3F64A

F17a-g lectin domain with bound glcnac(beta1-o)paranitrophenyl ligand
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
175
structure length
168
Chain Sequence
AVSFIGSTENDVGPSLGSYSRPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSSARYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17a-G
publication title Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia coli
doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 45
structure length 168
sequence length 175
ec nomenclature
pdb deposition date 2008-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 3f64A00
1O9ZA 1OIOA 1ZK5A 1O9VA 1ZPLA 3F6JA 3F64A 1O9WA 2BSCA 4K0OA 2BSBA 2BS71 2BS8A 3FFOA
chains in the Genus database with same CATH superfamily
1U8JB 5ENWB 1FN4A 3L54A 1XR9A 1QEXA 4G1MA 1KTDA 3QEQA 4JM2C 5F9WC 3UG4A 5A7EA 2WBJD 4JRXE 5AW2B 3FO1B 4IKJA 4AEHL 1INQB 4K3HA 5DD0H 4B5ZA 1AQKH 3OZ9L 1A0QL 2V5RA 2PO6C 4ODTL 1ETB1 3NA9H 2NSXA 5KVEL 2AGJL 3ARTA 3O0LA 4BXSV 4Z3GA 5TH2B 5D2NE 1DVXA 2K70A 2ZAGA 3HAEA 2F1BA 2W80C 3NCEB 4WI9A 2A73A 4NBZB 4XP4H 4P5SA 1P0SE 4QRSB 2NRDA 4DHLA 3GKZA 4XXCC 1QSFD 3T0EA 3BO8B 1T1XA 1U8IB 3Q13A 3NSDA 5AW9B 4APQB 3WYRA 1FNGB 4ZBJA 4Y4KA 4PVNA 2ZUQC 4Y0GA 5E8EB 2ZCHL 4FQXC 3MCKA 1IC7L 2ROYA 5FW6A 4WWKD 2NX5A 4LDOB 2XIIA 1Z9SB 4YEFA 2TSBA 4P48A 1D7DA 3VVWA 3L45A 1MH5A 2FL5B 35C8H 3CMGA 4ESKA 1O7SA 1ZLVH 2WO3B 3UTPE 4LK4A 4U3XA 4LBAA 2P43B 1JUFA 4Z18A 3II3A 2V2XA 4FERA 3MLPA 2FB4H 1XBRA 1L7IL 3LKNA 1NCCH 2ADIA 2CO6A 2UY6A 5JW3H 5DJ6A 4JY6A 2BNRB 2ATAA 1KB5A 1AG6A 2J88H 2N59A 4R83A 4WW2F 5LCVA 2VABB 3RNKA 3T09A 5HSFA 1OP5K 2XN2A 4FG2A 3N41F 1OF0A 2SODB 5I1DB 4KQ0A 2DF3A 5B22A 5HHMB 1UXWA 3SPVA 3WFEH 4F7MB 3D30A 3OVUB 4ZOBA 5F3HB 4HU2A 3H7BA 4TQEL 1B90A 4UT6A 1SHMA 4UIKL 3RWJB 2C9RA 3BXNB 3VB8A 2DBLL 5J1AB 3ALXA 3TFBA 3HJEA 4LASH 4HT1H 4X9GA 4QXWA 5AVUB 1IRAY 2E8YA 1J9TA 1H9DA 3VGHA 2OLDA 4BH7B 5L2JA 1H3VA 5GGSY 3A67L 3GJFA 1RZ7H 3JTTA 5D7IF 3ZN6A 4LOFA 1A6WL 1EHLL 1F56A 3QZNA 3OR6A 2IAMA 4KJQC 4HIXL 3VDCA 2OYLA 2Y4SA 2P80A 3HN8A 3HN5A 2F5AH 3MRHA 3DPDA 1JGLL 5CM1A 4GQQA 2YAMA 1A6TB 3FT1A 5AD0B 2Y06L 3II2A 4HV8B 4NGHL 1EAOA 2AJYL 4I3SH 2G3MA 5IG7B 3SQBA 2XKNB 3BEWA 2I7OA 4YFDB 4E36A 1ZDSA 4N2EA 3KXFE 3O8XD 3RY6A 3WIFB 2NQCA 4M1GL 2AEOA 4RAHA 1DHKA 1QZNA 5BS0D 5DSCA 3A4DA 3MO1A 1T83A 1AMXA 2C3HA 3GHPA 3UJJH 3UABA 1W6WA 1JK8B 4X99B 1A3RH 3QCVH 1SGKA 2DYPD 3ZKXC 4QRPB 2VN5A 5I6XB 1EBAA 4CSTA 1NEZA 5HVWA 1OAQH 3BWSA 1EJOL 3QXAB 4PN6A 4PRPB 4AEEA 2H41A 1LTXA 4K5OA 2HPTA 3CZSA 4Y2DB 4LQFH 4NQEE 1XZWA 3HE7D 5EEWA 2GABA 2GBUA 1J1XH 3MI6A 1RU9H 5FO8B 4X6BA 1F3JB 5HHVL 5C0CB 3ZJAA 4D0CA 5FR3A 3GSQA 1ZIAA 4F9LA 3KLAB 1E50A 3JWDH 4IIQA 4JO1H 4DGWC 1T0PB 4X6CB 2ESVD 3CJJA 1IC5H 3QUZA 2IPTL 4PGDA 4QI3A 1BAWA 1S9YA 5TQ2L 3HMXL 1CFVL 3KLSA 1MCLA 1RJLB 3Q2NA 5FFGA 2DQJH 1AKJB 2OBGA 2IWEA 1U30A 5D4QA 4W9HC 1ECYA 4D0DB 1DN2A 2EEBA 2IADB 4OGZA 5EORL 5B8CB 4Q9RL 4YPJA 3FONA 3CZGA 4XPAL 4ELME 1UENA 1URZA 1YAZA 2PXYA 3MAWA 4FTVB 1NCJA 2CZNA 3WD5L 3TT3L 2ED7A 5C71A 2LFGA 4P2OB 1LO0L 2JMRA 4CADA 1B2WL 2XVKA 3D4YA 3C5ZC 2B9AA 3WEMA 5CJOL 3QIUD 1SQ2N 3FTVA 5SWZB 4YIQB 2EDEA 3MACL 4W4OC 3B7TA 2AV7A 4L3EA 2ZUYA 1NTDA 1WFIA 2AABH 4JHUA 5GS1B 2N0KA 3IRCA 4KRMB 3K6FA 4KU1A 3O3DA 5D9SA 3GMOB 5C0BD 4Q6IB 2APVA 4YHNA 1LP9A 3ARFA 1I4FA 2O5XH 3ARDC 5HGHA 4PJAE 4NZJA 5FM5M 2F8XC 1A9EA 3S37X 1UACL 2VM3A 2OZ4L 3IAQA 4NC1C 5IGXL 2V5YA 3MLRL 1W0WA 3PFUA 2F53D 1OAYH 3HJ0A 3ZLQC 4Y16A 4OLYH 3D05A 4X4ZA 3O45B 4JFXB 3WELA 3V55A 1JNNH 2FJGA 2Q8AL 4YHML 3D69B 5IBLD 4ZO8A 5DMJB 3OKLB 1U3ZA 4QTIH 4XMLH 5DEFA 1YUHB 1LD9A 2JLLA 4BQ8A 4UOZA 2GHWB 4G80A 5FKPA 3C09C 4OSUL 5T1LB 1TETH 2DI8A 2HX8A 4XC3H 2BY2A 4DN3H 3BZ4A 2Z1KA 4BELD 4EZJA 4GYBA 1JYNA 2AEQH 2QADB 5AW5B 4XPGH 3BIKA 1IGML 5KANI 1GC1C 1PSKL 2BOBB 2QLYA 3FO9A 3UJTH 4AIOA 2CIIB 1G1KA 25C8L 3BI9X 1UWEL 1MJ8H 2EIEA 2JJWA 4UM9B 2OSXA 5ECJE 4PJGB 1BREA 2OTWA 8PAZA 1BYNA 5CLXA 4BQBA 1JGDA 2EXYC 2VLRB 1BBJA 5F70A 1FLRL 2AHIA 3Q06A 4MWFA 1O6SA 1CGVA 1H6FA 1KN2H 1FUNA 4XO5A 3PDOB 3PQYE 4AYEC 2VB5A 1RPQA 2JVUA 2X6UA 1SQMA 2OCFD 2Q3XA 5JHLL 3ZKMD 3WE6B 2PYEA 2M2DA 4A7SA 3WBDA 4L3CA 4MQ7B 2NY2D 2WUBL 3NCCB 3F7PC 3FN3A 3FPXA 3MGOB 1INEL 3FQ1A 4YBQD 2VXQH 3VWJA 1IFHL 1BLIA 2UY7A 2WMPB 4J27A 5CCKH 4XNMB 5L2KB 3VRJA 5H8DA 2QEJA 3D0AA 4WWID 2E7LC 2ZF9A 1GTFA 2WJ7A 4QRRE 4RGMB 3E6FB 2E56A 3VD1A 4NKOB 4IKIA 3QUYD 4JG1L 1SXCA 4HIIA 5EMYA 1LILA 3C60D 1HHHA 1X5LA 1NDTA 5HHQB 5E5LA 5L4MA 1UG9A 2WLMA 4KMLB 4W9KC 5ESAA 4TOYH 5IHHA 1IO4C 2BNUA 1R3LA 1TKWA 3TT1L 3PNRB 1DSWA 2ZX5A 3Q9PA 2BVOB 3QPXH 5LAXB 2D7TH 2OTUA 4RNRA 1G7QA 3ZDZE 3F2LA 2Q2LA 3IJ9A 1TIUA 3C08L 3WTXA 1E40A 3JWNG 5IJKA 5JZ7C 2MCPL 3FSAA 3RX7A 5DRZB 1EDYA 5I1AA 2IXQB 2Z4QB 1GW0A 4X4ME 1IEHA 3QQ4A 3NZSA 4E9LA 2J5LB 4J1UA 3EDJA 1WBZA 2B4CH 2EYSB 1JHTA 5F7EL 5JLZA 1DVUA 3PF2A 5J12B 4HKXB 3JWOL 4LRIA 1QFOA 4LSQH 3UAEA 4AUJA 1ORSB 3BGFB 1OM3H 1IAKB 2FNWA 3ZKQD 4NKQB 5AW3B 1NCWL 2MJWA 1XR8B 5K1NA 1ICTA 4RAUA 4YDKL 2FT6A 4ZOEA 5E99H 3UTZB 3QVAA 1LO3L 3LVEA 3V6OA 1UZ6E 4GS7C 3ZTJH 1MY7A 2VAAA 4CDGC 2ZAHA 2CHWA 1OGAA 4I18B 4HJIA 1CE6A 4IGBA 4V1DE 3NCYP 2ILLA 2HTKD 5ACZA 1EK3A 1BDYA 3RX5A 4EI5B 4CKQA 2VDLL 5IROA 2E9GA 3MLWL 1BF5A 2EVGA 2VM4A 3QDME 2ADYA 2APSA 5E0QA 2O93L 3DX8A 1E8YA 2P7TA 1U4FA 3FAWA 4XP6L 3Q5YA 2GJ6D 3T3PE 5JNYA 4UMSA 3ULVH 4W70A 2DQ6A 1E5AA 2G30A 5F71A 1NCBH 1UGKA 4QWWD 5DTFA 3D0LB 3QZBA 4GQPH 1YEWA 1JRHH 5F88B 5I8KL 4ATTA 3FBQA 5EIVA 4K8RC 3KPOB 5D7JD 3ZDXE 4E41E 2WQSA 5IUCA 4HQQH 5L88H 4U0RB 4CC0A 1QFPA 4WFFD 5FDWA 5BRQA 4X5WB 2EYRA 3OHXC 4HFUH 3RWIB 1CICD 2YUWA 4G82A 3IN0A 3LIZH 3SYAA 2VH5H 5J6HA 4YLCA 3ETSA 4ZUVB 1RUQH 1AS6A 1GCYA 1SBSH 5HI3D 3L3KA 2F61A 3NCJH 3HPJB 2CXKA 4LF3B 1AC6A 7PCYA 5J6GA 1AHMA 4PB0L 4WU7A 1XGRA 2X4QA 4X4KA 4JANA 1NBZB 3CU1A 1IBHA 1VF5C 4MZ2A 5G4OA 5E8NA 2BVYA 4E5XG 1IEAB 2Q8BL 3WV0A 2WQWA 2HRLA 3SDAA 1U8LB 2A83A 2J2ZA 3QNZA 2KLTA 4K9EL 1DFXA 1K72A 4Z0XA 2YXVA 5ISZB 2CGYA 3C5SB 2Y0SA 1ROWA 5FO7B 3ZE0B 4OM0L 1U95B 1MQ8A 3BUTA 3MV8A 4LPTA 5KZCD 4YC2B 4D9RD 3RWGA 1D2OA 3O3UN 3VFOB 5BZDB 4Q74A 5IW6B 3TCLA 3A0OA 4TUOB 1YECL 5DD3L 1XIWC 4TNWK 2R8SL 1EEYA 3T4AB 1FG2A 5D2LA 1OLZA 4L05A 5CEZD 2A9ML 2WAQA 2HWZH 4KVNH 3WJLC 1TQCC 5IQ7H 3MCLL 3H3PH 4CVUA 3RI5K 3EYUH 5D5ME 3EYOB 3CUPB 1SHWA 2EIJB 1QYGH 3D2UA 4HJJH 4KI5E 4LOVA 1GAFH 2NY6C 3VJ6B 4FRWA 4AGMA 3F6LA 3OKNB 4FL4B 3NJJA 1CYGA 1E28B 1KYFA 1G7MA 2KBGA 1NCDH 2QPFA 3P54A 4WTZA 5A16A 5IIEA 3QDAA 2ZXEB 1KMGA 2YD1A 4GW1B 3BVXA 5SV4A 1T5WB 3CZKA 3ZKNC 3BQUA 4JFDB 3FT9A 2G2PA 1DN0A 2GIYA 2BSDA 2Z93A 3DJ9A 4JFFB 1ET8A 4I0CC 2FLRT 2HT2C 2AK4B 3PP4L 3E3QE 1BVZA 1WE5A 2IQ9H 4LHUD 3UYOD 4XNQB 3NSFA 1V27A 4X98A 4PJEB 2EDYA 1DQKA 3BPCA 4Y9CA 4RGND 4KHTH 3L4XA 4ZFOL 4NRZB 4R4BA 3QUXD 5GIRB 4LLMA 3NZ8B 3K6IA 3E1F1 5C97A 5JYLA 3FYEB 4H88L 5C0RH 4F8PA 2IDUA 2FIRT 4MJ6A 5F7DB 1TNMA 1BFOA 2GAZB 3PS6A 2Z31C 4ADJA 2F7IA 2YARA 1YEFL 2FJHB 4JO3L 1XH2A 3VQMA 2X0UA 5C0JB 3K2KA 4GY4A 3RVVD 3RGVC 4M5TA 4Q97A 2I7SA 2BXYA 2WN2A 3D48R 1LM8V 2WIMA 2E47A 2H26A 2E9IA 4X5QA 4RAVB 2R0WL 2CDGB 4OQTH 4U1GC 4HHGA 1WZMA 1KPUA 2WO4A 1CTOA 2WNWA 3GPSA 4PRNB 2UX6A 1UOLA 2OULB 4JM4H 1TQVA 4H25A 4IIZA 4MCYA 1XGPB 5F9DC 2R4SH 4WO4C 3EGDB 4GBXC 3W0WE 1T1YA 1VEOA 1I8IA 2OKMA 5CJQL 4EIZC 3L4WA 1F4HA 2APBA 2BW5A 2HG0A 5C0EA 7FABH 2XA3A 5D7HA 5ADPH 3ALPA 1NKGA 3ABGA 5FM4A 3DX0A 2IV9A 3M17B 4AY0A 3BDXA 4CC1A 5D4JA 5LWYH 3GMQA 2APXA 3QXDA 4NFCA 5TTRA 1OW0C 1MWAB 4ODBD 5ACLA 3F7RA 4OLVL 2N3JA 3IBOA 1T89C 1TYRA 2H2SD 5I0DA 4RGOL 4JLRA 2I5YH 3PWUA 5E6RB 3GHBL 1TTFA 4I3GA 3U9PH 4LGPB 4FJ6A 1HK6A 5CJ8A 4PJ7A 3U82B 2E3VA 1I1FB 4JB9H 3RFZB 3LV3A 4TPRL 3HC0A 1B6UA 3D51A 4ETQB 3MTRA 5D7SH 3TWYA 1RPUA 5MENB 3HCVA 3HAEG 5E8OA 3PWNA 4CVXA 3V79C 4G70B 4CU6A 5EZPA 5EUOA 1K4DB 4AITA 3BZEB 3I75A 4ZXBB 3ZKSD 5DMIL 2R27A 2DQIH 3EAKA 3DUUA 1FN4B 4G1MB 2BWQA 1KTDB 3QEQB 1AFVL 5CP3H 2WTRA 2IPUK 3A21A 1DR9A 2FATH 3VH8A 2FWSA 3MJGX 4G8GD 5I8CA 4KVCH 3WG7B 3VSUA 4I88A 3F7YA 5CR1A 2R2EA 5JHLH 1TENA 1DQLH 3L9BA 3P0YL 1LVEA 3TIDA 4M7LL 4HXBH 4GXUN 4AJYV 3IMBA 1KBVA 4PWIA 4MXVF 1MZYA 3SJVA 4GUPA 3MNVA 1ND0A 4OCNC 1UXLA 5L4FA 1G7HA 3HAEB 4QRTA 4YO0A 5T3XD 2A73B 3B9VA 4R2GD 1JVLA 4I0PA 4B3EA 4AH2A 4QHKI 3EGSA 4RX4D 5I5MA 2QLVB 4IOFD 3T0EB 1T1XB 1TEYA 4YQXL 1NDMA 3STBA 2OYPA 2VDRH 2VQUA 4L9LA 4S1SH 3SE4C 3N6YA 5JHAA 1EDQA 4Y4KB 4MXQD 2IMNA 3BAEH 2H0JA 2ZJSL 3LRGA 4OF5A 4MZIA 1HOCA 3MCKB 2EIMB 3VD0A 2NX5B 3ULVE 1KYOK 1IC0A 4E9SA 5J06A 2Z31B 1OTSD 1MH5B 4JW3A 3L5XL 3MLVL 4EN3A 1SDYA 5HI4D 5DO2C 3I6GA 3BWUF 3FT3A 1JUFB 1IT9L 5FA3A 1E9QA 2V2XB 4OIAA 1CK0L 1UA3A 3LKNB 4LSTL 2CJUL 2ADIB 2CO6B 2UY6B 5DJ6B 4JY6B 1KB5B 4IDJL 3QRGL 3TNNA 5F6HI 3RNKB 3MRLA 5DWUL 3C6LD 3ZTDC 2R1XA 5D6CA 3GK8L 1K9TA 2H9GA 1HXYA 3AXIA 4JJHA 2CG9X 1XCTA 4U4BA 4Y1AD 5AZ2L 5IZ7A 4PU2A 3RVXC 1UXWB 3SPVB 2WOYA 2FX8L 4MNHA 2QQKL 4AQ1C 2ED8A 4HUCA 3H7BB 5PAZA 5BXFA 2ZXBA 2AS5M 2DIAA 1MFCH 1U3HD 3UIYA 5L6YH 4HC1L 5B1CA 3VA2C 3TEZA 4TM9A 3S36L 5HHOD 5E2JA 3V6FA 5LG1A 2YR3A 5L2JB 1JZ8A 4HIJA 3GJFB 3JTTB 3OKOA 1XCXA 4JRYD 4KDTA 5ABAA 4DW2L 5KYNA 3OR6B 2IAMB 1P4BH 3GIVA 2DLIA 2DI9A 4H8HA 4MNGE 3V7MA 2JB5H 5IVXA 4XPBL 1UKTA 1R5VA 3MRHB 3Q2LA 3PG2A 4FXKC 4G11A 2EEAA 3OMIB 2PP7A 2VISB 3AVEA 1TVDA 3SQBB 4M62L 3BEWB 5I1CL 4EKJA 2NZIA 5B1JC 4IM8A 2HT4D 3BX7C 3BZFA 1JNLH 1CUOA 1OAUH 3ZIMA 1DBJH 2K3TA 3QT2A 5GQBA 3UDWA 2X6VA 4JM2F 4JE0A 5F7KC 4Y1TA 1HYSD 2DLEA 4FKKA 5DSCB 2IGTA 3MO1B 3ZR5A 1AO7D 3VYNA 3FU8A 1QSEA 1TJHH 1LWJA 4AIXA 2Z6FA 3K6NA 3VXUD 2H3KA 3VFUA 3PAYA 4WI8A 4L1BA 2XBTA 3WMQA 4EKXA 5IT2L 1NEZB 3VFPA 1OAZH 3CZLA 1W8NA 5D7LD 2GSIA 3VI4A 2J8UA 5DHEA 3TYFA 3EUDA 3QGVA 5GRJL 2F8OA 4FOMA 2ZX7A 4JG0L 2JCWA 3ASWA 4APQD 2F6AA 4H26A 4ZMLA 3VW3H 1UJ3C 1P4IL 2AJUH 3DXAD 2QT6A 4HS6A 1Q4NX 2XTJB 2XTSA 3UCQA 3LQZA 4FADA 4X6BB 2K45A 5IQNA 4D0CB 1S8DA 2JFCA 3GSQB 3L5WA 4QO1A 2DJSA 2AW2A 2B7DT 1ZANH 1LO4H 4IIQB 4X6CF 4LGRB 1GGTA 2XLLA 4PJDA 3QUZB 4PGDB 1XGYH 1YEDA 2CU9A 1EGJL 1WUZA 2OMBA 1S9YB 2LV4A 3N3EA 1BXVA 1TSHA 3NRPA 3PPSA 3V0AC 3CN3A 1SJXA 4UNUA 3FONB 2G3ZA 1KYDA 1PD1A 2PXYB 3S3DB 4KZDH 1EHNA 3OXRA 2DMBA 1FRGH 2W5PA 1KB3A 4KTEL 5CZVH 1F02I 5CCGE 3LQAL 4CADB 3QIWA 3KG5A 3VD2A 1E0OB 3VG0H 1VADA 4G7RB 3NOIA 3MA7A 4LCUA 1YPZA 3I2CH 4ZNEE 2FJUB 2ODIA 4X7FC 4AC2A 2I69A 3NTCH 3UZEC 2AV7B 3H9SD 4L3EB 2QKIA 3MFFA 1CFQA 1DVQA 3NIGE 4HYTB 4C55A 3CSYA 4O5LL 3SBRA 2EXWD 1MJ7H 3I50L 5FCSH 1DEDA 1T2JA 4GO9A 5LNEA 4N0YL 3O3DB 5D9SB 2EDOA 4O4YH 3QHFL 2R29A 2CNYA 3FN0H 1D6VL 4YHNB 5KYYA 1LP9B 3ARFB 1I4FB 4WGWB 2P4AB 5F97E 2R83A 2FE0A 1A7PH 2GJPA 5HGHB 1A9EB 3OZLA 3OG4B 4NWTH 3FFCA 5A6MA 4OF0A 1EAJA 1Y6MR 1RUMH 4FLSA 1W0WB 1LHZA 1N64L 2GIMA 4Y16B 5ID1A 3NZHL 2H32A 3BD3A 1Z0NA 2FJGB 4Z7UA 1M6UA 3KVDD 4PRID 5K1VA 2G60L 3OF6D 5DEFB 2BC4A 1PNDA 4PJBF 5F9JA 1LD9B 2NY0B 1YNLL 3UGUA 4U6TA 4G80B 3FU6A 5FKPB 4OLUH 3WTYA 1QTPA 2HLFC 4Y4HA 4CMHB 1AGBA 2XZAL 2UXGA 3TO4A 5JQIB 1T7WA 3BZ4B 3VXSA 4ODVL 5AOMA 4DERA 3BIKB 1YEFH 4OCYL 4UMGA 3TL5A 3Q05A 3FO9B 4J39A 5BRPA 4H0IA 4OLWL 3LEVH 4BK4A 4QRPD 2EZ0D 2B77A 4Y89A 2OTWB 1H6TA 1ACZA 1J9CT 3CC1A 1NLBH 1JGDB 4B9PA 2GCYA 3NJMA 4PRPD 1BBJB 4OGYL 4EBQH 1DJHA 2P1YA 2CJTA 4LCWA 4MWFB 1O6SB 5EC1A 4Z0BH 1JP5A 4BFOA 3NBNA 1XB3A 5EU6E 4Z23A 1FBIH 4EF3A 2K7PA 2PYEB 1HYRC 3K7UA 4H1LH 2VLJE 4PGCA 4NAMA 1NKRA 1FLTX 1TTGA 4L3CB 1N2RA 2UX7A 2BFGA 3VSQA 5KJ7E 5T3XL 3QJRB 3N44F 3AROA 1GGIH 3DNKA 4K9JA 1T0NA 2B16A 3HMWH 2UY7B 3TJPA 3AQYA 3VWJB 4FLOA 5I1HL 3VRJB 2YPKB 1S7QA 3PHOA 2ZX6A 4KXZH 4MQTB 5DJZA 4Z76A 1CDGA 4LO9A 1RZFH 3CFMA 4Y88A 1OSPL 3T2NL 4Z7VA 2YD5A 2Y7MA 4FTVD 4Y8AA 4HIIB 4Z3IA 1CL7H 2XFGB 4M6OL 5FCUL 1A7QL 1HHHB 3EYVA 1B4JL 5ESAB 4P2OD 3HN3A 2BNUB 1R3LB 1TKWB 3P02A 4P3DA 4U6XA 5AVXB 4L1SA 3RIAK 2OTUB 3PREA 4RNRB 1G7QB 4XXWA 3QDJA 4QGYA 3EYQC 4EI6A 4J3SA 5JHDA 2XVBA 1BX2A 3F12A 3TWCL 4FABH 2ICWJ 2I07A 3EH3B 4NX0A 5J3HC 4L1HA 3B9DA 5KOMC 5I1AB 1EXUA 3H85A 1J8HA 1NEUA 3SKJH 2UWEE 4MQSB 3QQ4B 4BA0A 1AD0A 2CR3A 2D3VA 4TRPL 1SVBA 4TLUA 4J1UB 4Z7QF 3S48A 4D8PA 1WBZB 5DZNA 4DKEH 1JHTB 5JLZB 3UFIA 6CGTA 5HGGS 5ITBH 1T22A 2V9QA 4HLEA 3B9AA 4MSWA 2F19H 4Z77A 4OZIF 4JN1H 1FO0H 4FNLH 2WKGA 1WISA 1MI5E 2XJKA 1KACB 4XAWH 4Q0XL 1KLFA 3WUZA 4MLSA 4RAUB 4GRLC 3B2MA 1QKZH 4HWBA 4OFQA 5KS9A 1QASA 1S7SA 2HAZA 2DIEA 2VAAB 4OZGF 2AXFA 1OGAB 4GUQA 4G6KL 4IGBB 1CE6B 1RK0A 2VW7A 2QADD 3ZMEA 5ACZB 5ITFA 3WJJC 2EDRA 2YLKA 1NMAL 2DQTH 2W9LA 4L8SA 3ZK0A 5IUSA 4UM9D 3OZKA 1EZUA 4X83A 1Q94A 4YHOL 1YMME 2BO0A 4LKCA 3D5OF 3DX8B 1OP3K 2P7TB 3RAJH 1JFQH 1AYOA 3Q1EA 4MAYA 5JNYB 2V37A 3CXDL 5H4ZA 4BFFA 1EEUA 1HIML 4K5PA 2DICA 5DTFB 4IRJD 3MLXL 3VGBA 2R0LH 1PEWA 3RBSA 5IP4A 2XNAA 3MUY1 1S6NA 4HKJA 3DX7A 3TH2T 3KYOA 3CZFA 2ZKYA 2D8KA 4KKBD 2XA8L 4IBVA 5FDWB 3FKUS 4XVSL 2EYRB 1KELH 3H0TA 4N2MA 3WOVA 3GT6A 4P9HL 1ESOA 3STZA 1TQBC 5J6HB 4F7TA 3H3KA 2O5ZL 4UV4L 4KZEL 3GI8L 5D6DC 3L3KB 3PNWA 4J6IA 3ULUD 2C3GA 2VR5A 3G6JA 5DS8A 5J6GB 4WU7B 1XGRB 3C5JA 2X4QB 4JANB 3TH4T 2K4AA 1ZLUH 2R0ZL 2J4WL 4J2QA 4UV7L 5E8NB 3DMMD 5CP7A 3PGFH 5HDOA 3O4OC 3SDAB 4XXDA 1MHEA 2A83B 2J2ZB 4AKOA 3QNZB 4M1CC 3QCUL 1ZXQA 1T04A 4Z0XB 1NFDA 1SNRA 2ZOOA 3BFWA 1NMCB 5EULV 1UD3A 3HI5H 2P5ED 2D03H 3ZE0F 5IQMA 2IFFH 3ZZQA 1UWFA 3VM5A 4WEMB 3MV8B 3VGEA 4BUHA 5HI5D 3KPLA 3T3ME 5C0GA 3K1DA 4PWEA 1X9QA 2FECI 2NCEA 3RWGB 2C7FA 3GNML 1TEFA 4MA1C 3SBWC 4TF4A 3TCLB 1CGSH 5FYLD 1RUKH 3ZPDA 3QEGL 4IRSC 2FECL 1QRNE 2PABA 1JF5A 3EJUA 2F2HA 4M7LT 1EEYB 2J20A 4QXGH 1FG2B 5D2LB 2ZKHL 3V9EA 1FL5A 5BUAA 2A6JA 2AJ3A 2VCOA 2F53E 3FSZA 5AKSA 1CTMA 1KIPA 5FKAA 2B15A 3D2UB 3BVDB 4JFHE 4LVOC 1BZ8A 1UJTA 4I9XA 2X4TA 2E9BA 1G7MB 4LLVA 5A16B 3WKYA 5F3FA 3TYGL 2EH7L 4DGIL 2QGDA 1IAMA 3BAKA 5IIEB 1H8LA 2ICEA 2PCFA 5A2LH 4NZDA 2HP4A 4P46C 1KFAL 3BQUB 1ZJBA 4AG4H 1DN0B 2Z93B 3JTBA 3TN0D 2P8LA 3ZUNC 1HI6A 2OYMA 5T1JA 3OG6B 4S0HA 1Z3GL 4UTAL 3TEXA 2F7QA 3KPTA 4UT7L 4X98B 4H7VA 4YLBA 1HHJA 3BPCB 3BWAA 1B2YA 1OIOA 1NOFA 3HBPA 5GJTL 3MYZA 2AK1H 4R4BB 4LLMB 2VUKA 4FQHA 4RDQG 4FQJL 1A3ZA 5E0FA 2LR4A 2V33A 4MJ6B 1BFOB 3V7AG 3QP3A 4YDZA 4OZ4A 1EUTA 4XBGA 3UBXA 1A7NL 4DN4H 1F5WA 4NB7A 2B5IB 2I9TA 1F8TL 2AVFA 3IBEA 4CVZA 5DZVA 1TJGH 4NRYA 3J8F7 5E70A 1MNNA 3AS1A 4YHPA 2EKSA 2H26B 4X80L 3I84A 1QI5A 3SGDH 3DO7A 1WWAX 1KBGL 2YD0A 2ZXDA 1KXQA 2YGQA 4EO5A 1ET5A 4I9WD 1XWVA 4OR1A 2VKWA 5CZRA 1KPUB 1R33A 4C4BA 2ETWA 1JS4A 2AKRA 1G1YA 4FYQA 4HZLA 3J27A 1J1OL 2ORBH 4H25B 3U6XA 1ILSA 4QNPF 1D6VH 3MLSH 4FD0A 2BSEA 1ZGLA 1T1YB 4R8WH 1I8IB 1IAII 4KBPA 5C7ZA 5C0EB 1DJXA 4LNRA 5BMFL 1ZLSL 2MPAH 3D18A 1RSYA 2GTZA 2KERA 2KPNA 2J56A 3QFJE 4KKCD 4GIAA 4MXWL 3S35H 4ALAH 1JNHA 1IAIL 2KQMA 3GMQB 3QXDB 4X7TA 4LSUL 3VH8G 1JPTH 2CCWA 3VQ1C 5AZEL 4C56E 4JLRB 4NP4L 3PWUB 4Q9QH 2ALWA 2LVCA 2EC9U 3SPIA 2A4CA 5DRWA 1UFGA 1UM6L 4PJ7B 1P1VA 2ADJA 5H37A 3LV3B 1MFDL 3HC0B 3CVHH 2IANE 2ZSWA 4NQQA 6TAAA 2GJJA 3HCVB 4IMKA 5E8OB 3KBEA 4G6AD 3PWNB 1S46A 4MA1B 4CVXB 5M94B 3U9WA 5FEBA 5EUOB 3AT8A 5I8OL 4YGAB 5E94A 3I75B 1FZJA 4I1NB 1XF2A 2YKLL 3DUUB 3DYOA 4XPFL 5IVNA 2H0PA 1QNIA 4GAAA 3HG0A 3SPHA 2WTRB 1H15A 4IJ3C 3HG4A 1DQMH 3B56A 4NXSA 1ZD6A 3VH8B 1PVHA 3REVB 5C0ND 2IVFC 5I8CB 1CO1A 2MKWA 3F7YB 2R2EB 1CB4A 2WGXA 1NWOA 2WKLA 3BDYL 1ZVNA 4KJPD 1VFBA 4L1LA 3TIDB 4BZ1H 5DUPL 5GS3A 3PGCA 2AEPL 3AJ7A 4OCXH 4MAZA 5GZOD 1DVFA 1T0OA 4PS3A 2AK4D 2PUQT 3SJVB 4GUPB 3UAJD 3MNVB 1ND0B 2BIHA 1G7HB 3NAAH 4QRTB 2YO3A 4YO0B 2WQRA 4I0PB 4AH2B 2Z34A 2YUXA 3EGSB 1SDDA 3SE3C 1AOZA 5B21A 4ICXA 5KBLA 4F8NA 1NDMB 5E95B 1LMIA 4L9LB 3PDDA 1B4TA 4O02A 1UWYA 4PV8A 2DDQL 4NHCL 3QIBD 1HOCB 2YAOA 4IOIA 5D71H 5JO5A 1UM5L 4WCYL 2Q5BA 1SPDA 1S7RA 3CDZA 2P5WA 4I48A 3HTLX 3EYSL 4WRLA 5M95B 4XN7A 1MJUL 4EN3B 1JBJA 1SJHA 3Q8CA 3FK3A 4BJLA 2QR0A 4L4TA 3RUGA 4I3RL 3I6GB 1OWWA 3FT3B 4JQVA 5FA3B 1E9QB 5T1DL 3FTGA 4HWEL 1PX8A 4NNPL 4P0DA 2D3JA 2FX9H 1PF3A 3EHBD 2YAPA 3RWEB 4DPAX 4JR9L 1D5IH 1U8HA 2R56H 3QDGD 4JL1A 3TNNB 2GY5A 3DX6A 3MRLB 4FEIA 3EO0A 4MJ2A 1OAXL 2R1XB 3P1VA 5D6CB 2H9GB 1HXYB 1JGUL 1XCTB 1GA2A 4M9PA 1GJIA 2P44B 1IE4A 2R0KH 3SPGA 2XQ0A 1QHQA 3QJXA 1ASQA 1QWHA 1DJGA 3RY4A 1TJXA 4MNHB 5FGSA 1FORL 2I60L 5ILTL 5BXFB 2UZPA 3SIKA 1GS7A 2UVFA 4NZFA 3NABH 4OZFH 4JHAL 4ADIA 3P2TA 3S3CB 5BV7B 4FXTA 3HG1A 3WN5C 1JN6B 4UANA 4AK1A 3AT0A 3V6FB 1VPOH 3HI6L 2HJFA 4EEEA 3DV6A 4HIJB 3LEYL 1OGPA 2QMKA 5LVEA 1OLLA 3OKOB 3O6ML 3ZXAC 4MNQA 1ZCRA 4NO5A 4G7QB 3GIVB 2C34A 4BCYA 2VDPH 4ZO9A 4GSUA 4GP5B 1R5VB 3EJYC 4EXPX 4FCHA 3T2LA 3G5YA 1SUJA 2AI0L 5I71C 4U3SA 4A2LA 3NACH 3AITA 3IDIA 1JWUA 4GAFB 1PJWA 4M93B 1QUPA 4N2GA 5CEZE 4PR5A 2X2IA 3SDYH 2ENQA 3JT0A 5FUCE 1KJMA 3BZFB 1KXVC 4PBVC 1W9XA 5CHNA 1UASA 4TNWF 1E4XH 3B7UX 5FYLL 3ZW3A 5HDQL 1WA2X 1KTLA 4N2OA 4S0SD 5HGAA 3M7OA 3IN2A 3O3BB 3BFOA 3EOTL 2J1XA 1AJ7H 3RI5F 3LYRA 3HS9A 3LB6D 4PUBL 1QSEB 4WI3A 4HGWA 1X5ZA 1HEHC 3VFUB 3IMSA 3EOBA 2GVYA 1FYHB 5DHMC 2XJLA 1YEHL 1JK9A 3V0GA 4NQCA 3KYAA 3VFPB 4FLRA 1ZTXL 2XN9B 2GSIB 3VI4B 2J8UB 3TYFB 4GOSA 3T0ED 4GRWB 2VW6A 1P84K 4H26B 4BFJA 2IV8A 2FRGP 4Y4KD 1U2CA 1MQKL 3MV7A 4HS6B 5SWQA 1KCSH 1QAWA 3FB5A 3UG3A 4AV5A 2H1PL 3LQZB 1KZYA 2F54E 4JKKA 1KSRA 4HUMB 3M8OL 2NX5D 1S78C 3L5WB 4QO1B 4HPYL 4LSVH 4XHJD 4LNVA 2H6OA 4PJDB 3FFDA 3QNFA 5HVHB 1YEDB 2ZUXA 4EIUA 1QLEB 1AACA 1GSKA 1DBBL 1ZKAA 2M8XA 4WTXA 4NKIL 4LSPH 3KPPA 3ISRA 3RDTC 1Z9LA 2J57A 4J3BA 2N0MA 3HC2A 2KHAA 1HKLH 3K2UH 4Y4FC 2F7OA 1S3KL 4P5TC 1MDAA 5IBUB 3AAZA 3QIWB 1FFTB 5H2BA 3DV4A 2A74C 1YUKB 4G6JH 1VADB 4OTXL 3MA7B 4LCUB 5I15L 1YPZB 3WNJA 1RLWA 3X1NA 3WIHL 2ZCKL 3L1OL 4NWUL 2YQ3A 3IM1A 3FXIC 2QKIB 1DVTA 1MXGA 2A6KA 3MFFB 4F3FA 1CFQB 2Q86A 4I85A 3CSYB 1HQRA 4Z7NF 4LEEA 5K9KA 1FDLL 2IMMA 3RQ3A 3ATBA 3GRWL 3NESA 4IHOA 4LL9A 1E5YA 3MJ6A 5KYYB 2XX0A 1K8DA 2NY5C 3TVMA 2X0WA 1IKFH 1SHSA 4LVNC 5T5NG 2IAMD 2ZWNA 3PU7A 2YPLE 3FFCB 5EZJA 4BEIA 1E2ZA 1K4CA 4WLCA 5I18L 5ID1B 2W38A 2H32B 3MMEA 3T04D 1RLBA 3AMKA 4RVBA 4Z7UB 1OHQA 4QYOA 4ANUA 5HGDA 5F9JB 2AZUA 2BC4B 5FIEA 3IWUA 2HCZX 5AL8A 2Y69B 3DUHA 2PP8A 4Y4HB 3L5HA 1AGBB 4Q6KA 3TO4B 3LY6A 5LJYH 3VXSB 4AX3A 4JREC 3ZTEA 1P6FA 3L7EA 3OPZH 2A9NH 2X1QA 1NAKL 3JUZA 3KYNA 4W6WB 1UTDA 1BOYA 3L08A 1IBBA 2V5SA 2ZT9C 2BERA 4N5ED 4RZKA 4UAOC 4X80H 2AV1A 5E00A 4ZUWA 4JGNA 1OE1A 1OE3A 3D6GA 2GCYB 5KAQG 5D1QE 1AXIB 5TK2A 3PXHA 2HMID 4QRQA 4LCWB 1XD1A 2BH0A 5EC1B 1S9KC 1OARH 3BP5A 2JKSA 3LH8A 4XNAA 1W8EA 5JMRA 5IBTH 3NYKA 1CFTA 3GBDA 3F7QA 2P46B 4JMXA 5DJ0A 4MMXA 4PGCB 4K7PY 3QR2A 5DD5L 1PG7L 1N2RB 1XTMA 2F1AA 2CPUA 3SY0A 1UM4L 4NQVA 3KS0H 4HIPA 3B83A 2ZNXA 1F4XL 1CCZA 3DROA 4P23C 2G5UA 1T0NB 2RB8A 1YDPA 3BKML 3F7LA 2X7LA 1FWXA 1I8AA 3KLDA 3PHOB 1S7QB 5AW8B 1E8ZA 3ZZSA 5DJZB 5CJBA 4Z76B 5DUBA 2J8OA 4Z7VB 1XQ4A 4TKWA 1GTNA 1I3UA 3EYVB 1WC7A 1KULA 5JPNC 4WHTA 2JELL 2VDOH 1FCGA 3KWTA 1TFPA 5LGHL 3APCA 4U6XB 1GGCL 5DJXA 2HRGA 1NCAL 3QDJB 5DRNA 3FCUB 1TTBA 4EI6B 2G9HA 4L3ED 3U1SH 3UOAB 3HBGA 1BX2B 3F12B 4BH8A 4ODSH 2MQCA 1M1SA 2I07B 4GXVL 2BHZA 3UP1A 1PIGA 4Z7WF 1AGFA 1JERA 1EXUB 1J8HB 4CN6A 3CX2A 5C08E 3D7PA 3WFDL 3AM8C 4S1QL 5HHOE 2F15A 4HG4J 1AD0B 1FHGA 1Q1JH 1T21A 3OJDA 2FZ3A 3ARFD 4UIMA 3ZQXA 2G3NA 4MA8H 4NPKA 3P11L 2MQGA 1T22B 3BDYH 2OSLA 3CVBA 3V4LA 4MSWB 1UVQA 5IHUL 4Z77B 3I6KA 5EU7C 1E6JL 1YNTF 4J6RL 1JZIA 5DA4A 2JI3A 4Y16D 5GGSA 3W82A 3BE1H 2EYTA 2W65A 3E7JA 1ZAGA 1KLFB 3VXRA 2IBZY 5CSBA 5KS9B 1CZ8L 4WWNA 2WZPD 1E9OA 3TBVA 1S7SB 2AAVA 1ZLVK 4DO5A 3QZPA 2AXFB 1NUGA 3MRFA 1A6UH 1TJIH 4XNXH 1RK0B 4ABWA 4TULL 2FCBA 1X44A 5F72S 2CA3A 3V0HA 5ITFB 1IJ9A 3DWTA 2HFFA 3SO3C 5FFLA 1NIAA 1NOLA 5D1ZC 4NNXA 4J7RA 3D07A 4MXVE 1XGUA 2C4FT 3QS2A 4UOW0 2R1WA 1Q94B 1Q8MA 4LKCB 4U6VL 1TVHA 3L4VA 4XP1L 3F83A 3AS2A 3HFML 5DGQA 1VKXA 3FTSA 4MAYB 3S8GB 1G4MA 1QQDA 4PGJA 4PWKA 2Y9RT 4ANVA 1WITA 3GEFA 1P5VA 3A6BH 3OWRA 4QY8A 15C8H 1G5GA 2XNAB 3MGTA 3ILDA 4HKJB 1G1CA 5SX4H 3H42H 3CZFB 3OKEA 2WXLA 1JZ7A 3WTTA 1QW8A 1BPVA 2BVEA 3DDGA 3H1ZA 1XH3A 2F5BH 3H0TB 5GGRA 2BVQA 5E9DA 5CJ5A 2AP2A 3VWJD 1A25A 3OHMB 2ED6A 3STZB 3W5MA 4F7TB 1X9UA 4NN6C 5IMMA 3ULUH 1O7VA 4YHZL 2OI9C 5FYJL 3VXOA 2Y5TB 3PNWB 2ZCZA 1OY3B 2UZXA 2BNRE 3G6JB 3RZCA 5DS8B 3BPNB 5KW9H 1ILUA 3SODB 2FEEI 4CGTA 3F62A 3C5JB 3SE9H 3HFFA 1RK7A 2Q1EA 3VXME 4LOUD 4MQXC 4R5TA 5CP7B 2WB1A 2QSTA 4XXDB 2FEEL 3T08A 1MHEB 2QTEA 5HHME 2ZSVA 2BMKA 1T04B 4EOWH 1BM3L 2AQSA 4D9QD 1NFDB 1FNSL 1NBVH 4ZTOH 5KVFH 3WEXA 1MPAL 1KB5L 3QQNA 1TEGA 4PG9A 2X1XR 4AVJA 1BIHA 5T8IA 5I19H 2YZ1A 3GM8A 3KPLB 5C0GB 5CF3A 3GMMA 2WW8A 4E9TA 2E76C 4JO4H 1MFEH 4DETA 4KHXL 4YZFF 3LKQA 2R9HC 5DWPA 2JJVA 4MHHG 3MOQA 4HUXA 1R5IA 4XRCA 2VLKA 1CR9L 2JV6A 4YXHL 3KS0J 4JFEA 1RAMA 1FL5B 2A6JB 2CO2A 2AJ3B 4UCFA 4H20H 1KIPB 3NEXA 2FR4A 2YGNA 2YA2A 5FKAB 5FHBL 4MJ4A 4PJ8D 1TZGL 1M2VA 4XHQA 3S34H 1CLYH 3JWNH 5CBEA 4TL5A 2W9DH 4J4PA 2DLHA 2X4TB 3UROR 3MKGA 4LLVB 1KEGL 3U4AA 2WZAA 1BP3B 1OZUA 2HYMA 4BGLA 2ICEB 3WIAA 2PCFB 3M1OA 3ZL4L 5F1SA 4IGBD 4PLNC 3O6KL 4WV1A 1U3YA 3W57A 3QYNA 3F65A 4XO8A 2EE2A 2P8LB 4TSCL 1HI6B 5BVJA 1BZ9A 1W0YT 4QTHA 4LSRH 1T03L 4Z7AA 2A0LD 1FGVL 1MFBL 1ZA6A 2VJ8A 4BE5A 2Y72A 3RGBA 2RCSH 4G1EA 1HHJB 1DBBH 2VW4A 1H19A 3BWAB 1HL5A 2B20A 3BP4A 3D1MC 2H3XC 3GMNB 5HJBA 3SGKA 4FQHB 3ECQA 5CKAA 3ATAA 4TSBH 5GZND 2V17H 4KX7A 4CW1B 1TITA 5CU5A 5JIQA 2A6DA 2XT1B 1ZT7A 2JKWA 3FQNA 4KKAC 4OZ4B 1MEXH 3TA3C 4XBGB 3UBXB 3TP4A 1C5CL 5C0CE 4A6YA 1F97A 3T65A 4M5YL 4X7SH 2I9TB 2PWFA 4CVZB 4UTBL 2OZ4A 4NRYB 3NN8B 2A38A 4X6CE 4OF3A 3BW9A 4NSKA 3O0RL 4WSKA 4YHPB 5TFSH 2EKSB 3BN3B 4AL8H 5EHFA 4U1IA 4KQ3H 4BRVA 1PMYA 2JCCA 5KVDL 3DO7B 1ZA3A 2F9BT 1DLFL 4KAQH 4N8CL 5H37G 3OJVC 2AKRB 2CPCA 2D7NA 4HZLB 5SWSA 3V6ZA 1HNGA 3DUSA 3QI9C 3CN1A 3E1ZA 4OB5H 4BSJA 2ITEA 3Q9QA 2X6AA 4IKKA 4UDTA 5KTEL 3TCTA 1ZGLB 3FAXA 4W93A 4LU5H 2GK2A 2NPLX 2XG5A 5JXEC 1GGBL 1GOGA 4LNRB 4BRJA 2O6PA 3AREC 4G6FB 2BVTA 5ALBH 8FABA 3D18B 3RDJA 4JY5H 2GTZB 2VXTH 4OAWA 1JNHB 1JZHA 1M7XA 4HZAA 4JRWA 4APXA 3WI9A 3ENEA 4KTGA 4O9HL 4X7TB 1Q1PA 4C4UA 5C09B 2ITCA 4IMLA 5SWZE 2GYSA 2BM3A 2KDGA 4NQDD 3LPFA 4YNYA 3GO1L 2WBJA 1JZ5A 3QJSB 4K7PH 3RPBA 3F64A 4KZDL 1FVCA 5DRWB 4ORZC 5DMGC 5I75C 3RIAF 4Y9GA 2ZYIA 3QE5A 2ADJB 2NNXA 5CZKA 1CMOA 2ZSWB 4F58L 2Y1VA 2ZWSA 3S97C 1E4JA 1VESA 1X5IA 3DGGA 4XI5C 3RVUD 3P0VL 1WFOA 5IFHH 1H6UA 5E94B 1D2PA 1ES0A 1FZJB 1HE7A 3W38A 1U92A 1XF2B 3SDDD 2OCCB 1U42A 4WI5A 1QSFA 4WQOA 4ZO6A 3QS3A 4HUKB 5D1XD 2O5YL 4UB0L 3WE1A 4UQIM 5AVWB 4IRZH 1H15B 1IE5A 2Z64C 4H8WL 5IESH 3PJSA 3BGMA 3JWDC 1YEEH 1N5YL 3MBEA 4KVPA 3V0WL 2Q10A 1RIUL 1VFBB 2DTMH 3BSZH 3GS4A 4YDLC 2D7MA 3PGCB 1JHKH 5DUMH 3L5JA 4PFEA 4AQ8A 2GEQA 4WFED 1DVFB 2QQLH 4JDZA 3RB7A 4R0LC 3TC9A 5IWLA 5GGTH 4Y2LA 3CFQA 3SCMA 1QBLL 2K9UA 1SM3H 1B4LA 4PJGE 5D96B 4FFTA 1SDDB 5DD1H 3RFRA 5J7CC 5IQLA 4HALA 2DMGA 4NLHA 2VLRE 5HD8D 4O02B 4HOZA 4OFPA 4OU3A 1JPEA 1TDQA 3NCWA 4LLUA 3TJHC 4PV8B 1JI2A 1ZLEA 3BRDA 3WXVL 1MFAL 4IOIB 4NJAH 5JO5B 1UWXH 1S7RB 2V6HA 2JELH 1E4WH 1BEYH 2P5WB 3CDZB 4G72B 4GKLA 2WTOA 4I48B 2YJLA 4MGXA 5C6TH 3C8KA 1CIDA 4YBLB 1SJHB 3DARA 1KB9J 2QR0B 2Z7UA 4L4TB 4TTDC 3RUGB 5T5FH 2NY3B 1NBCA 4PYHA 5HYJD 4TLSA 3FTGB 4PJ9C 2E4FA 1NKOA 2ROXA 3IF1A 4LPUA 5L2KE 4YSDA 2WB7A 3WY2A 3U6RA 5DEGA 4Q14A 1KTKE 1U8HB 4X8JA 1L0QA 5F7HA 2G9KA 3DOSA 3DX6B 3HC4L 3EO0B 4AZ8B 2A3TA 4M00A 3ULUE 2YAEA 1WYJA 5D70L 3MNZA 3A4FA 4KI5C 1C5BH 4GG6A 2IH1A 2N01B 4XVJH 1X7QA 2EH8H 1G9ML 1G7PA 2CRIA 2WVSA 1CDIA 1JVOA 1MWAH 4PJXF 4MD0A 4HJGA 3FDWA 1NDGA 4OVUA 3E8VA 2WIIA 3PJNA 3HG1B 1ZY9A 2CSPA 2L04A 3CHQA 4DZ8A 1BF8A 1K2DA 5KVFE 1X9RA 2X12A 3WFBL 3MJ9H 4HBCL 2HJFB 3DV6B 2BJMH 5FGBC 5BS0A 1SYSA 3HNSH 1OQOA 1RZ8A 2FO1A 4MNQB 4NO5B 3M6DA 4M6MH 5JIHA 1BFVH 3DVFA 4UQBA 2DYPA 5C2BL 1GYVA 3X1EA 5F0LB 1KG0A 1CGYA 3G5YB 2NY4C 1BGXH 2V8MA 1CGUA 4U3SB 1XO8A 2EEFA 3IDIB 5D8JH 1JWUB 4OZIE 2XOTA 5AWNH 2X4RA 4PR5B 1SY6L 1I53A 2HX9A 3HB3D 4MAUH 1KJMB 3HE7A 2DLTA 5CHNB 3HFMH 4AEIH 1I1AC 1OCZB 2ZG2A 3HBZA 3K46A 1KTLB 3TZVD 4POZD 5HGAB 5FECA 5I30L 3MU3A 3OAZH 1MJJA 4Z95L 2YRPA 5EN2A 2ESVA 4NPYA 3S37H 2CO1A 2FIKA 4HGWB 4LLYA 4NZTH 3EOBB 1R3KA 4KO5A 4P4KA 4AGLA 4M3HA 1JK9B 4NQCB 3GS0A 3RNQA 2FGWL 3AB0C 3LOWA 1F0LA 4NM8L 3B2VH 3VYOA 4ZDHA 2NT0A 5HJGA 2EC8A 4R6UA 4AK2A 3MV7B 3SBPA 3TV3L 2PLTA 5SWQB 3IVKA 3FB5B 2XYBA 1MCOH 2VDNL 5GGVL 1YN6A 1FH5L 1UYWL 2Q3ZA 4UNTA 3CFCL 3M7FB 1HC1A 5FPIA 3VTMA 1KGWA 4JGUA 1Q0EA 1JMZA 3K0WA 2R7EA 4M7JL 5CWSA 4EN3D 4FA6A 3FFDB 1HN1A 1MCSA 4JAMA 1NGPH 4OZHA 5KVGH 1QPXA 3OV6A 4LRNH 3QAZB 4ANWA 4OCMC 3L3OA 1RZKL 4BWWA 4WUUA 2R4RL 3KPPB 5LCVH 1WFUA 1AY1L 2FH8A 5CN1A 5C0BA 4A2GA 2X1WL 1J1PL 3DOHA 1BQ5A 2B4CC 3HUJA 3RU8H 2XUWA 3VFMA 2C1OA 3E9UA 1AE6L 1DUYA 3AAZB 4LFHG 3RZWA 5H2BB 3DV4B 1R9FA 3WENA 4FNRA 1FAKT 4RRPM 2BHYA 1W2KT 4UT6H 2W0LA 1F2QA 5ERWA 2QHRL 3BKYL 4WNJA 3UAAA 2WXJA 2A6KB 5AVRB 3T0WA 4F3FB 4WHDA 5DVLA 5ISZE 5GGVY 2Q86B 3TBCA 1HQRB 5K9KB 3ZE0E 4RLDA 1NSNL 3ZHLA 3GJFH 1SBBA 1RVFH 2YSTA 4IHOB 4ZAKD 4WKZA 4LIQL 1K8DB 3TVMB 1SMOA 3O6FC 4YUEH 3IDMB 3X14A 5A3IC 3SHSA 3IFNL 3BN9D 3WUWA 5EZJB 1SXNA 1K4CB 2GC4C 2A4EA 5LBSA 4NZRH 2VXUH 5J5EA 3MMEB 1WCBA 3Q8EA 2MTPA 2O6CA 3P0GB 4CSSA 3KLHC 4HCRH 4Z7UF 4EDWH 3VSTA 3NQKA 2IPUG 4QYOB 5HGDB 3ULVC 3KPQA 3MZTA 1IQWH 5IOPA 3FUJA 1FE8H 5FGRA 1XHHA 4OIFA 4F27A 3HR6A 1ORQA 4OD1L 2XICA 1DQJA 2OR9H 4MJ5B 4OIIH 3D33A 1YEIL 2X88A 1EO8H 2D3LA 2F58L 3FQYA 2CBTA 2VKXA 3R1GL 4PJHF 2XZQL 3O9WD 5EOQL 3L7EB 3MUGA 2LT9A 2X0VA 3CZUB 2BS9A 4JFDE 5GRXG 3D52A 4YHYC 3KYNB 5KYUA 5F8QC 1W6LA 3QA3A 4JFFE 1OWRM 2CMRH 2AK4E 1EFQA 4AVHA 4QKTA 3NFNA 3VFSA 5E00B 2AV1B 4ZUWB 4XNUH 3EJTA 1EVUA 3O3AA 1RH8A 2BPBA 2Z65C 3OGCA 1LWRA 4RZCA 2K7QA 4LMQI 4L4VA 4QRQB 2PO6D 2C1PA 2C3WA 1I9IH 2FDBP 2VZSA 5GHWL 3BP5B 3C60A 5KJRH 2NY1B 1DFBL 4FFWC 4C54A 1L7TL 4Q89A 3MLYL 3T2PA 1CFTB 5DJ0B 4MMXB 2VZ1A 4J3OF 3ZE1F 2DWDA 5AOLA 5CNHA 3N0AA 5D4HA 1NGWA 3DTXA 2IALA 3LS4L 4JPWH 3SY0B 5AL0A 4NQVB 4DUXA 1KGUA 4E9QA 9PCYA 4A39A 3DROB 4Z8FL 1UZ8A 1LXMA 5E2VL 4HPOL 1YDPB 1BZEA 2X7LB 4FQIL 5FYKH 1KIUA 4FQXD 3UADA 5EN3A 4YDJA 5DUBB 1NJ9A 3HPLA 4DP1X 3FMGH 1CTNA 2AJXH 2KZWA 1RY7B 4G9FA 2CD0A 1KFGA 3ARBC 1WC7B 3DECA 2AVGA 4WHTB 2Z91A 1YEKL 4QNPE 5E08L 5A2JH 1FAIH 1KENH 3VFGH 3WXWH 5TE4L 5DJXB 5CBAA 3B37A 3CDYA 5KSBA 5DRNB 2XXGA 3LH2H 4B7LA 4HK0A 2G9HB 5E8DH 2MOQA 2OJ1A 4BFRA 1G6RL 5I1GL 4BH8B 1CE1H 1AGFB 2YS4A 4HXAH 2ARJQ 2C3VA 5ADOH 5F44A 3MLZL 3L4ZA 3B6SA 3EJPA 4LCIH 4KXCA 4XOAA 4RFNB 1KYUA 1T21B 3OJDB 2FZ3B 4UIMB 4JRXA 3QUML 4R97C 5E6IC 4P9MH 4P5RA 5DR5L 5HYEA 4JO5A 2OSLB 3FFCD 2FHCA 1YZZA 1AQMA 1OALA 1UVQB 3KHQA 3I6KB 3RWCA 3MLTA 5MENE 1ACXA 4FXGA 5GGSB 1IC4H 4FQQA 2EYTB 1AZNA 1PY0A 2W65B 3WAKA 3VAEA 1VAHA 1U8CA 3VXRB 5T33L 5KS9F 4WY7L 5D2NA 2JK5B 4KROB 2GJ6A 3W2DL 1E9OB 3TBVB 3WFCL 2ZKWA 2DWTA 3M88A 3QEQE 5BW7C 4NN7B 3INUH 4KJQD 1FC1A 1KC5H 1QBAA 4FNTA 4U1KA 4Y4HD 3MRFB 3UO1H 1YYLL 2X44D 3UEQA 3VXSD 4N28A 1AZRA 1JZDC 5EIIA 3ULAB 4M1DH 2V8LA 2VJXA 4XCFH 2HFFB 3ZZLA 1V10A 3KYKH 4L0YA 1ZVSA 3MRPB 5GRVK 4NNXB 1CICA 2HH0L 2ZUSA 1PLGH 1YMHA 3VWKC 1CGWA 1XGUB 2NR6C 4Y5XC 2R1WB 5I1EL 5FB8A 1TVHB 1SLVA 3E2HC 2WY3B 1VKXB 4JFWA 1IGIL 1V7NL 3T0EE 1QQDB 1ADQH 2PR4H 1YCSA 3DHUA 3N1GC 2XIBA 3K8KA 1HS6A 1I8LC 3K4ZA 3B1TA 1P5VB 1F18A 4QY8B 5F9OL 1DQIA 3BD4A 3MGTB 4TUKL 4OGXH 1AIFA 4G2AA 2XBDA 3OKEB 1C8PA 2WUCL 2IOOA 1XH3B 2YPVL 4Y5VC 4WK2B 5ABZA 5GGRB 3HZMA 2BVQB 5E9DB 3SB3A 2XV2A 3VXPA 3NPSB 3I6LE 3QQ9C 2B8OT 4UM8A 5IMMB 1BJ8A 4G5ZH 4NXKA 5KVGE 5IMLA 1P1ZA 1E9PA 4F57H 3PV6A 1AANA 3SGJA 5M7QA 2TSAA 3VXOB 5JPMA 3OKMA 2HFGH 1E90A 3MCG1 5I8EA 1Z3RA 4RISH 3KHOA 3RZCB 4FQ1L 2PP9A 1YYMH 3QHZL 1A4JA 1ADWA 1Q0YH 3UL4A 2COVD 3LKSA 3LHPL 2K6WA 4AOFA 3WDIA 5LBGA 2CIKA 1OCWH 2ZSVB 1DL7H 1M4KA 2BMKB 3QDJD 1EX0A 1QWUA 1IAIM 1L5GA 3H9ZA 4UT9L 4OUUA 1P9MA 5JHDD 3WEXB 2X28A 2J6WA 3ECUA 4KRLB 5CUSH 4ZPTA 5BRZD 5EWIL 5C9JA 2VLLA 4IYKA 4PG9B 2XQBL 1NGXA 2H7WA 2Y1AA 4NN5C 1J8HD 5I9QC 1DANT 3C5ZD 5B3NA 3ZL1A 2YFNA 3UTSE 1U0QA 3GMMB 3KXFA 4UNVA 4KTDL 1TCRA 3ZRFC 3LKQB 4V2CB 4OCSH 4S1RH 5GGUA 4LPWA 4KNUA 4XNYL 4HUXB 1R5IB 4XRCB 5HPMA 1OTTC 2VLKB 2WBXA 4JFEB 4LHUA 1JFHA 2ZQKA 3HS0A 2DQGH 1MLBA 3K4DA 3LMJH 4KUZH 4HAKA 4MA7L 3SQRA 2DQUH 3WMPA 4K23L 4F1ZA 2FR4B 1EGJA 2Q9OA 1M2VB 5IV2A 5F3BA 1S7UA 5CBEB 4WWKC 3GJEA 3H53A 3LKPA 3ARDD 1Q9LA 1MCQA 3OMZA 2LU3A 1P5UC 1L9SA 4XP5L 2J43A 2H45A 3TBTA 2NY7L 4XN5A 2KDYA 1TLMA 4NQEA 4RETB 4TYUA 2XXCB 2ZXGA 4WV1B 5GGVH 4ZW6A 2QPEB 4FHJA 4Q7DA 4B9FA 1UYWH 3WTVA 4TLKA 4YE4L 5E6SB 2HRPH 4LAQH 3ZO9A 2GJZA 4XP9L 2QVFB 3G08A 5BVJB 1BZ9B 2DRUA 3R7QA 1ZA6B 4BXVA 3BUDA 3NGBC 4N4YB 4Q4IA 2UXTA 2GT9A 3FUHA 3OLIA 4G1EB 3GD1C 4ELMF 5JORA 5E2UL 1EHKB 3BP4B 3GF8A 1JHLH 1PU0A 4Y7MA 1P7KA 1AY1H 4JVPA 4K3EL 4ENZA 1RHHA 4KFZC 4QYAA 1J1PH 2VSCA 3FQUA 2A6DB 2JJSA 5E7FA 1ZT7B 3FQNB 3U7AA 3EDEA 5JQ6L 4PS4L 2XTJE 4HLZG 4WEBH 4X6DA 4A6YB 1AH1A 1UC6A 4ZNCD 5KANG 3OKKA 1ODAA 1FYTE 2IDSA 5TDOA 2EXYD 3IPFA 5B1AB 3BW9B 1WG3A 1VCBC 4NSKB 5E23A 2K8QA 4DAGH 4Y19E 4QIRA 4U1IB 2CBQA 2JCCB 2R69L 1T66D 4NQUA 2CBPA 1ZA3B 3MLUL 4XWGL 3BKJH 3MXVL 1Z5LA 2PW2A 1MW2A 5AYUH 5SWSB 3V6ZB 3KPRE 3DUSB 4PJAF 3Q1SL 4LARH 5FYKE 3IJSA 2ZX9A 5DURD 2ZYSA 4U2YA 5AVVB 4UDTB 5K59E 4BUQA 5ICUA 1L9RA 4HMEA 4LIQH 4QF1A 3R8BB 2VERA 4LSDA 4I77H 3AY4A 4CN1A 1QHPA 1X5MA 2XG5B 3WNPA 1SYVA 1R0AH 3W9EA 2WINA 1NBQA 8FABB 4RMBA 5HPOA 1SDAB 1MAMH 3GMPA 4OAWB 3O8XC 4EMZA 4APXB 2M26A 3ZVVA 5CLWA 5FUZL 2ITCB 4IMLB 5BQDA 1TQTA 3DSNA 4OLZL 4L3EE 2WBJB 4WFHD 2NQDA 4YNYB 4YSPA 2BW4A 2NDFA 1U41A 2BDNH 1G7LA 4PREA 5I76A 1FVCB 4N9OB 4NKDA 1OVZA 2QVMA 3L16A 1VZIA 1JGVL 4NLAA 3VI3A 1G84A 3OPUA 3QUKA 4P5MA 2ZONA 4WWPA 1PPIA 4NCDA 3SPJA 2A9AA 1KN4H 1MG3C 1EHXA 1TPXC 2EICA 2F58H 1LP9E 2QZQA 3LD8C 3GDCA 3EXLA 4CJ0A 4XBEL 3GHEH 5KSUA 3WS3A 2FYYA 3DGGB 2PPAA 4HW6A 5JZ7D 3APDA 3MRRA 1TLKA 2JXMA 1HSAA 2VJ0A 1WZ1H 2A77L 1ES0B 1U92B 2E5EA 4RX4A 1LL1A 5LO7A 1QSFB 4NIYE 1U36A 4XMUA 3S36X 3MV9A 5GS0D 1CLOH 2R29L 1K3IA 1CVRA 4KGLA 3ABZA 4DVRL 4H2AA 3OAYH 5T1KA 3PJSB 3BGMB 2H1LM 1GHFL 2AFNA 5DJ8A 4W9DC 1UKSA 1L7TH 4KK5C 3QORC 3MBEB 4XZUA 4DSYA 3PHAA 3MRNA 1KGXA 3FQ4A 4RRPA 3EFDL 3LVTA 3P3YA 4JDZB 4FE9A 2YXFA 3R4RA 2CM5A 3SCMB 2GI0A 4GAJL 4FFZL 5IQ9A 1YEGL 4NUPA 5E1GA 1QG3A 4PBDA 2D9QB 4QMEA 4XCCH 4MB3A 4LT7A 3FH5A 4LPYA 4N0FA 3C6LA 5FGCB 2VUYA 1RPKA 2YOCA 3KVQA 4HJSA 4LLUB 3S3PA 3QIUC 3SOTA 3IDXH 2XZZA 2DEXX 3CDFA 2F8VA 3C6SA 1QWNA 1J5OH 1CIUA 1ODUA 2PYEE 2B1OA 4HSAC 3C8KB 3UC0L 6FABH 3CDGA 3RKDD 5K9OA 4LLAA 3NCMA 3FO0L 4QHNA 1ASPA 1CI3M 2FGZA 3LZFL 1MCNA 1U3HA 3V4PL 5I73C 3U7WH 2YMTA 2YC1A 4GKOA 5TE6L 1I9RL 5EEXA 2WK2A 1IKNC 1GS6X 1TNNA 3IF1B 3F85A 3U6RB 5DEGB 4X8JB 3QCTH 4JRYA 3DOSB 4L37A 4K8RD 5A6LA 1TZAA 5E03A 5KOVC 3MNZB 4K3JH 4UQ3A 1GZPA 5IBLC 4GG6B 2IH1B 2KZ1B 1X7QB 5HDBB 1G7PB 5DHVA 2Y7SA 1UZ6F 3ILPA 4HJGB 4MD0B 1RMFL 4YDVA 1NDGB 2EP6A 5CJXC 2VDLB 3O8XB 2WIIB 2JWYA 5HDWA 4JZJA 3RJOA 2ENSA 2XRAH 4DZ8B 1K2DB 1NM4A 5LQBH 3VM7A 3H9HA 4KQ4L 4Z7WE 3WNNA 2WWKT 3WLBA 3M1CA 5BS0B 1SYSB 4XB3A 1N5AA 1RZ8B 1AO7A 1AKPA 2G4GA 5ES4B 1GS8A 5CU9A 5E2WL 5LDSA 1S9VA 3VXUA 2DYPB 5TF1L 5E4AA 1AS8A 4DFHA 1KG0B 1WJ3A 1ZLDA 4FQPA 4P2QE 4MKTA 3QSKB 4R7NA 5D7LA 4PP2A 2X4RB 2V4LA 3T3PF 4AE0A 1KCUH 1GZHA 3WGUB 3CLWA 2VAJA 3ZKMC 1YJDL 4JDTH 3HE7B 3MRGA 2QMJA 3ZR6A 1T2QH 1ANUA 3DXAA 3MRMA 1HU8A 1XX9C 2VMDA 3V6OE 4GNKB 1AHWA 3T8MA 5LNDA 4FMKA 3ZDXF 5FECB 4FNQA 1OGAE 1M7DA 1NIEA 1R47A 1BXXA 1J87A 1MJJB 1UA7A 2JI2A 2ZKMX 5EN2B 3WL9A 2ESVB 4NPYB 3S35X 1HNYA 4TUKH 3A47A 2FIKB 3PL6C 4LLYB 1DVFD 3V52L 1T1ZA 1R3KB 2NW2A 4P4KB 5DDHA 3D2TA 3FULA 5AAWC 3R7RA 1JZ3A 5LKNA 2ZZUT 1YNKH 3QZLA 3QUYC 3RNQB 2PR9A 3BH9A 1UATA 3H54A 1XL6A 4OD3H 4XVTH 3QFDA 3GINA 5CEXA 5LXGL 5CLZA 4ZDHB 3CQQA 1AXTL 3ZKND 2N1TE 5EZIH 4R5VA 4HULB 3IVKB 1FIEA 1EFXA 3BCFA 1DQDL 2D4FA 3L95A 5B38B 1INDL 1YN6B 1SZNA 3JBG7 4OCLC 4TQIA 2CE6A 2WXGA 4CGUB 3T6QC 2P5WD 5CILH 5A40E 4U1LB 1JZ2A 2R7EB 5CWSB 4JAMB 3CFEA 4GSQA 4YDIL 3CSFA 1GKEA 3HKFA 3ESVF 2NY3D 1EO7A 4GIPD 2X89A 3L3OB 4WUUB 1GC1L 4NZUH 3BLBA 5C0BB 3LDBB 1E3XA 2EDQA 2EECA 3I74A 2MCG1 3VFNA 3HUJB 1BQLH 1WT5C 4PLKC 1LO2H 4PP1C 3DGCR 3WUWG 1BV8A 1O75A 2DI7A 1TTRA 1M53A 2C1OB 2DLFL 3VFMB 4V33A 3N1MC 3QUHA 3RGVD 1NL0H 1UD4A 1RURL 1DUYB 3P77A 4KTDH 1CLZH 4MMYA 1WFTA 1RZJH 4P2AA 3X11A 4FNPA 2OP4H 1IU1A 4HEMA 1GGUA 1PDKA 1FV1A 2PPDA 4KI5F 4QRAA 4HWZA 5ERWB 4PRIA 1IAOA 5BV7H 4PH8A 4UTAA 4ZI8A 1J5HA 2Y07L 4XH2A 2DS4A 3U7YH 3VUAA 5D4IA 1BFSA 1HDMA 3HG1D 3DVGA 4XC1L 4Y5YC 4WO4D 1HJBC 4GBXD 1EZLA 1JZ4A 1H3PL 5D5MA 2J71A 2LE9A 1F3DH 3MV8E 3ZSSA 4W9EC 4NM4H 4BFKA 5DJ2A 1BAFL 4NJ9L 4WKZB 1AXSA 3Q6FA 2EE9A 3X14B 4GUCA 1N18A 4MNQD 3D50A 3GI9L 3WUWB 2J6EL 3KWXA 3KE0A 4FFYL 1XAUA 4JK0D 5D2LE 3FO2A 2Q20A 1WCBB 32C2A 4XVUC 3U0PA 2MKLC 4LP4A 4LSSL 3KPQB 4E68A 4QWWC 1XCQA 2XWCA 5IOPB 4PIRF 5AAMA 4GEJA 1ORQB 1FGNL 2FJSA 3B5TA 1GIGL 1C1EL 5D7JC 2XWXA 1DQJB 1OM9A 3BSGA 4UDUA 4DUWA 1R1CA 2UZIH 5T3ZE 2J5WA 2EIDA 2NY2B 3WKML 1N7ML 2QSQA 3GXUB 3MUGB 2WVTA 5I74B 1Q72L 4JO8A 5KYUB 3QA3B 4PRDA 2BIMA 5GRUL 4DPCX 4G6MH 2OSWA 3EJCA 3NFNB 4NQCD 3VFSB 2VQ1A 2ZCLH 4K94H 4CL7A 5DEZA 5GS0L 3GUTA 4GRWH 5CXPA 2ZWLT 3O3AB 2YAQA 4PB9H 3CQPA 2LAAA 3OGCB 4LCCC 3SKOA 4L4VB 1HH6A 4XX1G 3ZT7A 2E27H 4X0NA 2C1PB 4ZTEA 1GPOL 1ACYH 1M71A 4IBWA 3C60B 7PAZA 1E30A 2WKOF 1ZV5A 2OL3L 2Q7AA 3GSNL 3O6LL 3OSVA 2KLSA 2R1YA 1A7RH 1CN4A 2YRBA 3IJ7A 1LK3H 1MRDH 2AQNA 2DWDB 3HNTH 4Y2NA 2R15A 3ZOAA 1Y6NR 1NGWB 1UD8A 2IALB 3DTXB 4FX5A 1NIDA 2V3DA 5FW7A 3S4SG 8CGTA 1QLEH 3RKPA 2YUZA 2BFVH 1UZ8B 1HINL 3DX1A 2W0PA 2WGNB 1QO3A 2BY3A 4TNEA 1RZIA 1KIUB 2I24N 3JV6A 4YDJB 1NJ9B 1BZ7A 2VLMD 3BZ5A 3HPLB 4ONHA 4QHLA 4PWHA 5E5MA 4DKFL 4HPHA 4G9FB 3SYCA 2BP8A 3B9KA 4FDWA 2RIKA 1MW0A 4XMKH 2B1HH 5IVOA 3SDXA 5KSAC 2XQYA 2Z91B 1E6OL 5F6IC 3DJTA 3JVGC 4FQ2H 1HHIA 1O6VA 5FUCC 2OJEA 5DO2D 1AR1C 5F1KC 2B2XL 5CBAB 4B3VA 3O2DL 3N42B 5KSBB 2P5PA 3VE0A 4N3TA 1JV2A 3P4MA 4HUVA 4HCGA 4HK0B 3F01A 2CM6A 2IG2L 3KL3A 2X09A 2YGVA 4YSUA 3NK4A 4K8RL 2VL4A 5JHBA 2R29H 2C3VB 3KVPA 3GZKA 4M3KB 4W68A 5E51A 5EIIG 3SDCC 3B6SB 4AQAA 4JRXB 1GHFH 4PJ7E 3TVMD 4PHZA 1RUAH 1RIHH 4QOKD 2J12B 4KNTA 5F7MC 3VGAB 3WTUA 1S7VA 2DQCH 2H32H 1JPFA 4MMZA 3MLTB 3RWCB 4D9LL 3TEYA 4F8LA 4FXGB 5I1LA 2Y5EA 3QUXC 4FQQB 4GT7A 4LFHD 5EUOE 2M83A 1U8CB 2O6EA 4MZRA 1T7XA 3RX9A 3FZUC 1MCIA 2B9BA 5MI0B 4JCLA 5D2NB 5KN5A 3ATDA 2GJ6B 2P45B 1E2VA 2LGNA 1XCWA 5F2FA 1JTTA 3ULVF 5MP6H 2W9EL 3CU7A 4U1KB 4RFOL 3RVVC 1TZ8A 1C7TA 4DGYH 5MERA 4N5UA 3FUMA 2Z8VC 3HLKA 4E9RA 4GAGH 2YUVA 2VWEE 5EIIB 2WSKA 2Q6WA 4F7KA 4PS7A 4DJMA 4X9FA 3NQIA 1ZVSB 3C6EA 3CFBA 4HAGA 2IPKA 2QVTA 4U6HA 4IBZA 3EH4B 1CICB 5KWYC 2JQZA 4Q9CA 1XZ0A 1Q90A 1YMHB 2FUTA 3SJVE 1IGCH 4DQOH 5IW1A 2XX1A 3SKUD 1IQDA 2F7RA 5FB8B 4XCYB 4O2FA 1NLDH 3FRPA 3Q7JA 2AC0A 1Z2KA 3ZO0A 2VR9A 1G6VK 3V4UH 3ZT6A 1Q9WA 4I4WA 4W9ZA 1F3DJ 1IARB 4FKHA 2ZF8A 1NAML 3FHEA 1QFWL 4ZD3L 5CAYB 4HHAA 3VD5A 4J3OH 3Q2VA 3ZHDA 5HYQA 4ALAC 3VFVA 3BCDA 1AIFB 1FVEA 2H2SC 1WK0A 2VE6A 1I1CA 3KJ6H 5I1KL 2WYZA 2CO3A 2OMTA 2P5EA 3HZMB 5IJDC 3CH8A 1F41A 3CN0A 5LXVA 3GFUA 3VXPB 4QT5A 4UM8B 5GRYA 3HRZA 5IMLB 1F86A 1P1ZB 1E9PB 3PV6B 5KZCB 5JPMB 4LPCA 3OKMB 5DVKA 2Y3NA 1JNJA 1JYXA 5I8EB 2B3IA 4KY1L 1KIQA 1TCMA 4PY8I 1E5UI 5BO1L 1PG7W 1A4JB 2YQ2A 4QEGA 3S5LA 3MJWA 4PTUA 4ZW3A 4N6QA 5MHSD 3LKSB 5F1OB 2Y1ZA 3U83A 2CIKB 3WY1A 2OFQA 1BWMA 2HJLA 3QYMA 1BD2D 1L5GB 4OUUB 1QLFA 3SN6N 2CLVA 5AZUA 4YHLH 1J8RA 1YQ2A 1KJVA 2QELA 4ZPTB 1FNEA 3WJMA 5E24E 1D5RA 1AYRA 5C9JB 2VLLB 5AVTB 2VZ3A 1YJDH 3PP3H 1NGXB 3UH8A 1JTPA 1VIWA 5JMOC 4CA4A 2NXYC 3S88L 1BA9A 1IGFL 1D7CA 4HS8L 2VN3A 3KXFB 4PV9A 1TCRB 3FU9A 5G55A 3TN0A 3H7LA 4K2UH 5GGUB 5D1QC 1IBDA 4QDGA 3WFZA 2JI1A 1JPSH 5HPMB 2J25A 4KPHL 4LHUB 3HNVH 4XAKE 3HS0B 3LXAA 1MLBB 2FBJH 5C07D 4HWBH 4RGNB 3VXRD 4F91B 2ALAA 2WLKA 5IV2B 1C16A 1DBMH 4JKPH 4F33A 1DBAL 1RFDL 1S7UB 1G9NH 3LKPB 1Q9LB 1PZDA 4KITB 5TDNA 3VYPA 2CHZA 1AXTH 4G5AA 3TBTB 2YD4A 4LKXA 5D7KD 4RWYL 4HF5H 2BXZA 2BCMA 4NQEB 3GRGA 3BPLC 3T6VA 4AXWA 4RMQA 2YD9A 3IFPA 3VTTA 2IAAC 2GJZB 5K39A 2ATKA 3G08B 1QSEE 5DFTA 1A7OL 3D12B 3WIHA 3MR9A 2YXMA 4BGDA 1NICA 5DA0B 4GMTH 2GT9B 2GSGA 3GIZH 1D9KA 2HLFD 1JZFA 1F4WL 1KWGA 3INOA 3T6ZA 5LGJA 5JORB 4D7BA 3Q44A 1BCIA 2XN9E 1UB6A 2J8UE 1HZHL 5IVZA 1AI1H 1P7KB 2UZYA 3RHWK 1T7VA 1RHHB 5C0AD 1K5WA 4L23A 3GRWA 4EIBA 3H6AA 4S2SA 3FTUA 1DVZA 3FQUB 1J10A 4G8AC 1X9LA 3CXHJ 2W1NA 3PWLA 5F7LB 1Z9MA 1ZGLP 1XGTA 1Z66A 4X6DB 1V55B 1B0RA 4KMTL 2EC9T 1LYQA 2G0LA 3OKKB 3PWJA 1VSCA 5TDOB 5CINH 3V8OA 2DQHH 3N9GH 4S1DC 5C0DA 5IEKA 4PJDE 4MFHA 1E27A 5B1KA 1Q0XL 1UD6A 4ZNEA 3BPOC 5C6WH 1Z5LB 2PW2B 2Z9TA 1PS3A 2P47B 2VOTA 2KZKA 4PMFA 4RMWA 3OTTA 3IJSB 4M5ZL 4TSAL 2XZCL 4QF1B 1HSBA 2WSPA 1LK2A 1SYVB 4MVBD 3W9EB 1MREH 3EJQA 1W72L 4JO2H 4N24A 4WAFA 1A5FL 4E5XA 3GMPB 1YPZE 4N86A 5F1IA 1J0HA 5GJSH 1IUZA 2VRKA 4F2MA 2KKQA 3JV0A 3DSNB 5C7XL 3FUDA 1VFOA 3B7RL 5FHAL 1HYSC 2PWEA 1G7LB 4PREB 5I76B 4NKDB 2CK0H 3VI3B 4OM1L 4YZWA 3QUKB 4XPHH 4P5MB 5J11B 2F1EA 4RRPG 3GZQA 3T0XA 2RMNA 1FPTL 3IKKA 4FZEL 1KY7A 5IMOA 4EN2A 1QSZA 4JFZL 3ISYA 4ETYA 3MUUA 2MPVA 2XWRA 2Z8SA 3EYQD 2WZ6A 2FYYB 3IXAA 3WS3B 4ZFGH 5KSUB 2VLKD 1EZSA 1KJ3L 1LDPH 3MRRB 2JXMB 1HSAB 4APQC 2AJSL 2ERJB 2KMWA 4R2GB 2W91A 3QDHA 5DGRA 4DP2X 2VQ4A 1MRFL 1W8OA 5GS0H 1KPRA 5E5UB 4Z7UE 3MV9B 5TE7L 4LDCA 3DC0A 3FOLA 1JXGA 1N68A 4J4PD 5J9PA 3QIBA 3Q8AA 4JQXA 1MLCA 5T1KB 3II1A 1KCRH 1MIEH 5DJ8B 1GJUA 3OKYA 1ZEAL 5DFAA 4F7EA 4XZUB 5K9QI 3MRNB 1KBKA 4PJHE 2FQEA 3Q6GH 4GRLD 2AJVH 4DGVH 4ZYKA 3BT2H 5I23A 4ZTPH 3MRCA 1YQVL 3ARPA 4PVMA 3IMVA 4OIBA 1NIBA 3BMVA 3QDGA 1BIIA 3EH5B 4BSWA 4N0FB 4O58L 3C6LB 4Q8BA 2YWYA 4LCWE 3T2QA 2ZUUA 3K2IA 4GFXA 5BZZA 1KDJA 3W39A 1H3TA 1WDAA 2DQEL 4OJFL 3PWVA 3FTXA 3C6SB 1CXFA 4HUUA 4PCKA 3GSVA 4XE0A 2H47C 5L9DH 1UH3A 3CDGB 2EXWC 5K9OB 2CKBH 2JE8A 4QHNB 1ZV2A 1U3HB 2ZWYA 3G6AA 3F58L 1IIIA 2YC1B 1QFUL 4DESA 1NM9A 1UHVA 2FX7L 3L13A 4PCTA 1AVAA 3QAQA 3DRTA 4GW4A 4FG6D 5GISL 1YVLA 2N4IA 2EVJA 4JRYB 4U31A 3O4LA 2DQDH 4L37B 1F58L 4Z7VE 1HAUA 4YX2H 5EU4A 4HOMA 1L9OA 4H8UA 2UWEA 4UQ3B 3AXLA 1GZPB 1JL8A 1A3QA 5CCHE 3KPSD 3UTTD 1CYXA 1QOKA 4EDXA 3P3TA 3RPIA 2APTA 4G7VH 5DHVB 3VDBA 3ILPB 3U30B 4JBSA 4X9IA 5I1IH 1HZLA 4MTMA 4YDVB 3UCRA 3CHPA 1QVOA 4XMPH 4BBWA 5JW4R 3N40P 2WP3O 3LTVA 2UUDH 2HJKA 1MI5A 4JZJB 3WTSA 2EE0A 4KH2A 4PW9A 3RLSA 3H9HB 4PBXA 5EOCL 2X1PA 2EDXA 5H37H 3TFKD 3WLBB 1J8HE 1EMTL 3ARZA 1N5AB 1TZOA 1UCBL 2L7UA 3SQOL 4A2MA 1AO7B 2CBMA 1QR1A 5I6XC 4M1CD 2EZ0C 1D5ZA 3W37A 3C2AL 1S9VB 1IV8A 3MREA 4N8UA 4PTTA 3VXUB 3WKQA 4TVPH 2Q7YA 3GS7A 4WI2A 1RULH 4K5MA 4PV1C 3DETC 1J0ZA 3CBKB 3NIDB 4Y2DC 4R7NB 3FQTA 5D7LB 1XTLA 4PP2B 2DMCA 5ANME 3LS5H 4TXVB 3NJIA 4ACPA 4AYGA 3UJIL 1LE5A 1V05A 5KS9E 3IMRA 3MRGB 4AJWA 1MNUH 4QRBA 3BRGC 3FSOA 5EEVA 3DXAB 3MRMB 5F96L 5F1NA 1X6LA 5D72H 5J56B 4KX8A 4IK7A 1AHWB 2QPSA 4IRSD 4QXUH 5LN8A 1OPGL 4TS6A 5E1HB 1E3ZA 1M7DB 5AVZB 3MBED 3F7VA 4GPVA 3WL9B 2BSCA 3LNIA 3IJYA 2RAMA 1HEZA 1KY6A 1SVZA 3KLLA 5ALCL 4GMSH 2K78A 1T1ZB 2NW2B 5B8CC 5DDHB 4K7PX 1DJYA 5I1KH 3SCMD 2XWBA 1AD9A 1JG9A 1KGYE 3BH9B 3EFOA 5FFOA 1BYOA 5DT1L 4O02H 4ZX4A 3QFDB 5CEXB 4LAJH 2VR8A 4P2OC 5HJ3A 3U0WL 1SEQH 1QRKA 1MRCL 4CN4A 5D93B 3S9DB 3CVCA 1BFTA 1EFXB 1CI5A 1J86A 3L95B 4BKTC 3H9YA 5K93A 3US1A 2B0SL 2FBRA 4EPSA 1KTBA 3C9NA 1TQWA 2NYKA 4WW2A 5GS1C 5TQ0L 1OP4A 3CSBA 3QXWA 5I82A 4MZ3A 3CFEB 3H9SB 2W95A 5ELIA 5DJCA 1MAKA 3VXTA 4IW4C 4ZFQA 4JHBA 2E46A 2ARWA 4Q6IC 4OLXL 2YK1H 4G9DA 3C5XA 5F93C 3T3MF 1BJ1H 1MVUA 3ZE2B 3DJRA 1DO5A 2A9DA 4JGMA 2XWZA 3LZQA 4NO0D 3VFNB 1E5ZA 1KB9K 3B2UD 3VRLE 3A6CH 3EJRA 1WEJH 5JR1H 3THML 5E2TH 3P77B 3G6JE 3OKDA 5IY5B 4MMYB 4DP8X 3HC3L 2X10A 2B1AH 4AVIA 1J9SA 3X11B 1KEMH 3I9GL 1BBDL 1FV1B 1PDKB 2E74C 2CUHA 3MCYA 4UTCA 4HWZB 3KR3L 4PRIB 4HS3A 5D7IA 1GCFA 2BP3A 5DYFA 1IAOB 4UAHA 1GR7A 3TF7C 4XH2B 1NFDE 3L3JA 1HDMB 3ZDYB 3DVGB 2X9XA 2QADC 3RBGA 3U4BH 2EIKB 4OT1H 1N8ZA 2Z7ZA 4R96A 5DJ2B 4I2XA 1AXSB 4B97A 5AB2A 3BH8A 3Q6FB 4XO9A 4RA0C 5DJAA 1GMIA 1VACA 4HCFA 1CG9A 2AEWA 4ODUA 2QFPA 2HKHL 3I02A 1EXGA 3VSVA 1XXDC 5GS2D 3WS6A 2HT3D 4L5FH 3L3HA 1KZQA 4M43L 3HVNA 4UTBA 4L8DA 2LAGB 4PG2C 3FO2B 3ECBA 3KH3A 4YHKL 3ZHNA 32C2B 3EO9H 3SE8L 3N85H 3U0PB 3E8UL 1A8JH 4L3FA 1KGCD 5EU7E 1XCQB 4IRJC 4O00A 4QTFA 1FFNA 1IILE 4OJDH 2A1WL 1U3JA 5GGRY 4UDUB 4HSQA 1QACA 4KKBC 1UA6L 1WHOA 2Y22A 4G42A 2P48B 2NTSP 4JNXA 4JDVA 4R90H 1BZDA 1OKEA 5BVPL 3TEWA 3ARVA 4J12A 4RCAA 4PWFA 3K0YA 3VQ2C 1I85A 3BUYA 4P4KD 4PRDB 4DPRA 4RGMC 1AGDA 3D9AH 5I6LA 3ULUC 2VQ1B 3GUTB 3GKWH 3CWGA 5DLMH 2EVIA 4GQ9H 1DJSA 1I3GL 3SKOB 4QHMA 1HH6B 1KNOA 1M71B 2XQYG 2I85A 2WWOA 4J28A 4K15A 3DMMC 1KIRA 2Y36L 1NMBL 3T0DA 5DQDL 1RK1A 4NRXA 1OSEA 2R1YB 4FC3E 4B50A 3S7GA 1L9MA 4PWJA 3CMOL 2HVKA 4GAYA 2ADFL 2J1ZA 3CNKA 4PJ5D 4YFLF 5BQ7A 3DBXA 2D0GA 4AMKL 4P2RA 1JYWA 3LNGA 1U6AL 2ENJA 1KCVL 1Y0LA 5HI5C 3BC9A 2V2TA 1QO3B 3OL2A 5EA0L 2J5LC 1FIGL 1RZIB 3T0BA 4WUUD 1KXQE 3NRFA 1LGVA 1TOXA 3JV6B 3PWPD 5E4EB 1BZ7B 4BIKA 3FQWA 1OD9A 4ONHB 5DU7A 4QHLB 5J12C 3SYOA 5E5MB 4ZUSA 3PY9A 3D4CA 4G7YH 2BP8B 3B9KB 3BGFC 3I3DA 4A6YL 4BZYA 3OB8A 3ZTJG 2AQ3A 3SDXB