3F64A

F17a-g lectin domain with bound glcnac(beta1-o)paranitrophenyl ligand
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
175
structure length
168
Chain Sequence
b'AVSFIGSTENDVGPSLGSYSRPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSSARYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17a-G
molecule tags Sugar binding protein
source organism Escherichia coli
publication title Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia coli
doi rcsb
total genus 45
structure length 168
sequence length 175
ec nomenclature
pdb deposition date 2008-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 3f64A00
1O9ZA 2BSBA 3F64A 1OIOA 1ZK5A 1O9WA 2BS8A 1O9VA 4K0OA 2BSCA 3FFOA 2BS71 1ZPLA 3F6JA
chains in the Genus database with same CATH superfamily
5EORH 5I19L 3PWLB 3REVB 1LVEA 4WEMB 1VFUA 2GTQA 4LOUD 4UT9L 4F5CE 3NCWA 3LX9A 3QO1B 3C60D 3J8F7 3A24A 1NFAA 4PJIB 4WK2B 1LGVA 1LYQA 2VAAB 1Q0YL 2J88H 12E8H 2XKUA 3X1BA 4OZHA 5LCVA 2XPGA 5EOTA 1HZLA 1JXJA 4FX5A 1B6UA 5CD5D 1FFRA 4JO3L 4NZ8A 3WO4C 5IIEB 4DFHA 2VSDA 5MEQB 5J6GA 1E6JH 2A6DB 5J1AB 3ULVE 4LPTA 3L9YA 4H20H 4OCRL 2DJUA 4JAMA 4ZMTA 3V5KB 2ILLA 1X4YA 1KB9K 1HI6A 4ZMVA 4XN7A 1W16A 2XXGA 3AAZA 3MROB 1IM3D 2H2PD 4HKXA 1UASA 4XN9A 5AOKA 1FNLA 1PJWA 3TCLA 3HNSH 1WAAF 3KD4A 1M42A 1SJHB 2DN7A 3P11L 4PV1C 3RDTD 4AUUA 1M7IB 4AV4A 3T08A 5IQOA 3NMEA 2BJML 1XF4A 1BOGB 1JVOA 2X1PA 3BKYH 3ENEA 2DY2A 5F70A 4ADJA 2QQLL 3O0RL 1QEWB 4ZZFA 2B3IA 1UKTA 4XOBA 4KKBD 1W15A 2F1EA 2PPAA 4Q8BA 4E42A 2WWNA 2R0KH 1BOYA 3KPSD 5DFTA 1S7VB 1TJIH 3O81A 3AT8A 4OLXL 4JFDE 3X3FH 3KDMB 4PMFA 5GJTL 4E9RA 4E41E 1YNKL 2ZCLH 4M5ZL 5BZDB 4IRZL 2RCSL 4Y4KA 1SOKA 2HFTA 4P5TB 4ELME 2AQSA 1UD6A 2DIBA 5D1ZC 1AGCA 5MENA 3L3KA 2XXFA 3OB0K 4UT9H 1MI5A 5FA4A 4LHUA 4X6CB 3IXTA 4AQ1C 3HG4A 4PR5B 4D2NA 2AJUL 1IGFH 2WXLA 4EBQL 4PJCF 2HFGH 5F9AC 4Z7OF 5DT1H 3BH9B 1CYWA 2YLHA 4JO3H 4QWWC 2ZUUA 1KTRL 4QHKJ 3JTTA 5H37H 4L8SB 1HH9A 4DW2L 1M9WA 4H20L 4OCRH 5F44A 4WU7A 3HZYA 3OXSA 1JI2A 2OTWA 4XBEL 3P0GB 5L0QC 3LEVL 4YXHL 2CHXA 1OGTB 2A6KA 3WHXA 5CJ5A 3M8OH 3QFGA 4XRCA 5KUMA 2HPTA 5C0CE 3F7KA 3RURA 2X53A 3PJNA 5F2FA 1K5WA 2HT4D 2HX9A 3UTPD 3N1PC 5L2KB 1PCSA 1Z5LB 3GBNL 5L6YH 4YR6B 1AHWC 4MD5A 3KYMB 5E70A 1KJMB 4IGBB 3T8XA 1TQUA 5B3NA 2VRQA 4V2CB 2P5EA 4B9KC 4NSKA 3ZDYB 2R29A 1T83A 1OZTG 2OTPA 5K9JH 2OMUA 1O7SA 5L2JB 4N2AA 1A22B 4L2YA 4OIAA 1C7SA 1P5UA 2L7QA 2RCSH 3QXDA 5AYUH 3VGGA 5GGRB 4WI9A 5KAQG 1UG9A 3T1WA 4Z78B 3UO1H 3V8CA 2HMID 1FNAA 1SN5A 4GKOA 4Y2OA 3LZRA 4TV3A 1A7RL 3EYUH 3VXRE 3LAFA 2C1PB 4V1DA 1KJ2A 3VRJA 1KTLA 1WUZA 4HFWA 5AW9B 4P46B 3ARSA 1S7RB 4PJFB 4KAQH 4L1TA 3VXMB 1V3KA 1FGNL 1BG1A 3RA7H 2VLRA 3W81A 5SV3A 3UC0L 1UWGL 1UKQA 4P5TA 3O6FA 4E68A 3RVWD 5FHAH 1T0OA 1HT6A 2K78A 4OCMC 3S97C 3QQXA 2QLYA 2EYTA 4J4PA 4L9LB 3ARBB 4LCCB 1S9KC 1DEDA 3N9GH 2V6HA 1D6VH 1KCKA 3ZDZF 3MJ9H 1CDBA 3SD5A 4G8IB 3LEVH 3X13B 1CFQA 3MRRA 4YXHH 4I9WD 3S3JA 2FBJL 1R0AH 1LO0L 4X80H 1I8UA 3PHQA 3DIFB 1I7UA 4RBPK 3IRPX 5EDSA 3I02B 2Q76A 2H2PC 1ROWA 2GKIA 4WEBL 1JDAA 2W07A 5F8QC 3N1GC 4XXDA 4JFHE 2WLIB 3BCDA 3D7PA 3DROB 3HZKA 5TGBB 4A7GF 4M62H 3DLQR 2JQZA 5A16A 4KJPC 1FFNA 1BQSA 4OLUL 4TRPL 1W9XA 4H1LG 5K9JL 3KXFB 1AZNA 2CDGB 3WJLA 1H8LA 4KKAC 1S9YB 5L2KA 3ARDA 1K4DB 1JPST 1S7WA 1AVAA 4OZ4B 2G5UA 5KEZA 4XRCB 2BOCB 2CO6A 2PXYC 1ORSA 3IPBA 3PL6A 1RUAL 4Y4FC 2PYFA 1UXMA 1ZT7B 3DSNA 3EZJB 2X4QB 3TT1H 5ICZA 4ODVL 2WSPA 5JA9A 1JWUA 4R4NC 3GSXA 3MCKB 4TPRH 5E4OA 4DKDC 4ENEC 4X6DE 1B0WA 1RZIA 4G9FE 1AR2A 3TZVD 5E6SB 3NABL 4XZUA 3CFEA 4OGZA 4JM2C 3FCSA 2Q7AA 4W9FC 3KW8A 4MJIE 5JOEA 5LHDA 1UTDA 1ZLWH 3O4OC 4LHUB 4S2SA 1OP3K 2EVIA 4IU3B 2B0SH 3I6LD 1Z9SA 3LV3B 1R0AL 1BPVA 4YSRA 1ZXKA 4FG4A 1O5DT 2Y7MA 2CIIB 1MJ8H 2Z9TA 1F18A 2YHGA 1JF1A 1MHCB 5I0DA 5TE7L 2NY6D 3KS0H 4I5BB 2HT4C 3EOBA 5HYJE 1U58B 2IBBA 3MXWL 3Q5OA 1E3ZA 3IS1X 3GMOB 5DRNA 3C6EA 4JW3A 4ICWA 3IDNB 4AQ1A 2RAMA 4JRLA 3CFNA 1MCJA 3C60B 4AY0A 3HMXH 2QMKA 3BKCH 3MRPA 3RIFF 3F85A 4UYQA 1WWBX 5AB9A 3NIFB 4ZPTB 3UCQA 4FXGC 1BYOA 4JNXA 3NN8A 5CEZL 2BFVH 3ZBMA 2HSIA 2YD0A 4PEEA 5I16A 1SDYA 1RHHB 2ZOUA 1CICD 5DURD 3L7EA 4P5KA 1OPOA 2BNUB 4FP8H 35C8H 3VFWB 1F56A 4GPVA 1SVBA 1X9QA 2AQQA 2XTJB 1ORQB 3EO1A 3KLHD 4ODVH 3T4YA 1QX1A 2BOLA 2FJUB 4ZK8A 2X9ZA 3MLUH 2X09A 2VXQL 5I8KL 3FF7A 4M6MH 5IWLC 5DJ8B 5E1AA 3ZUNC 1OCRB 2I9TA 3QG7L 4OUUA 2Y24A 1QACA 1CFSA 2BY3A 3MODL 4NQXA 1TEYA 4B6ZA 3T0EA 1PZDA 4QCIA 2BSRB 2CPCA 2DMKA 4PJAF 3VFSA 1FAIL 3WS3A 3F2LA 3IGFA 3WDHA 5J13C 2X2IA 3KE0A 2EIZB 1I8LA 3IS0X 4LLAA 4LLVB 1V7NL 2IDUA 1A6VH 5F7HA 3NFPA 1K3ZA 4O9HL 3VG0L 2MPVA 3CZLA 4XPAL 1KG0B 3VFMA 5HJBA 3EYQC 4KUCD 2ZX5A 3CTTA 4KTGA 4RESB 1XVSA 2CUHA 5L8KB 4DP5X 1L9OA 1A9EA 1AIZA 1JI1A 3QNZB 3QGVA 2YPVH 2EAEA 2JWYA 1A7NH 4FFZH 2VISA 3ESMA 4OD3H 5JOPD 5JHAA 4E41D 5MEOA 3HN3A 4P5SA 1AOHA 3HBGA 5D2LE 5CEZH 3CZFA 4GP4B 4JDVA 4JKMA 4KNUA 5F7NC 1PAMA 1RZQA 4KXBA 4C8XA 3WD5H 2KZ1B 3OTTA 3IGAA 3SCMB 4PTUB 4ERSH 2GTWA 2G5BA 1IVLA 3RY6A 3FONB 4L4VA 4PGEB 3FQTB 3TX4A 1MHEB 1YMHB 4HJIA 4XO9A 5JHLA 3BP4B 1MJ7H 1PG7L 4XN2A 1UB6A 2N3JA 2OPCA 4PG2C 3GKWL 5T3ZL 4FQJH 3EFFB 3FCSB 3R0NA 5BVJA 2EEAA 2BHZA 1JF5A 3QUMA 4NZUH 1L5GB 3MODH 4NCC1 1SDAB 1P1ZA 3QORC 3MJGX 1TZGL 5D7LD 5DFVD 1ZGLP 1PLAA 5B21A 4HPHA 1V54B 2VR9A 2YLKA 1JZFA 5I6LA 4JKPL 2WXIA 1SXCA 1A6VL 4PJ9D 2NZ1A 5CJQH 3OKOA 4XPAH 4CVWA 3WTXA 4HSQA 4LARH 1AKJD 2QKIB 1FG9C 3MTRA 2L04A 2CO1A 5E8NA 4XHJC 3IJYA 4ONGL 2Z3FA 4PLNC 2BSTB 3QXVA 2HXAA 1BVOA 1CXHA 5GGVY 1N64H 4GW4B 4I4WA 1SBBA 2YEQA 5SX4I 4AYSA 4JFEA 2PPFA 4IRJB 3A4EA 1NGXB 1NBZA 2EIKB 1A7NL 4OD3L 3RAJH 2CRMA 3RTQC 3J7HA 3N3EA 2UXGA 5DJYB 1MAJA 3LZPA 1BVNT 2HFFB 4OUOA 2DLGA 4QXWA 4NOFA 1HEZB 1IGJB 3CHPA 3LYRA 5DVLA 4RFNC 4D94A 3SOBL 1KMGA 1YUHB 3QIUD 4NQEA 5ADOH 2BP5M 3DPBA 5C9JB 3QUZA 3TURA 3NCXA 2WLIA 3HZKB 2QPFA 5TGBA 4HISA 4DO6A 5D5MB 2D31B 4AMWA 4NC1C 3RZCD 3CCHB 1K2DB 2ITCB 1LWRA 4G6FB 2X6AA 3FKUS 4BZ1L 1PG7H 1BM7A 4KZEL 1W72L 1W8NA 3V52H 1U3HD 1UXLA 1IGCL 1OB1A 2ICWB 3IKKA 3NQIA 2IWKA 4J6RL 2CXGA 4NZUL 3GGWA 2OCFD 2P80D 2BIIA 3BI9X 4ZMXA 4QWWD 3BH4A 3BWAB 1DN2A 1QSFA 4LCYA 4DEWA 1HXYA 3NSXA 4BIKA 5DFAA 4JKPH 4QXGL 4U49A 4AIZB 3HEIB 4JRWA 4LSVL 1CF8H 4PJFA 5HI4D 5IM7A 4NX0A 4GKNA 1UZ6E 3D4ZA 1FNEB 1A7PH 1PY0A 2EDTA 3OAZH 3WKMH 1UOLA 3V0JA 2LHAA 2Z64C 4G6MH 1ZVSA 3AS0A 3BUPA 4DGUA 3U4EA 3PIQB 5HBBA 4FQ1H 1N64L 3BC9A 2C7FA 3BVNA 4MMXC 3QR2A 1MFVA 4N9OB 3VWJA 4Y4FA 4KJQC 4MA1C 4DOHB 1U21A 2D0FA 1JVKA 1H15B 2DM7A 1XEUA 1RUKL 4XP4H 3DX4A 2IH1B 2UY7A 1MOEA 3QB7C 5EA0H 1CZ8H 1F6AB 3D6GA 3WJJC 3HR5B 3GPEA 3LVTA 4P46A 3SOBH 1AANA 2WJ5A 3QJTB 4OJCA 2FT7A 1OB1B 4P5TD 3WJLC 1XCTA 1HNFA 2XZAL 5C09D 1NCAH 3RJDA 3X3GL 3QUYB 3B2UD 2M83A 3NJGA 5DU7A 4YIQB 1L9NA 5DQJA 4V1DD 2OMTA 4UNVA 2IANE 3DIVA 3RX5A 4BZ1H 4ZNEE 1IT9H 4Y19D 3PP4H 2NYYD 4H8PA 1W72H 2NY5C 3DJTA 4B27A 5FYKL 2DQHL 5SWSD 3V52L 4QNPE 2VQ1A 3KPQB 2E8ZA 2IWFA 5CP7A 1MPAH 3IF1B 1IQWL 3RKDC 3QPXL 3O11B 5J1TC 1HZHH 2GJ6E 2OMTB 1HK6A 2B5IC 1G1YA 3Q3GB 3RY5A 1IKNC 4GRLA 4OZFB 4X98B 4IGBC 4YX2L 1JXDA 4LP5A 5FUOL 4Y1AE 1TTFA 3ZDXF 2P9RA 5J9PB 4R8WL 2D3VA 2BSTA 2XJLA 1F6AA 2RMNA 1FL5A 3CXHJ 4LK4A 1JD9A 1FVCB 1ZSHA 3LQAC 1Z6JT 3U4AA 3QXTA 2ADGB 4N20A 4OZFH 5AUMA 1Z9OA 3TFBA 1Q90A 3LOWA 4PBVC 4R84A 2ZXQA 1WBXB 3BSZL 1FE8H 4X8GA 1ZV9A 2R59A 2IH9A 3HLAA 1TENA 2F54E 4WGVB 1UXWB 5ECGA 4P4RB 3IFLH 1AO7E 5FYKD 3X3GH 4WWNA 2APXA 4ICXA 3OMAB 3I75B 2YXMA 5T1DL 5IJKC 4V2BA 3TEXA 3V4LA 1I7RA 2V8MA 4X4ZA 4PGBB 2X6UA 3EAKA 2EUXA 3Q2NA 3WY2A 1QQDB 4H0GA 4KH9A 1NZRA 1Q9OB 4GAJH 5AAWA 1IQWH 1QATA 1WFNA 3MV7A 2ICWI 3CZFB 4JDVB 4MXWH 5D93C 5C2BL 4R3SA 5FO8B 2PTTB 3QEGH 1N10A 4J1UB 4MJ6B 3MLSL 5KYWA 3BUBA 1YC7A 2ESVA 2WQVA 2FNWA 4WWKA 4L4TD 1AYRA 4PB0L 5F0LB 3TNNB 2UY6A 3B9AA 3FT2B 1WUNT 1XGPB 4QAWA 5GRUH 3T04D 5D71H 2AZAA 2XFGB 1F6LL 3RLSA 3PGCB 1BA9A 1ICTA 2E56A 2NQDA 1MN4A 1NCCL 2A83B 4LEXL 2CO4A 4PJ5E 1T1XA 4N24A 5D7KE 3O8XC 4KK9C 4ZTPL 2G9HB 2RQEA 3BAIA 5ETUB 2F53A 5I1GL 2FEJA 4F2ME 3EG9B 1SJMA 4B9ZA 3T1FB 3SKMA 1X9RA 2EDHA 1B0GB 4NHUB 5JOPE 2DQJL 1S5IH 1CVSC 2YPVA 5DS1A 5E2JA 4MXQD 3LB6D 3MR9B 4M9PA 3WNJA 3MRFA 3VO0A 3PABB 2F7RA 2JJSA 3UL4A 5DDHB 1DO6A 4QHUA 3QJQB 2YXWA 3PREA 2NNAA 4KY1H 4X0KB 4XXWA 3SQOL 4TL5A 4Q56A 2EXSA 4FQ2L 1FZKA 2AXHA 1JRHI 3JWOL 1FA4A 1E8WA 5I6OA 3DX7A 3K6SB 5D6CB 4UINH 5E9DE 3UH8A 2XG4A 4ILDA 5PAZA 1P9MA 3HB3D 2I5YH 5EO9B 2W88A 3DO7A 4J2XA 3M1BB 2VDQH 5JHDA 5C2BH 1CD1B 4MNHB 3EIFA 4HXBH 3PQYB 5KANI 3E6HB 4ZXBB 4DH2A 2DS4A 1NDTA 3GC3A 5C0CD 1QI5A 1T4KA 1QWHA 4XCEA 2B1HH 1IL1A 4QKTA 1YECH 1JV5B 5INCA 3CN0A 2IALB 1X7QB 5HHXH 3V6ZA 1KGCD 1NJ9B 2EDJA 2GSIB 4QHKI 1U3HC 2ERJB 4HUWB 2L8AA 1N9PA 1YRKA 1T89A 3FUFA 5DC4B 1OE3A 5CBAA 3CVIL 3LNGA 4I5BA 4X9IA 1IKFH 5CHNB 3H56A 5CU5A 4DO5A 3VNZA 4JANA 4QRUB 1YC8A 1MCKA 1S5IL 3K4DA 3EGXB 3H54A 3OAUH 3OL2A 4Y1TA 3I6KB 3CQQA 3HAEA 1PZAA 3K7UA 1V3JA 3FCUB 4R7DA 5IUCA 2HCZX 4S2SB 4XBPA 1YPZB 2W65A 2TRHA 3D2UB 3K1KC 4GOSA 3KGTA 4F1SA 2WVSA 5ACZB 5BVPH 1DJWA 2YXVA 3B1TA 4XC1L 5A6LA 5J6GB 1R3HA 2KMWA 1KWKA 3QWQB 3OLDA 3CVDA 4FE9A 4N85A 1AO7A 3QRGH 4EQ3A 2WLJA 3QZLA 4AYFA 4RX4D 1ND0A 5HHVH 4NP9A 5HI3C 1HNYA 1HSBB 4CGUB 1JPGA 1HX0A 4PJIA 4HEMA 3NJXA 5DJAB 3TVMB 3MRBA 2Y6SC 3IKCB 4LCIL 5D7JB 1YEEL 3I9AA 4Q9QL 1PNDA 1CE6A 2AJ3A 2BNQB 1KFGA 3BVVA 1SVZA 4BUQA 5A6MA 3KHQA 4FZEL 2EC9T 2WC7A 4R4BB 4P5KB 1AI1L 2YAPA 3PPSA 5IQ9B 4XCYB 1PS3A 4Q89A 4U7KA 4Z3TA 1NUNB 2FWLB 3H9ZA 3SSGA 1RJYA 2ED8A 5B7FA 3FQUB 5JIQA 4JLRB 4MDIA 4XPHH 4DOHE 2P8LB 1GJIA 4KQ3L 3LZFL 2G75A 2EYSA 2OYKA 3KPOB 5G5DA 1NDGB 2EVJA 5KYWB 3ECBB 3MV9A 2HTLD 2ZKYA 3F05A 4FHBD 1FUNA 5LGYA 3ULUC 1F3RB 4PJEE 4IS6B 3C8DA 5PCYA 1DBBL 1SYSB 2XBTA 5GS0C 1I1YB 2P5WB 1MCIA 4HJTA 2IGFH 3SJVB 4JKNA 2IALA 2ICWJ 4JFQB 2XT1B 4LGRB 1QEXA 5BVPL 1OT1A 3UJTL 1T0MB 1MY5A 1Q9LA 4P2RB 5DVNA 1B9ZA 2DWXA 3GTVA 5C0DA 5TF0A 3Q2VA 3DHPA 3VXMA 3IDUA 3SDDA 4HUXB 1E5YA 4NZFA 5B4MC 2FX7H 4A2DA 1YEGH 2UUDK 3APFA 1DVXA 3ARPA 1YYCA 3O6LH 1F4YL 1OLZA 4JJ5B 3HVDA 1VZGA 2YA1A 4MJ2A 5LBSA 4UQ9A 3TO4D 3QCUH 2A7BA 1I1FA 5CEZD 4Q9QH 4WKZB 2HRPL 2VO8A 3FT9A 5E5LA 5E6UB 4E2OA 5FCUL 1HAWA 4OLWH 4CMHB 2BMKA 2HFEB 3SGDH 1DR9A 3C5SA 4NBZB 1E28B 3PL6B 4OF3A 1FAKT 5SWSE 2ODHA 5CEXB 5HI4C 4OI8A 4P9HH 1CLVA 4NHUA 1J5IA 2ADJB 3IDGA 5DVOA 3T6XA 3OXRA 4CJ1A 1OTUD 3RTQA 1MLCB 4GRLB 1M6UA 4OZFA 4X98A 4XTRD 5C0BB 2AITA 3KVPA 4YN3A 3U1SL 4MJ5B 2OTWB 1E43A 3K8KA 4AITA 3FQ2A 1QHPA 1FZJB 3KYKH 3RVXC 3RVTD 4RGNE 2A4CA 3BLPX 1TJXA 3ZE2F 4KH2A 2WB7A 2FIKB 5C0CA 4NN7B 4WNQB 1AHMA 1O7DC 1WHOA 3JWOC 4ZO6A 3U4EB 1PGRB 1I85A 4PQXA 1TLKA 4AIOA 1T1ZA 4QF1A 1U91A 1ZDQA 1IBHA 1TMQA 1IU1A 2FYVA 3HNTL 5LBSL 1C08A 4DKTA 1NCDL 4CMHC 1DEEB 3P30L 4YFLF 5A7EA 2LU4A 3FN3A 3LRHA 3QCUL 5ICXA 3CAFA 4ELMB 3HI1B 5HYQA 5C0FA 3WIHA 3GGWB 2YIHA 4RGNC 4XP6H 5J89A 5ABAA 2VSKB 2X70A 4GO6B 1B0RA 4PYGA 1W0VA 2PW2A 3WUWG 2GCYA 4YJZL 4OT1H 3MLRH 4HXAL 2ZKMX 2ZG2A 3CLWA 3AY2A 4Z78A 1LMIA 3DC0A 3EYVB 2XYCA 3KLAA 4RRPG 4JFFE 1TUPA 1E8ZA 3FO0L 4NO0A 4P9HL 3UAAA 2WXFA 3ZYIA 2JELH 5IKCA 2Z91B 1AY1H 5FS5A 2QADB 1N6VA 4HMCA 5DRXB 2JQMA 4HEPG 3TCLB 3N44B 1VCBC 3WNPA 1GH7A 4PYHA 4DKFH 4PVBA 5E03A 3VRIA 3IMWA 4XPTL 2KBGA 3RIAK 1KIPA 1BPLB 1FBIL 2VR6A 1A3QA 2PW1A 2A6DA 2Z31C 4NO5B 3E9TA 3O3DA 3CFJB 3P54A 4UT6L 1RJZB 2Y2TA 5CSBA 4LQ1A 3QIWB 1IGMH 1XD1A 2XN9B 3CLFL 4LLQB 4AYBA 4KXAA 4A7QA 3UMNA 5I1HH 5EUKA 1U8CA 1NC2D 4IBQA 3QQDA 2Z7ZA 5E9DD 5EZJA 5CSGA 1FRGH 2C9SA 4OCSH 1J8HD 1W2KT 2D8KA 2HUHA 3S9DB 4LLWA 5L2KE 1NCDH 2DICA 2H41A 3P30H 4ZMPA 5C7XH 3LXCA 4Q2ZB 1E7VA 2ZJSL 4UU9B 3L3IA 2CO3A 5C0JA 1I3VA 3EYVA 3UX9B 1A2YB 3P4NA 3ETTA 4RRPM 1DUZB 3LNHA 2YGOA 3RG1C 2R15A 2XTJE 5IG7A 4GUPA 3SOTA 4P2AA 1P5VB 3FMGL 3ZO0A 3II1A 1E42A 1HL5A 5T1LD 5CAYB 1T21B 4OT1L 5EOCJ 4Q0XH 4BJLA 3L6FA 4KDVA 4X6CF 4FG6D 2AEWA 1XB8A 2ZXCA 3P3YA 4QRRE 4S1DC 5DRZA 4LNRB 4HEME 4MQSB 5D1ZD 2XA3A 4F7PB 4X0NA 3POCA 4M93B 1L3NA 4YO0B 3FU5A 4AMXA 4NQCE 2VXUH 4APXB 1LE5B 1FL6B 1M71A 1TJHH 2P24A 4QY8B 4DKFL 5ESQB 1HAUA 1F11A 1MCHA 4U1LB 1KCSH 4XPTH 4OLZH 1P1ZB 1RIUL 2FHFA 3QJRB 2DJMA 4Y1SA 2NUTA 4NAJA 3S5LA 1SOQA 4UI2A 2R0WL 2ZP8A 3FHQA 3V4PB 3DOIA 3JYCA 4AC2A 3HI6H 3R4RA 4LOEA 2J12B 4GFTB 4HP5A 5I1HL 3S8GB 3FRPG 1AGDA 4DN4H 2L0DA 2JVUA 5HDLA 3MNWA 4TVPH 1I9IL 3TV8A 3IFNH 3R4DA 4S0TD 5DEGB 1MFAL 3NFPB 1E4WH 1RZKC 5J4MA 3UBHA 1J86A 3TIEA 3BESR 3H4HA 3O6KL 5EZIH 1HEHC 3OC8A 2IEPA 1QYGH 4GYBA 1H8NA 2ZNXA 4G8GE 4HIEB 4QRPD 1CIDA 4NQEB 4L37A 1AO7B 4MHHG 2W9EL 3WAKA 2WTRA 3NPSB 3VE0A 3C8KB 3OSKA 4G8GD 2R83A 3TNMB 2J71A 4ISVB 1RY7B 5DEZA 4G72B 5T1JA 4BFGA 2FEDC 2DTML 2E7LC 1NCBL 4BSVB 1CT8A 1UJTA 4GT7A 2HKAA 4NQDE 3WNMA 5IHLB 1UOWA 3ARDC 1U4FA 4JFEB 4LHJB 3MBXH 3PGFH 1TJHL 3C12A 4L2LA 5HYJB 2OSYA 3FU8A 5F1NB 3N50A 3PV7A 3CX2A 4EPSA 2BSRA 3MMEA 5D1QD 4D9QD 4WWKC 2QVFB 4GAGH 1LK3L 3S37L 1E5CA 3OD3A 3CXFA 3ZX1A 3QZNA 3ATBA 2FGWH 1BX2B 3MRMA 1E4JA 5IV2A 1LEIB 1ML0A 3HG1D 4Y19A 4RMWA 3BXNB 1L7IH 3L1EA 2JKRM 3LKOA 3O4OB 4U4IA 3T2QA 3GB7A 1MIEH 2ZKXA 2IAND 3O3AB 4LPCA 3MA9H 5IJBC 3DTDA 1FYTB 4W70A 4DNLA 3JQOB 3MV8A 1D7BA 1I7RB 2NXZC 1IEBA 4GFXA 5CCKH 3CDYA 1P7KB 2PR4H 3VFVA 4BYHA 1BF5A 2BSSA 1GL4B 4PJEB 2PXYA 3FXIC 1KJVB 2CU9A 2XVBA 2VUOA 1BBDL 3B9VA 3DO7B 1TG8A 2BDNL 3V4PA 4U6YB 1VEMA 3BN3B 2XV3A 3CNKA 4JJHA 5GZNA 5J06A 4JY5L 3RUGA 4FFWD 1U4EA 1IAIL 1KEMH 3BAWA 3KWWB 1E7UA 1QFWI 1BQLL 1U8KA 3L3HA 3U46B 3V5DA 5I30L 3NA9L 1N26A 4UDUB 2VM9A 3UJJH 3VFNB 1TXKA 1MRCL 3SHSA 4W9EC 3ARRA 2GK2A 4F7PA 1NCBH 1HSBA 2ZTBA 3V4VA 5AZUA 4CBZA 5E8DH 3QUXB 3H53A 4JZNA 4U3SB 2GBAA 4OR1A 2CJ3A 5IMOA 4NGHL 3SDXF 3VGDA 3MV9D 4GP5B 5KZCD 5F1SA 4GRMB 2K3TA 1U8QB 1E4XH 1R3KA 3GBDA 3N85H 3NEEA 1INDL 2WV3A 3VYNA 1CDCA 1QAWA 5CZRA 4BSVA 3W9DA 1AHWA 3GSNH 3L95B 1MUJB 4M6AA 5IMMB 3T09A 5I1LA 3WNIA 2Q7NA 1MRDH 1TPXC 3O6FC 1U3HB 4LLYA 5FHBL 3W0WD 3ZZLA 4FXKA 3VFSB 5IOKA 3ULUL 2SODB 3OAYK 3P40A 1GJWA 1GGCH 4LSQH 2KS0A 3RJOA 4PGCB 3WMSA 2B4CC 5ELIA 1KXTA 4J3OC 3ARUA 1G1OA 2NYKA 1EDQA 3UTZA 2PR4L 2H3KA 2K6WA 4UIKH 5T1MB 4EZKA 4KX9A 3KPTA 3FT1A 3A4AA 1QSEE 2V5SA 3ARGC 4P46C 2JMRA 4HZ1A 3N43F 1I1CA 4NO5A 2D4FA 3VYOA 3RHWF 4AX3A 4JY5H 3OMNB 1IAIH 1KEML 4E5XB 4FA6A 3ZQWA 1YNLH 2V5RA 1AO7D 2EECA 4MCMA 4MAYD 2VABA 1XR8B 2J2ZB 2J3SA 3NA9H 4AJYV 2EO1A 3CK0H 3RI5K 2XRAL 1HDMB 1JSYA 5IJDC 4AG4L 3QUML 1HXMB 4NT6A 4Y2DC 2YC1A 2ED7A 4L18A 5FECA 4UOW1 3RB5A 3ABLB 4OIFA 1M3IA 4TSAL 5FKAA 5EO1A 2LU5A 3ZJAA 3FO2B 1NOFA 1G9ML 5E4IA 5HGHB 1ZV2A 5E00A 3T4AB 5C0CB 1EJ8A 2GUOA 3TBTB 1BQHB 5T1KB 3VM5A 3LKNA 4FG6C 1BQ5A 2G2NA 3CVHA 4NOBA 4R90H 4YDLC 4G3YL 3PPEA 3IMSA 4X7CC 4HKZB 4NM4L 4QHUB 2K7QA 3O6FB 5T33H 2CLZA 3BZ5A 3PY9A 4OBRA 2VLMD 4OBSA 1EO8H 4MYWB 4YBLC 4CVZA 1MCSA 4G43B 2HT3D 4H4NA 2E4FA 2HRGA 4NO3A 3TCXA 4AL8C 3FT3A 1KJ3L 4XX5A 5D2NB 3VD7A 5KJ7E 4S1RH 3HE6D 3AU1A 4F7EB 4ZYKA 4K9EH 1G7IA 1M7DB 2VMCA 4K3EH 3VX1A 3FN0H 1WZKA 5EPMA 1VLXA 1ZHNB 2DQCH 4IEFB 5C9KA 4U1MA 4AQZA 1BXXA 3CSGA 4E41A 1BZ7B 4QT5A 4AGMA 4CU7A 1H3UA 4PWJA 2X2JA 2OSLA 3PHOB 1ES0B 4U1IA 3VI3A 2BRRL 4S1QL 5H4ZA 1EHAA 4Y7OC 5LGJA 3DX9A 4Z5RB 1JFHA 1TQBB 3PWPE 4JFYB 1QTYT 2EDDA 4NUGL 4PJHF 1H3XA 3AJ7A 1QA9A 2NZ9C 3QIBD 1QFHA 1XMEB 4KK6D 1S9YA 3KLLA 1R6VA 1N2RB 3N40F 4PJ8C 3KZ8A 4DK6A 2AABH 2QHRH 3HRZA 3B7YA 4Z7WF 3UTTB 2KUTA 3ETBF 2AGJL 4U2ZA 2XNAB 1YLBB 3BPNC 4TSAH 1KXQA 1W6WA 3T0ED 1E28A 2F7OA 1A6TA 1RK0A 4ONHA 2WXPA 1OM9A 1LWHA 1NFIA 4K8RC 4CUCA 4KUCF 4Y4HD 3A4FA 1JCVA 2UWEB 2A6JB 5C86A 2FVNA 1EMTL 3CSYA 5I0WA 1HTYA 1NBYA 5T33L 1Q1JL 1AP2B 4I0PA 1B4RA 4H88L 1NL0H 5FKAB 2R56L 1HCFX 1W0VB 2PW2B 4HLZG 1KYOK 2JV6A 2N0MA 2XFXA 1CXEA 3FUNA 4YWGL 1OGPA 2YAEA 2ROXA 3RHWK 1AGCB 2W8CA 4K3EL 3WFEL 4Y1AD 2B5IB 4M48L 3W3BA 4QTFA 1T6WA 3GTNA 2ZUVA 1CPUA 1AQDA 3FFDB 4X5QA 4QGYA 5CGBA 4LL1A 1Q0XH 3ZZSA 3AW5A 4W81A 4BEIA 2BNQA 1UADC 3V95A 3DSFL 1O75A 3MQIA 3LPGA 2JB5H 1WAAE 4OFQA 3GPSA 3EDEA 1CGSL 1KXTB 3M45A 4BH8B 4EJ1C 1YYLH 1S3KL 3QUZB 2VLJA 1DJHA 4FABH 1ND0B 1XF5B 1RJYB 4AEHL 1QFWL 2BWDA 2F7IA 1T5WB 1DBJH 1SFHA 3F5WB 4HGWB 3WHE1 4PRIB 4Z7UB 4Y7MA 3L95A 4GLRH 3V0VB 3MUHL 4I2XE 3VNYA 1T66C 2WXMA 3ASOB 4IRJA 4RFEB 4TL4A 4CN1A 4A7UA 5ABZA 3D51A 1LO3H 4IMKA 2GC7C 4IKNA 1A7BA 2YOAA 4EMZA 4G80A 1FF5A 2JI2A 4AYEC 1J5HA 2ZCHL 2LE9A 1ZGLM 3FTSA 2R27A 3NH7H 3RRQA 1XGUA 4XNBA 3TN0A 4ZMLA 4H7VA 5CJOH 1QHOA 2NCEA 3EJZC 2KERA 4AVHA 2WWMD 3NQKA 4XMLH 1MI5E 1YYMH 1JTOA 2QLVB 2EO7A 4GBXA 4GRLD 5HGHA 3OKYA 1FYTD 4GQRA 1PDKA 2IADA 1BGXL 4Z8FH 4OCWL 3JVGA 4GQ9L 3IBEA 2GAZB 2W9DL 4PGDB 5T5NG 4KKBC 4JFDA 3MNVA 4MLIA 5LVEA 3U9UA 4AENB 3QFJD 4L1DA 2VUYA 1HDMA 3C09B 1YEDB 3L3KB 1K8IA 1HFUA 1OP3H 4BUGA 2VZSA 5HGBB 3WFZA 5ALBH 1UA7A 5HPOA 5LN8A 5JIPA 1S3KH 1BHGA 4FLOA 2GEQA 1NBVH 5JIIA 2K4AA 4WFED 1J1OL 4P46D 2YUWA 5KSBB 4ORZC 4OZIB 2NDFA 1DP0A 1QFWH 2EZ0D 3NSDA 3P73A 4YHZL 4U3CA 2IWGA 1ASQA 3PP3H 4U7MA 4AXWB 3TN0D 1CGUA 5MERA 2AJSH 1B4JL 4KRMB 5IHBA 3VU1A 4LAJH 2JSFA 2BW5A 1UQSB 5F96H 4A38A 1L9MA 1LO3L 3C60C 2KZKA 5LJYH 1XB6A 1Z9SB 2ZOLB 3F64A 1B2YA 1G0DA 4DP8X 1MCCA 4RIRB 5K39B 4JQXC 3DRQA 4Y16C 5AW2B 5CCGE 5IVOA 3JZ7A 1WTLA 5DMIL 4LSRL 1X5JA 2BP3A 1ZPLA 2QKSA 3GF8A 4PGJA 4ISVA 2NQCA 2VLJD 2Y22A 2ZWNA 4C4BA 4Z8FL 1OV8A 1C5BL 2OMZA 4GQ9H 3FTGA 2W9DH 1YNTF 1INEL 2YAFA 4M5YH 4M00A 1ZT7A 3DSNB 4JRXD 1MG2C 3CIAA 1J05A 1KB5B 1R46A 2IBZX 3L9BA 2QGCA 2R0ZL 4LVHB 5K9KB 1FLRL 3UBGA 4QRPB 4NLHA 5AVWB 3MV7B 4MQXD 4P2CG 4FD0A 4NXSA 4Z0BL 1ERNA 2RALA 4XB7A 4ZAKA 4Y1AA 3GMMA 2WO3B 3QPQC 5GGQL 1SOXA 1OAUL 3QORA 4H26B 1ETA1 4BK8A 4JRXB 2C3GA 4Q9BA 1QRNA 4X6DA 4ZMZA 3I75A 2E75C 3H7BA 5JPNA 3CBKB 2QPDB 4BFFA 2WOBA 1IEBB 4B41A 4CSTA 1XSIA 4JE4B 3FB8A 4XP5L 5JHLL 4I0PD 4KKCC 4TQ8A 5HDQL 5KAQF 3KNBA 5E2UL 1H5BB 3GWJA 3TPUB 2WPGA 1N6QH 3JT2A 3WTYA 3GMOA 3LQMA 1RVFL 4F2FA 3GSVB 2Y3NA 1RP8A 1IAKA 1RZJL 4AM0Q 1PJ9A 5IHZA 4Y19B 1AQDB 3CC5A 3FFDA 3EXJA 4FQLL 5D7IA 4PREB 3CVHH 1YN7B 3TBSA 4K3JL 5KS9E 4P4KD 2DYPD 5GSVA 2NR6A 4ZZKA 2KLRA 4Y4HC 2F8XC 3O3EA 5IB3B 3C5JA 2HJFA 1M1XB 3AS3A 5DHVA 1HKLL 4NBXB 4PRAB 5F72S 5LKNA 3IYLW 4C47A 3IN2A 3Q13A 5AL8A 3L9EA 1FCGA 2WQUA 2V7NA 4Q52A 3VVWA 4K3GA 3H9YA 2VQ4A 5B3JF 4EOWH 5DMGD 1MNUL 3ARFA 4CAGA 1PX8A 3CDZA 5D7IE 1OANA 3Q2LA 4WUKH 3KPRD 4Y5XC 1ZS2A 1A65A 3V0HA 5CP3A 4ZD3H 5LQBH 1F4XH 5BV7L 3KWUA 2WBWB 4WF7A 3ERXA 1MCRA 2NY3D 2EZ0C 3NCJL 4PJBA 3TH4T 3IWUA 3ZL4H 2J8OA 1ILSA 2P26A 2AV7B 2AQNA 2E46A 5LG1A 3W11C 2PYEB 4ODHL 4QO1B 2F53B 5ES4B 3FTWA 3MO1B 5E2UH 3MACL 2Z0UA 4GW5B 4U0RC 2BZ7A 3LH9A 4AGNA 3SE3A 3TLRA 4FXTA 4YZFE 4YDJA 4X99A 4WJ5B 1T1WA 3EYOB 1USZA 3WNKA 2VMEA 4HIHA 5DWUH 4J3OD 3EKCA 2ID5A 2EVFA 2W92A 1O9ZA 3FB6B 4Y16B 3UEQA 1CXFA 4EI5D 3H9SA 4PIRF 1JFQH 4ACTA 3OF6A 3MLVL 2BVYA 1VCAA 3SYAA 4C83B 1AACA 4R3SB 2FJSA 1YQ2A 4IRSD 1WIOA 1QW8A 2GCYB 4APQA 4JFZH 5IJVA 2IPUK 2ZWZA 4MNQB 1HKLH 2GTZA 3PNWA 5TE6H 1VFMA 1QSZA 1I8KA 4YSCA 4J3OH 5BV7B 4MAYA 3BPOC 1E67A 1BVLB 4MJID 5ERWB 4MB5A 5FA4B 2GI7A 4PCKA 5I1DA 1NEPA 4OJYA 3F7QA 3OKDA 4NO2B 5LAXA 2ZX8A 3QJFB 3H9SE 4E5XA 4HFWB 4MAYB 4BK5A 3ULVC 3I6GB 4JM4H 4L48A 5J3HD 1T1ZB 1C5DB 1I1YA 1TVBA 4MRCA 5BV7H 3SE3C 1ZD6A 4U6VL 5MP6L 3IJSA 3K72A 1RD6A 4KUZL 4FGMA 4XO8A 5EULV 2ORBH 4E36A 3HA0A 5AOIA 5IB5A 1R3LB 2CK2A 4P0DA 1X9LA 4AKPA 5JDSA 4F92B 4NT6B 4A37A 2VDPL 2JTYA 4K4KA 4X50A 2FH6A 5DEJA 3S35H 4HAKA 4OQTL 1YN6A 5ALCL 5AFAA 5I23A 3BLKA 2BVOA 3NG5A 4MQ7A 4P4KB 1DE4B 4YEEA 1DLFL 4X6DB 5D4IA 1KLUA 2QQQA 4J27A 5D8JL 5E94A 4U1GB 3ROLB 3LXBA 4YR6A 4TNWK 4J3VA 4N2DA 2AV7A 3LQAH 2GJRA 3TO4A 1A6UH 5AVQB 2ZUYA 4H0HB 4HUCA 4F58H 1A6WL 1HHGA 1CGXA 1NGZB 1FFNB 3H42H 3E6FB 4KI5C 4TSCH 3KYNB 5DZJA 5E2VH 1EXHA 2Y1VA 1I9EA 2XWJA 3MYZA 1AXIB 3H3KA 2BXYA 3NTCH 4XNQB 4E9VA 1RZJC 4WNJA 1I3RA 2CO2A 4HJGB 5IKCB 5DYFA 1SEQH 1KULA 4XAWH 1JZDC 1MCPH 3GSNB 3QXAB 1ZMYA 5DQJB 4AOFA 1VB9A 2X1QA 3VH8G 4K07A 1SEBB 1SM3H 3ROOA 1NIEA 3GM0A 5DC9B 2OP4L 2PO6D 2WCPA 3QZOA 5MHSD 3FK3A 4HBQA 1VFBB 2OJZH 3P2TA 1IAOB 4X7EC 3D12B 2HJFB 1MI5B 2ZP0T 1SJXA 2L7UA 4JO1L 2G2PA 2DLFL 3CMGA 4KUZH 4U6VH 5MP6H 4BZ2A 3QFJE 4X2UA 2HRHA 3DXAD 2Y36L 2A9DA 3K6OA 1T0PB 3R1GH 2VKXA 5DD0H 3WCYA 2BWIA 3IETB 4GW1A 1HS6A 2EVHA 2WVUA 2GSMB 3QUKA 3S35L 3WG7B 2YXFA 2G2RA 4YSPA 4UV4H 3QPQD 4UYPA 3CZUB 4KFZC 1MFNA 4WTXA 2MNUA 1T3FB 4ONFL 2WBXA 3LKQB 3IU4H 3QA3B 3TV3L 5LG6A 1P4UA 3QQ3B 3BWUC 2VZUA 3WXVH 4Q9RH 4YHOH 1SJEA 2ZOOA 2HLEB 1Q0EA 4O02H 5DJCA 5AALA 4GI8A 4FZ8L 5C0NC 5JMOC 4OI9A 4YHKH 2Q7YA 1CB4A 3WV0A 4EI5C 2EXWC 4Z3EA 1A1OA 1KPVA 2ZX6A 3GJFH 1VACA 3MNZA 4HIXH 4IBWA 1I8MA 1A14H 4BELD 2WWMC 3BFWA 3KCPA 3NTCL 3ARED 4BH7A 4UT6A 1UZ8B 4QR7A 3IDGB 3EDKA 1UUSA 5IT2H 4V33A 3MZTA 3ECQA 5L88H 2EIZA 4QRPA 1I53A 5KYNA 4UB0H 2EDRA 5C6TL 1R3IH 3IDIB 4QTHA 1BZQK 2FUTA 2BNRB 4XN8A 4M93C 5EF1A 2VXSL 4IKKA 2VKWA 5EEYA 3LHPL 3FTGB 1HHKA 5E9NA 2DLFH 1ZE3H 5JW5A 3I9IA 3X1EA 2ROYA 2NY1C 1ZTXE 4MJJA 1J5CA 1I31A 2Y36H 3VD3A 4UIMA 4KRNA 5DD0L 4ANXA 2YAQA 1DSFH 5ACZA 2G3MA 1JUFB 5E24E 1Q4NX 1JK8A 1U3YA 4OIIH 1CL7H 2NLJA 5EU7E 3RI5F 4CRPA 4JQIH 3GIVA 1JGVL 2R4SL 4HH8A 3VVVA 4HETA 1ED3B 4K94H 1GOHA 4L37B 4XNUH 2HUEA 5FIEA 2FD6L 4FJ6A 4EQ2A 4TUUA 4Z7VF 1RUML 4N2HA 3APMA 4GB9A 4KMTH 4LP8A 4MMXA 3FT2A 4Q6KA 3D05A 1XZWA 2AXGB 2W0PA 5DYOB 4YHKL 3JTSA 3QIWD 1MREH 3R18A 1H0DB 3SODB 1FI8C 1JWMB 4MJ6A 3F01A 5KBDA 2N0KA 1BSIA 3PAYA 1CGVA 2VJXA 3QNXA 1AZCA 1UC6A 5KSBA 3NZ8B 2UZPA 4YDLB 4QRQB 1XF2B 2O6DA 4PMEA 5HHOB 1L3WA 2EQDA 1EK3A 5DRZB 2RACA 5IT2L 1SXSA 3IMRA 1MCDA 1AKJA 2MTAA 1J9QA 1UZGA 1GGBL 2DTSA 4GBXC 4W9HC 3S5ZA 1YDPA 3OJ2C 3GTTA 3CHQA 4F33A 2DYPA 1DFBH 1XR9A 3SPIA 2EEXA 2AAVA 2X3CA 1K8DA 2DWSA 1F45A 2P45B 3O6ML 5HHOA 3S0PA 2ADYA 2ZP9A 3SGKC 3CQPA 1DUZA 4HS8H 5E9DA 1CGWA 4AH2A 4JPIB 1Q8MA 4OFYD 3K6SA 1KCBA 4L0PB 3BRDA 2YRBA 4JO4L 2NQ3A 3BISA 3KAAA 5IW6A 2DKSA 5KVEH 5IROC 3HG0A 2GG1A 4B9YA 5EOQL 5IGXH 3MLXH 1HQRB 4OIIL 4W9IC 5KS9B 1UXSA 2A77H 3U2JA 3BN9C 5DRWA 4JQIL 2BW4A 2VYRE 1U41A 1TFPA 3NBNA 4K94L 2X6BA 3ULAB 2KZWA 4KZDH 4G80B 2A74B 4IRSB 1I1AC 2Y1YA 4PS4L 4X4XB 4P2QE 2F53E 3OAWA 4WFHD 4NYLA 1D2OA 1HESA 3UZQB 4F57L 4L8BA 4NO0D 2BZCA 4OLEA 2H9GB 2Q86A 5AW6B 3GT6A 4DN3L 1K85A 2M26A 2BP0B 4B5ZA 1KCLA 3S96A 3U36A 5H94A 1MFEH 3ZKMD 5KSUB 3Q43A 4RWYH 4RDQG 5CP7B 2X05A 2DBJA 4G70B 4YXKL 6PAZA 3I3EA 3UG3A 1ZLVK 1JAEA 2CMRH 3LKSA 2ESVE 3GRWH 4PW3A 5E8EA 5EU5A 1CDGA 2YD5A 5IFJB 3K4AA 4XVJH 5KYXA 5FO8A 4FNLL 4Z7WB 2I26N 2YBRB 1OARH 4BV1A 3G6DL 2PKDA 2VC2H 3N40P 5BOPA 5KTEL 1WEJH 3LZQA 5D7JD 3DIDA 1B0IA 2XWBB 2P42B 1FORL 5F88B 2XVGA 3E1ZA 2EYTB 3SGEI 3T77A 3TFKC 4MMYB 5FYKE 1RHHA 3D4CA 2QSCL 4PVLA 5DO8A 3V0WL 1ZDSA 4P04A 3VXPB 3TJHC 1JZHA 2H32B 3LEYL 4HKZA 1FNSL 3DROA 1U3JA 1QPXA 2D03L 3WFBL 1BZOA 4NP4H 4S0HA 1A4KA 1P53A 1I7UB 3E1F1 4ODXB 2OYPA 3LKQA 3QA3A 4OH2A 4MZ3A 3HC0A 5BXFA 5JORA 4GUOA 1EAOA 3GZPA 2VDKL 4HUNB 2MSPA 3SQBA 3RTQD 4OLVH 2IXQB 2VL5B 3WSQL 4W9KC 4AW7A 3ZE2B 4JDEA 3AG1B 1JNNH 3KYNA 1MSPA 2VDLH 2VR8A 3QZPA 3K8LA 4OCXH 1GR7A 2WLYA 4TULL 5ISZA 1AR1B 5DK2A 1C9SA 5C1MB 1SBSL 1A8ZA 3RZWA 3ZKNC 2IGTA 3SEPA 1Z9MA 5DD1H 3EG9A 2OR7A 2J8UF 2YEZA 1OPGL 2CMRL 4JPWL 4Z7UA 2JQAA 1AOZA 3KWVA 3LXAA 3P0VL 1I85C 1JN6A 3GMNB 3FYIB 2HZHA 3SDAC 3VXTA 2Z1PA 3K74B 4PP2A 3OB8A 3EZ8A 3ZRFC 2BIQA 1CR9H 3LSOB 5F9WC 3DX2A 2D0GA 4QT5B 2NDGA 5B1JA 3UBXB 3ARFB 2H1XA 1Z3GH 4K8RL 2QSCH 3V0WH 3T9WA 3DJRA 1E5AA 5AZ2H 3PWPA 4JO8A 5GS1A 3NZSA 1NGPL 4U0RB 1SQMA 5IEHB 1XZ0A 3L3JA 2PF6A 4BM7A 3G6JA 5HVHC 4NKDA 4WGKA 1ITBB 5E6ID 1U8IA 3EO9H 1NGWA 4GKZB 3QEQD 3WFBH 3FSVA 4NO3B 5IROD 5DHVB 4W4OA 3ROLA 4FXGA 4RMUA 3BUYA 2MNJB 3TWYA 2W60A 2JB6A 4PV8A 1QZNA 4U3SA 1U8JA 3BP6A 3UBFA 2Q8BL 3GBMH 3NGBC 4WFGD 3NAAL 3SE9H 3TBTA 1WT5C 3KDMA 1C7TA 1LILA 2AP2A 5IHZB 1A4JA 5SWZD 4N3TA 2J6WA 4ODSL 4NN7C 4MAUH 2E9IA 3Q1SL 3D2UD 1IBDA 1C5DA 1TVBB 3HG1A 4TSBH 3D1MC 1J9RA 4RDBA 4ZFOL 2YRZA 2Y1AA 1N12A 4TVPD 4LDLB 4A6YL 4JPWH 1XH0A 4N0FA 3SDXB 4N28A 3QEHB 1YCSA 4OM1H 2JJWA 3AMLA 1CGTA 3FQRB 4H13C 4AEIH 2OMVB 2BPBA 4G5AA 4QJ3B 3NFNA 3QBTB 3BMVA 2BSED 5CJBA 3PJSA 1VKXB 1H3PL 2CBTA 4R4BA 4N0UA 2AK1H 4XI5C 4TQHA 1NLBL 5EIIG 3WDJA 4JDTL 3QJOA 2UUDH 3QDME 4X4YB 2X1WL 4NBYB 2AI0L 1JNLL 2VDOL 5EU5B 3D85D 3DA0A 5IFJA 4GKLA 3PL6C 4APQD 2X0WA 1SRDA 5BNXD 3WUWA 2MKWA 1RSFA 3NIDE 1ZS8A 5I1IH 4MMZA 1ZEAH 2FIRT 4WJKB 3S96B 1V7MH 3F84A 4HHAB 1E40A 5DJYA 1GPOH 3UTSE 4ZFZB 4B60A 4L8BB 1DLHA 1ZIBA 2YWZA 3EH2A 4HPOH 3OXRB 1N6UA 1MVFA 1X9UA 5EO0A 3ZKXB 5HYEA 2OTUB 1F58H 4RIRA 5K39A 3T5WA 4AVIA 1MDTA 5IQ7H 1RH8A 3S34H 1BZ9A 1JOIA 1JPSH 1P4LA 2X6MA 1U8PA 4I18B 5ISZB 1YPZF 5IBTL 4XCCH 5F0JB 5E8NB 4OTXL 1HHHA 3RUGE 4HC1H 3S3SA 3WFHB 1FJ1A 5B3SB 3U7YL 2YD2A 4L1BA 1YJDL 3LRMA 1KN2H 4PV9B 4IGBD 4AIXA 3PWLA 4PY7A 2Y0SA 2PR9A 1DQLL 3HE7A 5I8CA 1U8KB 3SB3A 2RR3A 1G9NC 3BH9A 1NSNH 2MQ3A 3C2AL 3HZVA 4H8UA 1L5GA 4X6FA 4Y9EA 5FK9B 5SX4H 2Y7LA 1QHQA 3RP1A 5DHYB 1JGDA 1H8SA 3L7EB 1CLCA 3T0DA 5LGHH 4HJ0D 4ZOAA 2IJ0C 4JDTH 2Q10A 3UPRA 1KPVB 4HUUB 1AR1C 5MENE 1U8OB 4IW4C 4PJEA 5ID0B 2AI0H 3UYRH 4YC2C 3ILQC 3V0GA 2GTWB 1XFPA 2PTVA 1PIGA 4N6RA 3S5LB 3VXSE 1DQJA 2CE6A 2ITFA 3PF2A 4FJYA 4FQCL 1SYSA 4ODTL 4DQOH 4M6NL 2YS4A 1V7ML 3NCYP 5ID1A 1O6SA 4M1DH 2CKBL 3UDWC 1WDAA 1GPOL 4OLYH 5E0QA 4FI7A 2HKHH 4XVSH 2FB4L 1JV5A 1MFCL 4ZX4A 2WZAA 4KKNA 4BE5A 4NNYA 2EXWD 3MLYL 1O6TA 3IDXH 4M1CC 3UTQB 5FR3A 4KVPA 3VM7A 3JVFC 1JPSL 5LGKA 4ZX5A 5HJGA 3KLDA 3AG2B 1OCZB 4XCCL 4X7TB 1JZJA 2CRYA 1LXMA 3LKPB 5B39G 5I73C 4Z95L 1P5VA 4JQXA 5EHFA 4NQSA 1R3KB 5TK4A 4L4TA 1AHKA 5HVFB 2G4GA 1MRFL 4UIMB 5FGCE 1HWHB 1DQLH 4OQ1A 2ZUQC 3C8KA 3TBVA 2YZ8A 2A38A 1GGUA 3C2AH 4EZLA 1DQKA 2V9UA 2NY5L 4KJPD 1WD8A 5K9QI 4OZHE 1UYWL 3LNIA 5ITFA 4W9LC 1WFIA 2YR3A 4XI5D 4X4YA 3TYFB 5KG9B 2YARA 2JJSC 3TIEB 2G0LA 2GBVA 3AVEA 1A1NA 2GJZA 1F13A 4BWUA 2FO4B 5D2LF 4JHZA 1KCRH 1S78D 3MUZ1 1TJGL 3P11H 5DEGA 3DRQB 1VGKB 2OQJA 2E76C 4MASA 2F74B 2HJLA 5HVWA 4M6NH 3SBWA 1M2OA 1YDPB 3VGAC 1AG6A 4KRPB 4BKSC 4PGEA 4M1DL 4ANUA 2DZEA 4IDJH 1MXGA 4WTQA 1E2WA 4OLYL 4N6QA 2XQBH 5FW7A 4AWJC 1TJIL 3WS6A 1JGDB 3HC3L 3MLYH 4IRZH 3V4PL 1I1RA 1L7TH 1S8DA 3UAJC 1K5NA 4WI8A 4LDOB 5E6IA 1AP2A 2VXVH 1BQRA 2CHNA 3GO1H 4X5XB 4XTRC 2V3EA 1NJ9A 2DLHA 1KEGH 3I3DA 4AMKH 2YSSB 4BKLA 1JJUA 4RNRB 1JF1B 5TDPA 1CGYA 4CW1B 1CFTA 3P69A 5K59F 2D2OA 2X12A 1MRFH 4RH4A 3RIAF 1KLFA 5HYQB 5JUEH 5JXEA 4DGVH 5JMRA 2O6EA 3AXHA 3QHZH 3UP1A 1ZCRA 1I8IA 1OF2B 2VLRB 5LNEA 3P1VA 4NKOA 4TYUA 2JLLA 1IEHA 2QSVA 3FB5B 5D70H 4HC1A 2NY5H 2R7EA 1QFUH 4XNMA 4FMFA 4LSUH 5DMYA 4PGDA 3ZDXB 1WFUA 1M9SA 3RYMA 5I66A 4QRRA 4B5EA 1TPXB 4HHAA 1RLBA 3R0MA 4AJWA 3SDCB 4ANVA 3HJEA 4ZXBD 1CQKA 2R69H 4FQIH 1MIML 1KB5L 3GJFB 4JFFD 1TJGH 4ZRGA 5BMFH 3U9PH 5JYMA 1YEWA 4F2MA 5FM4A 5L6YL 3BAEL 2IBGA 3DGDA 2KZBA 2YPKB 3HNVL 2NR6C 2A6IA 4PJ5A 1OSPH 1KT2B 2CNYA 4F37K 4UQBA 2XQBL 3GDBA 4Z3FA 4K23L 5TDNA 2ENYA 5FYJE 2K0RA 1TCRB 2VDML 3STZA 1F0LA 3DTUB 5DK2B 5T1LB 1LO4L 2WIIA 4QGTA 3WMQA 5CEXA 1XGQB 4UNUA 1Z9LA 4Y4FD 1HQ4B 5FFLA 3GO1L 1E4KA 2AK4B 3JWDC 4WFFE 1CFNA 1U8LA 3L2MA 5CSZA 1OE1A 1BJ1J 3O9WC 4YQXL 4MZ2A 1A5FH 2J88L 3LZNA 4K73A 4L8SA 2W07B 4NCC2 3UGUA 3HIZA 5B38A 4CILA 4JZOA 2AQTA 4DGVL 1ZHKA 4U1LA 5LLIC 2XY2A 3SD2A 1BEYL 4ZUTA 1TVDA 4EKJA 5AVYB 1G7LA 5EBMB 4MNGE 3TFKD 3LIZH 4ZAKC 5HGAA 4PVNA 4LSUL 3HR5A 2FEEL 3SGKA 3ZYOA 3V4VH 1SLUA 2G60H 1MFBL 4HUXA 3BQUB 1GYCA 4HZLB 3WL9B 1OM3H 4EO5A 4TVPE 4Z6AT 4P49A 2DMBA 3LPFA 4NXKA 1T0MA 2BNQD 4TNFA 4JN2A 3BEWA 5F88A 4RNRA 5TDPB 3FU6A 4WEBH 4M8VA 2EKSA 5E8PB 5SX5K 3G6JF 2BJMH 5D96C 3X2QB 1BECA 1PQZA 3IGKA 4Z7QE 1K3IA 2JXMB 5IF0B 4DTGL 5JYLA 4LHQB 1K9TA 3QHFH 4FI6A 3UTPE 3HHSA 3JV6A 5I6MA 4JDZA 4Q6YA 2UWEF 2D31A 4F15C 2QDWA 2YA2A 4NI3A 2DI9A 4HS3A 4WHDA 4K23H 4PGCA 2RB8A 3N44F 3AUWB 3D3VD 1WRFA 1A9BA 3QWRD 5E2WH 1YNKH 4JFED 4M5ZH 3D50A 4PJGA 2EUWA 3L4WA 1EGJA 4ZMAT 4LOVA 4WEUD 3UZEA 5EUKB 4F1ZA 1TQVA 2P5EB 4V11A 2JKLA 3IGLA 1AQKH 5EPMB 2H9GA 2JCCF 1IC4H 4YQXH 5D9SA 4ZTOL 1MLCA 1GIGL 1NGWB 3QC6X 2GSGB 4IOFD 1ACZA 1FL3B 4XBGB 2DQTL 4F15B 5KSVA 1CDIA 2HFGL 3MRKA 5GS1B 5IEHA 2AEIT 4TPRL 4KJYB 2XWEA 2YD6A 3VRIB 1F8TH 4BK4A 4LVNC 5KSAA 1B4LA 1QFPA 1UWEH 1FO0A 4J6IA 1JL8A 4ZT1A 4ES8A 2K7PA 4GRWB 4IBVA 2N1KA 5ECJE 3VTTA 5JW4Q 3O8XB 4NERA 2DQDH 3QO1A 2ZXAA 5CCHE 3TZVC 1MW0A 5TPWH 1GYUA 1KN4L 5GRJH 2CJUH 3SPGA 1ZTXL 3KPRE 1A4BA 2XWDA 3VFTA 4L8DA 3VMNA 3FT3B 5D2NA 4PLJD 1PBYA 4EIGB 4L4VD 3EFFA 3ARTA 4U1HB 4DQAA 3O3UN 4GSUA 4PIBA 4YHIB 1KIUB 3X17A 3SDDB 2WB1A 1GTFA 5I6NA 1KJVA 3ZE1B 2RD0A 3QHFL 4PG9B 5GSVB 3RVTC 4YHYC 2VQUA 1AE6L 2NW3B 2XWRA 3MVSA 5AL0A 5EBWB 3DI2B 3ESPA 1CI5A 3FSAA 1A02N 3GS4A 3DUUA 3O4LA 4G7YH 4P2OA 4MKMA 4MNQA 2ED9A 4M7JH 1PZ3A 1JS4A 1I82A 2Q87A 2HN7A 5LBGA 3WTSA 1AC0A 3NPZB 5DO2C 4G7RB 1RURL 3SO5A 1EFXB 3RVVD 3FT4A 3MNMA 4FQPA 4K71C 4RMQA 1A7RH 3EYUL 5H2BB 1W0WA 4ZTOH 2FIKA 3VXQA 4LNVA 35C8L 1F1AA 1KTDA 1QPPA 4X9FA 5IM7B 3ILPB 3BHBA 4OD1L 2OMXA 4QLRA 4JLRA 4OFKA 3TBWB 1S5HB 4KAQL 3P02A 1F1DA 5HPMB 4RFNB 4LPWA 1HQ4A 2F1BA 1PZUB 1F8TL 4ZUSB 1PLGH 3D39D 1M05A 2DJ4A 2ZOWA 3RVXD 3M1BA 4OD2A 3K46A 1UWEL 4JFFB 3V5KA 3MV9E 4FS0A 1OB0A 1Z7JA 3FFCE 3RTQB 5B7MA 3S88L 5C6PB 1M2VA 2CGZA 2YUXA 4Y1AB 4W9GC 3D0VA 3IMBA 1TO4A 3MJ9L 3BUQA 4ZFFB 1RIHL 2DQGL 2ITDB 3L9RA 2VMDA 1ADQH 2ITEA 2Z8RA 1QR4A 5GRJL 1MJUL 3NSCA 2YN3A 5C0RL 5ISZE 1AD9A 1FFOB 1NC4A 2CHZA 4HQQH 4L29B 2FR4B 3VI4E 5DJAA 4L0YA 3ZY7A 5D7SL 4O9HH 4FG2A 4JZNB 5I74B 2XN9D 2PCYA 3E8VA 2AW2A 4JL1A 4OUUB 2MIZA 1Z5HA 2ESVD 2F5BH 4U33A 2XBZA 1JGIA 1YVLA 4PY8J 1GZHA 2XN9E 1AE6H 2DEWX 2G3XA 1CU4L 1HHIB 2LU7A 3N1QC 3W9DB 1JG9A 4G6KL 2YPVL 1Y18A 4FLQA 1KNOA 3VFWA 2VUKA 3ZL2A 1YMMD 4XN5A 5J6HA 3WFCH 1HOEA 1D5ZB 3D2UA 4K7PH 5IQLA 4POYA 3BRFA 1J11A 4X6CA 1BYPA 1JCKA 4ZUSA 1X5GA 4Y5VB 3B2VL 4DEPB 2F54D 3QUXA 2W9LA 4WCYH 1SJEB 3E38A 1Z1WA 5CHNA 3SJVA 5I6PA 4K71B 2XA8H 3VXOB 1DYZA 2Z7YA 3GXIA 1PLGL 2PWDA 2FX8L 1JHKH 1H0DA 3CDCA 1U92A 1DQJB 3D9AH 4HULB 3QRFM 5FWRA 4XMKH 2MCAA 5FA3B 1JYXA 1BX2A 1FYTE 4I89A 5F1OB 4P57B 4L3FA 2OSXA 2A9NL 5BOZG 2K8MA 2EEDA 4MMXB 4A7TA 1D9KC 1UD5A 1KCWA 1X5IA 5C0ND 2ZSVA 4HKXB 3CLEH 1ETZB 1MJUH 4GAYB 3S98A 1OTSD 4WUUD 1G6RB 3VD5A 3BE1L 5JHDB 1E30A 4RISH 1T2JA 1ULVA 1OLLA 1YHPA 3MRPB 3OMIB 4U05A 5HP5A 4EI6A 5MI0C 2YPLA 4M8RA 3HFMH 1SEBA 1Z0MA 3SKOA 4H8WC 1ZA6A 4D8PA 3GB7B 4J3BA 4QLWA 2FJFA 3LRSB 1JWMA 2FX9H 4QOKE 1S7SA 1D2PA 4QOKA 5CJXA 1FZKB 5KOMC 1CU4H 3DO3A 2MEJB 3CFCL 3Q0HA 3AM8A 4G6KH 2ICEB 3GHEH 5IB2B 1MNNA 1C16A 1BJMA 4M7LT 4E9XA 4P2RE 2ADGA 1LE9B 3GHBH 2VN7A 4K7PL 2JB6B 2TAAA 4PV8B 1UJ3C 2O4EA 4CDHA 4OZIE 7CGTA 1NPNA 2GFBB 3ECUA 2C3VB 3LKRB 4KKLC 1Q1PA 2P5WE 4QUOA 4AQEB 1GY1A 2NNFA 4DP0X 3IM1A 2EDKA 4XVUD 2VN3A 3PDOB 4G8GB 1XZ0B 3L3JB 4QYOB 4CU6A 5JW4N 4B0MB 1U33A 3MXVH 1CYGA 3HG3A 2X1XR 4DEPC 1M05B 5AKSA 4PBWD 5I9QB 4UCFA 2BX5A 4DPRA 1F2XK 1ETJA 3RFRA 3D9AL 4KZEH 1FZOB 1V10A 2YGPA 2YMXH 3BHBB 4LRIC 4D7BA 3FTUA 3VXTB 4J6RH 3EYFA 1ORSB 3F3HA 4ECNA 1D7DA 1AJ7L 4IOFC 3IJSB 3D06A 2DBLL 3IJ8A 2EILB 3ARFC 1V7NH 1OY3B 4KHXL 1BAWA 3AU1B 2BNQE 3EFOA 5DJ0A 4F7EA 5SWQB 5E8PA 2Z31B 2WNWA 3DUUB 3LIZA 5A3ID 4PWFA 1PEWA 1VZIA 2GITB 5D5ME 3MI6A 1F86A 1K72A 2I25N 4OKVA 2NNXA 3GMRA 3CDGB 6CGTA 4BRJA 1AIFA 4FQ1L 1G4RA 1MWAB 2GEEA 4JDEB 4LF3B 4OCYL 4X7SH 3T3MF 1UM4H 4GH7B 2Z34A 2DH3A 3SE8H 1S46A 2WN3A 3RQ3A 1ZOXA 4PJDA 3M17B 3T2NH 3TEZA 2UZXA 3GHBL 2OW7A 4FG0A 4AUJA 1J48A 2D4DA 4U31A 4OGYL 4JZJA 4C83A 2NXYC 5DRNB 4Y5VC 1TCMA 1KYAA 1QLEH 2DDQL 1A4JB 1T7VA 2WW8A 2CUAA 3EUDA 3EOBB 4YUEL 3BYTA 2P5ED 3GSUA 3CFDB 4H8WH 1AQMA 1NCAL 4AGOA 4X0KA 1JYWA 1NFDA 1URIA 3D87B 4NSKB 5J6SA 5EZJB 3CZSA 4PG9A 4RAHA 4X8XA 2C1OB 3JSSA 3ZDYF 1RPUA 3PHAA 1MJ7L 4I1RA 1HNGA 1D5IH 3MRNB 3CH1B 3QXWA 4G8EA 2HT2D 2ZQKA 4FQJL 2Z6FA 1X6LA 4RFEA 2NY1D 5FYKH 2ADJA 2C7UB 2VITB 1QLRB 1WV7T 3FS9A 3G6JB 1OKEA 1R5IA 2IH8A 3P4NB 3QPXH 5FUCE 2CR6A 1HZHL 4NKIL 1AJ7H 5EBLB 5IFHH 5C3LD 1BREA 5I8EB 2HP4A 2J43A 4LIQL 5DEFA 5FUOH 3EJPA 4LASH 4EE2A 5JIHA 5DHXB 1MLBA 1J1PH 2XWJB 2QPSA 3VI3E 4P2QB 1MZZA 3J2PA 4PCTA 3VYPA 1PY4A 3L3OB 2CM6A 2IPKA 4IEFA 2BS71 5LB1A 3S8WA 5HY9A 9CGTA 4HOWA 4GRLC 1CG9B 1QFWM 1TEGA 1UM4L 5A2BA 5CS7A 32C2A 5KBKA 1N67A 2JKSA 2W94A 4G6FD 4D9LL 3UTTE 1I7ZB 3MPCA 3UAEA 5I1CH 5H8DA 4OSUL 2EE6A 2B14A 2J7LA 4HX1A 4M7ZC 1OOWA 2H5UA 2X4OB 1IBGL 3WEOA 5LDSA 5FUCC 3E8UH 2PCXA 1P2CB 1NPJA 2JCCA 1AAJA 4ETYA 3N1MC 3RDTA 3OHMB 2WLLB 2F6AA 3QYCA 5EOCH 2F5AH 2HVBA 1MW3A 2E86A 2F58L 1H9VA 3S36X 3RWDB 3BZEB 1JMZA 1KGIA 1MCWM 3BDYL 3CC1A 4EUPB 2YUVA 4N2FA 2WYZA 1ZJAA 5E99L 5BVJB 2UWEA 4XNZB 4UQ3B 3T3MB 3QCTH 3GSOB 1BBJB 4QEGA 4LEBA 4Z7IA 3EJJX 3ZW3A 1MHEA 5T3ZE 1NLDL 2XHNA 3MRGB 3P77A 5DD5L 2APFA 5GGUB 4N2GA 4WWOA 1HI6B 3BN9D 1MQ8A 3L5HA 1S7QB 2EC9U 4PB0H 4G5ZH 3P9MB 4EUPH 3N06B 5GRUL 4G42A 3AWGA 2BIOA 5D71L 1MW2A 2GI0A 1PVHA 2CK0L 4G6ML 2J5LC 3MRBB 5EF0A 3JVGC 4UT7L 1E8XA 3UZVB 2V2TB 1A3LH 1OEZW 5DF0A 1S4IA 1SJVA 1U9KA 1IFHL 1QASA 4X42A 2J72A 2ZXWB 1OAQH 3P4OA 1MHHA 3D85A 5I1CL 1RUKH 3OKKA 4XP4L 3MOBH 1FCCA 4LVOC 1UEMA 3CIQA 1URLA 5CCJA 1SXNA 1I1FB 5HYJA 1GY2A 5C0GA 2V8LA 2GT9B 1CXIA 1FP5A 4JAMB 4YFDB 4UNTA 4MBOA 1NBZB 3ECWA 3VFMB 3T0AA 1RULH 3L4CA 3TASA 4FQXC 2E9GA 2ZAHA 1PF3A 3OPZL 4DP6X 3QRBA 3HN8A 4GW4A 1KPRA 2C1OA 1KCVL 5IB3A 5D93B 2QDVA 1ZLEA 1DVFD 2E27H 3BDYH 1GJUA 4WVRA 4ZUVA 1KYOJ 3STLA 4LB8A 3TTYA 4L5FE 3WTUA 1LTXA 3T65B 2H6UA 4AYGA 2FEEI 3TA3B 4Z9KB 2PABA 4X7FC 3DV4A 5I17B 1HYSD 2R2BA 2F9BT 1X5LA 5DD5H 1IAKB 2E59A 1MCOL 4M02A 5BZZA 4DVRL 4AKOA 4G9FB 4QOKD 2YPLB 1YECL 3C8HA 2R2EB 3PNRB 4MSWA 4WUUB 1FSKC 3H2WA 2P8LA 3UGEA 3MNWB 2BRQA 2YUZA 3LH2L 3LN5B 3MRLA 5DTFA 2CDEA 4WW2A 3QCVL 2JKWA 2CK0H 3SDCC 4LVOB 4R4ND 2YZ1A 2V37A 5I28A 3UTSB 3P3TA 4KPHH 4UQAA 1IKFL 4Y2DD 4WUUA 1IFHH 1Q9WA 4NUPA 4RGMC 3UYPA 4X6FB 1CD0A 3N55A 1FE8L 2J5LB 1BG9A 4YDKH 3QFJB 2NY6B 1FL6A 1M71B 3ZT5A 1D7CA 3BXNA 2OAAA 3TIDB 4UV7L 4UOZA 1EPFA 2R29L 3T65A 5FF6A 5DMGC 3BSGA 3LCYA 2ZT9C 5F7WC 3MREB 3IETA 4GW1B 2YO3A 3GXDA 3W1ZA 3PL6D 3OPZH 3APCA 3FUDA 3DARA 1JPTH 5ILTL 5F7AA 5CP3H 1CC3A 3EHBD 4XCYA 1GXEA 5IMMA 1HCYA 3VSTA 3M1OA 3FU0A 4UQDA 4I8DA 3QI9B 1C1EL 5EN2A 2AEOA 2IH3A 1PAZA 3KWTA 2VRKA 3EBAA 4NQDA 3FPYA 4HGWA 3A3YB 2YK1H 1MEXH 3WE1A 3ARGB 4L5FH 3DNKA 4AGLA 4JM2D 3GDCA 1MCOH 4XOCA 4F5CA 5F89B 1FZMA 1JWSB 5DSCA 1ZS8B 3AQZA 2AEQL 1MY7A 1WAEA 4MHHI 4M4PA 4ODUA 1R17A 3WHE0 1KY7A 2AF2A 4ZQKB 3W9EB 2K9UA 2VZ3A 3GD1C 4JKWA 1QTPA 1BD2B 4JUSA 1WWAX 2VR7A 3BD4A 5DI8B 1EHLH 1BZDA 2UVEA 4JCMA 4K7FA 2JK5A 4I0PC 4LEXH 4LLQA 5I1AA 1Q72L 3EXLA 3JWDH 1ORQA 4ZFFA 4XPHL 3T0EE 1NC4D 1UZ8A 3WFDL 5JXAH 3OM3B 2ISDA 4GSRA 2DQJH 2OZ4L 4R26H 1IUZA 1VACB 1XTMA 3C2SA 2F19H 1JE6A 1JERA 1KGYE 1OCWH 2H6OA 4ZQTA 1A0QH 2C9AA 4KY1L 1P1VA 2FRGP 1M7UA 4JFTA 5AWNH 2Z35B 3SQOH 3BMWA 5EEUA 1W0WB 4XHQA 3QVAA 1A7QH 4NQEE 3BZEA 1OTTC 3WKPA 1NEZG 4AQ1B 1JPTL 1OK0A 5CXPA 2YBGA 3GLEA 1U58A 3QG6B 2AXJA 5INCB 4IHOB 4JJOA 2F7PA 2MCMA 3W0WB 3TA3D 1FJ1B 2YK1L 3U0TB 3QJFA 3DO4A 3ZE1F 4WLCA 2JIXB 3IRCA 2NY1B 3DHUA 1UT1A 1QLFB 4ABQA 4BXVA 1F90H 2KPNA 1NGQL 1H8OA 4BFJA 2Q2EB 4UBDD 3BP7A 1PZCA 4TXVB 5DK0A 2O5ZL 2R2EA 3L7FA 5DZNA 7FABH 1D5XA 2OXHA 3QK0A 2WN2A 1IM3B 2HMIC 1DHKA 1W6LA 2CGYA 1A25A 3DBXA 3FTYA 3HS0B 2DYRB 1XSOA 3K5RA 5D6CA 2IDTA 1T1XB 1AZZC 2NXYB 3C5ZD 1XSJA 3L3IB 4FLRA 5FCSH 3VE0B 5C0JB 1YY9D 5LGJB 1NC2B 3QQ9D 2QZ5A 4OGXL 2OZ4A 1D7FA 1I3RB 3P0YH 2DIJA 1XAKA 3IVKA 4JREC 3RWHA 1XTLA 4GJTB 1T04A 2QFPA 1CURA 1XSKA 5I71B 3LQZA 4YDJB 3X1FA 5TF1H 3VGBA 4Y16D 3V4UL 4NDMB 4EI5B 3PV6A 1G7IB 1A0QL 1HWWA 3Q2WA 2FZ3B 3ARDB 4HUMB 4EKXA 5AOMA 4DP1X 5CFHA 1MFDH 2FO8A 1EVUA 3MRCA 4G43A 1B2WH 1A7QL 3VJ6A 4LHUD 3G5VB 3PAZA 4FYRA 1WZ1L 2CDFA 5JA8B 5TQ2H 2F8IA 4ZO7A 4G9FD 1S5HA 4QJ5B 4GUQA 5LBSH 2WY3B 4KVCH 1IC5L 1DL7L 2JNZA 3QZWG 2X4SB 1YMMB 3ILQD 5C08A 1CICC 1YY8A 4M4RB 3C6SB 3OAYH 4XWOC 1NEZA 4OU3A 5AG8A 3EGDA 3NFSL 5KVDH 4XMZA 4PP1C 1CFQB 1OQOA 1VEOA 4TLUA 4OZGE 1FNEA 1TJMA 3BZ4A 2HJKB 4XP6L 5BOJA 4V1DE 7FABL 3L5WB 2AK4D 4FZEH 1AMYA 4MQTB 1FYHB 2OR9H 4GSDH 4PAZA 4ONHB 2JI3A 1CICA 1SYVB 1B3JA 2W60B 3G5XA 1FVCA 4PRDB 3CFKB 1QI4A 5A2FA 2V5YA 3RZCC 1AYOA 1YQVL 3FO0H 3ATFA 1S3RA 1I7ZA 5EWIL 3IDYB 5DD6B 5CLWA 4LBEA 4OGXH 5KSAD 4IIQA 1AD0B 1AY1L 1OCCB 5AW0B 3LZFH 4PS3A 4EN3B 1Y6KR 4X5WA 4XNYL 4PJHA 3TJPA 5JLZB 5GGSB 2YBRA 2J25A 4YOKA 3WLWD 5TF1L 4PBDA 4WNQA 1ZHKB 3W39A 3OR6A 3CSYB 4R5XA 4Z5RA 3RDTB 4HHGA 5LNGA 4JKLA 3QARA 3GXMA 3DMMC 1HE7A 1FO0B 2D9CA 4IK7A 4H8VA 1EV2E 3CLFH 1EGJH 2OX5A 4L23A 4MJ5A 1WAAA 5TQ2L 3B9KA 4KC3B 1ZLWK 3K2MC 2LR4A 4PJ9B 4GW5A 1QO3B 2FX7L 4HWNA 4PJHE 1TNMA 3ZPDA 4MCNA 4OCSL 4R0LA 1G43A 3ZTJG 1T80A 4GNKB 4HJUA 4R5TA 3ZR5A 2P46B 4L4JA 1IC5H 1W0YT 4FQHB 5FM8A 3HC4H 5I6XB 2OK0L 5C7XL 4ODBD 2X0UA 3AQXA 2N7SA 4Z18A 3IKCA 2WQ8A 4HWBA 3ARBD 4H0IA 2AQ1A 3KBEA 5D7HA 3FOLA 3GM8A 4Z7NB 4N1EA 2VWEE 3QZWB 1NIBA 2PCFB 3RX7A 4HCGA 1BZ7A 5HVHB 5I8EA 5GS3A 2QL1A 2P8MB 3EJYD 5EU6A 1NUGA 4Q0XL 3W39B 4AVKA 1E2ZA 3E9UA 4J8QA 2R2CA 2MJWA 3KWWA 3OZKA 5CNHA 3X13A 4AL8L 5I0YA 3ARDD 4KI5F 2Z7WA 4HG4J 3IMVA 3NZUA 2EDXA 4HCRH 2J6EA 2NYYC 2YAMA 2IAMB 4PR5A 1MVYA 4KXZH 5B1AB 4LCVA 4AIZA 2H32A 5BZWA 4ELKA 2NX5A 1F41A 2QQNL 1NKOA 3G5XB 4GBXD 3IFOB 4GIPD 2QKIC 3SKNA 5E6ZA 3UADA 4F7MB 3RY6C 1DDTA 1MH5B 4YNYB 4J39A 5EBMA 4P23D 4IOSA 1OVZA 2AXWA 4KNQA 1PKQE 2F8OA 4IS6A 3W5MA 1P6FA 5BS0B 3I9PA 2JE8A 4JVWA 4QTIL 3MYJB 2EYSB 2VR3A 3KPOA 5G5DB 2VW7A 3IFNL 3KGRA 4HIJA 3QUHA 1M7IA 2H2SD 2DQUH 4G7VL 1RK1A 1Y1DA 3HC4L 3PFUA 3C5XA 5M94B 5A40E 3B2PA 4MCYB 3WKNA 2XXCB 2OYLA 3MBED 2FSEA 4JPQA 4WENB 3CBRA 2Y5QA 5DJDB 2WXRA 4OW6A 1EFXD 5TDNB 4UOJA 4NQTA 3AT0A 3BPLC 3EO0B 3UABA 3T3PE 1CD8A 4WU5A 5DD3L 3VFPA 1H3WM 5EORL 4DPCX 1WICA 5T1MA 3LVEA 1QNZH 3S4SA 5K9KA 1PZ5B 3ULUF 3RWHB 3QIUB 4U6HA 3VSQA 4QJ4B 2JELL 3NRQA 2ZWYA 1G9MC 3INUL 4RGOL 1HH9B 4G11A 5C0AA 4ETQB 2OMZB 4YHPB 3L3DA 2JJUA 2E6QA 5I15L 3KXFD 1XIWB 2O61A 3AFLA 3W11D 4JO2H 4ZODA 5A2IH 5L8LB 1ADWA 4LCUA 4BBWA 4O02A 8PAZA 2H3NB 2PNDA 2H1PH 3O41A 1X3DA 1EEZA 5HHMB 2Q3AA 2A4EA 3B7UX 4K7PX 1MIEL 2OI9B 1VAHA 4QRUA 4KTEH 3EGSA 4WHCA 1FRGL 3MA9L 3OJVC 1ACYH 3O8XD 4KK9D 1LK2A 1CL7I 2ZUWA 1UT9A 4K0OA 4BSWA 3WENA 5CCKL 1T3FA 2AQ3A 2PMZA 2V4LA 3CFTA 4RAVA 2C9UA 4CGTA 5KUKA 4I3RL 4E0RA 4KOBA 4J5VA 3THML 3FQXA 1S8DB 3AREC 4WDIA 3BUIA 4BCYA 5LWYH 5CJ8A 4GG6F 2R0KL 3FQNA 4E9YA 1M56B 1T6VN 5ANME 2I60L 5B39B 1S9XB 5GJTH 3FMGH 5C2UB 1BAGA 3P4LA 4HPYH 3HFFA 5DD3H 3SBRA 3IJEB 5I30H 2CO7B 3V0AC 2ZKHL 5F7EH 5F1NA 3SE4C 5E1HB 1VPOL 5A2JH 2Q5BA 1IAOA 1I3GL 4PS8A 2KHAA 2P5PA 4Y5YC 3U2SA 4RGOH 3MJ9A 5I2IA 2J1WA 5E8DL 1G9EA 1CE6B 2AJ3B 1DJZA 5KG9A 4JPSA 2ZAIA 2X3AA 5I15H 4QHNA 4S1SH 1U95A 3CVCA 1WBXA 2GY7B 1RIUH 1MHPH 3MJWA 2IQ9H 4GBXB 3CZGA 2ZOTA 4HK3N 3PAUA 4PJGF 1QVOA 2IV9A 2Z8SA 4LPUA 5F6IB 5CZKA 1INDH 2ED6A 3BH8A 3HRZC 3VB9A 4XBEH 3ESOA 2Y1ZA 1KDJA 3MFGB 1U95B 5E2TL 4ORGA 4I3SH 1G5GA 4HKJA 2C4XA 4DN4L 4KTEL 4TVPL 1I1AA 1PX3A 1B0GA 3OWRA 5DHEA 5EO0B 2ARJQ 2I9LB 3QZMA 3BGMB 4LSQL 4PLKD 3LDBB 1R9FA 2CDGA 3GBNH 1G7QA 1NMAH 2P49B 4F93B 4H2AA 1L9PA 3UYOD 2UZYA 3UTTD 3S8FB 5K9OA 5BZXA 4XH2B 3I9GH 4I3RH 2H2SC 4JFUA 3O6KH 4X7DC 2Q2LA 2BVOB 4MQ7B 4MNQE 4P4KA 5TQ0L 3TVMC 5HPMA 5HYSB 1YEJL 4HIJB 4YDVB 2J4WH 2X9WA 4FEMA 5SV4A 3SY6A 3TIDA 3QS3A 1P4BH 4YPGA 3C60A 1X7SA 4LAQH 1YNLL 5AYUL 2N1TE 5HGDB 5L4JA 1HCZA 2EIEA 3DX8B 2BVPA 1O6SB 4IIZA 5LAPA 2HKFH 4QPEA 2KYIA 2XRAH 1KTJA 1QBMH 1ECZA 3MV7E 5ADPL 3S3DB 4LU5L 4KV5E 4KXDA 3NIDF 3C5ZB 3I50L 2VLKE 2V9TA 4RMTA 3E6HA 1DANT 1D5RA 5CN2A 1ZLUH 5ID0A 4K8RD 1N0XL 4YSQA 3SDDC 2IQ9L 3JBG7 1AFVH 4NWTL 1N5AA 1PG7X 4GO8A 5AVTB 1OQXA 2IIJA 4HW6A 3N9GL 4GQZA 4JFDB 3QQ3A 1E9OA 2NUPB 3BO8A 3HLAB 4HF5L 3PLYA 1WLHA 2ZE0A 3G6AB 2H7WA 5FW6A 1A47A 2HN7B 3IAPA 5E2TH 3MRDB 2FBJH 4I0PB 4RAUB 1D9KB 4PPTA 3RFZB 5IB4B 4JFSA 5B3JE 2Z1KA 2ICES 4P3DA 1T0NA 3D69B 4N68A 1MHCA 3ARBC 1KJ3H 1KLGB 3GXFA 2PYFB 4M43H 3WXWH 2BCMA 1XGUB 1ZSDA 3V0IA 4Z7QB 1EBPA 2WMPB 4WV1B 5IVNA 1QSEB 1J5OL 2DQCL 2E7HA 1PTZA 5AVSB 1FIEA 5KBMA 3QDGD 2IOOA 1BBDH 1YEFH 3IMUA 4H5SA 1P6WA 2H0JA 3IE9A 3O3DB 4U6XA 5I8OL 4E9WA 3VA2C 4IMKC 4LAQL 4PP1D 1E9PB 2EXYD 3TA4D 1PPIA 3RY4A 3DV6B 3FB7B 2J1KA 2HKFL 2YPKA 4N2KA 1DQVA 2OZNA 3G9VA 1DE4A 1T1YA 2BHFA 4QAMB 1P69B 1RUAH 2HH0L 5ESAA 4LLWB 1B90A 3AITA 3ARXA 2DWEA 3GUFA 1JHLH 3SZKC 2N01B 2OSLB 5EUOE 2QHRL 5FYJH 2J20A 3EFDH 2X87A 3KVQA 3Q2CA 1IM9D 3RVUD 1LLAA 4RWHA 2B20A 4NC0B 3QUYA 4N22A 5A1AA 3CMOL 1AFVL 1E5ZA 4NWTH 1BW8A 4XNMB 5SWZB 1R4XA 1MH5A 3N85L 4YNYA 2J5WA 3A6OA 1K4CA 5C7ZA 4N2EA 5AQ0A 2AMGA 3HPLA 5BUGA 1KTCA 5L2KD 4PRDA 5CMAB 3MJ6A 3V0EA 4ESKA 3U6RA 1BBJA 3M7FB 5F3HA 4Z3HA 2VN5A 3K6IA 4JGMA 5DRXA 1MJ8L 1XEDA 2DF3A 3GLAA 4C4KO 5DUML 1WWCA 2RFXB 3MN8A 5TE7H 4M43L 5CIPH 5DHMC 1JV2A 4YWGH 2XDHA 1IBYA 1Y0LA 5E6IB 2ZUQB 1J5OH 3WFEH 3RNKA 2PWGA 3U1PA 3GSWA 3ECBA 3RU8H 4M48H 4A2EA 3CZKA 3MRQB 1B0RB 1QR1B 1RZ8A 1J0HA 4HYTB 3HMXL 3NVQA 1HXMA 2FSDA 3JXAA 3LJ3A 2MQ0A 2QPUA 3RGHA 2J21A 2O1AA 3T3PB 5T3XE 3ZXAC 2PXYB 4JFHD 2LTQB 4KZCA 1KC5L 2BFVL 3FONA 1COBA 3KGSA 3IJ9A 2O6FA 3G5VA 5J11C 3MV8B 4OM0L 3A0OA 1T7YA 4MAZA 1BJ1H 4AG4H 1GRWA 4PU2A 5T5FH 2L3BA 3QUMH 1E8YA 3JTBA 3QFDA 5DJ0B 3WELA 1P4IH 1TTAA 3OZLA 3EFDL 4JFYA