 3PGDB 4GKOA 2MCPL 4NNXB 5E8PA 4D8PB 1UM6H 5I66B 4PY7B 2NX5E 2HLFD 3MLUH 1CU4L 5FV2A 1RJYB 2QADC 4JG0H 5FYLE 4CRPA 4MMZC 1MRCL 3IF1B 2FZ3B 5EIIA 3ARGC 3QQ4B 4XMKL 3UXFA 3CXDL 5DJDA 5LGHL 1J86A 5HHME 4KTEL 1P4BL 5T33L 3MCKA 12E8H 2VLRD 3MGOB 2XFXB 3B5HA 3TLRA 3SO3C 1KIUA 1JNNL 3CMOH 2YZ1A 4K9EH 5CEXA 3PWPA 2AK4B 3UEZA 2FO1A 3V9FA 5IHUH 5CP3A 3TT3L 1TVHA 2C3XA 3D39A 2HVKB 2XNAB 3ES6B 3GM0A 3KS0J 4Y4KC 3SCMC 5IQ7L 5GRXG 3F5WA 1D9KB 4WW2F 4OIIL 2DQUL 5C0RH 3U9UA 1NMCC 4QYOB 1XIWA 1OTUD 3BSZL 2FLBT 1CF8L 3V7AE 5T3ZL 3SKNA 4TVPH 4UTAH 1PZUB 1X44A 5JR1H 4ZNEA 4BZ2H 3EOYG 1X5HA 2DBLL 1NCCL 2GQHA 2VXVH 1S78D 3EHBD 1YEEH 3KPMB 3VDCA 1A3QA 1A4JA 4DW2L 3T0XA 4X6BA 3FT2B 5CIPB 1DBKH 4WFHE 4JFDE 3FN9A 4PLKD 5DMJB 3ET9F 4IS6B 5F96L 4RSVA 3SJVA 3KPSB 2J88L 3FQWA 5DUPL 1MCKA 2AEQL 1J9CT 3ZL4L 5I1GH 1KEMH 3WBDA 1BFSA 1D6EA 2AJXH 4XPAL 5DWUL 5DJAA 3F7PC 5A3IC 1MHPL 3MGTB 1AHWC 5ESVB 1WCBA 1D9KC 1ZVYA 4WU5A 1KIRA 1NBQA 4WV1A 1B4RA 1JZ3A 2CLVB 1ORSB 3QUXB 5IKCB 2ZOKA 3ALWA 4MSWA 1TVBB 4OZHB 5JHDE 4M00A 2YBRA 1A6AB 2YOCA 4JGMA 2CKBB 3HE6B 2HT2D 3GHBL 1RUAL 3TZVC 5C09B 3MLTB 5F1SA 4LLVB 3UP1A 3D5OF 2Q20A 1YQVH 3SPVA 1IEAB 1IAKA 3BPNC 1F6AA 1DBJH 2M2DA 4KKAC 2VZUA 4LSTL 3PL6A 1VACB 2IBZX 3MJ8B 3V4VL 4KVCL 1EO8L 4NCC1 5BMFH 3RUGB 4JRYA 4WO4A 4OFKA 5LGJA 4JY4B 3V52H 4N90E 4TUKH 4JAMA 1QPPA 3S36H 4CU6A 1D5XA 3BT2L 3LD8B 2HJFA 2YRLA 3GFUA 4MB4A 4ZUSA 1I3VA 3P0YL 3CH1A 4P0DA 4U1IA 5EIQA 4XH2B 2DQCH 3QIWA 3WCYA 4JCMA 4H26B 4HIHA 3QUXC 1MHHB 1NGWA 4OGAD 4TUOB 5KJRH 5J13B 4OCXH 4G6MH 5CEYA 4O4YL 5I1AA 2WP3T 4HGKC 4WEBL 4X6CB 3HE6C 3KDMA 1JGDA 4Y2OA 5E6YA 3VWJB 4YHNA 1EH9A 3M1BA 4PJGF 4NRYA 1R3LA 2P24A 3MSPA 4RAUA 4JM4L 3MLZL 1CI5A 4M5YL 5D5MA 1CS6A 4M6NH 3EDDA 1WFUA 1BOGB 1N64L 5IJKA 4IMLA 3ARTA 3ILPA 1LO5A 2OL3B 1OGTA 1KNOB 5D7JB 4XVTH 2O5XH 3KR3L 3QCTH 3BP7A 4UNVA 1AQKH 3MACH 4OCYH 5SWSD 3SKOB 3SO5A 2HJKB 1QFPA 4LPXA 4TTDC 1GC1C 3GMNA 3LD8C 4X99A 4K3HA 4QOKD 3KPRD 1IGFH 1G6RL 3R1GL 3FAWA 4JN1L 4PJGE 5A2FA 1F90H 3GK8H 2FGWL 4PGEA 2BSSB 2FD6H 5E4EB 4KGLA 2BNQE 3HAEB 1RIVH 3KPNB 3O2VH 3BP5A 3EKCA 1X5KA 2FECL 4XBEL 5F7KC 3VWJC 5FYJU 2VQUA 2JELL 1ULVA 4N1EA 4KQ3H 4BSVB 1LK2A 2QQKH 4XCFH 1FORL 3IFNH 4M4PA 1FNEA 2VDNL 1RZIB 3QNXB 5CAYB 1OGAA 3N9GH 3QFJA 3EO9L 1LGVA 4HCRA 3V5HA 2R2EB 3IRZA 1CD8A 1WBXB 4ODHH 4OQTA 5ETUA 1T0NB 3U0PA 2MWCA 3I84A 2E8YA 2VL4A 4G6AC 5IHZA 5HHOB 2WUCL 3VA2C 2PYEE 3SKJH 4ZSOB 2Y5TB 1AI1L 4U6XB 1MY5A 4K7PY 1EO7A 1MREH 1OM3L 3BH8B 3QNZA 2IWGA 1KJMA 1ZLSH 4LEXH 4XPTH 4QRPA 1B4JH 2FX9L 4LQFL 5F9AC 4PGDA 3ARDB 2NLJB 4YJZL 1ZT4A 3WHE0 1NEZA 1NKOA 3CPLB 5DQDH 1HHKA 1P1ZB 5GJTL 1K9TA 5DFVC 5HGHB 4YH6A 4D9RD 1CD1B 1NCWL 2N4IA 4RGOH 2DQHL 2HG5B 3OKEA 5D8JL 3E3QE 3TO2B 3VFPB 2P47B 5F89A 2NY0D 4NFCA 5KSVA 4FFVC 4FXLA 1PGRB 1DQJA 1KLGA 3WD5H 1NC2D 3F7RA 4RFEA 3VXTA 3ULUL 3HRZB 3KWWA 1TDQA 3P3YA 5SX5H 5C6PB 4KKBC 3IJYA 4OM1L 1OCWH 4LMQE 3RVUC 5FUOL 1B0WA 4MNQE 3U0TA 5EOCH 3LKQA 1MFDL 5F72S 1MCWW 5TFSH 4LRIC 4ODVL 3IKKA 5DD3H 4JHZA 4YHMH 5EIIB 1OSPL 4YEFA 4KROD 4MAYA 2W9EH 4D94A 2ED8A 5DJDB 1EHLH 3QDAA 5D7KD 5LXGL 2HYMA 2BCKA 3ARDC 5LKNA 1ZSDA 4M1CC 2F15A 1FE8H 3MCKB 2BRRH 5KS9F 3R8QA 3ARXA 1RIHL 3IU3A 3OAUH 1RULL 1TETH 5CEXB 3PWPB 3FFCA 3Q6GH 1DQDH 1F02I 5CKAA 3P30H 4BQBA 4I3RH 1TVHB 4CVXA 3D39B 3F12A 1A14L 1PG7H 4K7FA 5HVHC 1U41A 1YEHH 4WHCA 3F5WB 1ZT1A 2AJUL 4EXPX 4ZFZA 3U9UB 3UYPA 3O4LA 1XIWB 3I2CL 4J3WA 4WW1A 2G60L 5E4IA 2F54E 3DURB 1U8OA 4TNWF 1P4IL 2IPUK 1W0YT 1VFUA 5HGAA 3WHXA 3SKNB 1QBLH 3O6MH 3RWGA 2KQMA 4LCYA 3CLFL 4FG6C 1SQ2N 5EU7E 3D87B 4N0FA 1N5AA 2XY1A 3IAGC 4BFEA 1BVKA 3ORJA 4RX4D 3C08H 4DFIA 1A4JB 3HG1A 1NUNB 4NBXB 4X6BB 3FO9A 3SE3A 2BZDA 5CJOH 1LD9A 4H1LA 3S3PA 1BD2E 2V7HA 2XICA 4P3WA 4F58H 1MJ7L 3SGEH 1BP3B 1E6JH 3SJVB 2ZUSA 2APWA 5MEND 3FQWB 4I5BA 3JV6A 4S0TD 1FLRH 5DEGB 5JMOC 1D6EB 3UDWA 3UX9B 4G9FD 5DJAB 3WSQH 3DV6A 5FFLA 1A5FH 4Z18A 5BRZD 1AFVH 4ZPTA 1ED3A 3VXME 4TVPE 3LB6C 5DMIL 4WU5B 1JGUL 3HTLX 5GGSA 1XIWC 1KIRB 2J2ZA 4WV1B 3QO1A 4MJIE 4UI2A 4LARL 5KVFH 2ZOKB 4QGYA 4KMTL 4MSWB 1I1YA 3D9AL 1DQML 5D2NE 2YBRB 3DVFA 4K23L 4UQ2A 3RVTC 4YE4H 3IU4L 4NUGL 3SDAD 2LABA 5CZVH 4PJIF 1RIUH 4NQDA 4WUUE 3VA6A 3VXNB 4N8VG 3SPVB 3JVGA 4OTXL 1KCVL 3MOAH 5B8CC 4UV4H 2ZUUA 5JW5A 3HC3H 4PV8A 2R0WL 2YXMA 3PL6B 1YPZA 4WI2A 3CK0L 5I1LA 3BKJH 4WDIB 1FFOA 4ZOEA 4JRYB 4WO4B 5LGJB 1R0AH 4CDHA 4KHTH 5L2KE 5GJSL 5EWIL 3GNMH 4JAMB 5HHQA 1D5XB 2XYCA 3OKLA 2HJFB 1Z5LA 4XC3H 4G7YL 4ZUSB 1SEQH 4GLRI 5MI0B 1FIEA 3CH1B 5EC2A 5AEAA 4U1IB 4WCYL 1OP3H 1QSZA 4PJIE 3S88H 4K2UL 3QIWB 4PJHA 5E9DD 2K7PA 4HIHB 1NGWB 3MNWA 5CEYB 5I1AB 4XXDA 5E7BA 2ZUYA 4M4RA 3KDMB 3OL2A 1JGDB 2DI7A 4YHNB 3OKDA 3M1BB 5I8KH 4NRYB 2OR9H 1R3LB 2Q86B 5ADOH 2ZUXA 2BOCA 2E7MA 5TF1H 4RAUB 1IT9H 4ENED 5HPOA 2J8UA 2H32H 5D5MB 1TJHH 2AI0H 1NCAH 1YEFH 3G6DH 3TIEA 4IMLB 2AAVA 4Z7WF 3ILPB 3DLQR 1JZ2A 4JFHE 1MRDH 2VLKD 2G5RA 1MLCA 1AGDA 3BP7B 3H9YA 4GAGH 4GG6F 1BPVA 3JWOH 32C2A 3ZYOA 5LBSH 2AERT 5SX4H 3QDGE 3GMNB 4KJPC 5C0IA 5J0BA 4BQ8A 4X99B 5MI0C 4KJWC 4XI5D 3HMWL 4FA8A 4HC1L 4LK4A 5EU5A 4OD3H 1JF6A 5FYKU 1EFQA 1PEWA 3E8UH 2YPVH 5JHLL 1IBGL 1QSFD 4PGEB 4DN3L 3H3BC 1KTLA 4KKLC 1WBZA 3BKML 4Z7WE 1JZ7A 3BP5B 2ICEA 5F7NC 3HC4H 2P8LB 4ZO7A 4OAWA 2D03H 3DX6A 4YWGH 4NKOA 2DBJA 4CGTA 3EDEA 1CLZL 2MQCA 2DL9A 5BS0A 4GG6E 5GGRA 4I9WE 1LK2B 4NQEA 3UTSA 1FNEB 4OLUH 3I6LD 4JFEB 5IJKC 1OGAB 1B0GA 3V5HB 1V3MA 5CHNA 5L88H 1PYWA 2Y1VA 4X80L 2FECI 5ETUB 3U0PB 5IHZB 2E9JA 5DK2A 2L7UA 4YHOL 1CLOH 1MNUL 5ID1A 2H45A 3QNZB 1KJMB 3SBWC 4QRPB 2IGFH 2X9WA 4YQXL 4PBWD 4FQLL 5FXCH 4PGDB 1A2YA 3FB7A 1ZT4B 2RIKA 1MFAL 1NEZB 3KLDA 3QQNA 1HHKB 4AZ8A 1B2WH 4F9LA 3SE4A 3TFKC 4GW5A 5IBLD 1LP9F 2DQDL 3OKEB 2Z31A 4PPTA 4OCSL 3W2DH 2X1WL 5F89B 5KSVB 2X1QA 1DQJB 1KLGB 4AEEA 5J11B 4A6YL 2V2WA 4RFEB 5K9KA 2HFEA 5GIRA 3DI2B 5FHBH 3KWWB 5J12B 3DXAA 4KRLB 5CSZA 2ATKA 4Z8FH 3IJYB 4HS8H 4QF1A 2EH8H 4QXUH 3U0TB 3EYQD 4LVOB 1UC6A 4YDKL 3T3MF 1GYAA 4HKZA 3U30B 4BZ1L 5HDQL 2HA1A 3V5DA 1VESA 1LP9E 2ZJSL 4QRRE 2I60H 4PUBL 4Z0BL 5T1DL 1CGSL 1ZV5A 3RGHA 1CICA 4MAYB 4NZDA 3RDTB 2BCKB 2XZQL 2FJFA 1YEGH 1IKNA 1MQKL 3AAZA 4NPYA 5I1EL 3IU3B 4BA8A 4OZIA 2EZ0D 1NBVL 3FFCB 1DUZA 5DMKA 1OQXA 4CVXB 3F12B 3IFLL 5HDLA 4K7FB 2PNDA 5J11C 2E9IA 3T3ME 1ZT1B 3UYRH 4OFYD 1OAZH 4ZFZB 3OF6D 4ALAH 1X5JA 3T0ED 3O4LB 4B5EA 5J12C 5CZXD 4WW1B 3G6JA 5E2JA 3ZTJH 1U8OB 3WHXB 5HGAB 3N1FC 3RWGB 5KVMC 4X7TA 4LCYB 2OZ4A 4LOUD 4OB5H 4DKFL 4GAFB 3E6FA 3U30C 2H2PC 5AG9A 4U7SA 4N0FB 1N5AB 3HG1B 1TJIL 3FO9B 2AABL 1LD9B 4H1LB 4MAYC 2V7HB 5TQ0L 4CU8A 3RDTC 2R1XA 2X89D 3EOAA 2YEZA 3BGAA 4JREB 3MR9A 2H26A 1MI5A 1XMWA 1UA6H 3L3DA 5ESQA 5HYJA 4I5BB 2E9BA 3CLEH 2CDFA 3GB7A 4Q9QL 5C07E 1MIEL 5E0QA 2QSCH 4DTGH 1KB5H 3DV6B 3MC0A 2BC4A 4XWOC 4XGZA 5IEHA 2FX8L 4ZPTB 1ED3B 2W92A 1FRGL 3OGCA 5GGSB 4YBQC 1DFBH 3QO1B 3WJJC 3WMSA 1QSED 3EYFA 4NM8H 3MUHL 1RUPL 1L9MA 4J3SA 1I1YB 1WWWX 4UQ2B 1LO4H 5C0BA 4RDQF 4EN3A 3IDUA 4NQDB 3MLPA 3P4MA 1CDJA 2EECA 4P5TA 1MRFH 4PJ8D 4X5LA 4OF7A 4B0MM 5HSFA 2CUHA 4PV8B 4PRIE 3CDGB 2HWZH 2CIKA 1WGOA 4OCRL 3X12A 1YPZB 1JI2A 3P4LA 5I1LB 2UZIH 5FGBA 2WUBH 5EOTA 4MX7A 5AZEH 1FFOB 2VRAA 2MJWA 3TH3T 1MEXH 5L7XL 4KI5C 4QHMA 4RAVA 3UDWC 5SWZD 5HHQB 1DLFH 3OKLB 1JNLH 1Z5LB 2DQEH 3FO2A 5EC2B 4EI5A 1G7JA 3HZKA 2R15A 1DJSA 1CFNA 2JLLA 1Z9OA 4PJHB 1U8JA 1M4KA 3QA3A 1NGPL 3H3PL 3TP4A 1A7QH 5EZOL 4MNGE 3MNWB 5I71B 1I9JL 3RY6C 5DR5H 4G3YL 4KY1H 3UPCA 1W72A 4XXDB 2NX5A 2BY3A 1T21A 4RBPH 3C60A 4OCWL 1G7MA 4LHQB 3QJFB 4MCZA 3MNZA 3OKDB 5CBEA 4PJEF 3T08A 1QLRA 1CGXA 1LVEA 2BOCB 3H7BA 3MBED 4L4JA 4NT6B 4HSQA 2J8UB 3K81A 4NZTH 4G8IA 3TIEB 2P7TA 1MIML 3IB4A 1DANU 5GISH 4ERSL 3JWDH 2VZTA 3W82A 2W0KA 5TDNA 4MAUH 5T5NF 1MLCB 1AGDB 2J8HA 32C2B 2GTZA 1CT8A 1U2CA 1UKTA 5F97E 5C0IB 3LDBB 2VLRE 4GBXD 3TM6A 5EU5B 2A73A 4PJEE 3IDJA 1S5IL 4FMFA 2C9AA 3BQUD 5LG1A 3C09C 3TYGL 1P2CB 3HR6A 1G7IA 5TE4H 5F8QC 5DHVH 2YD3A 3W9DA 4DKAA 1F8TL 1KTLB 1N8ZB 1WBZB 1JF1A 3NA9H 4J6RL 5IMMA 4HK3N 1JF5A 4R26H 3GMLA 1WZ1L 5I18L 1LE9A 5IESH 1A6WL 1IZKA 3DX6B 3WNMA 4NKOB 5DA4A 2ADGA 4JFDA 5BS0B 3TBYA 3VXOA 5GGRB 3O3AA 4NQEB 4PJDA 3UTSB 1V7NH 2Q8AH 2ID5A 1RZKL 2X9YA 3SQOH 3PDOA 4WTWA 3WIHA 1B0GB 4WW2A 5I1IH 1F97A 3U7WH 1M05A 1PYWB 1KJVA 4OGYL 2CDEA 2JB6A 5EC1A 4IRJC 1ADQA 3FKUS 1OP5K 5E8DL 5DK2B 4P2RB 3BRFA 1C16B 5ID0A 4JHAH 4OZGF 3BDYL 5ID1B 1T89A 4YHLL 4LBEA 3WFDH 4MDIA 3B6SA 1BAFL 2E27L 1I1AD 1IKFH 1A2YB 4EOWL 3FB7B 3LV3B 4NHUA 2VR9A 2OYPA 1HOCA 2XZCL 3MJ7A 3UJJH 2F8XC 1QFUH 5C6WH 3WJLA 5JHDA 2JKXA 2OTPA 2XQBH 1MJ8L 3K74B 1CVSC 3TPUA 5A2KH 3HB3C 4GAYA 5FCUH 3MJ9A 4K3EL 5IEKA 2APBA 1F5WA 3FT3A 3C5JA 3V2AR 5JW4N 1YNTA 2V2WB 1CL7L 5K9KB 2JK5A 2HFEB 3NMEA 5GIRB 4AL8L 4HJ0D 1WT5A 4OZGE 4UU9A 3DXAB 2UYLA 5J89A 1WLHA 5JA9A 5CSZB 2ATKB 1JPSL 5HTSA 3LS5H 4QF1B 2IJ0C 5I1HH 5IVXF 5DT1H 4N5UA 4L4TA 1QP1A 5EBWA 1KXTB 1UADC 4HMDA 5ESAA 3QCVH 4HKZB 5DD5L 2FWOA 3V5DB 2WWMD 4D2NA 3KYKH 3MRCA 4YXLH 1LDSA 1NLDH 4I18A 4YFLF 1CICB 2EIZA 1OLLA 1OAYH 2EYSA 2D0GA 3L5JA 2FJFB 1F4XL 3FJTA 3FRPG 4GG8A 5CGTA 3AAZB 5HY9A 4F9LC 4NPYB 1TNNA 3SDCA 3RKPA 1GGYA 4OZIB 1KJ2L 5C08D 1DUZB 5IVXE 5DMKB 3U46A 5B39A 4XCCL 2IH3A 4HX1B 1A1MA 1SMOA 4OJFH 3NPSB 3UTTD 4O00A 1NCUA 3K1KC 4H88L 3RKDC 1OSZA 3BN9C 1IMHC 1FN4A 3MLVH 1MHCA 3G6JB 3C2AL 1NL0H 4WI4A 5DJZA 4OFDA 4WEMB 2R56L 5FGCB 4KMQA 3GIVA 3K4AA 2DTMH 4Y4FD 1CR9H 1YN6A 3E6FB 3LH2H 1OP9A 1A7NH 4J1UB 5DK0A 4JPVL 3O2DA 1CICC 1GGCL 4PJGA 4F7CA 4ZFOA 3WNKA 5CGYD 3EOAB 4AIXA 5TJWK 2YEZB 4NJ9H 5SWSE 3SGDH 2ZSVA 5DURB 3NVQA 3T65A 3VRIA 2H26B 1MI5B 3MR9B 3L3DB 5ESQB 2HN7B 1NMBH 2BNQA 2IQAA 1Q9WA 2FO4A 2ENYA 5D70H 4FRWA 2CDFB 3GB7B 1VGEH 4QOKE 3WUWG 3A6CH 1DN0A 3BGMA 1NGZA 3C6LA 5DDHA 5I1JL 3S37X 3NCFB 3QUZC 3OKYA 3QG7H 3D18A 5AUMA 1TZHA 1BLNA 4WWKA 2Y06L 4OD1H 1KLUA 4RRPA 1QYGL 4XGZB 1Z0MA 25C8L 5IEHB 1H3PH 5I1DA 3RHWF 3RNKA 3OGCB 3QIBD 3RX7A 2FB4H 1BIIB 4Y2DD 2ICWJ 3HCVA 4R6UA 4I0PC 3EYFB 1F3RB 3O2WH 3N50A 1GAFL 5ICXA 5C0BB 2ADJA 2IF7A 4EN3B 1MVUA 2YUWA 4I48A 3P4MB 2FYYA 1CDBA 4RMWA 4P5TB 1KYOJ 4M7JL 1WK0A 1VHPA 3I6GA 1K6QH 2D7QA 1C12A 1H3WM 3D85A 4PP2A 3W5NA 2CIKB 3X12B 1MJUH 4MX7B 2XQYK 4W4OA 2BX5A 4QHMB 1DQLL 4DZ8A 4EDXA 3NOIA 2WWKO 2W91A 5MP6L 3FO2B 1K2DA 1RVFL 2YHGA 4EI5B 5HI3D 5C2UB 1G7JB 3HZKB 4YC2C 1CBVL 2PXYA 4J4PD 3OMZA 4KAQH 4BQ9A 1OF2A 1CFNB 3TV3H 1U8JB 1U8NB 3QA3B 1UH4A 2X4UA 3AFLA 4MNQA 4MB3A 2YD1A 4Y88A 1ZHLA 1K3ZA 3MODH 2NX5B 3PV6A 1T21B 1IGMH 3C60B 1G7MB 4EN3C 4XP9H 3H3KA 3SGJA 4JANA 4MCZB 3MNZB 5CBEB 4JFZH 4X9GA 4PY8J 5EU3A 3H7BB 4TSBH 5EA0L 5DQ9A 2P8PA 3MQIA 1IFHH 2MFNA 1AR1C 4G8IB 4TQEL 2EIDA 5DZLA 3K4DA 4APQA 2P7TB 2QV2A 5IFHH 2CKBL 1RAMA 3GSVA 5FUZL 5TDNB 3QIUA 3D2UA 1V7ML 1GOFA 4NKDA 5IBUG 1UJTA 1JTOA 1ZTXH 1B90A 4Y1AA 3BEVA 4R2GD 5EOCJ 2GTZB 1CT8B 1RFDH 2VXSL 2VAAA 2DI9A 3ULVC 2Z92A 4F8TA 4EI5C 1NMAL 2A73B 3EZ8A 3IDJB 3DUHA 4JO2L 2F54A 3VFRA 1XGPA 2ZPKL 1ZE3C 3Q6FB 1G7IB 4UNUA 3M8OL 2OK0H 1E4JA 3W9DB 2H8PA 3TBVA 3UPAA 2VYRE 1JF1B 1QFWM 4MJ2A 5IMMB 5KS9A 3C60C 5KVGL 4YDLC 3GMLB 3O6LL 4J2XA 1AO7D 4Q0XL 1LE9B 4PJFF 3IRPX 2BFVH 2ADGB 4JFDB 3TBYB 2VJXA 3VXOB 5CLWA 3EFDH 3O3AB 1AGCA 4I77L 4PJDB 1LDPH 1LO0H 5HI5D 5T1LA 3WNNA 3LIZH 3PDOB 4GRWB 4PLNC 4WW2B 1EIBA 1M05B 2DRUA 1KJVB 1Q0YH 3S3JA 4HDIA 2OLDA 4ODSL 2CDEB 5DI8A 4H20L 2JB6B 5EC1B 4HWBH 4KQ4L 1AE6H 1ACYL 4M62L 5ID0B 3C8DA 4RIRA 4LCIL 3SDYL 1MCOL 5JMRA 5BO1L 1AQDA 3V7MA 4LBEB 5H8DA 4HD9A 3UBXI 3UYOD 3VXMA 4QXGL 5CFHA 5KW9L 5MENE 4RMRA 1IAIM 4MDIB 2OL3L 3B6SB 3RL1A 3VWKA 1ZANL 5L9DH 3VFUA 4PJFE 4DQOH 1A21A 4NHUB 5JXAL 1I3GL 1HOCB 3MJ7B 3H9SD 4G9FE 3O8XA 3Q1SL 2VDPL 5BRZE 3RWIA 3TPUB 2FNBA 4GAYB 3U1SL 2YSSA 5IEKB 5C0JA 3FT3B 3C5JB 1EFXA 4XMPH 1YNTB 2CR3A 2WQRA 5B4MD 2V5SA 2JK5B 1EEYA 5J06A 3RTQD 1I9RH 2R0ZH 3LKPA 3TVMA 1RZ7H 3R0NA 4UU9B 2UYLB 1KC5H 5C0NC 4G7VH 3ZKSD 4A2MA 1NGQH 3IS1X 3L7EA 3MXWL 4JB9L 4WW2C 2P8MA 3RGVC 5EG6C 4GXUM 5CZKA 4U6VL 2RQ8A 4L4TB 4UZGA 5EBWB 5MHSD 3VG0H 5ESAB 5E2WH 5L2KA 3U0WL 1CL7I 2FWOB 4P9HC 3DI3B 4W6XB 2R1WA 3MRCB 1UM4L 4PJIA 4I18B 1CTNA 5E2VH 2DQFB 5HI4D 2EIZB 1T66C 4L1HA 1OAUH 2EYSB 3J7HA 3BE1H 3EOTH 1MWAA 3ILQC 4F2MA 4GG8B 5C0AE 3WJLC 3B43A 3S5LG 2FEDD 3SDCB 3U7YH 1E4XH 1WTLA 4M8QA 4OSUH 3U46B 4QXWA 5B39B 3VGFA 4ZS7H 2IH3B 5E9DE 1A1MB 3MXVH 4IRSA 3TGXA 1KYOK 2J1KA 1OSZB 1FN4B 1MHCB 2ED9A 3AGVA 2EDQA 5DJZB 5EBLB 3GIVB 5IWLA 4XNXL 1YN6B 2GAZA 2VOTA 3QDGA 2F53D 3PNWA 1P4LA 4OZFG 4HKBA 1EV2E 4XHQA 5DK0B 4BK5A 5IJVA 1HZHL 4J3XA 4XPHL 2X4PA 4I18C 2VLKE 4HKXA 1NDMA 4ZFOB 4F7CB 1J5OL 3KYNA 5F9WB 4KUZH 3T65B 3VRIB 4DCQA 2BNQB 4O2FA 2IQAB 1Q9WB 4Y16B 3N0PB 5DJCA 2FO4B 3VXRA 3DX9A 1DN0B 3KLAA 3BGMB 1NGZB 3C6LB 4NZRL 2VDOL 1LK3L 3D18B 5AUMB 1TZHB 1BLNB 4WWKB 4M1DL 1KLUB 3EJZC 4XMKH 1JZ6A 4GG6A 5I73B 2XKUA 3QRGL 5I1DB 5CSGA 3RNKB 2IALA 5GGVH 1Q9OA 1NAKL 2BJMH 2NXYB 4FTVA 5T33H 1P4BH 4CUCA 4XPGH 3HCVB 1FH5L 4RMTA 4HPOL 2A38A 5ICXB 1IM9D 5GRZA 2Q8BH 5SX5K 2ICWA 3MRBA 3VXPA 3O3UN 4ZTPL 2ADJB 1MVUB 2OJEA 4F7EA 1RUQL 1Y0LA 4I48B 3BWAA 5IQ7H 3I6LE 2FYYB 3BPOC 4OIIH 4CKVX 2DQUH 2XG5A 5I15L 3BSZH 3D85B 1C12B 3O9WA 4PP2B 4I3GA 4O9HH 1MELA 6CGTA 4XP6L 2YK1H 4LPTA 4EDWH 4F37F 2AVGA 5CJQH 3OJDA 4Y16C 2A1WH 3R0MA 4YXHH 1TPXB 2I5YL 1YY9C 4DZ8B 1IC7L 4KRNA 4EDXB 1OWWA 3KYOA 1EMTH 4WWKC 1K2DB 1T1XA 3MMEA 4EZMA 1NSNL 2PXYB 5FAAA 1OF2B 4KZDH 1J1OH 4XNYL 3HI5H 3NCJL 2X4UB 5F96H 2VDQL 3T77B 1WSST 2FGZA 4MNQB 2F74A 4OLYH 2ARWA 1ZHLB 3DO3A 5C0EA 3M45A 4HGWA 5DJYA 4JFOA 3DETD 2APFA 4JO3H 1CDCA 3PV6B 4JANB 4CMMA 2CK0L 2NY5C 3WXVL 4QRRA 4FMKA 3K0WA 5EU3B 2NY4B 4UB0L 5DQ9B 2P8PB 5E5RB 3ZKMC 4NCDA 1P7KA 4APQB 4ZQKA 3P77A 2DQTH 5HHPB 1J8KA 3QIUB 3D2UB 3HKFA 3E3QC 4NKDB 1QLFA 5GRWA 1UCBH 1L0YA 1RUAH 4Y1AB 3BEVB 3CXHJ 4JY6A 1CFTA 5CD5C 1YEKH 5D7SH 4RISL 2VAAB 2Z92B 2NZ9D 1NAMB 2PXYC 3HNTL 4UV7H 1DVFD 2W0PA 4LSTH 1C5BH 2F54B 4JPWL 3VFRB 1XGPB 3UZQA 4WI6A 3V4VH 4KVCH 1EO8H 1T03L 2AJYL 3O3BB 2AQ2A 3KAAA 2H8PB 1IAOA 3BVNA 4LSUL 5KANI 5IB3A 5KS9B 3GMRA 3T0EE 4ZMAT 2UV3A 4AMKL 2PTTA 1RPQA 4HWEH 3QUYD 1QOKA 1AGCB 4B7IA 1J12A 3PHSA 4UT7H 5T1LB 1NEUA 2EDBA 3BO8A 3L7FA 2F5AL 2D7NA 4IDJH 2KPNA 4L29A 4HZLA 4HDIB 3QIUC 5K9JL 3NIDF 2R8SH 2MPAL 2Z8SA 4HXAH 5C07A 2FJGA 4TPRH 3HAEG 1WQVT 4PP1D 5IROA 3GM8A 2DJ4A 2BY1A 4RIRB 5GGTH 2VMFA 4YDJA 1AQDB 3TJHC 3GJEB 5D6CA 4HIIA 3VXMB 4CDGC 3RZCA 4M5YH 3RL1B 1I9IL 3VWKB 1JYVA 3VFUB 1Y18A 2FATL 2A0LC 4AYFA 4FABL 3VFWB 3OXRA 1HKLH 1PFCA 3I85A 1OP3K 1NCTA 3O8XB 3LVEA 3RWIB 3GSRA 4R97B 2EDNA 5C0JB 1SHMA 1EFXB 1QFOA 3VGGA 3NIDE 1Q9LA 1QSEE 1EEYB 2BMKA 1NDGA 3AS3A 1X5GA 3LKPB 3MREA 3QQ9C 3R1GH 1VEOA 4Y4HA 3TVMB 3W0WD 5IFJA 4JN1H 3FO0H 4NHCL 4PRIA 3C5ZC 4KZEL 2V2TA 3G5VA 2FGWH 3L7EB 4PG2A 2P8MB 2WLYA 3IDNA 2DM4A 4MZ2A 3UJIH 4PLJD 3WIFA 3IXAA 3H7LA 2ZWLT 2YKLH 5L2KB 5FEBA 4YHIA 2W9DL 1L7TH 5E94A 4I1NB 1LO3L 4PJIB 4K94C 4S2SA 1FORH 3VWKC 2VDNH 5FYJD 1WF5A 3EO9H 3S98A 4MNGA 1MWAB 1S7WA 1HQRA 3KPQA 1T5WA 3FMGH 4F2MB 3ARBB 1I8LC 2X4OA 3VXUD 1AI1H 4M8QB 4MXWL 4E5XA 4YK4B 2EDXA 2VITA 5KG9A 1HYRC 4IRSB 2LTQB 1MHEA 3CSPA 4NZUL 2WLZA 1V3KA 4LQFH 3S37L 3TVMC 4MHHG 4POUB 3HZVA 5F7EL 1WIUA 3BGFB 3KLHD 3EZJB 4XRCA 5GJTH 5FGRA 1ACZA 1CZ8H 2V9QA 4I3SH 1NCWH 1K8DA 5D8JH 3EYUH 1P84J 3GKZA 3LZFL 4F33A 1ITBB 2GAZB 3QDGB 3PNWB 1XGQA 1KG0A 2CXGA 4HKBB 1JCKA 5IJVB 1R5VA 2VLRA 4WENB 1ZVSA 2X4PB 1FL5A 4M7KL 1FBIL 4HKXB 5DD1L 1NDMB 3KGRA 2Y36H 1N2RA 4F80A 3QUKB 3B2UD 4OM1H 4KK9C 4RA0C 1QFHA 3D69A 3KYNB 2ZCLH 2ZG1A 4DCQB 2F19L 3MBXL 2NY6D 2X05A 4O2FB 1U0QA 3HS0A 3ARBC 3ZMRA 2IFFL 5DJCB 3I02A 3VXRB 3DX9B 4IEFB 4Y5XC 4ODVH 3KLAB 2H32A 4MJ5A 3X3GH 4QGTA 4OCLC 3PQYD 3SN6N 5J6GA 4P3CL 1DBBL 4GG6B 1CVRA 3MUZ1 5I9QB 2IALB 4R90L 4FTVB 1IGCL 1RIHH 5EZJA 4KK8C 1RULH 4OV5A 4UOW1 5FO8A 2ICWB 3CFBA 3MRBB 3QXUA 4UIKH 5IWLC 2OJEB 4F7EB 4PREA 2VKXA 3SGKA 4NOFA 1Y0LB 3BWAB 1A8JH 4YFDB 3ZSSA 5FB8A 3VFSA 2AJUH 3CXHK 4M61A 3PUCA 2VC2L 3GSUA 4JDTL 1J1XL 4ETYA 3H6JA 2HJLB 3I2CH 1IC4H 3O9WB 2G60H 3PXJA 4DAGL 1O7SA 4V1DD 1HH6A 4LGPB 4Y19D 4WIQA 1P4IH 4XWGL 3SHSA 3QDMD 2ZCKH 3OJDB 1F58H 4X0KA 1YEJL 4XNUH 3ZDYF 1PLGL 2PTVA 2EIBA 5B38A 2BNUA 3VI3F 4CW1A 3ISWA 2E7BA 3KYOB 4Z5RA 1EEQA 3C9NB 1SJEA 1T1XB 3MMEB 2HT4D 2ERJC 4ZO6A 2BY2A 1CDIA 3ZE2F 5FUCC 5I9QC 4O02L 1A7RL 2F74B 5C0EB 4NKIL 4HGWB 5DJYB 4JFOB 4ZNCD 5GRUH 3C87A 7CGTA 2R69H 1UENA 3QAZB 3OG4B 4CMMB 2Y72A 2H1PL 4WTXA 3ZDYE 4JKPH 4QRRB 1P7QD 4DUXA 4G8GD 3AC0A 3VI3E 4PS4H 4MJ6A 4YXKL 5I19H 1T22A 5DMIH 4YHZL 1JGUH 3O9WC 2YD8A 4M48L 4ZQKB 3P77B 3ZE2E 3FRUA 1GZQA 4QHKJ 3D9AH 1DQMH 3QHTC 4K23H 1ZGLA 1CQKA 1QLFB 2LE9A 2NY1D 1FNSL 4L9LC 2B4CH 5FM5O 2R4SL 5F3BA 4WHDA 3ZTNL 1OHQA 4JY6B 1CFTB 3EFFA 3WO4B 4PJ9C 4FQ1H 7FABL 2BVQA 4HPYL 4OTXH 4DGVL 2GHWB 1CDGA 4JO4H 2D0HA 3ARQA 2HTKD 3RHWK 5BVPL 5C08E 3CK0H 4WY7H 1BEYL 2OTWA 3LEYL 5H37G 1JI1A 4M1GL 5GPRA 3FTGA 2R2CA 3MROA 3ARSA 1IAOB 3BVNB 5IB3B 1RK0A 3NABL 3GMRB 5DEZA 5HVGB 2K9UA 1EVTC 3OZ9L 2PTTB 3S35X 4WCYH 5A2JH 4N8CH 3X3FL 1E4WL 2GK2A 3VXSD 2P1YA 3TESA 2O61A 1N6QL 5SWSA 2JTDA 3RNQA 1OTTC 3BO8B 3L7FB 4HUUA 4C56D 2P5ED 4L29B 4HZLB 3CCHA 4UINL 5MEOA 1R3KA 3KPRA 2VDRL 3MPCA 3QUMH 3J8F7 2ICES 5C07B 2FJGB 1RJZA 2AEPH 4O5LH 2ZUQB 3FAXA 3T2NH 4IOIA 3WFCH 4NGHL 4RQQB 4S1RL 4YDJB 4MYWB 3RZCB 5D6CB 4HIIB 5KZCB 3RPIA 5JLZA 4JQIH 3RPKA 1Y18B 3TBWA 5EU4A 3OXRB 2A77H 3SKUD 1EUTA 1FFRA 3QDJD 3WDJA 4N5EC 3K7UA 4JDVA 2BNRD 1RQ5A 3Q48A 3GSRB 1P84K 1AKJD 3BP4A 2OXGA 2X2YA 2VLMD 4GW4A 1DUYA 5E8EB 1Q9LB 4XVJL 4OCMC 2VABA 4RBPK 2RAMA 4X6FA 2BMKB 1NDGB 1LEIB 3MREB 4Y4HB 5IFJB 4U1JB 4PRIB 4GRLD 2V2TB 3G5VB 3V6OA 3DROA 1KB5A 4DN3H 3IDNB 1FNHA 2YD6A 1KN2L 3WIIL 3WIFB 3SCMD 3BKMH 1J7VR 3IXAB 2JJSA 1FGNL 2A6DB 1PSKL 4Z95L 3GJFK 3QXWA 5DD0L 1MFBH 4LHJB 2ZUQC 4YHIB 3GKWL 5KN5A 5E94B 5L8KB 1CLZH 1UG9A 3ZZ1A 3ARYA 4OLWH 4ODBD 3RZCC 2OI9B 4NKMB 6FABH 3VFTA 2IC2A 4S2SB 5BV7H 4LEOA 1SVZA 3UO1L 3VDBA 4MNGB 1S7WB 3KPQB 1HQRB 1C7TA 1T5WB 3GIZH 4X80H 1X5AA 1EBPA 2RGSA 1NC2A 4XC1H 5HD8C 4FZEL 1KFAL 2X4OB 1CD9B 4KRPB 4U0RB 1V3LA 4E5XB 4Z0XB 4EUPH 5CJXA 1A1OA 1FYHB 4M6ML 3P73A 2IG2H 2JF1A 2VITB 1TNMA 5KG9B 5CUSL 3RVWC 2RJMA 4YQXH 4FQLH 5EZIL 1MHEB 4FFZH 1INDL 3HZVB 1AXTL 1K5NA 4XP5H 3B2VL 4M7LL 3EBAA 1MFAH 1ZS8A 4XRCB 2BY0A 4PG2C 1CGTA 1I4FB 5GGSY 3B9KA 1JUFA 4WFGE 3K46A 1K8DB 5A3ID 2DQDH 4TSAL 1KCKA 3OB8A 4OCSH 1S3KL 1XFPA 2X4QA 4F33B 1IL1A 1D9KD 4LSQH 4FQ2H 2CXKA 1KG0B 4KKCD 2XXMB 4A6YH 1CCZA 1JN6A 4OUOA 5HHMD 1R5VB 2VLRB 1ZVSB 4OGXL 4GMTL 1FL5B 4P2OC 1N2RB 2DQIL 3T0WA 2BDNH 3D69B 2DJUA 4OIBA 4XZUA 3TZVD 3HS0B 2CQVA 4M9OA 3ZKND 3MRIA 2FJHA 3I02B 4LPCA 4M7ZC 4NJAL 1RUKL 2H32B 2EDOA 3QPQD 4MJ5B 4U0RC 4XP4H 5CILH 5DHXB 5FHAL 5HDQH 4TRPH 5J6GB 5FO7A 4Z0BH 4KKAD 1RSFA 3QEUA 4UOW0 1CGSH 1FFPA 2VXTL 3HI1A 1TQBC 2XZQH 5IHBA 3L1OH 1U3JA 5BOZG 1QNZL 3AS2A 3DHJA 5I1EH 5CS7A 1AO7E 1YMME 4RX4A 4EXKA 5ADPL 4OV5B 1NBVH 5FO8B 4OBRA 3CFBB 3UJTL 3TT1L 4Q9RH 5A2LH 1FC2D 5JW3L 3IFLH 4PREB 1EERB 5FB8B 3CSBA 3VFSB 1BX2A 4M61B 2Q1EA 3GSUB 1KT2A 4PJFA 3PWJA 2D4DA 1ZLUK 1HH6B 3LCYA 4G9FA 4GQ9H 5HGBA 1VADA 4MD4A 5FGSA 3CD4A 5BRZA 5C09D 2P48B 4X0KB 4PJCA 2R29H 3CC5A 2APXA 5B38B 1MCPH 2BNUB 4H0IA 4DKFH 4CW1B 4JQVC 1W2KT 1QBAA 1OTUC 4Z5RB 1MCLA 1WFTA 1SJEB 2AABH 3H9SE 4LQ1A 4QTIL 4ONFL 1JE6A 3AROA 5FYJH 4HG4J 3NCMA 1Q94A 4JVUA 1J1PL 3SDAA 1BZ7B 5ILTL 3WV0A 3T2OA 1CG9A 5IW1B 5I76A 3VMOA 1LILA 5BQ7A 1BOYA 1WAAF 1FZMA 1IAMA 4N0YL 4LFHG 4ELME 3LQZA 3S36X 3SGKC 4KXZH 4LIQL 1K4DA 3W11C 4R0LA 1OW0A 3L3KA 4MJ6B 1FRGH 1T22B 3B9EA 2GYSA 4E0RB 5MHSE 3MCG1 4JRXD 5A16A 5GGRY 1RUPH 3FRUB 1GZQB 4N90D 4E41D 1X3DA 1SVCP 1ZGLB 3VGEA 2YR3A 5FYKL 3ULUC 5F3BB 4FNLH 5TE7H 2G75A 1RURL 3PF2A 3F62A 5E9DA 4DGYL 3CFDA 3EFFB 3VH8A 1WAAE 2BVQB 1NCBH 4YHKL 5D1XD 3VG9B 4G6AD 5HHXH 3WDHA 4OCRH 1UWXH 1YA5A 2OTWB 4OLVH 5CP7A 3FTGB 1O5DT 3MROB 5E95B 4PGCA 3ROOA 1HSAA 4JZOA 3Q0HA 1RK0B 1FAKT 3ULVL 2RCSL 1U8PA 4CVWA 4HUKB 2VLKA 5DFVD 1JHKH 4HUVA 2YXFA 2O61B 1JMXA 3RNQB 4TOYL 4HUUB 1I9JH 5LCVL 2F53E 2OJZH 3MZTA 1X5LA 3CCHB 3BZ4A 4FFVD 5FYLL 2AV1A 1FVEA 2GCYA 4F37K 5MEOB 1UWEH 1R3KB 3KPRB 3WL9A 4OCWH 5K9QG 4LVNC 2P5WD 2VWEE 4TSCH 1FO0B 1RJZB 1IAIL 4JO1L 3AUVA 4UIMA 4IOIB 4OIAA 4EIZC 4KKBD 3QWOA 5D2LF 4OGAC 5IOPB 3QI9A 1QSFA 1NANH 5BZDA 3RPIB 5JLZB 5DLML 2IBGA 8CGTA 3TBWB 1BWWA 2WMPA 4AG4L 5EU4B 4MA7H 1BBDH 1PKOA 4K3JL 1S9KC 2Q6WA 4ERSH 1EEUA 1FGVL 4JDVB 3GBML 3DSFH 4XAWL 1ZGLM 3LHPL 4NSKA 3VD3A 2UUDK 5IB2A 5DRWA 4CAGA 1CIUA 1H3TA 3BP4B 3V5KA 4GW4B 1DUYB 1NBYA 3ARDD 4L8CA 4M1CD 3QZWG 4G6KH 3CNKA 2VABB 2ZZUT 5C0CE 3BW9A 3ARVA 4X6FB 4HT1L 1CDHA 1U8LA 1RZJH 3LQAH 3PP3H 1S5IH 3OWEA 2WBWB 3TYGH 5D2LE 4ZXBC 1GXEA 5IQ9A 2PYED 1N3NA 3QQ3A 1MAKA 3DROB 1KB5B 2IPTL 1HXYA 1WV7T 2AJVL 1D3CA 1T6VN 4LPYA 3KJ4B 1F8TH 4J6RH 4HF5L 4MJ4A 2JB5L 3L5HA 1ETZA 4F7TA 1HN1A 1A6WH 5B22A 1LO2H 2HAZA 5E6IB 5JDSA 3WIHL 3VFTB 2ADFL 5CEZL 4M5ZL 1EDQA 1NQBA 1T7ZA 2A6KA 3STZA 4LEOB 5DGQA 3TO4C 4FG6D 4BQ6A 1ADQL 1KN4L 2B5IB 2YS4A 2Z8WC 2NY0B 4OGYH 1CN4A 4XPBL 3WUZA 3D48R 1NC2B 3MLSH 4P9HL 1G9MC 1KIPA 3WN5A 1CFVL 3NZ8A 4FXKA 4JFPA 3PWNA 1A1OB 1CLYL 1CQYA 3BDYH 3MA9L 1HDMA 3BMVA 3P73B 3IDMA 4OLXL 2A83A 5ALCL 1PKQE 5DRNA 2YRPA 1BAFH 1DSFL 2E27H 2APVA 5EOQH 1K5NB 4K7PX 1R3IH 1Y6KR 2XKNA 1ZS8B 5DS8A 2BOBA 3V6OC 3FQUA 3MJ9L 3B9KB 1JUFB 3KJ4C 3HRPA 4LASL 2D9CA 2X4QB 2WSKA 2JJSC 1IL1B 5GRVK 1RU9H 1N5YL 3LB6D 1JRHL 4LVHB 4JLRA 1XIWD 1HHHA 1JN6B 2VH5H 1NGYA 4NQSA 4AL8H 5E6IC 2DQJL 1FAIL 5GRJL 3QEQD 3RVTD 1UWGL 5AWNH 1QG3A 2B5IC 5E08H 4HG4K 3TCXA 3QEGL 4XZUB 1X4ZA 3NFNA 1BJMA 2FIKA 3MRIB 2FJHB 4Q58C 2H9GA 4OFYA 3OF6A 3T0EA 5CJXC 3UBXA 5E99L 5AZ2L 2IFGA 5FO7B 1TJGH 5IIEA 3QEUB 4PBXA 4YO0A 3JWNC 1FFPB 3HI1B 1C8PA 2Q7NA 35C8L 4R4FH 4EBQL 3ZSTA 1F4XH 2NXZC 4Y5YA 2AKRA 3O6FC 2QLVB 3B9KC 1P7HL 2HP4A 2RBLA 1KJ2H 2M8XA 3MLRL 1CE6B 4P4KD 2L7JA 5D9SA 2X89A 1BD2D 5K93A 4M9PA 2VL5A 4HKJB 2IADA 4XHJD 1KT2B 1EXUA 2CMRH 2DS4A 3IS0X 4I0CC 1FDLH 4PJFB 3BKCL 3QDHA 3BI9X 3PWJB 2X44D 1BF2A 2DYPA 3C6SA 1IC5H 1DBAL 4G9FB 5HGBB 2ESVD 2R56H 1VADB 3GMQA 3N85L 4PJCB 1IE5A 4JM2C 4X9IA 3CC5B 4XMLL 3F58L 1ND0A 3O2DL 2GUOA 4ZFOL 4NC1E 4ZOAA 4MJID 2APTA 3JWDC 4JDZA 1H0DA 1KPUA 3LPGA 4HWBA 2X9XA 1EBAA 3DUSA 1Q94B 5TE6H 3DARA 3SDAB 2EE6A 4FQCL 1CG9B 43CAA 5I76B 1DL7L 2Z0BA 5JW4R 2DIAA 5BQ7B 4WUUD 4KJPD 1U6AL 1FZMB 1KCSL 1X9QA 3HUJF 5I1JH 4PJ8A 4KJWD 1HINL 1IGIL 3LQZB 4NNPL 3WS3A 3TWCH 5C0DA 3DOSA 4YFEA 4R0LB 3L3KB 4ZODA 2GY5A 4YZFF 4RNRA 3MLWL 2EIEA 2DL2A 4URTB 5I8OH 3RBGA 4KKLD 5A16B 3S35L 1X5ZA 1GH7A 5SWZA 4KV5F 1UACL 4OZFH 3HLAA 4U3XA 2NY5L 3FN0L 1ZHNA 2GJ6A 4Q7DA 2G75B 4CMHB 3NACL 1HIML 2X4TA 4FFWC 1OARL 5JQ6H 1NPUA 4ZAKB 4L8SA 3VH8B 3HUJE 4M7JH 4NO0D 4M43H 3BUYA 3INUL 2C26A 2WW8A 5CD3A 3VXUE 3SDAC 4R8WL 5J57B 4LRNH 3MV7D 1UFUA 4YZFE 5CP7B 4PGCB 3ROOB 3MGAA 1HSAB 3RBSA 4JZOB 3MBEA 3KYMA 4DVBA 5ITFA 4KV5E 5F21B 1U8PB 1GCFA 4Y5VA 5DMYA 1CBVH 1UT9A 3SDXF 3TJEH 1OW0C 3AM8A 2VLKB 1QFWI 4JFHD 2R1YA 3D1MC 3MV01 3QNYA 4HUVB 1JYNA 3UMTA 1JP5A 1XF5A 3BZ4B 2QQQA 2AV1B 2GCYB 3STBA 4DN4H 2CKNA 3C2SA 4X7FC 5L2JA 3WL9B 3WFEL 4GBXA 4HUWA 3MRNA 4UIMB 2NY7H 3ZYIA 1AD9A 3BQUA 4CMHC 3F6IA 2ITDA 4PBVC 4ZAKC 2GEEA 3QWOB 2E9WA 5D7LE 4JFED 4JKLA 3QI9B 2DJSA 1QSFB 4XPFL 4LAQH 4NQTA 5BZDB 2DKMA 5JUEL 3EYSL 4TQEH 4UT9L 1XH3A 2M26A 5DJ0A 1KB9J 4DEPB 3SDXE 2KUTA 1YJDC 2Q6WB 1OAXL 5MEQA 3PQYE 1IAII 3U4AA 5F8RC 4NSKB 5IB2B 1ZKAA 3V5KB 4LDEB 1NAML 3RP1A 1UM6L 1NBYB 4W68A 4L8CB 2EC8A 2FBJL 4K71B 3BW9B 1NMAH 1U8LB 2NR6D 3RU8H 3LMJH 2VR4A 3DYPA 5IQ9B 1N3NB 3QQ3B 1G7PA 1HXYB 1GC1H 3IVKA 4LPWA 5E24E 5TQ2H 4F7TB 1ETZB 3O6LH 4RWYH 2R23A 1I1AA 4Q0XH 2FHCA 3CMOL 5GXBB 1A7BA 4V1DE 4Y19E 2BVYA 4QO1A 5D4QA 5IHUL 3QI9C 3QDME 5JDSB 2FIRT 4I77H 2A6KB 3STZB 2YD9A 4X6DF 5D71L 2OXHA 3NGBB 4K55A 2H2PD 5C0RL 3BXNA 4ODSH 5D6DA 4H20H 1KIPB 2HKFL 3WN5B 4M62H 3NZ8B 1EPFA 4FXKB 3PWNB 4JFPB 4K94L 3GI9H 3WO3B 1HDMB 4U3HA 3RDTD 3IDMB 5BO1H 2A83B 5GGUA 4QXGH 4KJQC 5JR1L 5KW9H 4MXQD 5DRNB 1JVKA 4HBCH 1YN7A 4W4NA 1FIGH 3QO0A 1YEEL 2I07A 1JJUA 1I3GH 2XKNB 4JVWA 3CAFA 5DS8B 2BOBB 4KDTA 1DBKL 5AAMA 1T20A 3FQUB 3BPLB 2VSCA 2DLFH 5EB9A 4X6DE 1FL6A 3GRWH 4G8GE 5HJ3A 4Z7QF 1HHIA 3CZFA 5JIHA 3BISA 3CGTA 4L4VD 4JLRB 4I8DA 5KOMC 1HHHB 3HNSH 5B39G 1NGYB 4NQSB 5I1GL 2NYYC 2BP3A 1IEBA 3D3VD 4LPUA 3QWRD 5JXED 3KXFD 3WXWH 5C08A 2GK0A 4LSRH 3HAEH 4JB9H 3MXWH 2VKWA 1JGEA 4GJTB 1J0IA 4M7LT 2FIKB 1JRHI 1KPRB 4ELKA 1OLZA 2H9GB 4FFYH 3UTTA 3U0WH 4EQ2A 3WN5C 3T0EB 1IILE 3UBXB 4HK3J 5FOJA 4IBLT 4N9GA 1KTKE 3PWVA 1QEWA 5IIEB 4YO0B 4PRAA 4Z7QE 5DC4B 1FCGA 1MWAL 4U31A 2UWEF 3TPKA 2EKJA 3EYQC 4NQCD 4Y4FA 4GXUN 3EGSB 4Y5YB 4KI5D 1AGEA 2AKRB 3JV5A 1DBJL 2AJZA 1PY4A 4OKDA 1OOAA 1AC6A 1OTSD 3F8UB 3QXVA 3OBAA 4U1LA 5D9SB 3IDIA 5E03A 4PRDA 3DMMC 3VXSE 5BMFL 1FVDA 1UZ8A 1T7WA 2VB5A 3ZT7A 1XGUA 2VL5B 4C56E 4MQ7A 2P5EE 2Q7YA 2IADB 1EXUB 4CVUA 4TUKL 3IDGA 3S36L 1VFBB 4C59B 2OSLA 2EZ0C 1ERNA 1KGCD 2DYPB 2QQNL 1MCHA 1YMHA 3C6SB 4G80A 2DOCA 2B1HL 1N6UA 4IOFD 4MCYA 2CO7B 2UWEE 4YPGA 3GMQB 3T0VA 2DQCL 1SBSH 1XEDA 2YMXL 1MCWM 4XNXH 1JNHB 4PRPD 3T0EC 1ND0B 4OCXL 3QIBA 1UCTA 3AXLA 5JNYA 1RZKC 2GUOB 5TH2A 4Y2DA 1JGVH 3QDJE 2MQ3A 1L7IL 1H0DB 4TULH 1KPUB 4WI9A 2BNRE 3RAJL 5EDXA 1J5OH 2X1OA 3DUSB 1C1EH 4Y5YC 3T2PA 43CAB 2VLME 5GGTA 3TNNA 5C86A 4M6NL 2YWZA 4AY0A 1B88A 2QBWA 3QXTA 5EN2A 4PJ8B 1U2HA 3V0WH 4AM0A 1IM3A 3T0AA 4XVTL 3WS3B 2O5XL 4M1DH 1AQKL 3MACL 5C0DB 4CN6A 1QD0A 4RNRB 2J5LB 1BBJA 1BFVH 1NAKH 4P5KA 3GSNL 2ZCHH 2NTFA 1IGFL 3F6LA 5CP3H 5SWZB 1KB9K 4JVPA 4AEIH 3HLAB 1S5HA 1T0MA 1ZHNB 1XAUA 1F90L 4P5MA 2GJ6B 4J4PA 3GK8L 4D9QE 1F00I 4LLWA 2FD6L 2X4TB 4L8SB 4LKCA 1B3JA 1DTUA 4G5ZL 5I15H 3BUYB 4AEHH 5KSBF 4IRJD 4F7MA 5CD3B 4XP6H 3ZLQC 5I0ZA 4KQ3L 2QQKL 3IFNL 3I9GH 1RHHB 5FK9A 2I5YH 4NBYB 3MBEB 3N9GL 4F9PA 3KYMB 4DVBB 5ITFB 3OJVC 4ODHL 1K85A 3MRRA 4WI7A 4Y5VB 3SKJL 1KENH 1PJ9A 3NAAL 5IGXH 5DJXA 3QNYB 1NH6A 4XNYH 2IEPA 4HGMA 4J7RA 3SE9L 1BQLH 3CFJA 4LCWB 1ZLSL 3HB3D 5EU6B 4LEXL 4OV6F 4CBPA 2AW2A 1B4JL 1XF5B 1URLA 1JGLH 5L2JB 4ODXA 5KSBE 1CGVA 4X98A 4GBXB 4F57L 5DQDL 5BS0D 4HUWB 3MRNB 2DDQH 3ZE0F 4Z7OF 2CK0H 4LMQI 1AD9B 3BQUB 1T5XA 4L8SC 4RA3A 3TEUA 4HJJL 5I0DA 3LN5A 3CFCH 4ZUTA 3B4NA 1BGXL 1XH3B 5IBTH 5DJ0B 3DV4A 3BZFA 4P2RD 1AO7A 1J05A 3CFKA 4O58H 1D5ZA 1JWSA 1OCWL 3UTOA 1QTYT 3V8CA 1MCNA 2DWEA 3S96A 5EOCL 3LKOA 4RISH 2DWDA 4FQHA 4Y5VC 5TFSL 3LN4A 3ZE0E 5F7HA 4Z7OE 1EJ6A 3HNTH 5DD3L 1EAPA 3UC0H 3RVXD 4YHML 1CDUA 5B3JF 3KPPA 1HSBA 2AQ1A 2CJUH 3O0RH 1G7PB 3T09A 2W9EL 2WWKT 2XG4A 1EHLL 4X9FA 1I7UA 4K7PL 2X41A 1FE8L 2AGJH 3MNVB 4GUPA 3U4EA 1U3YA 2R23B 1I1AB 2OM5A 3RKDD 3BQUC 3BN9D 1TETL 1H15A 3TN0B 2Y07H 2KZ1B 3H9SA 1DQDL 3P30L 5C09E 1MFNA 3IKCA 3MLYH 1YEHL 2C4FT 4BYHA 3PJSA 4MDJA 3BXNB 4NN5B 2DM2A 1KCUH 1G84A 4BKLB 3NFSH 4P46D 2ITCA 4B41A 3RTQA 5B3JE 1NGXA 3MRFA 2OBGA 2E6PA 1PX4A 1QKZH 5DVOA 1JZ8A 3RWFA 3RUGE 5GGUB 3ARFD 4HLZG 4BFIA 4YLQT 1I9IH 1U8IA 1YN7B 3QO0B 2X4SA 2I07B 3HR5A 3ME0A 3GO1H 5CJOL 5I2IA 1T20B 3QUZD 5KBNC 4PJXF 1XCQA 3MV9A 5C7XH 1CXHA 4AH2A 4F58L 1FL6B 4DUWA 3VD4A 1UB6A 3FHAA 1E6JL 1JYWA 5HJ3B 4X6EB 1HHIB 3ZHLA 3CZFB 4POZC 1EZVX 3BKYH 1WAAA 4JRXE 4WGWB 4QY8A 3TN0C 3TF7C 1D5MA 1IEBB 4I0PD 3GBNL 1A3LL 1E0OB 4NHCH 4G8FA 4E41E 1JHLL 1A5FL 5ICZA 4XB7A 5C08B 1AFVL 2GK0B 4HK0A 3BZDA 1FCCA 1HWGB 1JPTH 3F7QA 2NW3A 1JGEB 4GSDL 4Z6AT 1UM5H 3MTRA 5D6DC 1DR9A 4ELKB 2I24N 3UTTB 5KVFL 4PJXE 2W9DH 5DFTA 1EA9C 4N9GB 3PWVB 1QEWB 1WZLA 3SDDD 4YE4L 1F6FB 4PRAB 5CZVL 5IW6A 1JPFA 1RIUL 1NFIA 3D25A 4LU5L 4KDTC 1SYSA 2F53A 2IQ9H 3MOAL 4YDIL 1TTFA 1IZJA 3HC3L 1AP2A 1DBMH 4PB0H 5I8CA 2EXWD 1WIPA 2AJZB 1LE5A 1F42A 4U1LB 5IVOA 3BKJL 3IDIB 4PRDB 3MRLA 1JWUA 1FVDB 2Z91A 1Q72H 1UZ8B 3BH9A 4QLRA 3P9MA 1XGUB 3HMXL 4MQ7B 1R0AL 2Q7YB 3S37H 2EDRA 4KHTL 1IGYA 3GNML 1UGNA 3IDGB 3O6KL 3MRMA 2OSLB 3S34H 5F7EH 4XC3L 4LSVL 1YMHB 1SEQL 3K2MC 4G80B 2P5WE 3E6HA 2VN7A 2Y4SA 4LNRA 4MCYB 2EO1A 4YPGB 4IMKA 4U6HA 2K7QA 5AAWA 2V17H 1RK1A 1HHJA 2HH0H 1BJ1H 3BD5A 1KOAA 2C3GA 3L9RA 3WE6A 5J13C 3QIBB 1SY6H 3AXLB 1AR1D 5JNYB 5TH2B 5HHOE 4Y2DB 1TZGL 2YD5A 4M7KH 5F7UA 1FBIH 1GRWA 5DD1H 1IM9A 1C5CH 3QUMA 5D2LA 5ADOL 2EH7H 4FQJH 9CGTA 4NFDA 5D1ZD 1J88A 1IT9L 1QZ1A 3QB7C 2RB8A 5EBGA 4HFWA 3TNNB 1TJHL 2IFFH 2AI0L 2MHAA 1NCAL 1PEZA 3G6DL 5EN2B 3ULVD 3NCBB 4EI5D 4AM0B 1X5IA 1IM3B 3O45A 5D7JC 3CDYA 3JTTA 1ZA6A 3LKRA 5CGYC 1F6LL 2PUQT 1DBBH 1OPGL 1I1CA 4GAGL 5LBSL 3AY4A 3QT2A 4R90H 1BBJB 4JPKH 4X8JA 3OR7A 5J6HA 4P5KB 2B2XH 2NTFB 4S1SH 1IGCH 3LRGA 3WFBL 3FN3A 4UBDC 4JZJA 1UJ3B 4AT6A 1S5HB 1T0MB 2DLIA 3E8UL 2YPVL 2OMBA 4MD5A 1T7XA 4P9ML 4LLWB 2ZSWA 4OQ1A 5EPMA 1UH2A 5E4EC 4BSJA 1JL8A 4ONHA 4HAGA 4Y8AA 4LKCB 1JZ4A 2VC2H 1PKQA 4Y2DC 3WLWC 4JDTH 3HC4L 3EDJA 3W39A 1J1XH 1MCSA 2D03L 2ICWI 4M8VA 1YNLL 4DAGH 4F7MB 2DI8A 4XWGH 4NNYA 2J4WL 1KCLA 2EDTA 2BSRA 5KTEH 4OLUL 5FK9B 4HUXA 5E8PB 5L88L 4NC0B 1T83A 4ESKA 2GSGA 3MRRB 3BAEL 4XP1H 2B1AH 4AIZA 3RY4A 1CLOL 2VE6A 3FZUC 5DJXB 1QR1A 1AJ7L 2VXUH 3CFJB 1N0LA 2ZOLA 4EUPA 4R2GB 3RQ3A 2IGFL 3WKMH 4NKIH 3BJLA 1UJ3C 4ODXB 3A6BL 2X7LA 4JFFD 4X98B 3EO0A 5HI3C 1GPOH 4J4PC 1RHFA 4FP8H 1DVFA 1QPXA 1D6VH 1T5XB 4ISVA 3QEQE 2Z93A 4OZ4A 3RGVD 1EK3A 3C5SA 3LN5B 4ZUTB 4M48H 3DV4B 3BZFB 1AO7B 3DVIA 1J05B 5DC0A 3K8MA 1FV1A 3H8NA 3CFKB 1D5ZB 1FNSH 4HS8L 4DK3A 5T5FL 4PY8I 1UQSA 4KDWA 2DWEB 4NIKB 4QXUL 3S96B 1T66D 3LKOB 2DWDB 4FQHB 7FABH 4HPYH 4X9HA 2G2RA 3ILQD 4DGVH 3CZJA 2SEBA 4GH7B 4LDLB 1EAPB 2CGRH 5BVPH 1U92A 2I60L 1PBYA 3VGAB 5GZOD 1HSBB 1BEYH 3L5IA 1OD7A 4M1GH 3B9AA 4C4KO 2BXYA 1YEGL 3H42L 4GUPB 3U4EB 5JPNA 5J3HD 4Y8DC 5C0GA 4L8BA 1T7YA 1TMCB 5C6TL 1H15B 2CH8A 3X3FH 1F13A 1A9EA 2ESVE 3IKCB 1N6QH 4L4TD 1L4IA 1WCBB 3VU2A 1OAZL 2VZOA 4ZS6C 3PJSB 2A6JA 4MDJB 1FO0L 4GMSH 3SEPA 2ITCB 2AXJA 1LWRA 3RTQB 1NGXB 3MRFB 4NN7B 3W0WA 1UWXK 5GS1A 1J0HA 4HAFA 3RWFB 4NGHH 2A9NL 4N9OB 4S1RH 4XB8A 3BPCA 4JRYE 2YD4A 2XWTA 4BFIB 4OB5L 5IMLA 5J1AA 1U8IB 5GS0D 2X4SB 3HR5B 2X42A 4UT6H 1X4XA 3EDFA 1G9ML 1KCRH 5I2IB 3ZT6A 1IAKB 1CFSA 1XCQB 4IIQA 3MV9B 3FRPA 1F6AB 4LPVA 1UB6B 1A4KA 5IMOA 3JV4A 5B3NA 4XVSL 1XT5A 3CLEL 4GQPH 4NCC2 1D5MB 4JGJA 5C0AD 5CSBA 2QSCL 4DTGL 3FHQA 1KB5L 4G8FB 5ICZB 2O93L 3VXUA 4HK0B 3FOMA 5F1KC 2NW3B 1GHFH 3MJGX 3SGEI 1FVCA 3ZKXB 1KN2H 4JY5H 3QHZH 3WIIH 3MRPA 3JZ7A 1FGNH 4WV1C 1UXSA 1L6ZA 4NM8L 4PJAF 4OM0L 3GHEH 1LO4L 4RGMB 5KAQG 1BECA 3MV7E 4ZOCA 1FNLA 5IW6B 1JPFB 4UMGA 4S0SD 1VKXA 5DUMH 5J9PA 4Y16D 1NFIB 5F6HI 3UO1H 3D25B 1S7UA 2P24B 1YY9D 1SYSB 2F53B 3B8SA 2I27N 3RA7L 2AQ3A 3F7VA 4LLUA 5I8CB 3PP3K 1H8SA 2HWZL 4U6TA 4MQXC 1GIGH 3PL6C 1LO5B 5FOBA 1OGTB 4ZFFA 2UZIL 2VSDA 2WUBL 3WUWA 1I8KA 5AZEL 3MRLB 4M6MH 1JWUB 3WYRA 4C57C 2Z91B 1HCFX 3BH9B 1MEXL 3P9MB 5CUSH 1G9NH 4WO4C 1M71A 5A43C 3N1GC 1IGYB 1YEDA 1AXTH 2JIXD 3MRMB 4PJAE 2DQEL 1OT1A 3E6HB 2WZPD 4LNRB 5DVLA 3PQYA 3ZKXC 1ES0A 4U6HB 3QIWC 2O5YL 4JFEE 2DLEA 1A7QL 1SMAA 1HHJB 3AB0B 2XY2A 3QHFL 3L9RB 5ITBH 5DR5L 4KY1L 1A6ZA 5IUSA 4OGXH 4KPHH 4ONOA 1FHGA 4RGMC 5IVNA 2EDWA 5IB4A 1IM9B 1ZOXA 4Z7VF 3QUMB 4HIJA 5D2LB 4WU7A 5I1KH 3NTCL 2FBOJ 1U42A 3KHOA 1XF3A 3MV11 4HFWB 2XN9A 2MHAB 5CD5D 3Q3GA 4LCUA 2FX7H 5C1MB 1G7LA 4NJAH 1RUKH 4NRZA 3QFJB 5FHAH 3VFOA 3UAJC 3OHXA 3O45B 3JWDL 4G8EA 5AG8A 5B38G 3JTTB 5FIEA 1ZA6B 3LKRB 4V1DA 4Y19A 1J10A 1OL0A 3O3EA 3REVA 5T3XL 1IVLA 1Z2KA 3Q5TA 4DUVA 4X8JB 4YX2H 1D5IH 3OR7B 5J6HB 2GJJA 2P49B 5CINH 4BSWA 1QNZH 4LHUG 4JZJB 4Z7VE 2R0LL 4AT6B 3TT1H 4ACPA 4MD5B 3V4PH 3GMPA 5EPMB 2ZSWB 4WNQA 5TE4L 4H25A 1HXMA 4ONHB 5SX4I 3TH4T 1T1YA 5DA0B 1PKQB 2GJZA 4ZD3H 4DGIH 3W39B 2DKSA 4R26L 1OY3B 1ZXQA 4Q2ZA 3U9PL 3MCLH 1J0KA 2J3SA 3QIUD 3PP4H 3GBLA 4NNYB 4DKEH 3VXTB 5TGBA 2W38A 2PF6A 4G43A 1ZA3A 4X6DA 1P7QA 2BSRB 1V7NL 4G8GA 3SQOL 4HUXB 4R4ND 3TJHD 5I1IL 3M07A 3KPLA 1UYWH 2FL5A 3CVHL 2GSGB 5BV7B 1T7VA 3OJMB 3LKQB 2A0LD 1AGFA 4AIZB 1AH1A 1A7OL 3FFDA 2VE6B 1QR1B 1EGJL 2D3VA 1HE7A 1J1PH 2ORBL 5IB1A 2K3TA 3THMH 2ZOLB 4EUPB 3WFDL 5JW4M 3RWEA 4L4VE 1IKFL 4JKKA 4YR6A 2OCFD 1ZSDB 3EO0B 4KI5F 2E8ZA 3D3VE 1QFUL 2XTJD 3QQ9D 1DVFB 4LIQH 4X4ME 3KXFE 3C5ZD 4ISVB 5T1LD 1FNFA 1FNGA 1YYLH 5FCUL 2Z93B 4OKVA 2PKDA 3C5SB 3DETC 3VFGL 3V8OA 4OFVA 4JJHA 2CO6B 1FV1B 5BOPA 2WAHA 1I1RA 3LS5L 1A64A 1UQSB 4J12A 3S7GA 3VXSA 5F6IB 5DT1L 5BV7C 4Q9BA 4NQCE 1TCMA 4LVOC 4C56A 4KI5E 4YHKH 3QCVL 4NFBA 5T1MA 2SEBB 4IHOA 2Y5EA 1YJDL 1I7ZA 3U79A 2NZIA 1BVKB 4Q6YA 2XZAH 3KYKL 1U92B 5HPMA 4LSSL 4TUJA 1NLDL 2UWEA 4GKZA 1OAYL 1XCTA 4OF8A 3MRKA 4RFOL 3ULVH 5JPNB 5C0GB 1DVFC 1SJHA 4YFLI 3PGFH 1EUUA 1KGCE 1OAQH 3JV6B 4LCCA 1JWMA 2NNAA 3CVIL 5ENWA 3QDJA 2N56A 1A9EB 2BNRA 1KJ2A 4NQDE 4RMQA 1WBYA 4F15B 4PJHF 5IT2L 4HS6A 2H2SC 2J6EH 4OJFL 1AKJA 5LCVH 5FA3A 2CRIA 4PB9L 4PRPE 2A6JB 1YNKH 2IH1A 5FECA 4DJMA 2LAAA 3QULA 3E2HB 4JO1H 3P11L 1GGBL 3W0WB 1XGYH 5GS1B 3VW3L 4GRLA 5FV1L 5DSCA 3BPCB 2D7MA 2DTML 2XWTB 4HULB 5C0FA 1CR9L 5IMLB 2J8UF 5J1AB 4JN2A 3LH2L 4NWUH 4P4RA 3ARBD 1A7NL 1U9KA 1IARB 4P2YA 3SCMA 4MS8D 4K3JH 4AG4H 5FM8A 1QO3A 2VZSA 3SE3C 4PP1C 3SOBL 1CFSB 3GBMH 2OR7A 4XAWH 4IIQB 4WI8A 5JW5B 4PJHE 2X10A 4NJ9L 3JV4B 3S5LA 4GW1A 4K8RD 4JREC 2N7AA 3NH7H 1F2QA 1NMBL 1C7SA 4H8WC 4NC1C 4AEFA 1VGEL 2HFGH 3MUGA 2HFTA 3QG7L 4KK8D 4RMUA 3IF1A 3QEHA 3VXUB 4F7PA 1FNAA 3FOMB 3QQ4A 5JTWA 2DKUA 3L5XL 1H3PL 2AJVH 2J8UE 3MRPB 3QSKB 5HYSG 1UXSB 4PIRF 5GS1C 2PTUA 3ARED 4FHBD 5GGQH 1D5BA 4GRWH 4OZFA 3NFPA 1VKXB 5J9PB 2Z35A 1AHWA 3DYMA 1S7UB 2JCCF 3JVGC 5BXFA 3QCUH 4L9DA 3F7VB 3T0BA 4XBGA 4LLUB 5KSBA 4P9HH 3CU1A 2D0FA 4IIQC 5EBMA 1KEGL 2OP4H 3GJFH 1MJUL 4S1QL 4DOHE 2YN5A 5FOBB 2J12B 1CLYH 3HFMH 3MA9H 4POYA 3PDGA 3WUWB 4ZFFB 1I8KB 1NUFA 4OLXH 2W0LA 5MEPA 5ALCH 3EJYC 1M71B 4ONGH 1RV6X 1QA9A 2W59A 2Z8VC 4WTZA 3TZVA 1A02N 3DX7A 1YEDB 1KSRA 4WUKL 5F7YC 1EJOH 1CXLA 1S9YA 1F4YL 3DVGA 5BS0E 2IAND 3PQYB 1ES0B 5AYUH 3H9ZA 4KHXH 3TV3L 3UCRA 2JCCE 3LQMA 1RMFH 4PFEA 5I71C 2D7PA 4N1HB 1H8OA 3MODL 3AS0A 3O9WD 1A6ZB 1IGML 3HE7D 2ICEB 4P2RE 2DQJH 5FA4A 1Q1JH 4XP9L 4D9LH 4OBSA 5IB4B 4OAWB 2F9BT 5J1SC 3X11A 4JFZL 4HIJB 5GRJH 4HQQL 4WU7B 1UWGH 1WTGT 2Y6SD 4TSBL 1FYTD 3QEGH 4JG1H 1XF3B 2H3NA 1IFHL 4BUGA 2XN9B 4NC2B 3Q3GB 4LCUB 4MA8L 4PJ9D 1G7LB 1K8IA 3EW3B 5IFHL 5CHNB 1YUHA 3OHXB 1YC8A 1WEJL 4YBHA 4V1DB 4Y19B 3O3EB 3REVB 3U82B 1MSPA 4U1HA 1ZTXL 1A6UL 2YPLD 5GS0H 4XCEA 1RFDL 2C1PA 3RIAF 5I6XB 1BREA 2FH8A 2D2OA 4U05A 1AY1H 3LDBC 1FPTH 4BSWB 1R3JA 3BDXA 3W5MA 1JTPA 4OZIF 1QHOA 3ALXA 1EZVY 3GMPB 5CMAA 3A6OA 1HXMB 4GW5B 1T1YB 2Z31B 1OTTD 4YPJA 4PRHD 1WFNA 1KACB 2GJZB 4LNVA 3BKCH 4Q2ZB 3PHOA 1A6VH 2BFVL 3G6JF 2QTEA 5TGBB 4G43B 2V6HA 1PAMA 1ZA3B 4UAOB 1LDPL 4U33A 4X6DB 1P7QB 1LO0L 4P2CG 3L3HA 4G8GB 2QR0A 4L5FL 5T3ZD 2Z8RA 3KPLB 1TZIA 5E5UB 2B20A 5IBUB 2FL5B 5HYQA 5TDPA 4JRXA 3L5WA 1AGFB 4OZIE 2YD2A 2XXCB 2KDGA 3VH8G 3FFDB 2B7DT 4E41A 3FQTA 5HDOA 1Z0NA 3VDAA 3T4YA 5D72H 1ZLUH 2B0SL 2NY1B 5I6XC 5F44A 5IB1B 3S9DB 4FQCH 4R4BA 5L9DL 2AJSH 3RWEB 4DQOL 4YR6B 5IFAH 3G6JE 3STLA 1VENA 5D1XA 1IGIH 1QRND 1RZJC 4PJXA 3LQAC 4NNPH 3BOVA 3T4AA 3O81A 3SE4C 2Z31C 1FNGB 1JTTA 5K59E 1WWAX 4OKVB 4S1DD 3GRWA 3IJSA 3PDDA 4XMPL 5JOFA 1CE1H 1E6OH 2R0ZL 1VFOA 2P4AB 2VZVA 1RZFH 2NY5H 2ADIA 3FN0H 3GSOA 5DJ2A 4R96A 1UXWA 3HA0A 1NGQL 3N1QC 3NACH 1HIMH 2KL6A 3VXSB 1OARH 3HAEA 1ORQA 4X7TB 3QG6A 3VG0L 4KJYA 4C56B 5F71A 5E2WL 5T1MB 3T8XA 4IHOB 1I7ZB 4X7SH 3DNKA 4Q6IA 2YWYA 4Y89A 4QHKI 5HPMB 2P5WA 5K9OA 4Z7UF 1INEH 1HNGA 2UWEB 4OT1L 3VJ6A 5E2VL 4LIQE 4GKZB 1OAUL 1R24A 1XCTB 3QNXA 2R1XB 3MRKB 1Q0XL 1N6VA 1CFQA 1FG2A 5E8OA 1FZJA 3HZMA 1IKNC 3DGGA 5HYJB 1SJHB 3P0VL 2V2XA 4LCCB 4LRIA 1JWMB 2NNAB 1KBGL 3ULVF 5ENWB 3EYOA 3QDJB 3U7YL 1E4XL 2BNRB 1KJ2B 1RI8A 2HKHH 4LLYA 4ZS7L 1WBYB 2BC4B 4HS6B 5GZNC 1AKJB 1ZEAL 3MXVL 5FA3B 5BW7A 1BMGA 3NPSC 4NQVA 4LKXA 5FECB 4MVBD 2NLJA 2D7TL 3WFEH 4FQIH 4Z7UE 5GHWH 2VIRA 3QULB 5DF0A 4P2OD 4PG9A 5HGHA 4OI8A 3OQ3B 3IGAA 4GRLB 5DSCB 2H41A 2PYEA 4MLIA 4XPFH 1HEZA 2NTSP 2QL1A 1BJ1J 5D7IF 3QBTB 4FQXD 5C0FB 3KG5A 3F7YA 3DTXA 4JN2B 3SCMB 4P4RB 4JR9L 4CVZA 1I8MA 3ULVE 5ISZD 1QO3B 1M6OA 1OAXH 5FDWA 1N0XH 4J8RA 3IDXL 4P59H 4GW1B 3S5LB 4KUZL 1JHTA 1NAMH 5EOTB 4LCCC 2QSTA 2FBJH 3MUGB 4RAVB 3NIFF 1Z3GL 4PYHA 2EC9U 3QEHB 5D1QD 4HHAA 4F7PB 5E70A 5D7IE 3SGDI 3I3DA 5GGVL 4YNYA 2BJML 2UUDH 4XPGL 5CBAA 5JDJA 5IK3A 2FSEA 3SE8L 2OTUA 4GRLC 5E2UH 3QPXH 5ERWA 1W72B 2PO6D 1D5BB 2Q8BL 1F3JA 2UY7A 3OPZH 2VDLH 3OJ2C 4OZFB 3NFPB 1FC1A 3LKSA 4BZYA 4PJDF 2MNUA 2Z35B 1YQ2A 1AHWB 2BHYA 4WFGD 5D71H 4FQQA 1QLRB 4XCYA 4GRWF 4P5TC 3NIFE 1HNFA 1EEZA 5BXFB 4DWHA 4XBGB 4YAQA 5KSBB 2EO9A 5EBMB 5HHMB 3VGBA 2HKFH 3DURA 4O9HL 3KNBA 4LSDA 3HI6L 2WNGA 2AP2A 3SQBA 2YK1L 4XNQA 5DHYA 3MJ6A 4G42A 4K94H 4EDWL 5I75B 5FGBC 5CJQL 3QEQA 1SM3H 2E7CA 2A9MH 4JQXA 5MEPB 2A1WL 4YXHL 3UBXG 3VFNA 1JIBA 1QA9B 3TZVB 3DX7B 3LRSA 1EMTL 5FKPA 4JFFE 4ZYKA 4KTDH 1S9YB 3DVGB 5B8CA 3BPNB 4PJDE 4KZDL 1J1OL 1IQWH 1VA9A 1WITA 1HH9A 3HI5L 1GVIA 3W81A 4GRWE 3W11D 5CEZE 4OLYL 1P6AB 5C2BL 1OVZA 4JO3L 3CSGA 1MFCH 1X6LA 5DEGA 3U4BH 3PE9A 2NMSA 5FA4B 1T1WA 2X4NA 4U1NA 3HN3A 3X11B 1YMMD 4ZFGH 5EUOF 1H3VA 4P4KA 3ULUD 4U1MA 1T80A 2V5RA 2H3NB 3HNVL 5J56B 1HYSC 1BD2A 4NO3A 4WWID 4KKCC 4QWWD 4N0CC 4U49A 5KSUA 4HLZH 1CDYA 5KVDL 1K8IB 4LVEA 4HIXH 3V4UL 2OMNA 1YUHB 1OAKL 2DQTL 5I75C 1C5DA 3QP3A 4KRMB 4KK5C 1QUNA 2ESVA 4LHUD 4U1HB 1MWAH 1UCBL 1WFOA 3MX0A 5DMGC 3ZKNC 3RL2A 1YEKL 3VXNA 5D7SL 4XCEB 2C1PB 5LJYH 3QPQC 4MLSA 1R3JB 2EEBA 4UV7L 5EUOE 4ODWA 1C5BL 4MJIA 2CRZA 1FFNA 4K8RH 4UILL 4WDIA 4ODTL 5CMAB 4R3SA 5JHDB 5D2NA 4L4TE 1HILA 4NOBA 1JFQH 4ODUA 3L3IA 2GIYA 2A6IA 1FL3A 5HHVH 2HMIC 4WUUA 2QQLH 3PHOB 2QQNH 4NWTL 2B1HH 1VFMA 4HWEL 3A67H 1D7FA 5IG7A 1BQSA 4UT7L 3L3HB 2YMXH 5JOPD 2QR0B 1YC7A 4HBQA 3FONA 1TZIB 1VFAA