3F62A

Crystal structure of human il-18 in complex with ectromelia virus il-18 binding protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
GAMVETKCPNLDIVTSSGEFHCSGCVEHMPEFSYMYWLAKDMKSDEDTKFIEHLGDGINEDETVRTTDGGITTLRKVLHVTDTNKFAHYRFTCVLTTLDGVSKKNIWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for antagonism of human interleukin 18 by poxvirus interleukin 18-binding protein.
pubmed doi rcsb
source organism Ectromelia virus
molecule tags Cytokine
molecule keywords Interleukin 18 binding protein
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2008-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f62A00
3C8KB 4IMLA 4WJ5B 3MV8A 4GW1A 5I15L 1MFDL 4P2QB 3ZHKA 2DQFB 3PJSB 5BW7C 2X4RB 2P43B 3K81A 3HAEH 1CFQA 4U1LB 3BQUD 1YPZB 4LEOB 1S78C 1GIGH 4NNXB 2M1KA 4WV1B 5EBLB 5EZLB 2BXYA 5ITFA 2YK1H 4Z8FL 4JFEE 3GI8H 5I1KL 4F33B 3MV8D 3WDIA 4U33A 1D5ZB 3IF1B 3JV4B 32C2A 5GZOC 3CVHA 4HK0A 4F15B 4L4TE 3AREB 3K8LA 2RGSA 4JN1H 2A6JA 1A3RH 4PLNC 4TULL 3UTQA 5FFLA 3FO2B 3THML 5HHMB 1UEMA 4D0CA 2YPKA 3RWGA 1U41A 3KXFD 5DS8B 5ICYB 2YWYA 2XXMB 3WUZA 3K2MC 1GAFL 1FG9C 4KQ4L 3HE7D 3SCMA 4NZUL 4MSWB 3TN0C 3F5WA 3I02A 2IBZY 2ADFH 1BD2D 4JFHE 3KDMA 4F7EB 4V1DE 2Q1EA 4I3SH 1NLDL 1F2QA 2B5IC 2YXFA 4GRWB 5FGSA 4FFYL 3O8XC 43CAB 1JWMB 3R06B 2VLRB 4Y1AD 1NC2B 4JFYA 4ODTL 5DMGD 2AI0H 5C08B 4WENB 2DQIL 2GJZB 5C2BH 4PYGA 2IANA 3GM0A 5C71A 2BNUA 3GSQB 2Q7YB 1RY7B 1WZLA 3B9VA 2R2CA 3C8KA 1S78D 2XWBB 5LWYH 3KJ4B 5CJXA 4GFTB 3HG1B 5C0AA 1F4XL 3RAJL 1JHTA 1WBXB 3PWPE 1NMBL 5EBMA 3H0TA 3HFMH 1YJDH 3T1WA 3QXUA 4FQJL 1QSEA 2Y72A 5DD1L 1RV6X 4MNHB 2P7TA 4QTHA 4MWFB 1D5XB 1Z6JT 1EXUA 4M7JL 3ARFB 2B39A 32C2B 1F00I 3BZEB 3DETC 3AB0B 3QHTC 3ZKMC 5I75B 2CK0L 5C08D 4WI9A 3MUGA 5ANMB 4OFIA 5IBTL 1I3UA 3P4OB 3QCVH 4F57H 1RHFA 3ES6B 1CFTA 3CPLA 5E08H 4WI3A 3WSQL 1JWMA 2X42A 4U6VH 1PEWA 5CIPH 1CICD 3I75B 3QNZB 1NBQA 1NGXA 4YHYC 1I3VA 4DW2L 1LD9B 1A1OB 2HKFL 3D0LA 4AEHH 5I1EH 5IB5A 4BSWB 2Y7QB 2Q7NA 1AHWC 3QUKA 3CSYB 5LBSH 4BK4A 1H3XA 4HWBA 4EIZC 2FEEI 4JCLA 5EUOF 4L4VB 5I1AA 1DUYA 5EA0H 5DVKA 2AAVA 3BPNB 2DAVA 3WHE1 3GMRB 4DKDC 1S7TA 3BKJH 4RAVB 5B21A 3GMOB 1UKQA 4UV4L 2IANB 4XB8A 1SY6L 2V5RA 5DRWB 4U1KA 4URTB 4LNRA 5D1ZA 1SMOA 1RZJL 4Y19A 4DGIH 5IB5B 1Z5LB 4ONFL 3JTTA 5D1ZC 3BQUB 5EIQA 3QUZA 5I1JL 4ZOCA 5BS0A 3G08A 4KI1A 4LF3A 4YUEL 4WFEE 1CT8B 5D8JL 2D2OA 4P5MB 4R26H 1RZFH 4FRWA 4IRSA 3GMRA 1JF1B 4G9FA 3V8CA 3VXQA 1I7RA 5DQJB 3DX8A 1OHQA 2NY5L 4JPVL 1HIML 3V6OA 2D03L 3BYYA 2DYPB 5D96B 5DK0A 5JNYB 3JVGC 4ODXA 4X7TB 2EDYA 5I8OL 3I2CL 3ROOA 3D69A 1A7QH 3QJFA 5LCVH 2G2RB 3GJFH 3BGMB 3T65B 1S9YB 1WWAX 3FT2B 2YEZB 5SX5K 3K74B 4RBPK 4EJ1C 1FORH 4TUKL 3SDYH 3EUUA 3BKML 1RUQL 4XVTL 1CIUA 4R3SB 2A73B 1IGYB 2B5IB 1KCLA 2KL6A 2X9YA 2BSTA 5EIIA 1YMME 1HNFA 5GGUB 1FJ1A 3UJJL 3VGDA 1NAKH 2CR6A 2BFVH 1A9EA 3FQXB 4WI7A 3B4NA 2V2XA 4GRLB 2O61A 4UI2A 5IBTH 5CHNB 3BEWB 2F58H 5KVDL 1HYRC 2FL5A 4Y19E 1RZJH 4DGIL 3C5ZA 4PJHE 3W39B 1AP2B 4NP4L 4YAQA 3NCCB 2BC4B 2H3NB 3OXSB 3QEQB 4L3ED 4OM1H 4M5ZH 4ELKA 3B9KD 3LPGA 4UBDC 2H9GB 4B50A 4KAQL 4OLVL 5HXMA 4MD0A 4LPUA 4YBQC 4NQDD 1FBIH 1KN2L 5IF0B 1NGYB 4S1QL 5CEYB 4XPBH 3V7AG 5J1AB 3S4SB 5I1GL 2QKIB 4NO0A 5IHUH 4I0CC 5C0BB 4EN3C 4KY1L 3DX8B 4TNWF 4NQDA 4CN1A 3KPSA 3K8KA 4Z0BH 4K94H 3EYSL 1W0YT 3VXNB 2H2SD 1BJ1J 1OSPL 3QXAA 2F58L 2ICWI 3O8XA 3S37X 3O4LB 1NGWA 5GRVL 1RFDH 2HA1A 4LCYA 3AMLA 5BRZA 3BUYB 1KPUB 2VNCA 4OFVA 4HFUL 3RWHB 4XTRD 1HHJB 4M1GL 2AXHA 1PX4A 4PJGE 3FRPA 2VQ1B 4WCYH 4NO2B 4P4RB 5FA3B 4LGPB 4G3YL 1UM6H 4JM4H 1NBYB 1VPOL 2NY4C 3R1GL 4JG0L 2HT3C 1G9NH 3E6FB 3QFJD 3U0TB 5KTEH 4PJFB 5BV7C 1DLHA 3EYFB 1JMZA 5IK3B 2QQLL 4X7SH 3G6JA 3DO7B 1EVUA 4KVNH 3DX7A 3BN3B 2YSSA 4IRJC 1SEQH 4CMMA 3RA7L 2YKLL 4H0GA 4Q74A 5L6YL 2W38A 1AHWB 2IGFL 5B22A 5EN2A 2XNAB 4IRJD 3WNOA 3HUJA 1QG3A 3B43A 3MOQA 1IILE 4EOWH 1PVHA 3PHOB 1YJDC 3RRQA 3ZTJH 4XNXL 3T77A 1VENA 2XV6B 3G6JB 4FMKA 2AJ3B 2LFGA 4BQBA 3DO7A 1QEWB 5CBAA 5F9AC 2PXYA 4JDZA 5KS9A 2GK0A 5FUCC 4P23C 4LBEB 3CH8A 4G6AD 4JDVA 2D0FA 4CDGC 2EE2A 3H3BC 3O6FB 5TQ2H 5FB8B 2FJGA 2VR9A 1X6NA 4OGZA 3BVNA 3RWDB 3ARFC 1GZPB 4P2RE 1VHPA 4PJCE 3OKOB 4WFFE 4X6CF 3H2WA 1GGTA 4LCWD 5JDJA 3LEXA 1ZGLM 4JKWA 4BSVB 1HXYB 1S5HA 2CRIA 3HUJF 1FIEA 3DOSA 3OKNA 1FPTH 3NCYP 4XI5C 1HHGB 4DK6A 3SDCC 3VXUD 4M6AA 3KG5A 2HKHH 1JMXA 1OARH 4YHNB 2FB4H 1BAFH 3OKMA 2FJGB 3TIDB 1EZVX 1R0AL 4MJIE 4UINL 43C9A 1ZANL 1NCCL 4GKNA 5D1XD 1BGXH 1CD8A 1YEIL 4NQVB 3NCEB 3M17B 2J88L 2AJ3A 2AK4D 4XAWL 3FFDA 1TPXC 1CE1L 5J6GB 1X5FA 4HGMA 4CKVX 3P73B 5EWIL 5JMOC 5F96L 1A6AA 2Y07H 3G5ZA 1MHHB 5HYSG 1VFMA 3ZDXF 2D9CA 2PO6B 4D3CL 1NC4D 2ADJB 4P46A 5HYSB 2AI0L 4G7YL 1IM3B 1EO7A 5T1DL 1FQ9C 3MLZH 4YXKL 3WEXB 3EDKA 4YDVB 2NPLX 3SOBL 5DQDL 5EO1B 2HFEA 3CZFB 1OAXH 1SBSH 5E2JA 4DN3L 2NXYD 4LGSB 4N9GA 1NC4A 4P46D 3S36L 4K7PY 2Y4SA 3W0WE 5KSAB 1NFDF 1RJZA 3AREC 3FQRB 5AZ2L 2BVTA 5F89A 5HPOA 1HCFX 4XBGB 5JHLL 2J8UF 3S97C 4C55A 1JN6B 3NA9L 4AIXA 3I6GB 3BDXA 4NDMB 4YGVA 3QXTA 5BZDA 3MRKA 3CFBB 4OJFH 4GKZA 5DQ9B 4JO1H 4ZTOH 3M17A 3UBXG 5E2UH 3BP6B 3V5KB 4OLYH 4HGKC 1MFBL 4JQXC 3DTXB 3BE1H 4ERSL 2CUIA 3FOLA 5FHAH 1QSFB 5B3NA 1RZJC 1IGIH 4QHLB 3WS3B 2NY0D 1J1OH 4NN7C 4MAYD 3GHEH 1GGBL 4ZSOE 2NX5B 1KELL 3A0OA 3DUUB 5DJZA 2F15A 5MEND 3VD9A 2YC1A 1ZEAL 3MR9A 4ODUA 5T1KA 1JUFA 4QXGH 1IQDB 1S3KH 4NZRH 4YGAB 3U7YH 3BPLB 4YPGA 4G6JL 3ILQC 4PRHE 3T0VA 1PZUB 1NGQL 3HI1A 5SWZD 4P46C 1MWAL 3HE6D 3N0PB 4UIMA 1QFWH 5I19L 3KYMB 2CJUL 1F90H 4Y1AA 5F7EL 1QSVA 1JHTB 3AM8C 1HQ4A 4XVUD 3HE7C 1EHAA 1PBYA 4NKMB 3WIFA 4M43H 1DQML 2AGJL 5ICXB 1E4WL 3MRHA 3T1FA 1AY1H 5B39B 4AK1A 1C5CL 1NMAH 4MLIA 3KPPA 1JNLH 3CVHL 3VXME 5C3LD 2VDPL 4J6RL 2WANA 1AXTL 3TM6A 1AGFA 1EDQA 4MQ7B 3L5XH 5GJTH 2DD8H 4IBLT 5ESAA 1DVFD 3Q6GL 5FYJE 4ALAL 5DMIH 2IH3B 3NIFE 4RFEA 5ESQB 2OR7A 1ZHLB 4NN5C 1FVDB 1QNZH 4J23A 3C8DA 1KCVL 4M62H 3KPRB 1DBAL 2R0ZH 2XWJA 5CJQH 4X6BA 2NXZC 1WQVT 4P4KD 4P2OD 2IAMA 3BD3A 2G75A 4P5TC 3FONA 3HUJE 1IAIL 4FTVB 4W6YB 3WMSA 4F7CB 2YBRA 2A74A 4U6YA 4R6UA 4FZ8H 5CFHA 4JVPA 1R5VA 3R0NA 4MDJA 1E6JH 3FZUD 4TSBH 2X4TB 4JRXD 2KKQA 2ZUXA 2DWEB 4FTVD 3MXWH 3MNWB 2B1AL 4F9PC 1MQKL 3I6KB 4HS6B 2DD8L 3HI1B 4M7JH 5HVHC 2X7LA 5I30H 1T7VA 3SDXE 1BLNB 2DIJA 1KT2B 3U6RA 2V9TA 1EIBA 3OB8A 3RGHA 3QUMA 3L3HA 1JF5A 2APTA 1YEJL 1U58B 3DXAB 2F5BL 4Z5RB 1W72L 3HE7B 1T66C 1F4XH 3QIUA 2HG5B 4XNZC 4RX4D 3NCBB 5KW9H 4RMTA 4KRPB 1AO7D 5JPNB 1CTNA 4DAGH 4FQHB 3GSUA 4JHWH 4M62L 3C87A 1WAAE 1EXUB 4C56D 3VH8B 4XAKE 2ICEA 3L5WB 5CWSB 4KXZI 4E9LA 3VFUA 3F65A 5EG6C 2FO4A 3BGMA 4PIRF 4S1SL 4GRMB 1CK0L 1XGUB 2O5ZH 1RHHB 2A74B 4WUUA 1AO7A 4MA3A 5D1QB 5HDOA 3IFNL 1T20A 2Z4QA 5E9DE 1PKOA 4R0LA 4HKJA 4GG6F 5C0RH 3GK8L 2Y36H 3MRRB 1WV7T 3MQIA 5SX5H 4MGXA 4HHAB 5E56A 4NQUA 1LD9A 4OF8A 1HQRB 4RGNC 1CZ8L 3IDNA 3ZSTA 3Q5OA 3WL9B 1K6QH 3LS4H 3DPBA 4HS3B 1MWAH 4QHNA 4FXLA 4JQVC 2P5WA 5JORB 2YN3A 5DC4B 1UWGH 4IOIB 3SPVB 1JL8A 1XGRA 1JV5B 1T3FA 4HX1B 4NKQB 2XZAH 5CLTA 4UT7L 2HH0H 4NFCA 2D0GA 3BJ91 3LPFA 5I1IH 5LGHL 1XF3B 4G8GA 4KZDH 3I9GH 3K7UA 5JXED 3RVXD 2ICCA 4MA3B 4Y5VA 2NY4D 5DMIL 1OT1A 1H3WM 3BGFC 2JCCF 5CGYD 3I75A 2B0SH 4UT9L 1KTDA 1C7SA 3LKSA 5F7WC 4EI5C 4ELMB 5FO8A 1OCWL 1FHGA 3VH8A 1KTLB 3VWJD 5DRZB 4F9PA 5FDWA 2EC9U 2V2WA 3KYNA 5I1HH 3IAPA 1U8JA 4HKZB 1J18A 2ORBL 4ZYKB 1R0AH 2DI7A 1A1MB 1M1SA 1MCFA 2WM0A 5E94B 4PJ7A 1YY9C 5HHME 4Q9RH 3MXWL 4WDIA 1TJGH 4N0YH 2GYSA 1OPGL 5E6IA 1YMMA 4ODVH 4PJXB 4N5UA 3HCVB 5DA4A 4LHJB 4Z77B 1A6TB 1J10A 3GNMH 5TGBB 1EEZA 5JQ6H 4MCYA 2WBWB 3KR3H 1TLKA 2O61B 4OUUB 4V1DB 1AI1H 3WXVH 5IVOA 3PWNB 3IJSA 4ZYKA 5IEHB 4JJHA 4ZSOA 1DBAH 2R0ZL 5CJQL 3HNSL 5T3ZE 4L3AA 1A1NB 2OR9L 4LSSH 4PB0L 4EI5D 4Y4FC 2XFXB 3EOYG 2Q6WA 1M4KA 2UYLB 1MIML 1TZIB 3HZYA 3TC9A 2BOCA 1F8TH 1P7HL 1RMFH 3LEVH 3GNML 4H88H 5EU7C 4WTZA 1LHZA 4G6AC 3P2TA 2ZUTA 5FO9A 5JPMB 5BXFB 1SJHB 2OQJB 3B9EA 3GIZH 3HG1E 5EOQH 1E4JA 1MUJA 4WFHD 2E7MA 5I30L 2XNAA 4N8VB 2QHLA 3SQOH 3ABZA 3MA9L 2P45B 4OGYH 3QEUA 2ADGB 1TNMA 3H9SD 4Q9CA 2VDNH 5DR5L 3RGVC 3VXRB 3VXSD 3N9GH 3HTLX 3FT3A 4JAMA 1AGCB 4APQC 5DUBB 4RGND 1F4AA 5DUPH 2AK4E 5E0QA 1MAMH 4Y89A 3EYVA 3KPTA 5FB8A 5F7LB 2UVFA 4ZODA 5LGJA 3BI9X 2EDRA 1JPST 4FP8H 4KQ3L 4DN4L 1J87A 4PGZA 2XZAL 1F4HA 4G3YH 1JPSH 1XGPB 3RQ3A 2AEPH 1E4XL 1RVFL 1JZ2A 2F9BT 4FQXB 4Z7QE 4U6TA 3LN9A 4YR6B 2YD3A 4FQLH 5C09D 1IBGL 2N7BA 1P4IH 4ZNEE 4PRPE 2W9LA 3MOAL 3CK0L 1PGRB 3SKJH 5I18H 1CN4A 1IQWH 5EBGA 4WFED 1OTUD 3VWKA 3QULB 4XWOD 2IC2A 1JGLL 3VRLE 2XICA 2YD2A 5HVGB 1CLOL 4L4JA 5KVGL 1X4YA 1B88A 1QBML 2BRRH 5HGAB 1VKXB 4OZHB 2O93L 2QSTA 1E6JL 2VSCA 2G9HA 1DLHB 4OFYD 4HBQA 3L1OH 1OAKH 2O5YH 4PTTB 2FLBT 4L8BB 5D1XC 3AS1A 3S35L 3ZE1E 1EGJL 1MPAH 3L3IA 5CMAB 4W70A 5JOFB 1NDGA 1BFSA 3ARBA 4DJMA 4XB7A 1YEHL 3EDJA 4NBXB 4JR9H 4R4FH 5F6HJ 4Z7UB 2N56A 1XGPA 2C1PA 5KG9B 3LCYA 3QEGL 1WBYA 2ESVE 5DC9B 1UB6B 4QRRB 2G9HB 4OAWB 2F53B 5J6HB 5I75C 4R7DA 3HMXL 3AB0C 4QRPE 1E4XI 3JUZA 4JKPH 4PJIF 3WFCH 3VRJA 3GI9H 1E28A 2VDQH 4HUXA 4ZPVB 4HUVA 2R0WL 3S96B 3RZWA 4U3XA 2MOVA 2HKHL 1QYGL 4Z76A 4Y5YB 1MF2H 2C3GA 4DKFL 4M8QB 4QWWD 1UGNA 4PJHB 4N90E 2OS7A 2GCYB 1OL0A 1I8MB 3LRSA 3MLXH 1YZZA 4K3DL 2FGWL 5IHUL 4OIBA 3QEQE 1ZVSA 3T3PF 5IFJA 3D3VB 2E6QA 3DUSA 4OD1H 1F5WA 2MSPA 4FMFA 4S1QH 4PJDF 5KTEL 4LMQE 3L3KA 4BSVA 3NFSH 1IAOA 4YDKH 3HKFA 1EFXD 1SM3L 2NY5H 3NCJL 1IAIM 4PJ9B 4U3HA 1EA9C 4UAOB 1L7TH 2JB5H 4WW2C 1G0XA 5AEAA 1CXLA 2QR0B 3CC5A 1FV1A 3SBWC 5I71B 1P6AB 1ZLSH 2F74B 4Q7DA 5IMOA 2ADJA 4P46B 5KSAD 4JHZA 3SE8H 5D2LA 2W1NA 4IJ3B 5SWSB 4ZUVB 3X3GL 2Q8AH 1JGUL 3O2DA 5FKPB 3LQZB 4FHBD 4LCIL 1N5AA 1MRFL 5B38A 4RQQA 8FABA 1DQDH 5GS1A 1IGCL 1VCAA 2FH8A 4YWGH 5IMKB 3MLUL 3UPRB 35C8H 4L1HA 3L3OB 5MERA 4U49A 3CC5B 2MQ0A 3HE6C 3RWJA 1MHPH 4LHUA 3HZVB 2OX5A 1KFAL 5ID1B 2VLJA 2PUQT 4YHOH 3C2AL 1TVBA 5C6PB 2X4PA 3MRPB 2VABB 3SBWA 4HWUA 1KUMA 5EO0A 3FN9A 4BQ8A 1CDHA 3LKOB 4D2NA 1MHCA 5FGCE 1MY5A 4NBYB 4RMSA 1QACA 3BO8B 4W6WB 5I66A 3O4LA 3LEYH 4PV8B 3R1GH 2V7NA 4DGYL 3OMZA 1T5WB 3AS0A 1VPOH 5KSBF 1KF9B 3V6ZA 5T3XD 1L7IH 5C0JB 5DD0H 5KN5B 3FO9A 4JM4L 1V3LA 2GT9A 5D1QC 2RIKA 2EDFA 4X6DA 5B4MC 3OKDA 4LKXB 4XP6L 3FB7B 3B8YA 1F4YL 3V4VL 1JIBA 2DQEH 3QXDB 5JLZA 4NC1E 2Y25A 4NOFA 3AM8A 2NY3D 3CMGA 3UTSD 3QEHA 5EORH 4XRCB 1X5HA 3V0VB 4AENA 4HIEA 2NZIA 2D31A 3CDGB 2HT4C 3DURB 4G42B 4JZJC 4XGZB 1J0HA 5F44A 3EYSH 2XG5A 3LRHA 5H94B 4XWGH 3G6JE 2OI9C 4KKAC 4GG6A 1GC1C 4LSUL 1MLCA 3BT2L 3MZGB 1CVRA 3CX5K 1AD0A 4HK3J 3FT4B 1U42A 4JREC 3MODL 3SN6N 5I76B 4XWGL 3NCMA 3S5LG 3WHXA 2ICWJ 3MFFA 3VE0B 1PD6A 4XVJH 4JPVH 5IHZB 4RGNE 1D5MA 4PY7A 3BT2H 3P0VL 5D7IF 2MMXA 1HEZA 2X1OA 1A2YA 1Q1JL 3O2WL 5F96H 1B6UA 5CJ5A 3DI2B 1CLYL 5BS0D 2IH3A 3C08L 4PJCB 3RU8L 4RAUB 4JY6B 1QRNA 4PD4K 1G1YA 2A77L 3B9KA 3W9DB 3PWUA 3NIGE 4LRIA 4Y1AB 3LQAC 1ITCA 4TUJA 4PREA 5DJDA 3IDNB 3HZMA 5MENE 1KN4L 1TCRB 2ZKHL 3C60B 3TBYB 1JHKL 3VI3E 3OHXA 4M1DH 3QCUL 1F4YH 4MDIA 3VFNA 3X3GH 5DZOA 5EOTB 1OM3H 4OQTH 4K94L 2AEPL 1G6RB 4FFZL 1UZ6E 3HPJB 3BPOB 3VFRB 1JPFB 2X89D 5LBSL 1UFUA 3QQ3B 2IQ9L 1KEGH 4TUOA 3RIAF 5JHDA 4ODTH 3VXOA 5F97E 4WV1C 1UM4H 1KCRH 1MFAL 3OB0H 3WFEH 5J57B 4Q6IC 4KKLC 5DK2B 5KSVA 2YK1L 1SM3H 2CLRA 3OJDA 4G5ZH 4HC1L 2EE6A 1INQA 1INEL 1ACYL 4XC1L 4KUCF 2ENSA 4YHOL 5HVFB 5TDPB 1QLEH 5FOBA 3HC0B 1NEZG 5DJCA 4O2CA 3MCKA 1Q8MA 2AJVL 5BMFL 3D85B 3UMTA 5K33A 5JW3H 5GGVL 5FM5M 4I9WD 4KI5D 1VEOA 1SVZA 5GSVB 5HYQB 1LVEA 5IVZB 3C6LB 3ULVE 1KBGH 1DQDL 1ZA6B 3FN0H 4YXLH 3TBYA 2AJVH 2BVPA 4J12A 5FF6A 1NBVL 2CDGA 2ZOLB 1AP2A 3LV3B 4QTIH 4D0BB 2A9NL 1F45A 4MS8C 1OLZA 1BPVA 3VFSB 1IGTA 4NO0D 4TSAL 3ZTNL 3MMEB 1NKOA 3NIDE 1SEQL 3RZCC 4HWEL 2GJ6B 4TUJB 1MSPA 5LWYL 1VGKB 1AXSB 4OI8A 1AJ7H 2VUYA 4EQ2A 4NKIH 3OBAA 3AY4A 3WFZA 2W92A 4Y4HD 2C4XA 5D7LD 1L7TL 2JB5L 1MFAH 4U2YA 4ZSOB 4MB3A 3H42H 2MPAH 4XZUB 5CSGA 2EEAA 1DUYB 4QGTA 5K9KB 4LQFH 3D2UD 2DJ4A 5MEQB 4BZ2L 5A2LH 5DZLA 1MREL 3RVXC 1S9WB 3QIUC 4XXCC 4JFQA 3VXUE 5I1DB 4FQHA 1JGEB 1NAMB 3MUZ1 1P9MA 3VXOB 3BWUC 3L9RA 4I3SL 5E9DA 3HC3L 3VFUB 5D7SL 2BNQB 4ZXBA 3OAZH 1A7OL 1ZLWK 1OAZL 2X4NA 3T3PE 5I9QB 2HN7B 4P5TD 3SDAC 1I7TB 4HMCA 4WRLA 1ZT1B 1CGYA 1FVEA 1IL1B 2EIEA 2NY7L 3BYTA 3MV9A 5JW4M 5LQBH 1PDKA 5DD1H 3LRGA 2Z92A 1A6VL 3X14A 4O58L 4R90L 3LHPL 1MVUB 3WKMH 1PKQB 3VXMB 5EZOH 3FT2A 1ERNA 2ZCKL 5FA3A 3KDMB 2CKBA 1WITA 3ARYA 4Z8FH 1H3VA 3KYMA 3QH3A 5D2LF 1NFDA 2DQUL 1UH2A 5CBEA 5C2BL 5FKAB 3W9EB 3KLHC 4X9BA 2D7MA 4MA7H 3WD5L 3NIDF 4IHOB 1BBDL 2VE6B 3FO2A 3UP1A 4R96B 4NWTL 3EO9H 3VXUA 3KPSE 3P77B 1G9NC 5CZXD 2OJEA 4OZHF 5BVPL 2VTFA 4XX1E 4ZO6A 4JFFB 1EO8H 4XCYB 4NGHH 1YUHB 1BIIA 2ED8A 3VGHA 4X4XA 3H9ZA 1DFBL 1T1XB 1BOYA 2FCBA 5DO2D 4QXTA 1UCTA 3T0XA 1CXFA 3HRZA 5GZND 2Q8AL 1EEQA 1P84J 3IKCA 3VRLF 5I16B 2CQVA 1QSEE 4OGYL 5IFAH 4JDTL 4OLZL 4JFOA 3P77A 1KTKE 1K3ZA 1DBBH 3ZHDA 2HN7A 4I77L 3SDXB 3IXAB 1M7IA 4M5YH 2VDMH 3GBLA 3IJSB 4ENEC 3RZCA 5BRZD 5CBAB 1WIPA 1WBZB 3MBED 4XP5L 4C56E 4H8WL 1J8HB 1Z9SA 1VFOA 4E42A 1GVIA 3A67H 3ARGB 1MCIA 4M3JA 1FGNL 4P5TB 2IPTH 1PYWB 3F7YB 1MVUA 2UZYB 3MA7B 5DUPL 1ZLUH 4Z7OE 2ED7A 3FMGL 4LRIC 2IBGA 4QRSB 4NM4H 1YYLH 3V4UL 1HZHL 4OBSA 1MFDH 4OFYA 4WI6A 1EHNA 4LRNH 4K7PH 2X1XR 3RZCB 4XNUL 4MJ2A 3DVGB 3QUKB 5A43C 1HH6A 2YPLD 4X4XB 1ZHBA 1R3IL 5IM7A 4PP2B 4PFEA 3OXRB 4DQOL 3DGGB 4ONGH 5JIIA 2EDHA 3PIQA 1MRFH 1N3NA 3ILPA 4PJFF 5GRUL 5IV2B 2E3VA 2F5AL 1ZLVH 4DWHA 4NUGL 3UZEA 2RCSH 3TLRA 1L6XA 1NH6A 3ULVL 1E0OB 1Q0YL 1A0QH 2D4DA 1A3RL 3QUXD 4Y5YA 4GKNB 1P2CB 3NH7H 3JXAA 5EOQL 2J5LB 2EXYC 1LEIA 2VDLL 4U1HB 1U8HA 1I75A 4HCRA 3UDWC 1RURH 2DQHL 3MRDB 2UWEB 4G5ZL 5C08E 1RZ8B 3FRPG 3HE6A 3RWGB 4IMKA 4OB5L 1G7HA 1KNOA 4BQ9A 2I9LB 3JWDL 5D7IE 3G6JF 4KPHH 3MJ8B 1PW3A 3H9HA 3G04B 3I6LE 3OAZK 1IAOB 4LSTL 2IBBA 3HG1D 1YNTB 1C5DB 4E41A 1F11A 1WZKA 2MCG1 4HJ0C 1RZGB 3QJFB 4H5SB 4HIXL 3RDTD 1HYSC 5IWLA 4R97C 2D7TL 3PWPB 1CD1B 1T7YA 4IS6A 4PB9H 3GSNB 4PGJA 1ND0A 1ZHBB 5JQ6L 3K8MA 3F12B 1UCBL 2QTEA 3HPLA 3MSPA 4GG8A 1FLRH 4EN3B 4EEEA 1N0XL 5HSFA 4Z7VB 4P3CL 3TCXA 3VXQB 3WFCL 4ELME 2PXYB 4JDZB 1JTTA 4RSVA 2Q7YA 4LARH 4OTXL 1BEYL 3MPCA 5TPWL 5I17B 2YPLA 3UX9B 3U48A 3DGCR 1CZ8H 2EYTB 1H3UA 4FQQB 1XZ0B 4APQD 3MV11 3S34H 1S9YA 2HMID 2DI8A 1HSAB 1OGAE 1NC2D 3RWFA 3GK8H 5KSAC 4Z7VA 3UBXB 3LB6D 3V5DA 5E1AA 1AFVL 2P5EE 2C3XA 4PJEE 1ZGLB 2C1PB 5MP6L 3RDTC 3SJVE 1PY4A 4UQ2B 1R3HA 2VXVH 3EJZC 4JM2A 2OTUB 2VAJA 1PJ9A 1K6QL 3R0MA 2H1PH 5D9SB 5FYLE 1AE6H 4X6EA 4H0HB 4TPRL 5CEZH 1N2RA 2VDKL 4X6FA 5C0JA 2IWGA 4F3FB 5SX4H 1A02N 5JW5B 4M6OH 2GQHA 2CPCA 4G8IB 1HQ4B 1X5XA 3G6AB 3SO5A 1IGJA 1MAKA 3QNXB 4DKEH 2FJHA 1U91B 2ZUQC 4ZTPH 3FB8B 4LSPH 3GM8A 1KC5H 1WK0A 4G8FA 1WC7B 5DMYA 1RJYB 4FG6D 2Z8RA 5GZOD 4LLQA 4FQ2L 1OVZA 1MQKH 1Y18B 5DJ6A 2N1KA 3OKEA 4ZOEA 1HHKA 2ITCA 1BD2B 3STZB 4YHML 2EDOA 4APQA 1I1CA 3VXRE 1OP5K 1IKNA 3H0TB 1ZGLA 2D7NA 4ZAKB 5CJ8A 1SJEA 3BMVA 6FABH 5HHOB 8FABB 3SOBH 4EDWH 4P2OC 4P4KC 1PG7X 1M6OB 1X4XA 5HHNA 2A6IA 3PE9A 5I8CA 1ZT7B 4A6YH 1MI5D 2ZUYA 1W2KT 3FTGB 4JFEA 1A7PL 3BWAB 3V6BR 3F58H 3TJEH 9CGTA 3PQYB 2V9RA 1R3LA 1WAAF 3NPZB 2VDLH 2NY3C 4K3DH 1TTFA 1CU4H 3OKLA 2ZPKH 4P4RA 3CLFH 3E6HB 2WLZA 4PJ9A 1NGPL 3W82A 2P5WD 2I60L 5D71H 2DWEA 4XP9H 3RI5K 2F5AH 3QNZA 5FUZL 4D8PA 3L6FB 3TT1L 3QG6A 4WGWB 3HMXH 3OR7A 4WUUE 2ZUVA 2E7CA 4WJ5A 2KZWA 2OSLB 1X5ZA 3WO4C 4CN4A 3SE4C 3RKDD 1NDMA 3F7VA 3ZYZA 4CADB 5DURB 5D7KD 3AVEA 1MRDL 3GMPA 3B3IB 3T2QA 3ARXA 3ULUD 5T5FH 5C6TH 5DVMA 1G84A 3R8BB 3O6FA 1L0XA 4AENB 2DTML 1GRWA 3Q6FB 4N8CH 5ALCL 1GZQA 2FSEA 2FX7H 4NNPL 1CICA 4DZBA 1I9JH 4GW5B 3ULVC 1C7TA 5F7HA 2X4PB 1TQBC 5IQ9B 1EK3A 4Y16A 5GRJH 5FYJL 4M5YL 3X3FL 1QEWA 2ZSVB 3VXTB 1C5CH 4MMZC 1J12A 3FRUB 4LLDA 1CYGA 5DI8A 1W72B 3TVMB 5KSBE 3WIHA 5EU6E 3MROA 5GXBB 5I18L 2Y23A 5F7DB 3S35X 4X6DB 1VFUA 4OZ4A 1QHOA 4C83B 3CIQA 3DSFL 4Z0XA 5HGDA 4M6OL 5E2VH 1HEZB 4OJFL 2XZCL 4O00A 5D2NA 4K7PL 4CADA 5EIVA 1UACH 4TPRH 4X6BB 5I8EA 3EDFA 3IVKA 2MWCA 3QEHB 2C3WA 1UADC 4LLDB 4YH6A 2XZZA 2R1WB 5F1IA 1O0VA 1D6EA 5L8LB 4OIAA 5IHZA 5T3XE 1CD9B 1FNGA 2GITA 4NQSB 4RX4A 3HS0B 1FLTX 2DB8A 4JVWA 3U0PB 1IC5H 4ODXB 1BWMA 1KJVB 4HLZH 5EB9A 3KPNB 3TH2T 1Q9LB 43C9B 2XZCH 3S96A 2NTSP 4NRZB 4Y5XC 5BV7L 5JMRA 3U46B 4Z78A 4CGTA 2QQNH 1OGTB 3GHEL 4YFLF 1RAMA 5J13C 3SKNA 2J8UE 4LCUB 4WU5B 1U8QA 1NANI 1B4JH 3GSXA 1HSBA 3NFPA 4LAQL 4OCSH 1H3PL 3KPRD 5ANMA 5HHOD 4I2XA 5B3JE 3MRFB 1R6VA 1OTSC 3VXPB 2FWOA 1MWAA 4KK5C 4U0QB 3GB7A 4HJJH 2MCPL 5T3XL 4YHPB 3GIZL 3L3KB 3D25A 2EC9T 3LH2H 2YUVA 1JPSL 2DRUA 4X5WB 5F6HI 2AV1A 5D72L 4NWTH 4BELD 3T3ME 5CILH 1CK0H 3UTTD 1D5IL 5HHMD 1CXEA 1XT5A 3ZL4H 3PDGA 4JFDE 1FNEA 2VH5L 4KPHL 1T7ZA 2P42B 2CXGA 3GZKA 3KWWA 3RVWC 4H26B 2AJZB 4JFXB 5TDOB 2YWZA 4NRZA 3QHFH 4MXVF 5FGCB 3D9AH 1DDHB 2HFGH 5JO5A 2ATPA 3TBTB 2ZNXA 1BIIB 1ZSDB 1Q9WB 3AU1A 4GXVH 4KK9D 4X9IA 5F88A 2VLKE 4OF7A 2UVEA 4OTXH 3LZFH 3WJLC 4P5MA 3EOBB 1FDLL 3DJ9A 4X8XA 1P1ZB 2RB8A 4FFWD 3MCKB 5C0GA 4YHPA 2YPKB 4LASH 1C5BH 2AJYL 5L2KB 1BAFL 4KRPC 1JK8A 4HG4J 2APFA 5A16B 1I9RL 4Z7VF 4G6JH 4Q9QL 2FX9L 4BZ2H 2P8PB 1HXMA 4CL7A 3SO3C 3H9SE 4E42B 5E6ID 5HYIA 1CFSA 3IFOB 1R24A 1Q0XH 4H1LH 3IT8D 5DHVB 4ONOA 5A2KH 3TGXA 4HSQA 1JYXA 4HZAA 3V0WL 1D7FA 2IQ9H 1KEGL 3W0WB 5D72H 3WKNA 3U7WH 1G7PB 3MCG1 4XBEL 2AS5M 5HD8D 2CKBL 3ZTNH 4YX2H 1ZT1A 5C0CE 1NCNA 4OQTL 1IC4L 2ZCHH 1JFQL 2V17L 4HAFA 5DTFB 4ZS7L 3VU2A 3OAUL 5GS0H 3G9VA 2YSSB 3AU1B 3N50A 5GGRY 3KPLA 1QTYT 4L8DA 1A7NL 1MJ8H 2DMKA 5CJOL 2RQ8A 4G9DA 4MHHG 4M6NH 2NXZB 5DJYB 5F9JB 3Q3GA 5J12B 4CBPA 3QQ4A 3EDDA 1QSFE 3VI3F 1LILA 3QQ9D 4MJ4A 4XHJC 3GHBL 4K8RL 2EDXA 1KB9J 4QOKA 1MCEA 1BFTA 4LCCB 4F58L 2X1PA 4LEXH 5MENB 4CVZB 3L3DB 4L29A 4YHIA 5MI0B 4NQEE 1QBBA 3PL6D 2QKIA 1X44A 5E2WH 5GRYA 3BH8B 1J1XH 4RMVA 4WWKA 2LVCA 1UM4L 4CMHB 3L3JA 3OR6A 4QOKD 3ZE2E 2VXVL 3CCHA 1ZS8A 3SDAB 5FK9A 2X9XA 3N85H 2XTJE 1LK3L 1OM3L 1RZGA 4X0KB 3C9NB 5ILTL 2A9MH 2Q76A 1TCRA 1XCTB 4OV6F 5FXCH 4H1LG 2JJUA 1KB5L 2DM4A 5EU4A 3QBTB 3V6FB 2X4RA 4C59B 4ELMF 4RMRA 5JXAL 4HPYH 2XQYG 5KVEH 3TPUB 4G9DB 1S7TB 1IQDA 3RFZC 3BXNB 4BFIA 2H26B 3J8F7 1QVOA 3TYFB 2Z91B 5HYSA 4S1RH 3VG9B 3S7GA 3CU1A 5FAAA 1HQRA 1OAYH 2F53D 1IEBB 1H3TA 3MZTA 5IMMA 2ARJA 5E8OB 2C4FU 2ID5A 5ETUB 3RIFK 4YDLB 2KBGA 4QHMB 3QDGD 4WU7B 3DGGA 1W0WA 4FQPA 3CFCH 3FQRA 2VC2L 5ICXA 4XH2B 3S37H 3T1FB 4KTEL 4JY5H 4JFPB 3CCHB 1YQVL 3LN5B 3H42L 4LSTH 4QXUL 2Y06L 4KV5E 1NCDL 2X4OB 1P2CA 4D3CH 1Y0LA 4DAGL 4Z6AT 1L6ZA 4XMKH 5C8JB 1H8OA 4HV8A 5IMMB 1T03L 4U7SA 1ZLWH 2HMIC 1S7QB 1XF5B 5C0BE 2VXTL 3JWOH 4G43B 4AIZB 5HGHB 3MRDA 1T6WA 4OCXL 2VKXA 5J89A 4YWGL 1D5XA 4FQCL 5FO8B 4R26L 1GGYA 2N4IA 4MLSA 1IGML 3I3BA 5JR1H 3DUUA 5DJZB 2EH8H 1UCBH 1AY1L 1ORSA 5GS2D 2V2WB 2BZDA 3RL1B 3DRQB 4MXWH 3Q5TA 4HV8B 4DEPC 3O4LE 4LBEA 1XF3A 3SGKC 4KMLB 5INDA 2BSRA 2MKWA 1GSMA 5J56B 1ES0B 5JQHC 4TRPH 5C07B 4NFDA 5D7SH 1HINH 1QVOB 1NCAH 2PYEA 3IDGB 1MCWM 3ZT5A 4PJGB 2Y5TA 1Z0MA 3GI8L 3QA3B 5J9PA 1VERA 3JWOC 1NCBL 4M7ZB 1JJUA 5FUCE 2PXYC 5IFHL 1I7TA 1Y0LB 4K8RC 3V95A 3VXSE 5IBLC 2HT4D 3CFDB 2GSIB 1F6FB 3ULSB 1OB1A 3F5WB 3I02B 2OYPA 1JNHB 2W91A 5C70A 5EULV 4TQEL 1ROWA 4GUPB 4ONFH 1S5IL 3BAEH 3TBVA 5D1ZB 2YUXA 5IBUB 4HEME 2EH8L 3B5TA 4YO0A 5IGXL 1FC1A 3VFGL 4K7FB 1U8PB 3MGOA 5F71A 4ZTOL 3I84A 5DEFB 3U2SB 2JF1A 5HYJD 1WFNA 4G43A 3P73A 5IMLA 5L7XL 4FTVA 1ES0A 4WHYG 5A1AA 1HHIB 2HVJB 4PJ9D 4LAJH 5I8KL 1IZJA 3SDDD 1Z9MA 1A14H 4M61B 3STLA 4F7MB 5C0CA 5IQ7H 1S7XB 4MHHI 5DMGC 4OD2B 4JFFA 1MEXH 1DLFH 5CJXC 4OKDA 5BXFA 1R5IA 5BS0B 1J0YA 4WTXA 1T1XA 3X11B 3SDDA 1LO3H 3C5JB 1NCAL 4MJID 5F8QC 2H6PA 4PRHA 5JORA 4I0PC 1P69B 2W9EH 1GL4B 1J1PH 4Y19D 2Y07L 3C5ZD 4HXAH 4JGMA 1CLOH 2F54B 3EO1A 4HWZA 1R3JA 1FO0B 2R2BB 1MF2L 4PJIE 5F7NC 3NVQA 1UVQA 4JPWL 5L8JB 1WIOA 4R90H 2VDQL 2EDDA 3DTXA 4J3SA 3SKUD 5FUOH 5SV4A 1WBZA 4AIOA 2E7LA 4J3WA 3SKJL 4F7TA 3I6KA 4FABL 2J3SA 1DSFH 4PLJC 1ZT7A 1GH7A 3D0LB 5L2JB 3ULUF 1RIHL 3V4PH 4PJXE 1G7QB 4P0DA 4MXQD 1KSRA 3ZE1F 2DQFA 1RK0B 3O9WA 5H2BA 3MR9B 2A1WL 5F8RC 3VFNB 5EU5B 1I7UA 5KZCD 4HKZA 4V2CB 1QPXA 3C5ZB 1I9EA 3C60D 4I0KA 3BP4A 3LEYL 3OSKA 4DGYH 4ODHL 1HH6B 3TO4C 3O6LH 1EGJH 4YQXH 5C7XH 3HS0A 4LGRB 2AJXL 5KANI 3C8HA 4LNRB 4X80H 3STZA 4K9EH 1T2QH 5GS0C 4R4ND 2OSLA 3RUGF 5JLZB 1FAIH 5J13B 3U1SL 4NZTH 1WWCA 2R1YA 1KGCD 2C9AA 1I1FA 4NKMA 1NGYA 3PDDA 4O02H 5I8KH 1A9BB 4R0LB 3B9DA 4ZO9A 3SDDB 1Q94A 3ESUF 3FQTA 1WEJH 3PABB 2XG4A 5GGRA 3S5LB 5C0BD 1NAML 2JTDA 2DYPA 5LVEA 1IGCH 5I74B 4M93B 3O2DL 1UQSA 3V5HA 3QJHB 3MRFA 1FO0A 2BNRB 3RIAK 5JOFA 1WZ1L 5IKCA 2UV3A 2NTFA 3WNNA 3BEVB 4CVXB 3MRLA 1G7LB 2ZSVA 3UTSE 2VLKD 4L3CB 4NC2B 4XNUH 2DQDL 3LSOA 4K9EC 4HC1H 3MREB 4JFZL 4PRAB 1LEKB 3BKMH 5EIIB 2Z8WC 1UWEL 3QEQD 4XCCH 1YECH 3G5ZB 2VERN 1QFUH 5E9DD 3IAGC 1JZ3A 5IG7A 4Y2DC 3H7BB 1F3DJ 5GISL 3NFSL 5HYEA 1GIGL 3QXVA 3EYUL 4JEGB 5EO9A 3C2AH 4B5EA 4R4NC 1YECL 3KJ6H 4MQXD 2MJWA 2G5BB 4LSQH 3AXLB 3MNWA 4UIKL 3LS5H 5D1QD 1OTUC 1YC7A 4MJ5B 2AERT 1NL0L 4KHTH 5L9DL 3VMNA 5INCA 5LAXA 5K9JL 3RNQB 3H7LA 4J7RA 2F74A 5IMOB 3L7FA 3RJDA 1KXVC 3RNKA 2RR3A 3OKYA 2HG5A 3EYOB 1SY6H 3MYZA 1IL1A 5D96C 3SO3B 5SWZB 3QFJA 5MEPA 4CVXA 1Q94B 2GTZB 2X10A 3FQTB 1B0GA 1S7WB 2DKSA 3WUWA 3LKPB 4ETQA 3MRBB 3IAQA 2UYLA 5E6IB 3QYCA 5FHBL 4FQ1L 3UPRA 1UXWB 4H20H 2ICEB 3GMQB 4X7SL 1T89A 4LLWB 4JPIA 3TA3A 4YBHA 3CSYA 3M07A 2HYMA 1BD2E 5I1IL 4N0CC 5HJ3B 1X5LA 3C5ZC 3S37L 1UT9A 1FZKB 2AQ2A 2KPNA 2NY1B 1OAKL 1T1YA 4OCNC 2J2ZA 2XY1A 1K4DB 3ZDZE 2R1XA 4M1CC 2OL3B 2WWMD 5D5MA 4NWUH 4PGEB 4PV8A 2BSED 3DV4A 1HKFA 4NRXB 5CEXB 2PTUA 4X7TA 1DUZB 1MVFA 3TF7C 4YPJA 1JGLH 3VFPB 3F8UB 4Q6IB 2GT9B 2KDGA 5DF0A 4EI6A 1ZHKA 3D18A 3S88H 3WFHA 3ROLA 3LVEA 1DSFL 1ONQA 1DBKL 3RWIA 1XF1A 1SJEB 1JF1A 3NN8B 4L8SA 5CZXC 1LP9E 2VWEC 4HWBL 3FQXA 1TMCB 3QDAA 3PP3H 2Z93A 2GY5A 3D3VE 3QRGH 5D7JC 2VZTA 3WYRA 5KJRL 5L2KD 4TQEH 2G60H 4R2GD 4U1JB 2DM3A 2VZ1A 5BJTB 3CFEA 4GAJH 4ZPVA 4ZUTB 2PETA 5HHPB 2AJZA 4KJPC 3IRPX 2MPAL 3NZHL 3VJ6B 1S7WA 2A0LC 5EZIL 1FNSH 2YMXH 5BRZE 3TIEB 3RWIB 2R23B 3MLTB 1AC6A 5L2KA 3O45B 1XR9A 2PW1B 1JWUB 3FONB 3QULA 3DVNA 2H32B 3WHXB 2VLME 3KYNB 4KHXH 1LK2B 5CJBA 1FFNB 4U1IB 4L5FH 2EXWD 2YS4A 1CFSB 2I26N 3KWWB 5D7KE 4NBZB 1DL7H 3SE4A 2D4FA 3EOTL 4M6NL 2H26A 1MH5A 4HG4K 7CGTA 2R8SH 5IW1A 4X5XA 5JO5B 3BKCL 2YA1A 4HPYL 4JN1L 1IBGH 3MV7A 5KSBB 2VOTA 1XIWA 2JK5B 3B2VL 1KB5A 5CSBA 5EU6B 3DMMD 1WLHA 2ZCHL 1T22B 4ZS7H 3NGBC 3QXAB 5K59E 1UA6H 3EO0B 3VWKD 3PP3K 2VLRE 1BF8A 1FAKT 1E27A 2Q86A 3MRKB 4U1HA 3MC0A 1UZ6F 4TUKH 2ZG3A 5F3HA 4UU9A 4KVCH 1MCNA 2GFBA 4KKNA 1IM9A 2BJMH 4NC0B 4TSCH 2VQ1A 1PLGL 1NBZA 1KNOB 4XPHL 3MV7B 4B53A 5T1MB 1I8IB 1X5IA 2PO6D 3P4LA 3IJHA 1HDMB 4HT1L 3FJTA 4BYHA 4BH8B 3HZVA 4FFVC 3TWCL 2NW2B 3WO3B 4M3KB 1YEJH 4S10A 4JY4B 1U2HA 4XP1L 2VABA 2ZKHH 4PJFA 1EFXA 2VDPH 4ZD3L 1O5DT 2PO6A 3QPQD 2FATL 3HPLB 2EZ0C 4NJAL 2VKWA 5HI5C 2H32A 1UM5H 4OCYH 3ARDD 1TITA 5MENA 4HUXB 3BJLA 3O4OC 3MCLH 5I17A 4JKPL 5KSVB 2HWZL 4M00A 1CXHA 5KSUA 1BBJA 4ZUWB 1I1YB 2QQNL 3D9AL 4RZCA 3FHQA 5F7EH 4CW1A 3BPNC 4OGXH 3V7AE 4NQTA 1SYVB 3MGTA 1DQQB 3CXDL 4JGUA 3O4OB 2QR0A 2P5WB 2Q3ZA 4I3RL 1BZ7A 3PF2A 4I0PB 1NGQH 2NNAA 5ACZA 4PRBA 2VJXA 3QDMD 4XBGA 3QDJD 15C8H 2YPVH 3RWFB 3RY5A 3N85L 2BHZA 2LTQB 3TT3L 3A6OA 5SWSA 1SYSA 2IADB 4Y8AA 1TVDA 4JB9L 2QQKL 2DQCH 5T1MA 4BKLA 3OPZH 1IAKA 1JZ5A 4NN7B 4OLEA 1IM9D 2J7LA 2GTWA 3LH2L 5DEZA 3LV3A 1S7SA 5GS3A 1U8KB 3I85A 4LIQE 3V52H 1BZ7B 5DEGB 4YE4L 1AH1A 2EO9A 3LKSB 5ID0A 5DD6B 5ALBL 4MNQA 2FH6A 5DRZA 1CDGA 1ED3A 3H6JA 4OLYL 4U3CA 2YC1B 2HP4A 4ETYA 4BH8A 4S1DC 4XMLL 4JN2A 1T2XA 3EW3B 3QDJB 1G1CA 1N5AB 3QWOA 1K2DB 1WVZA 4FQJH 1WUNT 1FCGA 3IFLL 4OZHA 1A3LH 3P9WB 1ETZB 5ACLA 3QUXC 3DV6A 4OV5B 3U0WH 2A83A 4N9OB 4HJ0D 4RISL 4WDIB 1RQ5A 3TIDA 2BC4A 2H3NA 1ORQA 1NGXB 4IOFD 1CG9A 1MI5A 3OKEB 2AEIT 1HKLL 1BQHB 4JO2H 1GOFA 4P2RA 4QRUB 1H5BB 5C8JA 3EJZD 4U0RC 2AVGA 3QNYA 4Y16D 4LVEA 3VFMB 3TZVC 4KTDL 1WBYB 4PJ7F 3KLAA 3MLVH 5HDBF 3BD5A 3QHZL 3RWCB 5JIKA 1RK1B 2XKSA 4OCRL 1ORQB 5KW9L 3F7QA 1SYSB 4KGLA 2VZOA 3LS4L 1F6AB 2DLHA 3GHBH 4Y19B 5HY9B 2ZP0T 4XPAL 1G7JB 5GHWL 2DJSA 4Z7WB 5ICZB 1BOGA 1F3JB 4OT1L 2XWJB 3LZFL 3W11D 3ZE0E 1BQUA 1YA5A 4BZ1L 2JELH 4PJGF 1BECA 2F19L 4ZUSB 4GKSB 1JPGB 2Q8BL 1XGQB 5BV7H 4WI2A 2BP3A 3PGDA 2ARWA 3T0EA 2NYYD 4J8RA 5DO2C 3QUZD 2YRZA 1RZIB 3ELAT 1B90A 1KJ2B 1RPQA 5F93C 3PV6B 4JRYE 4KI5F 4NQEB 4A6YA 1N59B 1GCFA 3NABL 1PYWA 1JHLL 3IDUA 5MHSE 5CP3A 1C8PA 3MV8B 2HWZH 4X98A 2V6HA 3C60A 4B41A 3GUTB 3SJVD 1A9EB 1WTLA 5I6XC 3DARA 2FJFB 5J8OA 1W0VB 5HPMB 1L9MA 5ACMA 3VCLA 2W60B 2CLVA 3P11L 1F3DH 1C5BL 1UZ8B 1OPGH 4P3DA 4CJ0A 1R3KB 5AYQA 2CDFA 4PJ7B 4XNQA 3RWCA 3EDEA 1RK1A 3CD4A 2F53E 3JV4A 3ETBF 2D9QB 3HHRB 1N59A 5IEKA 3KHOA 1OP3K 2PCPA 4U6HA 4U1GC 1IT9L 3GUTA 5C0FA 1CBVH 1KLFA 4EBQL 4Q9BA 3QEGH 3HMWL 2X6MA 3GFUA 1JUFB 2DLTA 5E6ZA 3BGFB 3K3QA 1UJ3A 1MHCB 1A1MA 3BISA 1D6VH 1T0MB 5C0NC 3AS3A 3GSOA 2YR3A 1EJOL 4EDWL 1KGCE 3ORJA 5IB4B 3HI5H 3KPSB 1FH5L 4RFOL 3N1FC 3QI9A 2FRGP 2VL4A 4H8WH 5GRXG 5IV2A 1AFVH 4AY0A 1U6AH 4X98B 1TJGL 4N0YL 2VWEE 4PJ5E 4HH9B 4OZIB 3MO1B 3DSNA 5KVGH 1EH9A 4HUUA 2F19H 1EJ6A 3QH3B 4U1SB 4Q2ZB 4P9ML 5D93C 3WJJC 4H5SA 3WUWG 1U93A 5GQBA 1FL3A 4JHBA 4L3EE 1CI5A 2G75B 1JRHI 3LEXB 5IUSA 2H2PD 1HXYA 1S5HB 2PXYD 4F7CA 1IQWL 3QZWB 5TQ0L 1OD7A 1NMAL 3W2DL 4QHUA 3GSNH 5E5UB 4QNPE 5IOPB 4PJ8D 3MRQA 2ZUWA 4HGWA 2FJFA 4NQDE 2R69H 4F80A 1A3QA 4X83A 4R7NA 1OAUL 3WUWB 4GG6B 2FWOB 1IC5L 3I9GL 4YC2B 1AE6L 1CL7H 1CGVA 1J8HE 1FZOA 3FB5B 3P30H 4A6YL 4X99B 1F58H 2IMNA 1Y6NR 2HJFA 3STBA 2IPUK 5JOPD 1H0DA 2KUTA 4BH7A 3BP5A 3HI5L 3O9WB 5E24E 5IKCB 5E03A 1F58L 1IC7H 4Z7OF 3WS6C 2YPLB 4RAUA 3WKML 4KAQH 4LDLB 2BVEA 1NLBH 3TA3D 1DQLL 4WI5A 1PSKL 4Z77A 5H37H 4XMLH 5HGDB 5HHQB 5DRNB 3DSFH 1U9KA 2YZ1A 1BM3H 2MTPA 2NTFB 4Z5RA 1BEYH 1CR9L 4FABH 1J5OH 1JWSA 3OHXB 4IMLB 3PWJA 25C8L 1J9CT 2EYSA 1MCWW 5AG9A 4OFDA 2ATKA 5IT2H 3P11H 3MLPA 1E4KC 4PG2A 4KC3B 2WWKT 5DRWA 3RTQC 2OTUA 4U1KB 5EBLA 3GKWL 1CU4L 2UWEE 3VFOB 4ONHA 1UQSB 4LPXA 1N3NB 3ILPB 1B0RB 1YYLL 2X70A 3VXMD 1RUKH 2WUBH 4X4MA 3VD7A 4TSCL 5E1HB 3UCRA 3EOAA 3TT3H 2BMKB 3MRIA 3U46A 3JWDH 2KQMA 1EMTH 2YD5A 3AC0A 3MRPA 4HKJB 1VKXA 1XR9B 4NZJA 5DVNA 3QIWB 1DCLA 4G80A 4GBXC 1JV5A 1T3FB 4HX1A 1T66D 3MLWL 4EBQH 2EDKA 4M03A 1CTOA 4YPGB 4K3HA 2Z31A 3MLSL 5IP4A 1Q0YH 2BNQD 1E28B 3IF1A 1MWAB 2LAAA 5C92A 4ZFOL 3HNVL 5MEPB 3WL9A 3OKDB 4PGCA 4JANB 4NUGH 5FUZH 2IH1B 4LSPL 3T2NL 1K5NB 1DEEA 1V7NL 2FB4L 4ONGL 2MFNA 1E4WH 5E7BA 1P84K 1OGAB 4N5ED 3MJ7A 5HI4D 1MAJA 5EA0L 2A6DA 1EAPA 5HTSA 2HTLC 2VLLB 4GLRH 4F9LC 4XVTH 2DMBA 1JVKA 3GJFB 3LKRB 2JB6A 4Z95L 4G6KH 4WNQB 1P9MC 3PGFL 5ISZE 5CLWA 4Y5VB 3S3SA 3DHMA 1S9WA 4LLAA 1RIUL 1WZMA 1NC4B 2QSCH 5KSAA 4JFZH 3T0DA 5EUOE 1QKZH 1GGBH 4L8SB 3U83A 1MJUH 2P8LB 4XP5H 1U2CA 4YC2C 4D9QE 3D3VA 4GBXD 3SDCD 4OD3H 4D0DB 3QCUH 5TE4L 4EI6B 4FA8A 2L7UA 1S8DB 2OK0H 4JHAL 4QRTB 3EOBA 4JY4A 5GGVY 3W81A 4EUPA 1EHXA 3C5SB 2DLEA 1AR1D 4UILH 4WY7L 5K9JH 5EBWB 2AEWA 5EU4B 3EOTH 3RY4A 1AQKL 5DDHA 2BOBA 1ODAA 5ENWA 4P2QD 4X6CA 1RIVH 3DX9A 3RVTC 1PKQA 3TVMA 4DQOH 1Z9OA 5C09E 5IROA 3KJ6L 2VQTA 3RPIA 5DZNA 3BPCA 3HC3H 3FN3A 1KT2A 4FS0A 4KRPD 3WFHB 2NQCA 5CBEB 2OR8A 3MUGB 2PTVA 3O3UN 3VMOA 2R23A 5BQ7B 1IGJB 4Z0BL 3ZMRA 4LLVA 5HHOE 5DWUH 3UTSB 5I8EB 4XCCL 1ZLVK 5JW4Q 2B1HH 1HN1A 3IS0X 3BX7C 2AXJA 2IMMA 2HVKA 1VFBA 3C6LD 2P7TB 2DQIH 3A6BH 1FGNH 1OTTC 2CO7B 3MJ7B 1U95B 3RUGE 2AJXH 1LK2A 3G04A 2JIXD 3FO9B 1DP0A 3KXFA 2YRPA 4JE4B 3EHBC 4UT6L 4F57L 5C9JB 1IFHL 2NY2B 1BVZA 3WN5C 3BEVA 3QUML 3UYOD 4WO4A 3IKCB 4Z78B 4L4VA 2R9HC 5I1AB 1RUPL 1BJ8A 2AKRA 1T21B 2R0KH 1F4WH 4OZFA 1GHFH 1P7KA 3CVIH 3T08A 1UM5L 4O02L 2EEBA 3CLEH 5D1XB 1B0WA 3MNVB 1K2DA 1ORSB 1A8JH 4P3CH 3QUYD 1FP5A 4OF3A 1N0XH 2EYTA 4PJBE 5F3HB 4NGHL 4UT6H 1WT5C 2F8OA 5ESVB 5HHVL 2X40A 1YY8B 3L3JB 4OD3L 3SCMC 1MJ7H 3R4DA 1T04B 5F9WC 2LABA 4NQXA 3D39A 4PRHD 5GRVK 4EXKA 4UDTB 5C0AD 5DJXB 3AFLA 4DKAA 4HXBL 3QUYA 1AIFB 1QFUL 5DQJA 4NQCB 3FQNA 3K80A 3OR7B 3PWLA 3QXWA 4B7LA 1KFAH 5IESH 4UQ3A 3GMMA 3CUPB 1A6UH 1M71B 5CHNA 1PQZA 4DUWA 3G08B 2HJKA 4IOFC 1VB9A 1KULA 3UTSA 4OLUH 4JFQB 5I1DA 4HJGB 4NQCD 1AXTH 4TTDD 1JHKH 3W9DA 2E27H 5EZJB 4XCNA 1UYWL 4X7DC 5E8OA 4UNUA 4JKKA 4UOJA 2W0FB 3CNKA 4IRZH 1GZQB 3EZ8A 3QFJE 5F6IC 3SGDI 3U9PH 1FO0L 3F6LA 1LEIB 5I1CL 4NOBA 1MCPL 2VQUA 3KS0J 4K8RD 4KHTL 4MDIB 4HIHB 4ZQKB 1IGFH 3ZTJG 4U2ZA 1U0QA 2NY2C 2IGFH 5CSZB 1S7SB 1Q1JH 3BZFA 4HJGA 4NNYB 1PY9A 3BMWA 5JHDB 1AKJD 3LKQA 4XCNB 1RUQH 1GGCL 2BK8A 1QA9B 3BEWA 1AGBA 4AEFA 4YHKH 3WNPA 2KZ1B 3VW3L 4X4ME 4A6YB 3FO0H 3LRSB 4GSDH 5GPRA 1ZHKB 3D18B 2YHGA 1IGFL 1RU9H 3ROLB 5K9QG 4HKXA 1DBBL 3V0VA 4N0UE 3WDHA 2EKJA 3FAWA 4O2CB 5C0GB 4LCYB 3RX8A 5BRZB 5IJKC 3FL7A 1J88A 2ICWB 3BIBX 2J8UB 3ARQA 4NO5B 3OX8A 2EZ0D 1I85C 4YUEH 1IGMH 2JJTC 2PTTB 2VLKA 2XA3A 3KPNA 1KJMA 4JLRA 5E8PB 2XTJD 4OLUL 2VL5B 4RNRA 2Y6SD 3HRZB 1KIRA 1A7RL 4OQ1A 1NFIB 4MD5A 2JCCA 4KVNL 4MXQC 2P47B 4JFOB 1XGRB 2FSEB 4G9FB 4QHKJ 5GS1C 2K7PA 1NCDH 2Y6SC 1EUUA 3VXNA 4GW4A 4X80L 1YEHH 3DVFA 4KMQA 4MCZA 2K3TA 3TA3C 5HYQA 2E9IA 1YEFL 1FFNA 4OV5A 4DZ8B 3EFDL 4I2XB 3JSSA 3WFEL 2ERJB 3NZHH 2HKFH 5HHVH 4BFGA 4PLOB 1ZE3C 3RWJB 3MROB 4P5TA 4XBPB 1GC1H 5KZCB 4ZFZA 5CILL 2BCKB 4ZUSA 5C6WH 3QIBA 4WWKC 5D93B 1YEFH 3NAAH 4RGMB 4Y88A 4K71B 3JV6A 5AUMB 4IDLA 1ZA3B 4G8IA 4TTGA 1NBYA 1RIHH 3MLYL 5ICZA 3BDYL 3QPXH 5JA8B 1UKTA 2X4SA 4WUUD 1UXSA 5B39G 1U91A 4R4BB 1A9BA 4NT6B 3KPQB 2NMSA 2VLKB 4KFZC 3VXSA 1CR9H 1J5OL 1YN6B 3CK0H 5IGXH 1H3PH 1J05B 3LD8C 3MLYH 3PHQB 4XBPA 2FD6L 2HT2C 4HGWB 5L2KE 5D7LB 4UB0L 3SDDC 1MHEA 1WIUA 2DIAA 1FYHB 4Y7MA 5C0IA 1NMBH 1FYTD 3FHAA 4ZUUB 5ADPH 5DFVD 3A6BL 4OFPA 5IEHA 5FOBB 5HHOA 2ARJB 3H9SB 3KPSD 3TPKA 3CU7A 4JY5L 1IEAA 4AH2B 1CFBA 1CL7I 5K59F 1YC8A 1YEDB 1HI6A 3QCTL 4QRQB 3W5MA 5FYJU 3PHQA 4MYWB 5C0AE 2VIRB 3U0PA 2R2EB 1TJIL 4M02A 3E1F1 2NY0B 4O2EB 2EDQA 3LMJL 5FYKD 2CDFB 5J1SC 1K4CA 1WSST 1PZ5B 1KLGB 3ARVA 4O9HL 5GGVH 1ND0B 5DJ2A 4CW1B 1VADB 1NMCC 5F7MC 1NBVH 1A6WH 2AQ3A 2NY1D 4LIQL 4YXLL 1JGUH 3REVA 3E3QE 1AGDA 3U4EB 2CMRL 5CP7A 1FO0H 5MI0C 2BDNL 4LSRL 1KPRA 4O9HH 3BP4B 3K4ZA 2WIIB 5L88H 3NBNA 4HC1A 3LMJH 5JOPE 1B2WH 5GIRA 3ARBD 1A7QL 5GJSH 1T89C 4H8WC 5FCUL 1NCUA 1GGCH 4K9EL 4LVNB 4CU8A 5IFHH 2R15A 1P7QD 2AABL 4OSUH 2VSDA 4P57B 3TA3B 2VC2H 4Y8DC 5FCUH 1ED3B 5F7YC 5D8JH 2ESVB 4K23H 2MHAB 1JPFA 5C0EB 3SQBA 4HUWB 2L7JA 4GQ9H 4QRRE 5D2NE 5JA9A 2Q8BH 3ESVF 5GGTH 3OXRA 1UJ3C 3QAZC 2I5YL 4HDIB 4LSRH 1CGWA 5D9SA 4BZ1H 4MXWL 5JOEA 2EYRA 1CE6B 5A2IH 1X5AA 4P5KB 5F89B 3TBVB 2MQCA 4J1UA 2V17H 1IARB 1R24B 4OCXH 5KVEL 2I07B 1X9QA 1U3YA 5D4QA 3UTTE 4R96A 3PGCB 1GHFL 1HOCA 1GOHA 3O3DB 4I5BB 3R8QA 1YMHA 3TO2A 5D6CA 4IRJB 4JO4L 1TJIH 1F02I 2Q3AA 2IBZX 1RSFA 1URLA 3CDFA 1ZOXA 4E41D 3X12B 3GJFA 1B9ZA 1IVLA 4KWUA 4Y5XA 1A7BA 3MNZB 5LGHH 5TF1H 5BV7B 4KTEH 1U8OB 1I3RB 3GKWH 1RULH 1MJ7L 2CDEB 1NMCB 5TDPA 4FFYH 2E7LC 3L1OL 1ZTXL 3CFCL 1U8HB 4JM2F 4K7FA 2NY4B 4UZGA 4R0LC 4XP4L 1BOGB 4BSJA 4JRYB 1CICC 3MRCA 2ZWLT 1H0DB 4YFLI 5AWNH 3AAZB 1FYTB 1F97A 3DX6B 3L5IA 4QRTA 1TZHB 3SGJA 2R0KL 2BY3A 2DQEL 2EYSB 2ORBH 5CZVH 3THMH 1OGAD 1VSCA 3CDYA 4N0FB 4LHQB 2GKIA 5JW4N 2ZG1A 5FYJD 4X4ZA 1I8MA 4HW6A 1S7QA 4TN9A 1RJLA 1WCQA 4UT9H 4PJ7E 2EYRB 4ENED 5B39A 5FDWB 3CSPA 2A9ML 2R9HD 2VZUA 4CU7A 4F8QA 1RUAL 3BIKB 3AREA 4OZFG 1R5WA 2DTSA 4DK3A 3KLDA 3MV9E 5JUEL 4ZDHA 3WNMA 2JJSC 3ARDB 3DWTA 1LE9B 5HPMA 5I8OH 1LDPH 5EO1A 3RL1A 2Z92B 2E6JA 3SE9H 4YHLH 1DEEB 1QKZL 5B3JF 1KEMH 2MQ3A 4LSVH 1MCBA 4GOSA 3V9FA 4MNQD 2RHEA 2XWBA 3B5GA 1FNLA 5JDSB 5E2VL 1A14L 2AEQH 4RGMC 5DGRA 1CL7L 3IDYC 2LU4A 2OBGA 3NACL 4KK6D 5EPMB 4U1NB 4AL8H 1BQLH 1FZJB 5FIEA 3IJYA 1NC2A 1T0NA 4JFYB 3Q5YA 4QGYA 5AD0B 2ERJC 4IRZL 5KVFH 4HUMB 4PY8I 1FZMA 2P8LA 4L3EB 2Z91A 4LLUB 1MNUH 3RVTD 2R2HA 4KK8C 3RTQD 1JYVA 2DQTL 4KKLD 3GDBA 1ZGLP 1C5DA 2HFGL 4YIQB 2NXYB 4QT5B 2VXTH 3JWOL 5ALCH 1RMFL 2APVA 1T1ZB 12E8H 1OSZB 3V0AC 3VD4A 4IHOA 3UBXI 1DN0B 2D7PA 3KNBA 4OCMC 3HE7A 4FFVD 3MGTB 4S11A 4GG6E 3QEUB 2R29H 4K94C 3KS0H 5EOTA 4Q2ZA 4DVBA 1TZGL 3LDBC 5GGSY 1FIGL 3ARED 1M7IB 1BLNA 5T1LB 4PLKC 4PRPD 1UKSA 1D5ZA 3GMMB 5KS9F 5DUBA 1R3LB 1Q72L 4NYLB 5BCAA 5IG7B 4QHUB 5AAMA 1G9MC 3C5SA 3DRQA 4NHCL 4F7MA 5EBWA 5D1ZD 1HINL 1IAKB 3CPLB 4HMDA 3HMWH 5E4EB 1S9VB 5LGJB 2VLRA 2VRAA 2W59A 3HC4H 3HNVH 3TBWA 2A2QT 3MUHL 4OCLC 3S3PA 2H32H 2WBKA 1T22A 5H35B 1KCKA 5LGKA 5LG1A 2R2HB 3QO0A 5IB2B 4NN5B 3OTTA 3ZDYF 3O3AB 2OM5A 5BQ7A 1QSED 3CFIC 4NHCH 5B4MD 3QWOB 3RAJH 4L29B 1WBXA 4YBQD 2XIDA 5KAQG 1EMTL 3CAFA 1I4FB 5DVOA 2DLIA 5DMKB 1S7RA 1LO4H 4JFED 3RTQA 2I9TB 3LKPA 3IKKA 1LO0L 5FM8A 3RWEA 1QFHA 3TBWB 3F58L 2NW3B 4XPTH 3TJEL 6FABL 2XRAL 4DVBB 1YN7B 3PWVB 1EHLL 2BJML 5DJ0A 3GSRB 3L7FB 1KJ3H 2P24B 3IB4A 3R06A 4UDUB 4JFFD 1YNKL 5GGSA 3KXFE 2HVKB 2ZUUA 3ARFD 3P0YL 5LJYH 3VD3A 4OUOA 2C3VA 1W72A 1KV3A 4HJJL 3NIFF 1NDGB 4Q9RL 4FXGB 1FFQA 3U0WL 5C0CB 3STLB 4OCSL 1AIFA 5DR5H 1LO5B 4OZGA 5CEXA 5FA4A 1H15A 5IJVB 1M05B 5C1MB 1KC5L 2X05A 4FN0A 1Z3GH 2Y7QA 1SYVA 4LLWA 4RNRB 2WNGA 3BSZL 2B1AH 1DFBH 4P48A 5FYLL 1K8IB 3RI5F 1U8LB 2A73A 4M7LH 4RWHA 4LPYA 4YDLC 3QI9D 3P40A 3EYQC 3QIWA 1BJMA 5D2LE 3GSUB 1KJ3L 4HKBA 2EIBA 3DV4B 3ZYIA 2B8OT 3O0RL 4POZC 5EZIH 1A6TA 5K9OA 5T5FL 3MX0A 3P4OA 1AQDA 3V5HB 1BVLB 2HJKB 3HB3C 4M4RA 3WD5H 2GAZB 2R4SH 3VWJB 4LU5L 1TCMA 5I2IB 2QQKH 3QDME 1U3HC 5DA0B 2DN7A 4W4OA 1AO7E 2HRPH 3O8XB 5E94A 1CT8A 4P2RD 3RTQB 2I9TA 1LO0H 3UBXA 1K5NA 3RWHA 3VRIB 2VZVA 3DBXB 4IEFB 5EUOB 1JGDA 3RGVB 1OD9A 3MV01 3MYJA 2XTJB 4HKBB 1P4BH 3IDIB 2GITB 4NQSA 4R8WH 1XCQA 4UINH 4PYHA 3UROR 2R0LL 2NYYC 2YEZA 4LVOC 5BW7A 2VO5A 4YZFF 1VFAB 3JV0A 5TPWH 4UOW1 4IDJH 4PRIA 1PKQE 2P44B 2PYEE 2XI9A 3DMMB 1MIMH 1JFQH 4DZBB 2XQBH 1YNKH 4OZGB 2PW1A 4JPKL 4H88L 4I13B 1HH9A 4GH7B 5F70A 3U7WL 3E8UH 4CRPA 3QHFL 15C8L 4N8CL 1NGZB 4Y4FB 3ZKND 4PGDB 1AI1L 1I7UB 2VDRH 3IGAB 4WI4A 2YD1A 5DI8B 1YEDA 3T65A 3CXDH 3GB7B 3BZFB 1G9MH 3VFWA 1CDCA 5E8NB 4QY8A 2GFBB 4NKIL 5CP3H 2HLFC 1HHJA 1CXKA 3MCLL 3RUGB 4I9WE 4KI5E 2H41A 2DQDH 2PTTA 1AGBB 4OGXL 2R1YB 4C4KO 4YO0B 1BZQK 4P9HC 4PD4J 4ODSL 5IF0A 3T0EE 2IQAB 4JZJA 1MNUL 2XN9E 5D6DA 1XR8A 1U3HB 3O3BA 1QFWI 2AK1H 4JJ5B 5E2UL 4D94A 3TO4B 4MNGB 2PR4H 5CP7B 1EFQA 3CLFL 2IG2L 4KGJA 3O6FC 1RUML 1B4JL 4KZEL 5DLML 2ZUSA 3PIQB 3VXMA 4GRWF 1ZA3A 5CINL 1REIA 5CMAA 3O8XD 4EI5B 3PQYD 2XA8L 4L5FL 1PLGH 1U3JA 4LU5H 4U7KA 3O11B 4YDJA 1C12B 1QRNE 4PJAE 1XGYL 2Q87A 1UB6A 1MIEH 4PUBH 3GIVB 1S3KL 1A1NA 1G0YR 4KJWC 5A2JH 1A4KA 3P4MB 3EAKA 3G5YB 1CFNB 4GRWH 3CSBA 1QNZL 1IC1A 1D5IH 3WCYA 4F37K 2YRLA 4UBDD 4GAJL 2ESVA 1Z2KA 4NQCE 1UZ8A 4GS7B 1IGIL 3ALWA 4G6ML 1CDBA 3EFFA 5KANG 2EEDA 1UACL 2BHYA 5HGBA 1VGEH 4RCAA 3UC0H 5I1LB 4ZUTA 4IMKC 4KU1A 1QFWM 4X7FC 3ME0A 2QSVA 5E8NA 3P4NB 3GMQA 3GSNA 2GEEA 3JV6B 4N90D 1MHHA 5KVFL 4RA3A 3RWDA 4PJDB 1G7QA 2P5EA 4KHXL 5FYLD 2R8SL 1A2YB 3NA9H 4LLMA 3PL6A 5EUKB 3IFNH 1UJ3B 3QAZB 2UY6A 3FFDB 3FQNB 5AZ2H 4CUCA 2HFEB 4I3GA 3QFJB 5KG9A 3B9KB 4YHIB 2P48B 5M94B 3MJ6A 4ZPTA 2ADIA 1KPUA 4PGEA 3S36H 1ZTXH 5C0DA 1J7VR 2FX8H 5DD3L 5I73C 3PV7A 3SE9L 2WAHA 3EFDH 3WDJA 1WCBB 5IFJB 3MRNB 2YMXL 5L8KB 5CIPA 5KSBA 2O5XL 3D6GA 2FIKA 2DBJA 2CGRL 3FCTB 4PJXF 5BS0E 5F1SA 1J1OL 1KACB 3E2HC 3E3QC 1R3HB 4I3RH 4ZQKA 3OAYH 3FOLB 4Z7VE 4HFUH 1A7RH 5D70H 3TESA 3DIFB 5A16A 2WP3O 1EUTA 5IK3A 3HC4L 4JREB 5TQ0H 5EH1A 2EIZA 3QDGB 4NRYA 1TVHB 5SV3A 2AJSH 3PL6B 5EUKA 3MRLB 4X0KA 4EN3D 2RAMA 1J11A 1DQMH 1GGUA 3ZE0F 3CFKA 4HIJB 4PS4L 1W0WB 1QFPA 1FPTL 5DD0L 1IAIH 2P5WE 4WHTA 1TJHH 3S36X 5IW6A 1I7ZB 3J7HA 3H9YA 1OP3H 3V4UH 2P5EB 4J2XA 4PJEB 1QFWL 3H9HB 4M61A 1Y18A 4NDMA 4YGVB 4QF1B 3V6ZB 4W4NA 5KN5A 1RULL 3DRTA 3VA2C 3P3YA 4MA8L 5CS7A 4PY8J 3U7YL 1U8NB 5CD3B 4WO4C 1G7IB 5IW1B 1OGTA 1KCVH 2AW2A 2VB5A 4I2XE 3MLTA 3B9AA 1MQ8A 2A9NH 1QUNA 3IDYB 5JDSA 1KJ2H 1KPVA 4WHTB 5MHSD 4QRRA 4HWEH 1TQBB 4MD5B 1NEZB 4CN6A 4WVRA 1VDGA 1A4JA 3MXVL 5AG8A 3P9MA 3F7PC 3GBNH 4KJPD 5C0EA 3GSVA 1TENA 4H26A 4M6MH 5D6CB 1NPUA 1UJTA 3I3EA 4HZLB 4I48B 1LMKA 1NGPH 3DROA 5L6YH 3SCMB 1X7QA 1XF2B 4XNQB 3SDAA 3EHBD 2X4NB 1N6QL 1QQDA 4MQ7A 1LE5A 1U8KA 1TQCB 4Y5XB 4OCRH 1I8IA 1IE5A 1YEEH 4P23D 4R97B 5JHLH 5D7LE 3X17A 3P9MB 3QUXA 2W65B 3N1GC 3EO0A 5E95B 3C6LC 4ZMAT 4MA7L 1HOCB 3O3DA 3WBDA 1BIHA 2VAAB 1MELA 5TDNA 3P9LB 4LLVB 1ZT4A 3IETA 4BK5A 2BSRB 2IAMB 4NZDA 1IZKA 3KYOA 4RA0C 3TFKC 5I0ZA 4MAUL 4M1DL 5I71C 2NLJA 4TRPL 1KIPA 4XAKD 3LHPH 4QOKE 1QO3A 5E2TL 3MFFB 3VFVA 1KBGL 5FKAA 5KSUB 5F88B 4ZG1A 2QQQA 3G6AA 3S34L 4NCC1 4WU7A 5JW3L 1U8PA 3MGOB 3GSVB 5LKNA 2P1YA 2OJEB 5DT1H 1MFBH 3RU8H 5IR1A 4LLQB 1HE7A 3KYOB 1ZHNA 4N5EC 3WE6A 1A7OH 3PWUB 4PJCF 2X4OA 1JN6A 4XP4H 2P8PA 1PG7H 2IAMD 3TNNA 1EO8L 1A47A 4EVNA 4W6XB 5ILTH 3V5KA 1BREA 3UTQB 2OTWA 1I1YA 3TN0A 3UDWA 3ARPA 2FYYA 2FHBA 5L0QB 5GSRB 1MREH 1FAIL 4RFNB 1J8HD 5ERWA 3OJMB 4YFDB 4GLRI 2NNAB 1M6OA 5ACZB 2EDTA 4ODWA 4UV7H 4JRXA 5DJCB 3SDXA 1S7VA 1J0JA 1ZHNB 4WHCA 1KN2H 1DVFA 2AABH 4OSUL 5DJ0B 5DUML 3ZDZF 3QUMB 1BFVL 1RHHA 2J6EA 1YEKH 4UTAL 4FXKA 2QADD 3QDJA 1J8HA 5IVZA 4PJEF 4UDUA 4OZGF 3C6LA 4TSAH 1N7ML 2BOBB 2ARJQ 3BH8A 5T1KB 1KPRB 1QR1B 4NM8L 4M4PA 5JTWA 1GAFH 1ZLUK 3UTPE 2IFGA 5JPNA 4KDTA 5ERWB 4HK3N 3NH7L 4OZFH 2HTKD 2LU3A 4C57C 2WBJA 3V4PL 4U05A 4TOYH 3GRWA 2WV3A 1S9XB 2BY0A 3HC0A 3OZ9H 4Y4HC 2VXUH 3QQ9C 4XHJD 1SVCP 1RFDL 5EZJA 5JZ7D 1GGIH 4OIIL 1H5BC 2X1WL 4NM8H 1FRGH 3TYGH 2YBRB 1OSPH 5JXAH 4DVRL 1DBJH 2X5PA 3UAJD 4ISVA 1E27B 2Q86B 4MS8D 5AD0A 1DQJB 2N7AA 1C1EH 4AG4H 2XQYK 3UTTB 1H8SA 5FCSH 3SY0B 2YKLH 1LEGA 3KPMA 3FO0L 2W9EL 1MEXL 4BM7A 5H35A 4F7PA 1SBBA 5I1GH 1FL5B 3MACH 2YD6A 3ZHLA 4ZXBB 4GAGL 1HDMA 3VWJA 5I2IA 3L3HB 1VGKA 3TN0D 6CGTA 1AJ7L 2D03H 1DLFL 3SKOB 1D5MB 4N0CD 4PY7B 4OZIE 1TNNA 3QIWD 2RBLA 3MRMB 4H25A 2EKSA 1D3CA 2DYPD 4XCFL 1C1EL 4AG4L 2VN7A 1FNFA 3KPRA 1MOEA 3QIWC 2BSTB 2NY0C 3O6KL 4DFHA 1QRKA 2QHRH 4DGVH 4XVUC 4JY6A 3FN0L 4GKSA 1T0MA 3DECA 3H3KA 3LN5A 4JFXA 4OM1L 5TDOA 1TETH 2EO1A 1S7XA 2JLLA 1MCLA 5LXGL 1GGIL 1HWHB 4OIIH 2RCSL 3TFKD 2LTQC 5CJOH 1N6VA 1IJ9A 4PTUA 4Y4KC 3WLWC 4M8VA 1YNLH 4D9QD 4QHMA 2X4TA 3PWNA 3BH9B 1FVEB 2VXSL 1T20B 1CWVA 5DJXA 1DQJA 3U1SH 4XCFH 3WNKA 1NAMA 4G8GD 4EXPX 4QNPF 2C3VB 3HAEG 5GRWA 2AQ1A 3S9DB 3QO0B 1JYNA 1RU9L 4RAHA 2NY2D 4NIKB 2GY7B 2WUCH 1YEGH 3G6DL 4NZTL 2E7HA 1Z5LA 4ZNCD 3ES6A 3UZQA 3IDJB 5FYKH 2HTKC 4HMEA 3U9UA 4WNQA 4OCWL 4NO0B 4RAVA 4L3CA 1T83C 1DZBA 4QY8B 3EBAA 4NCC2 5BO1H 4IRSB 2Y5TB 2HLAA 3DYOA 3BFOA 5I16A 1FL5A 3UEZA 3O2DH 2A6KB 4UMGA 3MV7E 1OW0C 2PKDA 3O6FD 4ORGB 4EKXA 3T2OA 4BSWA 3HZKB 5I1JH 4L4TD 4WCYL 3VCLB 2FECI 2AXFA 3VD5A 1CGTA 1GPOL 4NJ9L 1EX0A 5CZVL 2X4SB 4QRPD 1ZA6A 2GSIA 3DO3A 1DE4A 4Y16C 1J86A 3L5JA 5C07A 3PJSA 1M7DA 3FB6A 2QHRL 4DGVL 2NY6B 3VFTA 2Q6WB 2VITB 4FXGA 1CGUA 3FO1B 2UZIH 1SEBB 1ZAGA 1L7IL 4X6CB 4WV1A 1VACB 1FJ1B 1M7XA 2GJJA 3Q3GB 2D3VA 2GJ6A 2FO1A 1N5YL 4JPIB 2AJUH 4XMKL 1T03H 4G8GE 2LQRA 2XPGB 5K9KA 3DETD 1N64H 5J3HC 1LO3L 3SGKA 5F21B 1FE8L 4PRIE 4ETQB 5DDHB 4YHZL 4XNYL 2K1MA 1JGEA 3BPOC 5DK0B 2WUCL 5DS8A 4PBVC 3ZKSD 3OR6B 1AQDB 1DN2A 2CH8A 5JXEA 3VFPA 3U9UB 4YIQA 4HH8A 3QIBD 4MVBC 2VYRE 5I74C 4FQIH 1WTGT 3VDAA 2VXUL 4Z7WF 4FZEH 1PG7W 3WHE0 2ESVD 3CVIL 2PYFB 4XP6H 1K4DA 4MD0B 2C5DC 1PSKH 1JK8B 1HHHA 4TULH 4UNTA 2I5YH 3TPUA 1YJDL 4LFHG 3RUGA 1U95A 1IEHA 3Q1SL 4QO1A 1KCSH 1P7QA 4WWKD 2Z31B 4JFDD 3X3FH 3QDJE 4M9PA 4ZOAA 3O6KH 1N8ZA 1S5IH 5E8DH 4KDWA 4I18C 2V2TB 5FECA 1MUJB 4MJ5A 3SGEI 5HHXL 3BOVA 1JCKA 4JRXE 3PWPA 2EDJA 3JBG7 1VESA 4J4PA 4V1DD 1HNGA 5IVXF 1A6PA 1KIUA 4OD1L 5HDBE 5F7KC 3TNMA 1L9NA 1XF4A 4Z95H 2FIKB 3NOIA 3T0EC 4FQXC 2I9LA 5EU5A 1NCBH 2BNRD 4HUVB 2VLLA 4JVUA 2OP4L 1MHPL 3NMEA 4L9LC 1NLDH 2NZ9C 3MLUH 4M48L 3VJ6A 2R56L 3QZWG 5L2JA 5F3BA 5JR1L 1I4FA 4P4KB 4P2OB 2CRZA 1G6RH 3U9PL 1AQKH 4GW5A 1HHHB 1FFOA 2AV7A 4ZAKC 4OQTA 2WK2A 4WY7H 3EOAB 1G0DA 4UNVA 4MQXC 4Z18A 1A7NH 4WFGD 3ULVF 4J1UB 3D5OF 1P5VA 5BZWB 4Z7WE 3CFKB 4LSQL 2WMPA 3O3BB 4YLQT 5CD5D 2OR9H 7FABL 2FX7L 4NNPH 2DDQL 5CSZA 1XH3A 4XBEH 4AEIL 4HLZG 4L9LA 3V2AR 2OJZL 3L95A 5BVJA 5ITBH 2VDRL 5HDLA 1MRCL 3ECBA 4PG9B 3MODH 3WJJA 2DBLL 3T77B 1ADQL 4YDIH 1G9ML 3W5NA 1L0QA 1K4CB 4HUUB 2IH1A 2HFFB 5J7CC 4EUPG 1Q9OA 5GGTA 3QDMB 3B83A 1I1AB 4BJLA 3BIAX 4K71C 1JP5A 3QFDB 4IDJL 2AXGA 4XXCA 3ZKMD 3PHOA 1SJVA 4PTTA 3MV8E 1QSFD 3H7BA 3WFDL 1WCBA 4K3JH 4HIIB 1I7RB 4R8WL 3OX8B 1MCRA 5EU3A 2XZQH 4HEPG 3HLAA 3RDTB 2AV7B 5DFTA 3SDCA 2H8PB 2PYED 4RQQB 3IJHB 1RIVL 2GW5A 1QA9A 4LKCA 3U30C 1OP5H 3LAFA 5C07E 2X1QA 3GMLB 4JLRB 3FFCE 1ULVA 4LCUA 1DQQA 1QQDB 4X99A 4BA8A 3NAAL 3O2WH 2NCMA 3WS3A 4XMPL 3T0WA 1QBLH 3IDXL 5EOCL 2UWEA 1EAPB 3TVMD 4M93C 3C60C 3UTZB 2J8UA 5CZKA 1MIEL 4KRLB 5CUSL 5EO0B 4GMTL 4MMXC 4HAGA 5SWQB 2XQBL 1XGTB 2JKXA 4WTZG 1NSNH 4PJHA 3W39A 2VL5A 3U4AA 2Z8SA 1VFAA 4XRCA 3ZE2F 3RIFF 3IFLH 1UWGL 5J6HA 1JRHH 3ARBB 3C09B 4KZEH 3BZ4A 3V6OE 2GUOA 4PJ5B 1V3KA 1DR9A 35C8L 4Y5YC 3VRJB 5SWZA 5H94A 3PWLB 4ZAKA 4NPYA 4ORZC 2CLVB 2V5TA 1WGOA 2HT3D 2W0PA 1NCWL 2OL3A 5D5MB 2VLJD 5D70L 1YPZF 2IPKA 1EO5A 3BAEL 5J1AA 5CGTA 4LLYB 1J05A 2CKBH 4YX2L 4HULB 1DQLH 1I1AC 1OF2A 3QG6B 1BQHA 1F42A 4NQDB 1NANH 3I6GA 1WICA 4DCQB 3V5DB 4LKXA 4ZUVA 1AR1C 1AGEB 3SKMA 1T1ZA 1Q0XL 3PNWB