3F64A

F17a-g lectin domain with bound glcnac(beta1-o)paranitrophenyl ligand
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
175
structure length
168
Chain Sequence
b'AVSFIGSTENDVGPSLGSYSRPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSSARYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17a-G
publication title Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia coli
doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 45
structure length 168
sequence length 175
ec nomenclature
pdb deposition date 2008-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 3f64A00
3FFOA 3F64A 1O9VA 1ZPLA 2BS71 4K0OA 1O9WA 2BSBA 1OIOA 1O9ZA 1ZK5A 2BS8A 2BSCA 3F6JA
chains in the Genus database with same CATH superfamily
1JPTH 4ZAKA 5L8LB 1I8KB 3F04A 1ORQB 5D2NA 3NEXA 3LXAA 1KJMB 4TSBL 1WE5A 4PGCA 5IROC 4PJXF 4WHYG 4U3XA 4AY0A 3TVMA 4U6HB 1VFBB 3WNKA 3VFTA 3H85A 2D03L 1FHGA 4HSCX 1CXIA 5F1SA 2F7IA 2W80C 1IGML 1VADB 2JQAA 4W93A 3V0WH 4BH8B 5E4OA 2X1QA 1SN2A 4KV5F 2UX7A 1F58H 2LU4A 2VW7A 3ZOAA 4X8CA 3ZDXF 1ZSDB 1T0PB 3S4SA 2VW6A 3BPOC 3F7VA 4DQOL 3EYFA 4YXKH 1A2YA 4D7BA 5JYMA 3Q2NA 1CF8L 3MCG1 2YRLA 2H9GA 2IPTH 1T0MB 2V5MA 3CZUB 3WL9A 4I4WA 4K94C 3QCUL 3V4LA 3FF7A 2UXGA 2KZ1B 2PW2B 3B2PA 1Q9WA 4M1CD 1UM6L 4E42A 5DT1L 3BVDB 1MIEL 5F9JA 5I5RA 3PY9A 4M29A 4A6YL 1BQHG 2AV1B 1RAMA 2FBRA 3T77A 1IEAA 3B56A 5KZCD 1CLYL 3CBJB 1UZ8A 4PJHF 1WZKA 2VDQL 3BLBA 2TSBA 3O3AA 4LEOB 5E94B 4I9WE 3HG1E 1TZIA 3NSYA 4YDVB 5ILTH 4OLVL 3QRBA 4TV3A 5CM1A 3IFLL 1S7VB 2FJUB 4CVXB 5EPMB 2Q2LA 3V0GA 2Q86A 3EJCA 4LU5L 1MQ8A 3P02A 5EO1B 3X1EA 4IRJD 4ELME 5T5NF 5HTSA 2YFNA 1KLUB 2E6PA 2WINB 4CNIA 2OTUB 4L4VB 1FFQA 4JHWH 5I16B 3LZPA 3QZPA 3ZUCA 2EYRB 3MRKB 2GTWB 4RGMC 4ZUTB 5GJTL 2ZJSL 4QAMB 4AC2A 3U0PB 2OMNA 3CBKB 2CUIA 5DEFB 1NEZB 4BKSC 1MCDA 5D1QD 2NR6D 2O6DA 3WU1A 2OPCA 2BWIA 3KYKL 3OVUB 3QDGD 3BPOB 4KGJA 1LE9B 3JWOC 4WSGA 2H7WA 1AI1H 2ITEA 4OAWB 2VXSL 3QJFA 1I1AC 5DD0H 2A3TA 4ZODA 4WGKA 1TQTA 3BT2H 3WE1A 3HUJA 3NCMA 4UOQA 4QRTA 3MROA 3U2SA 3D48R 2GEQA 4N2HA 3H42L 4EAEA 1OAXL 1U3HA 5E0QA 5KAQF 2PP8A 3QIBA 3IXTB 1QHQA 3M1OA 3GMLA 4AIZA 1N6UA 5KN5A 1BCIA 1RULH 3QDHA 4TKWA 2HT3D 3EUUA 2ALAA 4DO4A 3L1GA 2G3ZA 1JDCA 3RTQD 3MNMA 4J3TA 2UZXA 4V1DA 2DLFH 1IFHL 2B59A 3OB0K 1D7BA 3UZQB 4OJEH 5TDPB 5B7EA 3G3LA 3FHEA 2ZF8A 3T1WA 2XACC 3K6IA 3RA7L 2BVQA 4L4JA 1KB9K 1OB1A 4W4OC 1BQ5A 2PPFA 2OZ4H 1YEFL 4JM2C 1MUJA 4RWYL 4RGMB 1IM3B 2J6EH 2X0WA 3IJHB 3K7UA 4PJEE 2GHZA 4NKIH 4ZK8A 3D08A 3RHWF 4BH7A 2GIYA 2VR9A 3HE7C 4RMQA 4S1RH 1IC4L 4HGMA 3BAEH 2DQGH 4E41D 2RH0A 5L4FA 2QHRL 2OMBA 2H6PA 1XMWA 3L1OL 5HDBB 3NIDF 3ZUNC 4GKNB 2X2IA 3GMNB 3DRQB 4N85A 5ACMA 3GRWA 4ZXBC 1ULVA 3DO4A 3NQKA 1N3NA 2VXQL 4IEFA 3QXUA 5J1TC 1J0HA 5DMKB 5E8EB 4EVNB 5D70L 1TVBA 3UEZA 5IVXA 2FBJH 5LXVA 1TJMA 5B1BB 3JWNC 4X0KA 3TYGL 1JZFA 1SJEB 4JEGB 2E59A 2BNQE 1VEOA 2KC0A 2OSXA 4FXGC 3FO2B 3QUXA 5I1CL 1D5MB 2K6YA 4KK9C 2QADD 5J1AA 2DLEA 3Q3GB 4XVSH 4JFFE 2LABA 3E8UH 4IRZL 4GW4B 4QHKJ 3MYZA 4HXBL 3QUMB 2ZWYA 3CX5K 2P8LB 3RZCD 3GMRA 4WGVB 1TJXA 2AV7B 2HFTA 3FS9A 4BELD 4LSUH 3GRBA 2YQ2A 4N2LA 3KPTA 4NPYA 3EDJA 1XXFC 4JM2B 5IIEB 4LLMA 5AQ0A 4OLUH 4OT1H 1R3IH 1ES0A 1TEGA 1P6FA 2CHWA 1OAYH 3HB3C 4HH9B 3HE7B 1L9QA 3VGDA 1XEDA 2DWSA 4YX2L 2L4OA 5E9AA 3P9MB 5C0EB 5G5DA 1J48A 1YA5A 2XPZA 3SE4A 4QLRA 1QNIA 5J13C 3IRPX 2BSCA 2HT2D 1SLVA 4ZBJA 3VFUB 3C6LA 4UTAA 3N43F 4HK0A 2V4LA 1QSFB 1HC1A 3GB7B 5EBWA 4ZXBB 1BLNA 4PBVC 3BOVA 4XCEA 4YBLC 1QPPA 1TZGH 2ZOLA 2BFVL 4R0LA 4ZFQA 4YGVA 3JZ7A 4NC1E 4ETYA 2RMNA 4AVKA 1JGIA 4BKTC 4YHKL 4ZNEA 1JAEA 1TJHL 2NW3B 4AWJC 4FXGB 1KPRA 2GJ6D 4WO0A 3QWRD 2PABA 3L3DB 1N67A 1DANU 3E2HC 2QSCL 3N04A 1T89A 3QQ9D 4MXQC 3GK8L 3TN0A 1ZVSB 2ADFH 4NRXA 1CR9H 1WISA 3RY6C 3TBWB 4AV0A 4UOZA 4I3SL 5B22A 3NPZB 3QUKB 2AXFB 4ZMLA 3VG0H 2M1KA 4ONFH 3SD2A 1SBSH 5DD1L 4B0MM 1MFBH 3GHEH 1QFWH 3TPKA 5JOPE 3HC2A 3ZIYA 1DZBA 5CILL 4CSTA 2BVPA 4C54A 3HB3B 1SHSA 4OJAA 1OT4A 1RZFL 2RCSL 3KH4A 4MD0B 3BQUD 3AFLA 1RLWA 4DO5A 2E9JA 4PN6A 3L6FA 1MFVA 1NAMA 4ZUWA 2CLZB 2X3CA 4ZRGA 5E7FA 1DUYB 5J13B 4JPVL 2K9FB 3QAZC 3QDGE 5B38G 5E6UB 2LR4A 4ANVA 3QIWA 3U7WL 2OTWA 1WDAA 5E99L 4RGNE 1UHVA 2ICWI 3NVQA 4F58H 4NHUA 4YBLB 2OCFD 4L5FH 1N5YL 1ETZB 1JD9A 5JQ6H 1N59B 4N2MA 5EZLA 3EYUH 1NM4A 1UH4A 3WEOA 1AC0A 3FB5A 1V5JA 4YVNA 5J4MA 2XVGA 1UUNA 2EO1A 1BYPA 1U8QB 3E2HB 3LS4L 3VFNA 1YEGH 1FFNB 3CLEH 4KY2A 4MRCA 4U1NB 1JZ7A 3C5ZC 4GG8B 1A6AB 2WQ8A 4TPRL 3ELQA 4LOUC 3F62A 4L8SC 1T1WA 5F96L 2WTRB 4FLSA 4BFFA 2EDDA 5C2BH 2F8IA 2OBGA 2UUDH 1S3KH 3FUHA 1G7IB 5E5UB 5CD3B 5A16B 2J21A 3QDJE 2WLKA 4OJYA 1WFIA 4GSDH 3BUYA 1KPUB 3IDMB 4X8GA 5CEYA 1D5IH 2O5YH 1PD1A 3LTVA 2G3NA 2DI7A 2WIIA 3GXIA 3HS0C 3UYRL 2DF3A 3R0MA 3ARFA 5K9JH 4HUWB 3MV7B 4OCWL 3TX4A 3L3JA 1EDQA 1L9PA 3QAZB 1T5WB 2RFXB 3I6KA 4GXVH 5AD0A 4GUPB 3U9PH 3PJLA 3CVIL 4PCKA 3HA0A 5E5LA 5I1KL 4AKOA 2PMZA 2P28B 2LAGB 3NOIA 3D2UA 3GGWB 4QKXB 4KKQA 2R2HA 1KV7A 4FQLL 5KVGH 3QGVA 2ICEC 5JMRA 4OF3A 2ZE0A 1DQQB 3X13B 3WIHH 4GO9A 5F72S 3LPGA 5FR3A 5FYJL 2EEDA 3UG5A 3SBPA 4ONGL 5DUPH 3ABZA 3C5ZB 1B4LA 1IKNC 2O6EA 4RGOH 3BH9B 3QZOA 2VDNL 5E24E 1V8HA 4A7GF 3BAJA 1CFNA 3DTDA 3WMQA 4L8SB 1Y18B 4PJXB 2JK5B 4UM9D 4OQ1A 2FD6L 4NQXB 4U1SA 5HYIA 4GKLA 2MCAA 1ED3B 4IOFC 2CU9A 1D9KC 1V7ML 3SO5A 5ERWA 3SDXA 5IROD 5DR5H 4LLYB 4RFNC 5EWIH 2CBQA 5JXEA 5I1DB 4XP1H 4LRIA 3HS0B 4TVPH 5BS0B 4PWHA 4HT1H 5D71L 5T3XL 4L4VD 2YAEA 2ZKWA 2K45A 1I7ZA 3E6FA 4AUUA 5D72L 1WIOA 2HLAA 4CILA 2CO6A 5CD5C 2B1OA 3UBXA 3QG7L 5AUMA 1T2QL 4K5MA 2WYZA 1EJ6A 2X6AA 2YHGA 4HF5L 2BP8A 3NIGF 4M3HA 4HWEL 1G7JB 3OG4B 4YHMH 3U2IA 5I0DA 4X5XA 4MYWB 5GZNC 1CDGA 1MSPA 4Y5YA 5IV2B 3H3PL 4HXAL 3SDAC 2NCMA 4U1GC 2ICEB 1EHNA 3PIQB 3V4UL 4K9EL 1LNUB 4A6YA 1I9RL 2ZXQA 4D3CH 1JD7A 4BDVA 4PJHB 1PY4A 4PG2C 1J0IA 5K59E 1IC7L 4Z7VB 2GAZB 3QFJE 4LESA 5BVPH 2Y07L 4YXLL 4ELDA 2GUYA 2HP4A 2WWKT 3HHSB 5F6IC 4J12A 2ZUQC 2EDYA 2EADA 3GSXA 2NYZA 2VKXA 1QFUH 4HPYH 5L6YH 5AVWB 4LAQL 3WFCL 4TL4A 1A6PA 1RUKH 4MXVF 4WNSA 4M61B 3H3BC 4MA7H 2ADYA 5CXPA 2IFGA 2DQIL 1GYUA 2WAQA 3ZTEA 4KMTH 4PUBH 1BECA 4YBQC 4XN8A 2PF6A 3LH2H 2VDOB 7TAAA 1K3IA 1PG7H 3LVEA 2D7TL 5L4JA 2FL5B 3F01A 4U2YA 3D09A 1ET5A 4L3EA 1MAKA 1KXHA 2JKRM 5J0BA 1RLBA 3PRZA 3EFOB 2HN7B 2OW6A 3K6FA 2X6CA 1HL5A 4FRWA 3V9EA 4DAGH 1T6BX 3WG7B 2CA3A 4U1HA 3G04A 1DBKH 3CSFA 4GQ9H 4PJAF 1J9RA 2VITA 1ZPLA 3FQYA 3MRGB 3X1BA 5JW5B 3HZ3A 1UXWA 2VM3A 2IOMA 2VR5A 3Q0HA 4Z0BH 4U1GB 3SDAB 4AENB 5LWYL 4N2IA 4QTHA 1I1AD 5DS8B 1J0KA 3OAUH 4GRWH 3IVKB 4H25B 4WUUB 1BPVA 4Z5RB 2VZTA 4O2CB 3NJMA 4ANWA 2EVIA 5SWQB 5IVZA 1A3LH 5DJAA 3ATAA 1H5BC 2ITFA 3CZFB 1RPQA 1J5CA 4L48A 5F6IB 2ZUQB 2YGQA 5T8IA 3P0YL 1DQJA 1DCEA 2GK2A 1G0YR 2BVTA 1ZT4B 5FKAB 1G9EA 4N2KA 4C8XA 1MRFH 5D5ME 1VKXB 5GIRA 3A3YB 3BKCH 5HDWA 4LP4A 5I15L 1ORSA 2BM3A 1BFOB 3Q43A 4LLVB 4NJAL 1DDHB 3HMXH 2XZAH 4JRXB 3ULVF 4WW1A 1EZLA 3TWCL 1AYRA 3CIQA 4XMPH 2E6JA 3FT4B 4YZFF 1SY6L 1CFMA 1Q9KA 4HOWA 3F3HA 1CLZH 4QHLB 1FVDB 2JI1A 3ZQ9A 1A5FL 4BKLB 4K8RH 3C2AH 2WMPB 3C9NB 5EOTA 4JM2D 2DKMA 1IJNA 3BN9C 5DZAA 1ZS8B 4OVVA 1QPXA 1DN0A 2H1LM 3HE7D 3T4AC 3MRLA 3NIDB 5D93C 2FJGB 2PYEE 4XI5C 4CADB 1XWVA 5BQ7B 3RIFK 1CF1A 2V2XA 3OZLA 3REWA 4FQ2L 4N2AA 2CCWA 1J5OL 4PH8A 3BD5A 2VXQA 4G8EB 5I6MA 1J10A 3WKPA 1UKQA 4XNXH 3BDXA 3I9AA 1LWHA 1BQHA 1SQ2N 4Y4FC 1QR1B 2W0PA 4YSCA 1CFVH 3O0RH 1GOGA 1H5BB 1UT9A 3OWEA 1P7HL 1QSFD 2PCPB 2FQDA 3CFBB 4XB8A 3RB7A 5BVJB 4YHNB 1QUPA 4ZXBD 5IOPB 5LG6A 3KWUA 4AKQA 4LEEA 3BFWA 4DK6A 4XPBL 3M07A 4IRZA 4NFCA 3AACA 1J8HE 5F6HI 1E7UA 3GD1C 4ZD3L 1NBZA 1I3GH 1UWFA 4D9RD 4F80A 3IN0A 3D9AH 1M3JA 1NAKH 4KK9D 2Y72A 3CXDL 2GK0B 4RNRB 3DV6B 1JVLA 1QUNA 2WVTA 2Y5TA 4LLUB 4XNUH 4AGQA 3OKOA 5E9NA 3VW3L 1IMHC 1UWGH 1ZLEA 4PJ8A 4DKAA 5IKCA 4JR9H 4JFPA 3MVSA 3VXOB 3O11B 5BZWB 5CIPB 1NFKA 3QB7C 3MDJA 5GPRA 2XFXB 3HUJF 4ISVB 1PNCA 1YUHA 3L8QA 4PJDA 1FUNA 4RA3A 1KCWA 4DFHA 6FABH 2YBRB 2IMMA 3HB3D 3QISA 3I75B 4L4VE 4TS6A 3T4AB 4O51A 3VXTB 1NFAA 5AAWC 5D93B 4W9CC 3PP4L 3N43B 3AS2A 5AW3B 4QRRB 1RZGA 2YPVA 2WZPA 1QTYT 1KLGA 5BO1H 4G8FA 1HSAB 4HJUA 3MU3A 4P49A 4OLYL 5CJOL 4HW6A 2EDMA 4ZO6A 2R23A 1WO2A 2CKBB 1EX0A 2LU5A 2Z7ZA 5FCSH 3GZOA 1EHLH 2R69L 2HZHA 2YXMA 3KBHE 3S3SA 3U9WA 3H9SA 1U8CA 2B16A 5CJQH 4Z8FH 3O2WH 3R06B 3ETBJ 1BXXA 5IR1B 3VI3B 3B7UX 2LVCA 4OD2A 1PLGL 3GMQA 2DH2A 1RZJL 4LCCA 1TZ8A 5DYOA 4MXQD 4UINL 5DDHB 4MJIA 3IBEA 4HG4K 5TPWH 5CP3A 3IU3A 5DK3A 3NK3A 4I88A 5H94B 1PZ3A 1QBLL 5AOIA 1KIQA 1NDGB 3ZBMA 5BMFL 1YSOA 2G2PA 2FO1A 3P30L 2ARJA 2FATH 4PWJA 3MRDA 2V9UA 2OX5B 1VIWA 2GI7A 5AL0A 4RQQA 1V55B 4BD4A 4KVCL 3HMWH 3F64A 4H2CA 2M26A 1V7NL 1KENH 2NXYC 4DN3L 4IOSD 3KPMA 4MTMA 5IVXF 1AZRA 4HIXH 5BV7L 3BVWA 4QT5A 1EVUA 3MV7D 5BOJA 1XCQA 4ZPTA 3G5ZB 1W91A 1USQA 3P73A 1Q0XL 2DWDA 5EEXA 3LMJH 1EANA 3OZ9L 3QG6B 4YPGB 2A6KA 3ZDZE 1YYCA 4WY7L 1AZUA 4NQCA 1KB5L 1A9BB 3TF7C 2B4CH 4RFOH 4QRPA 5HDBE 4B27A 2BP5M 1C8QA 3O2VH 1RUMH 3CVHB 3QWOB 3VWKC 3Q2CA 1X6NA 1TFHA 3MLYL 3ZO0A 3FO9B 3L3IB 4Y88A 5ID0A 1B0GB 2YO3A 2DQJH 2BIQA 1OAUH 4P3DB 3LHAA 2EDQA 2OP4L 3QNXB 2OCCB 3KPSE 4Z95H 2KBGA 4G83A 2DWXA 4IIQC 4U1KA 3FQNB 2DDQL 3C5ZD 1U36A 2WLLB 1BMZA 3OPUA 4PTTA 1OARL 3JZYA 1CZ8L 4LOUD 3TNNA 4AM0B 5D4IA 1OGAB 4KTDH 5I2IB 4J6RL 3NZUA 1IKFL 4R7DA 1KBGH 4I13B 4O4YL 1Q1JL 3LXBA 4FJZA 3S36X 3T0BA 2Z6FA 5C0CB 2DMKA 2J12B 4BWWA 3MRFA 1VZHA 4PAZA 1BXVA 3V4VH 4MCYA 5KBNC 4PRIB 4TNFA 5KVFE 3V6ZB 1L7TH 1CFTA 2WN2A 2NXYB 3MGTA 3ARXA 4P4RB 5BS0D 1MLBB 3P3YA 5MENB 3MLZL 5C0RL 2R4SH 4J2XA 3NCWA 5F93C 4WO4C 1JMZA 3WNMA 3MBWB 3LRHA 3NJHA 4FL4C 4Z3FA 1Q90A 3SODB 3D18A 4XNDA 1MFCH 2XWJB 1NBYB 4JW3A 1KJ3H 3WIFA 4HGWB 4W68A 4YHYC 3DBXB 2D3VA 2NSMA 2OSWA 4XO8A 2IBZX 2Z8RA 2OAAA 1A14L 1E50A 3QH3A 3LKRA 4AYGA 2APBA 3VWKB 2GIXA 1JE6A 4BSVA 1T22A 3ZE1F 2EZ0C 2FO4A 4G7VL 1AHWC 1RUQL 5HDQL 4J2QA 4WAFA 1X3DA 3NIFF 4IIQB 1NSNH 2XXFA 3KDMA 2WQAA 2XG4A 1QEXA 3JWNE 5C6PB 7PCYA 3ESUF 3BLKA 3W37A 4J8QA 1MQKH 4D9RE 4RISL 3NYKA 5A6IA 2BJML 2A7BA 2PLTA 1S7QA 4XZUB 2I7OA 2VLRB 3MAWA 3NABH 4NKDB 1O9ZA 4IOFD 2C3WA 1JYVA 1CI5A 1BOGB 1RZKC 4DP8X 5C7XH 4XRCB 1OPGH 2FWUA 2VL5B 1VGEL 3D39A 4JN2B 4LPCA 1A6UL 3K2UH 3NIGB 5B38A 2ESVE 2AJYH 4BCZA 4WEMB 3KWTA 2NY5L 4WO4B 1XB3A 2FT7A 5CD5D 5L8KB 5EF3A 4UQDA 5C0BB 3QVAA 3G6JE 4FL4B 35C8H 4ZAKC 3DHUA 5D2NC 1I1FA 3T3MF 3U30B 3UC0L 7FABL 2WB1A 1KBWA 3D87B 4LF3A 3D07A 4K7FB 5GZND 5CZVL 4YHYB 4C4KO 1S5IL 4B7IA 2FLMA 2CIIA 3RFZA 3SDAD 3C6SA 12E8H 1Y6MR 2YJLA 1JV2A 3BPCA 3GSNB 4GMSL 4EQ2A 1YEEH 4WUUD 3FCTA 4KK5C 4RLDA 4TUJB 1AHWB 5EC1A 3AT9A 3VXRA 1OK8A 5A7EA 1H15A 2YZ8A 4MJ5A 3KPPA 2PCFA 4MWFB 3N9GL 4JFDA 2BC4A 4FULA 3V0FA 4ZYKA 2IEPA 1QI3A 3IK2A 1N64H 1KB9J 4UV7L 4XBPA 4F91B 3ULVC 4S1QH 1F4AA 3K71A 2EUVA 2ZKYA 4FNRA 5FKPB 3MCLL 3UBHA 2EDWA 3A22A 1ZSHA 3OR7B 4G80B 2IDCA 1XCTB 2C1OB 4JRXD 3AU1B 1CDBA 1PPIA 1XGRA 5EU5A 1TYJA 4QYOB 4YBQD 2BFGA 4G7QB 4G3YH 4NGHL 3EYOA 3HS8A 4U0RC 3UJJH 2N7BA 3FU0A 3VGFA 3UPRA 3WFEL 4WEBL 2ICCA 5T1MA 1WWBX 1O7DE 2FDBP 1TJIL 2HJFA 1X5AA 2E7LA 5EF0A 4R90H 5E03A 3BAXA 4YE0A 4N8VG 3PXLA 3C60A 4F7KA 2HVJB 3CU7A 3L5JA 1YEKH 3B6SB 3O41A 4P2QA 1NLDH 3CFEA 4KJPC 1F8TL 4ZAKB 3BKJL 4ZFGL 1GR7A 4W9DC 3TP4A 1ZGLM 5D2NB 2ZXWB 3F58H 3G9VA 2D4DA 4J1UA 3HFFA 2C3GA 4MMYA 3W39A 3GKWL 3MV7E 3CAFA 3EYVA 4PGCB 3NSFA 2LHAA 3TVMB 3LKSA 5I73B 5FECA 1NUGA 1PTZA 3ULUL 3VFTB 4JMXA 1FH2A 3AS3A 2WM0A 3MOAL 4LQ1A 4PP2A 3TTYA 3BAWA 3MOQA 4H8PA 4YDZA 3IJ8A 1ITBB 4NSKA 1GPOL 5ALCH 2Y3AA 3NJFA 3CX5J 3S6CA 4URTB 4XWGH 2YQGA 5LO7A 1G6RL 3VRIA 1NCCL 1GH7A 4Z78B 2WD0A 1RPKA 1MRCH 1ZS2A 2VRKA 4MCNA 4NC0B 2EO7A 3O6KH 1WGVA 1SY6A 2GBAA 3S4SB 1OAKH 4YHLL 3F7VB 3EYFB 5KSAA 2N3JA 3DMMA 4BZYA 5HYFA 1A2YB 3QQNA 4N1CA 4B97A 5BXFA 4XNAA 5JHDA 3ME0A 2V3FA 2AQ3A 3N1FC 4FE9A 5MEQB 2H9GB 1UXSA 1YJDL 2Z4QA 3KE0A 2HPTA 3WL9B 1YAZA 3RGVA 4I4WB 4X98A 1ASPA 1H3PH 4U0RB 1ZD6A 1L9NA 1NA8A 4MA1C 1Q9WB 2WTPA 4E42B 1N7ML 2OYPA 1A3ZA 5F9JB 2K3TA 4G6KL 4ABUA 1U3HC 3FNKA 3CGTA 2BHZA 2GSMB 3QIBC 3T77B 2UYLA 4LPWA 1FLRH 4N2FA 1OCZB 1UZ8B 4ZUVA 5IGXL 2BXZA 3D4GA 3BN9D 4M93C 3O3AB 3HFML 3US1A 3WTWA 3DECA 4AJYV 1IQWH 1TZIB 2XV2A 4TNWF 5C08D 1TQBC 2D0GA 4N0FA 5BS0E 5I19H 3ZDXE 1LK3H 5E2TL 1BZOA 3JV0A 2OKMA 3JYBA 4WV1A 1T7WA 1TLMA 1TCMA 2Q86B 4XI5D 1GOFA 1A1OA 5ABZA 2RD0A 3CN1A 4QRRD 4XVUC 5J6SA 2DB8A 2YD9A 5FM4A 2FJSA 1I9JL 4CNIB 5EULV 1DJYA 3WEMA 4YEFA 2EE2A 1D2OA 3GBMH 1KEML 4Y4FD 3T1FA 1LE5A 2VMJA 5F7EL 2DPKA 1HH9A 3V55A 2HH0H 1JK8B 1A4KA 1U8IA 2DD8H 2MQ3A 4XP5H 1B4JL 4X2UA 1D6VL 2FYYB 5FGBA 2WO4A 3T8MA 3BMWA 1BVNP 1Z66A 4PI2A 1GSKA 1CD1A 3DVNA 2AFNA 1Z5LA 3PUCA 1PJWA 2ZUXA 4AEHL 3QJFB 4OFYD 1XSJA 5CJBA 4L23A 1GGIL 2DBLH 4N22A 1ICTA 2J1KA 3HUJB 4QRTB 3MROB 3U2SB 1T03H 4MA1B 5FGCE 1KCVL 1E2ZA 4R5VA 1NMCB 4PVBA 1XAKA 2ZP0T 3BH8A 4ZTOL 1U3HB 4XPFL 2IDTA 3ML8A 1HQRA 3QIBB 1MCWW 3M8OH 1WZMA 2G3MA 3GMLB 4AIZB 4PSRA 4OZHA 4MB1A 5KN5B 5DRWA 1MZYA 3KJ6L 2E7BA 2XI9A 5LJYH 1IT9L 3P3RA 1W72L 3QUXC 2CDEB 3SKUD 4BUHA 2R2BA 1FYHB 2UZXB 1MJ8L 4V1DB 3ABLB 1PVHA 5IBUG 1LO4H 2B59B 3PWUA 4P2OA 5T1LA 1U8MA 2WY3B 5ECGA 1F90H 1WTLA 1U8NA 2BVQB 3WTTA 4XAWL 3J7HA 4HYTB 1DBAL 1OB1B 2R69A 3LNHA 1D3CA 2VDML 3FB6A 4B9YA 3BSZA 2B39A 3D69A 1MUJB 1WIUA 3L1EA 5HHOA 3UXFA 3GMMA 2AMGA 3V4PL 1NGWA 4UT6L 1U2CA 2W81C 3SIKA 4DPAX 1I85A 3GI8L 5GHWH 3GNML 2GSIA 2WK2A 5HHXL 2B9AA 4BH7B 3H2WA 4LQFL 3W5MA 3B9KC 1KLFB 1J1OL 5E08L 3PGFL 2DEYX 2YAOA 3IT8D 3SE4C 4XNYH 1MFMA 4HJJL 2D7OA 3II3A 1ZLVK 5IWLA 2H6PB 3ASOB 5D1XA 4LSVL 2APSA 3WBDA 5MEPA 4LMQI 3C6LC 3DRTA 1CXFA 2QVKA 3SDYL 1BAGA 2O6CA 2PPDA 4KHTL 2Y7LA 5I17A 4HUCA 1Q72H 1RUPH 4XP4L 3LSOA 4KDVA 1OTSC 2X2UA 5JO5A 1OGAD 3KBPA 3LPWA 5FW6A 1RFDH 1N3NB 1AIZA 4IEFB 1FORL 4KX8A 1HL9A 4QHUA 3RNQA 4D9QD 3S8GB 3GTTA 1FJ1A 3F00A 1PNDA 1TVBB 4R0LC 4PS8A 4WI2A 5IVXB 5C0CD 4KKRA 4X0KB 5JNYA 3C5JA 2H26A 3S34L 5E2UL 3QUXB 3W81A 5D7SL 4PRID 5J1AB 3RIFF 1TITA 2J8UE 3MCYA 5CP7A 2NXYD 1T89C 1D5ZA 2BOCA 2CIKA 3L4WA 2XKSA 3QPXH 3TN0C 5MEND 1IU1A 1KB5A 3GMRB 3RBSA 1OGPA 5IJKA 1JXFA 3KWXA 5A3IC 1HCZA 1D5XA 1NCBL 3HTLX 3TEXA 5A2JH 3KLKA 1FNEB 2YGOA 2YD2A 4NPYB 4UF7C 4XPHH 4NXKA 4LLMB 4UQAA 2WOBA 2AERT 3B9EA 1GA2A 2XSKA 1ES0B 1IL1A 2EEBA 2VL4A 2EDEA 4G7YH 1A0QH 4FQHA 3MA9L 3UAJA 5TD4A 3EFFA 3SE9H 2EP6A 3FU5A 3DPDA 3VWKD 1X6LA 1P5VA 4PJDF 5G5DB 3SQOL 4X6BA 1YHPA 3BGAA 2Y9RT 1W9XA 4Z77A 5I6XC 4W9HC 1MF2L 3QZBA 2VC2B 3C6LB 4G7SB 1QFWI 2Q9OA 3QIWC 4HK0B 3V6OA 4Y4HC 5EBWB 3Q2LA 3KWWA 3GPEA 3ZJAA 5DURB 4XCEB 4O02H 2ZOLB 2VLRD 4R0LB 4YGVB 5LLIC 3D50A 2H41A 1DQML 1K6QH 2CDGA 1L9RA 4HIHA 2P4AB 1KPRB 1FL5A 1X5KA 2FWOA 5KVDL 1UVQA 4X4MA 1WGOA 3TN0B 1FNHA 4NRXB 4QRUA 2X0VA 5D6CA 5C08E 4ZJ9A 4FJYA 4WO4D 2H2PC 5EEZA 3DGGA 3DO7A 3AG1B 3KCWA 4CL7A 4QGTA 3I6GA 2VM9A 3ZE1B 3MLVL 1KCRL 3UG3A 2XV6B 2SEBA 5E2WL 2BVPB 2X70A 4M48L 3NIFB 2X4SA 2QGCA 4KMLB 3MA7A 5JHBA 3ZTNL 1DEEB 4OGAC 1HKLL 3AC0A 4Q6IA 3WNLA 3L6FB 1NAMB 2EZ0D 4BWUA 4ZUWB 4YAQA 3WD5H 3ARFC 5J7CC 3GYRA 5TF1H 1NDMA 3T6VA 4CRPA 1VGKA 1KJ2L 1MCSA 4PGEA 3PS6A 3IDGA 5I6XB 4PRBA 4YDIL 4NWUH 1T1YA 4JKMA 5M94B 3QCTL 5E8OA 3QIWB 1EEUA 2OTWB 8FABA 2WO2B 5HGBA 4Z18A 1TETL 1F3DH 2YWZA 4FTVE 4NHUB 1JVOA 4Q9QH 3LNGA 1NOAA 1M71A 3K1KC 3CQQA 4HKZA 2W1NA 1MJUH 1UD6A 2F6AA 3RRQA 4PRDA 5EZLB 4AKPA 3FB5B 3TJEL 1G1CA 4HIPA 4P04A 1XGPA 3QT2A 5C3TA 4YHZL 5DZOA 5L2JA 3VFNB 3ILQC 3T3MB 4K7PL 4U6VH 1LDPH 1RVFL 2WSKA 4HS3A 2YARA 1X4YA 1THAA 3TBTA 2C5DC 3PNWA 1T1WB 1DQDL 2WLMA 2XV0A 1GS6X 2XQYG 4QEGA 4XX1G 3MLSH 4ZAKD 3L5XH 3B2XA 4OCYL 3MJ9L 1FFRA 3ATBA 1KPVB 5SWSE 5TQ0L 1T4WA 2V0AA 4N2NA 4I1RA 5KS9A 5GGTH 3MV9E 3B8YA 4L2YA 2OK0H 3BUYB 3VQLA 4DFIA 4EN2A 3MACH 5CEYB 2DICA 1AJ7L 4KJWC 3IAPA 4MD5A 3TVMD 5I0XA 4Y5VA 5JXEC 4BIKA 2WIIB 2Z7UA 4LRIC 4OFDA 2XTLA 43CAA 1QP1A 1VENA 4KK5D 4RX4A 2ZSVA 1JBJA 3ARFB 5T3ZE 3MLTA 1PSKH 1K5WA 3L3JB 2C9UA 3MBXH 1MWAH 4OZGA 3GJFK 4GO6B 3I6KB 2K0RA 5AD0B 3ULVD 1R5VA 5DO8A 2OCJA 3E1F1 2A9MH 4M1DH 4NIKB 2XVKA 3D2UB 3IPBA 1LXMA 4Y5YC 5C0AA 1RJYA 4PVLA 1DCLA 4NQDA 2R2HB 3BP6A 4FP8L 3X3GH 5DJ0A 5I8CA 1MAMH 1ZKAA 3SDDC 4UOW1 5I6PA 5C3LD 3S8WA 3QR2A 3V7AE 5BOZG 3FOLA 4EIZC 2R0ZH 1CN4A 3NTCL 4LO9A 1SHMA 3W0WA 3VD7A 4D9QE 1U4EA 1WSST 1F42A 4NQEE 3DK0A 5C0CE 5E1AA 5C09D 1CFNB 2NMSA 4KC3B 3VI4E 2PWDA 3CFMA 3NZSA 4KJPD 5SWZD 2X1XR 4U1SB 43C9A 5BUAA 1UEMA 3ZL4L 2BX5A 3NBNA 1UCBL 2BXYA 2DI9A 1RMFH 3MV8B 2E5EA 5ERWB 4Z1PA 1G6RA 4P9ML 4P5TC 4XB3A 1I82A 2JMRA 4OM1L 1YMMD 2CK0H 3FT2A 4HEPA 4JDTH 4FAAB 1LGVA 4KKBC 2A38A 3NDYE 4J6IA 1E4JA 1GGYA 1I9IH 4MVBC 1I7ZB 3E6FB 1U41A 1OM3L 4H8HA 2HLAB 3KG5A 2CO6B 1IILE 4X9HA 1INEH 4HJ1A 1BYNA 4E5XG 3UBXB 3ABGA 1A64A 1NBVL 5AUMB 4QRSA 3VFWA 4EI5A 1N0XH 2NY3B 1I7TA 2BP8B 1XMEB 3BDYL 1C5DA 1MFEH 4X5XB 4M00A 4XCFH 1B88A 1ZTXH 3O6ML 3Q48A 4Y5YB 4XC1L 2Z7YA 2D9CA 2J73A 4Y2OA 2Y36H 3H54A 5FFLA 1KTDA 2XZZA 2UY7A 5IFJA 1G7LA 4H40A 4PRNA 4BDVB 2VDQB 3LX9A 4XVOA 4K4KA 3FUJA 3Q1SL 4HFUH 4AQAA 3I9GH 1IBFA 2VLRE 1JWSA 4MD4A 2XXGA 1U3HD 4TSAH 3GSXB 3QIBD 3BXNA 3I50H 3PP3H 4QJ4B 3BZDA 1KV3A 2NY6C 2X9ZA 4DZ8A 4JGUA 1LTXA 2YOCA 1TVDA 4WUKH 2P8PA 2EYTA 2LQRA 5TE7H 1V3KA 4NO2A 4MS8C 4V1DD 4UIMA 5AENA 5IQ7H 3ZQXA 3KZ8A 5IHHA 2GEEA 2YA1A 3F12A 4ADGA 3BWZA 1XH3A 5GISH 1DLFL 4KUCF 4DF9A 4L1BA 5KW9L 2GCYA 5H2BA 4XVUD 4PJIE 5EUKA 4YC2B 4HC1L 3A6CH 4L3EB 2OXHA 1PKQA 5EU6D 4CN1A 2EIJB 1U0QA 1X7QA 3PHQA 4HG4J 4HU2A 3ZT5A 2CHDA 2PETA 4U1HB 4FCAA 3G04B 2AC0A 4L4TE 2HB0A 2WZAA 5HHVL 5DJXA 2VITB 4EIBA 4PRPA 3GMPA 1F6LL 1QASA 3V5HA 4LKCA 2DQEL 1W0YT 3L3KA 3DX3A 5DHDA 2CO7A 1FCCA 5AG9A 3JTBA 3IMWA 5JOFA 1UXWB 3GEFA 5BRZA 5GZOA 3N1PC 3KD4A 1QTSA 4YFLF 5IVOA 1GAFH 2BOLA 4N8UA 5F1NA 3B3BA 2BY3A 5LQBL 4WJKB 1G9MH 1EO8H 5DEZA 2E9IA 5IVZB 2FZ3A 5DJAB 1M42A 3RAJL 1OAZH 1W72A 4P23A 5LNDA 2WWNA 4EPSA 3ECBB 2G3XA 4QXTA 1TTAA 1DQJB 4NM4H 1AXTH 1E5BA 3FTYA 5GIRB 5FK9A 3HE6A 2NY6B 1ORSB 3LIZH 4PJAE 1GTNA 4PU2A 3QUXD 4WW1B 1EGJH 1N4XH 1R24A 1FBIL 1MFNA 3FUEA 2L7QA 2OYLA 3V4PA 2OSYA 3VXPA 4UT6A 1JN6A 4Z23A 3GI9L 1BWMA 1Q9KB 4UT7L 2QQNH 4PRHE 5IJVA 5J9PA 1CTOA 4PJ7E 2AEQH 1R3JA 6TAAA 3IYLW 3LNEA 5EOTB 3NJLA 1RD6A 4K94H 3NJNA 1GS8A 2QBWA 1TO4A 3GXFA 4IJ3C 1MFAH 5IHUH 5ALBH 1KJVA 4PY8J 1DN0B 5LBSH 4MZRA 1XR8A 3MRLB 2IMNA 3B9KD 1LP9E 1OTTD 5FO9A 2QPSA 1YN7A 3TPUA 2V2XB 3REWB 2WXRA 5I0VA 2FX8H 1A7OH 4PBDA 1UXMA 3PWPA 5D2LE 5DYFA 5E00A 2UXFA 3BSGA 1BQHB 3N3EA 4NRYA 3C6LD 2MSPA 2UXTA 4FD0A 3LQZA 4HOZA 3FPXA 5GQBA 3VSUA 2AGJH 3DJTA 1E4KA 1OTSD 3O3EA 4M6AA 5AVTB 1N18A 2CM5A 5DURD 3OTTA 1OSPL 1J0ZA 2AQPA 5F7WC 4J27A 5C9JA 1CUOA 2NOYA 3WEAA 1Z0MA 4TLKA 3P54A 1M1SA 3ENEA 3X1NA 1NIDA 4ZSOA 5FUCE 5JIHA 1E2VA 1NBZB 4YO0A 4M5TA 2B0SL 5F0PB 5C6TH 2HRLA 1OQXA 4DHLA 1C16A 1KTKE 5C09E 5DO2C 1OANA 3G5VA 1Z9OA 3GM8A 2XICA 4LCCC 4L9LA 3S35H 4YUEH 2Y5TB 1A3RL 3CK0H 2J1XA 2X88A 3OKOB 4UZGA 5F9AC 5SWZE 3TN0D 4PJ8B 4M5YL 5IKCB 4JFPB 3VTTA 1J5HA 5KBMA 5A3ID 3UERA 3SDCA 3B1UA 4N9OB 1BEYL 3GSOA 4JRYE 3G6DH 1XIWA 3P1VA 1QFWM 1YUHB 3GSQA 4QMEA 2VMDA 4PJDB 1YMME 1THCA 3M1BA 4PGJA 4IJ3B 4R8WL 3NSXA 5C1MB 2GBUA 3CLWA 4NLHA 2E7MA 3PNRB 1J1XH 5E8DH 4S0TD 1YYMH 2A83A 2PO6A 3WEXA 4XT1C 4LE8A 1DTUA 4OZHF 1XT5A 5DVNA 2XWZA 4AEIL 4UAOB 4ERSH 1RZGB 4TQ8A 2UV3A 3BKYL 3GPSA 4QNPE 4ICXA 4XP9L 1KLGB 2N56A 4G8FB 1U2YA 4F24A 1Z7JA 1QWHA 5GS2D 3QIWD 2QPEB 4JO4H 4Y4HD 3HKFA 4DWHA 3CQFA 2R23B 4ODUB 4CBZA 3HUJE 3FHAA 4GMTH 3H9SB 1U8CB 3N85L 2Q7NA 1LWRA 1BBJA 5L88H 2XWXA 5TDOB 5SX5K 2MFNA 1CGXA 1N70A 3TT1L 1AD0A 4BRVA 4F7PA 4OD2B 3GMQB 1B0RA 4WWOA 1NCIA 4LCCB 5DYOB 5AVSB 4MJIB 5CSBA 4P06A 5BO0D 2RR3A 1DYZA 3LQAL 2H2PD 3EO9H 2JKIS 4V1DE 2E9GA 4OCRL 1QG3A 1KIQB 4PHZA 1UD4A 3ZU8A 3WNJA 2IALA 1ZDSA 3UTTA 1FSKB 2ZOWA 1FNGA 2ARJB 3JUZA 4UOW0 1KJ2A 3MRDB 4OM0L 2XCMC 1NEUA 4X7SH 2D31A 4RQQB 5EU6E 4RVBA 4F2ME 4OGAD 4I3RH 1OTUC 3KPMB 3GLDA 4G6JL 4YE4H 3ARFD 1OIOA 2I25N 1EEYA 4QT5B 1XCQB 4ZPTB 2P24A 2QGEA 5FGRA 3P73B 2DWDB 1MCPL 3T6WA 4X5RA 5HHQA 2NNXA 2IANA 1INQA 4M6MH 4XBGA 2A6KB 2TRYA 2GFBA 1FV1A 4X7TA 4NQCB 3D2UD 2YRBA 3KL0A 3UZVA 1RSYA 4QRPB 2VABA 3MPCA 3VDBA 1ZVYA 5GSVA 4HETA 2W91A 3OPZH 2HFGL 3U82B 2XG5A 4Z7NE 5TE4L 4H5SA 2ZXEB 4AUYA 1J1PL 5ID0B 5D1ZA 3D25A 4M1GH 2BY1A 1CC3A 4V2BA 2XETA 4LIQL 4U1KB 1EK3A 2R4RL 3MJ9A 3ILQD 4HHWA 5AG8A 5GGQH 1SNRA 4GSQA 5BW7A 5AW2B 1JV5A 4PTTB 5EZOL 3TNNB 4K5OA 4UQCA 4OI8A 3AXIA 5E95B 3W5NA 4WHTA 4X8JA 3OAYK 4NZTL 2BVEA 2C4FT 4KOBA 1LK2A 4R7DB 2R0LH 1TZAA 2NZIA 1NMBL 4G8AC 2KDGA 2WOYA 3THMH 2CR3A 4MRBA 1TLKA 3C12A 3MRFB 3CWGA 3MV8D 4KI5F 4KJWD 5JXED 3WENA 3HZMA 1CFTB 5DRXA 2QSTA 1GZPA 1HYRC 1NIBA 2AJVH 3MGTB 3V6BR 2R8SL 4PGDA 2FO8A 4H8QA 5IW3A 4BRJA 2FJFA 1FG2A 1UH3A 2HRGA 3UAEA 5DD5H 1HL4A 2NYKA 1YC8A 4K9EC 3R7RA 3EIFA 4WIQA 3D18B 2MOQA 5I8KH 1OCOB 2WW8A 4IM8A 2VRQA 3O4LA 4OR1A 1KBBA 4MMZA 4ZPVA 3WIFB 4W6YB 1MRDL 2K6ZA 5FYKL 4N8CL 3RFZC 5EF1A 3QH3B 4KKCC 3LKRB 3K5RA 3ARGA 1JG9A 2R51A 1MEXL 3RI5F 3SDDD 2VDNB 1IM9A 4AYEC 4BSVB 1T22B 1PW3A 3OKKA 3LEVH 2ZAHA 1C9SA 2OL3L 4G42A 4URKA 4EZLA 1KFAL 1AZBA 4UBDC 1EZSA 1XXDC 4GQRA 2YD3A 1GZQA 1WBZA 3KDMB 2XG4B 3ABMB 3QS3A 4F33A 5CUSH 3HI5H 4ZZKA 1YNKH 2MCPL 3HBGA 3HHMA 3TV3L 3UCQA 1S7QB 2IV8A 4LSQH 4PJGF 4YXHH 1AR1C 1ANUA 1BG9A 3CD4A 4FI6A 1NGXB 3VXUA 2J72A 2D2CC 1NGYA 4P5TD 1YCSA 3D39B 1L0YA 4F8NA 1QX1A 2E7LC 3AXLA 3ZE1E 4F57H 3CC1A 5B38B 4KKBD 4L3ED 2F0CA 3C60C 4BXSV 3EZ8A 4MVBD 3VFVA 2H2SC 4JVPA 3KXFE 2EDRA 4B3VA 2ZG1A 4RAHA 4IK6A 4WLCA 2ID5A 4MJJA 5CINH 4BUQA 3IRZA 3ALXA 3CFJA 1I1FB 1A6ZA 2O5ZL 1P5UA 4X7CC 3V8CA 3ZTCC 5K5YA 4LF3B 4L1SA 4H88H 1QFPA 4LT7A 2FQGA 1SQMA 1UA6L 2CIIB 3RFZB 1VPOH 5F9WC 3C6SB 3RPBA 2ATAA 3DX4A 2V9TA 1JV2B 1YPZA 3BPCB 1FA4A 3U6XS 1RUAH 25C8L 1UOKA 2O6FA 3FC8A 1E30A 3FCTB 1TQCC 4IKNA 4PY7A 4W70A 4PJCA 5KS9F 5EC1B 3VXRB 1BM3H 1CU4H 5BRPA 1H15B 4HMEA 4MJ5B 1KXQE 3KPPB 2PCFB 2XQYA 4JFDB 2BC4B 2HTKC 4ZYKB 2GJPA 1MIML 1I3VA 4XVJH 4XBPB 4MNQE 5DJ6A 4EBQH 3K71B 1L5GA 4CDGC 1V3LA 1ODUA 1E9PA 4BBWA 5AYTA 5L7XH 2NY6D 5CKGA 2VR4A 3DMMC 3PHSA 4OZGF 1ILSA 5KSAC 3IB4A 4HQQH 1AR1B 4LSRH 5KVEH 4MS8D 2ZZUT 1XGRB 5EU5B 5ANMA 4FEIA 2ZX7A 2BWQA 3HKZA 2Z8VC 4HLEA 3UPRB 1B3IA 3KPRA 5T1MB 5A2AA 2HJFB 3ZDYE 2XZQH 3KAAA 4HBCL 1I31A 3C60B 5B4MC 3P40A 3O41B 3C5XA 4P2QB 4I9XA 4DP1X 4DVBA 3S7GA 3CFEB 3QC6X 2VWEE 1E3XA 1CICA 4R97C 3TM6A 2V9RA 1R4XA 5EIVA 1NMAL 4J1UB 3VUAA 3HVDA 2EQDA 4U3HA 4MMYB 3W39B 3U1SH 4WV1C 3EYVB 2UX6A 4JPWH 1F4WL 2IPUK 2P5WA 3RURA 3LKSB 5FECB 5BUPA 3V52L 3WIAA 4I2XA 5EIQA 5F1OB 2XBDA 4PP2B 2I07A 2I60H 1TQCB 4NSKB 4R26H 4C4UA 5AOZA 5KYWA 2QV2A 4HKBA 2AJUL 2AQSA 3OMIB 3VRIB 1LILA 2VDOH 3WV0A 2DMBA 5FGBC 4LXFA 1T80A 2VO8A 2PUQT 1HHGA 3B9DA 5KVGL 4QOKE 2ZKXA 4CJ1A 3ETSA 4BFBD 2D7MA 2FWLB 1AE6L 1WC7A 4GINA 5KSAB 3DMMB 3MJWA 4QTIL 5BXFB 1J87A 4NUGL 5JHDB 5HI3C 4KZEH 1BQKA 2WV3A 1UXSB 2CSPA 2Z4QB 1S9KC 2A77H 4ZTPH 4XVTH 1OKEA 3RGVB 3NCYP 4X98B 5BPPA 3F2LA 4L3CA 4AQ8A 2FNBA 4HEMA 2JI2A 4NENA 1BQLL 2R0KL 4FZEH 1JPFA 4TULL 3MV8E 3WFBH 3ZK0A 4NPJA 2UYLB 1RIUL 1S7UA 3FJTA 4DUVA 3A23A 5KJRL 3QDAA 1KXVA 2APFA 2GYSA 3EADA 4R97B 3QUZA 1RIVH 4N0FB 4XCCH 1JF5A 4X99A 1HZLA 4GT0A 3TH4T 4WV1B 2Z93A 4HALA 2CD0A 2NNRA 3KBFA 4DKDC 1KEGL 1CBVL 1ZRUA 4P2OC 4XMLH 5I74C 3P2BA 3CHXA 3ZE0E 2EKJA 2Z3FA 2WZPD 4QXGH 2IIJA 2F54E 4HP5A 1MREL 2GIMA 3EJUA 1JHTA 3ULAB 1OF2A 1S2EA 3I6LE 3QJHA 5DJDA 3T1FB 4C55A 4NCDA 2KLRA 2ZSWA 3J2PA 1LE5B 1HHHA 1HH9B 1I1CA 1NGPL 2BIHA 2XX1A 1CVSC 1U8IB 3HC0A 3IF1A 3QXWA 2CMRH 1W2KT 2X41A 1WK0A 1I85C 4YBHA 3SYPA 4TLSA 4CN4A 1EO7A 1N10A 4IGBA 2KPWA 1CD1B 3DVNB 3H9SD 2GG1A 1Z5LB 2XYCA 5I30L 5F0LB 1DSFH 4O5LL 5FOJA 5IWLC 1HAWA 5DO2D 3BKMH 5D1XC 3ZMNA 5BZDA 5FW8A 5CS7A 1BIIA 4MJID 1E2WA 4YDLB 3AQXA 4XCYA 1L3WA 8CGTA 3BH8B 5DCCA 4Q9CA 2DIAA 1QRNA 2IBBA 1HQRB 3CFNA 1A6VL 1EA9C 2R15A 4OZHB 2WQWA 5DRWB 1P9MA 1BVZA 1E4XH 4GP5B 3NP4A 4WKXA 4JLRA 2JLPA 3FAXA 1KCSL 2R2BB 1GY2A 4PD4K 1QR4A 3C8HA 2XFGB 3PWUB 4IHOA 4P2OB 4XWOC 2X05A 5T1LB 2XTJE 1G7HA 9CGTA 1EUTA 5I74B 1U8MB 3VFMA 4AM0Q 3OGOE 2WJ7A 1U8NB 5IJKC 4BZ2H 4DH2A 1SN0A 3FB6B 3QUYC 3D69B 5HHOB 4JY5L 3GMMB 4G5ZL 1NGWB 2VCOA 5FDWA 2A9DA 4M62H 5HXMA 3GJEA 1MI5E 1VZGA 3MX0A 1OLLA 4QRPD 2GSIB 5CIPH 1KYAA 3S3CB 3UAJC 5LHDA 3WXWH 4ATWA 3VD2A 2VQ1A 2AITA 1HINH 1EZVY 3TIDA 1BZDA 4EOWH 2IQAA 2VXVH 5AOLA 3L95A 4YQXL 4N20A 4NZJA 1SMDA 5D1XB 3PHOA 2KZBA 5MEPB 1BAFH 3IFNH 2BRRL 3DRTB 5ICXA 3QYMA 1E5CA 3CZSA 5I17B 1E9OA 4NN7C 3UTPE 3MYJA 3V6OC 3LSOB 3MLXL 4OCSH 4WFFD 5F7MC 1QLFB 5JO5B 1Z3GL 2KQNA 4CBPA 4KI5C 2CLRA 1NKGA 1DJHA 3N5AA 1DL7H 4QHUB 3RNQB 1FJ1B 3H0TA 4TRPL 3NA9H 1YEJH 3D6GA 4DN4L 1MCJA 1G9HA 2MKLC 5JNYB 3C5JB 1WBXA 2H26B 4BK4A 4I48A 5I1EL 2APWA 1K72A 4MASA 4OV6F 4ALAH 1FNSH 2ZCKL 4O02A 4UU9A 2J4WL 1R3KA 4RSVA 5CP7B 2IVFC 5JLZB 2CKBH 1D5ZB 1OTUD 2CIKB 4J3SA 3WKYA 1KB5B 1MHHA 2E6QA 3WFHA 1GKOA 1PZ2A 5E1HB 2P5PA 5K9OA 4Y9FA 1D5XB 2AJXL 2NT0A 3HG0A 1OCCB 1MW3A 4K5LA 3U9UA 3GSUA 4MCZA 5LVEA 1ZT7A 3QUYB 2C3HA 5AZ2H 2EDBA 5B3JF 1T83A 1IL1B 2XN1A 5TFSL 5FYJD 3INUH 2H1PH 4FQHB 4UIKL 2KZWA 4GKZA 3EFFB 5B1CA 3VX1A 4HKXA 4E9LA 5GGVL 1LMKA 1FGVL 2IJ0C 4J3WA 5CEZH 4N86A 1FCGA 4CVUA 4KNQA 1P5VB 3Q13A 3QNZA 1PFCA 4X6BB 4O00A 3R1GL 4Z77B 1CYGA 2YUWA 2C9SA 3U36A 3WE6A 2BDNL 4M7LT 4DTGL 1QAWA 1XR9A 5FCUH 1UATA 3IBOA 2BCKA 3KWWB 4GPVA 4JG0L 4G2AA 1FPTH 2R56H 4IDJH 1M7XA 3CMOH 2RA1A 3VTMA 3HN8A 2NY5C 4U6TA 4DPBX 1DQLL 2CDGB 4HIHB 3VD0A 3FU6A 1FL5B 2V17L 2YKLL 3D39D 4DKEH 5L9DH 2R29L 3CXHJ 4FFTA 2FWOB 2PW1A 3DWTA 1UVQB 4PJDE 4DP7X 4WDIA 1ZHKA 1FG9C 2APTA 3CVHH 4LSPH 4QRUB 4FJ6A 5D6CB 3U4BH 2QQKH 4JCMA 1IGJA 4F2EA 5F1IA 3DO7B 4JVWA 2VLKA 4ODWA 2XN9D 3TA4D 3VNYA 2D0HA 1RV6X 2HX8A 4Y19A 2X4OA 5J11C 2BZCA 4XMUA 1ZVNA 2SEBB 1IJ9A 4GNKB 5IW6A 1P1ZA 2DLHA 2DQUH 2X70B 4JQVC 4KK6C 4PIRF 1JP5A 2NX5A 4OI9A 1GCYA 5CCKL 2X4SB 4Y5VC 4KKCD 1SYVA 3P77A 3MA7B 1HXYB 4LSTH 1IBYA 4Q6IB 3J8F7 4YAQB 4WW2A 2WXMA 4FF9A 4DQAA 3VXRD 1KWGA 5ISZA 3RIKA 1NDMB 1VGKB 2B9BA 4UBDD 4PGEB 5KTEL 3T0EE 3IDGB 4X50A 4JFDD 4PRBB 3PWNA 4PJGB 2I26N 4Z7WE 1T1YB 3FYIB 5GS0C 5E8OB 2ZCZA 4H26A 5K33A 5GGSA 4E0RA 2IG2L 5HGBB 1ZJAA 2AI0H 4KUCD 2CGZA 5IREA 1M71B 2OR9H 4UTCA 5FGSA 4HKZB 4PJFA 1AR1D 1EAOA 5HVGB 4PRDB 3S9DB 2CLVA 2VDLH 1XGPB 1JRHI 2EIKB 4ODTH 2IGFL 5DD3L 4HMDA 5L2JB 3SZKC 2Y2YA 3L5WA 3OB8A 4BJLA 2BNRE 5C07A 2E86A 4HS3B 2KKQA 3LOWA 3C60D 3CZNA 3TBTB 2BS71 2JJTA 2H2SD 4P2QD 3PNWB 4GQZA 2B14A 4GAAA 4ZS7H 2J57A 4Q9BA 4PWGA 5I71C 4JFVA 5D7EA 3P11H 4JDVA 4M7KL 3V0DA 5J11B 1NLBH 1JGUL 5KS9B 3HC4L 5JW4N 3GM0A 1FF5A 3AW5A 1JXGA 4KTYA 3T6XA 4BM7A 4MD5B 4LARL 4Y5VB 1FH5H 4IOIA 4Y1AE 3RWGA 4P5RA 1KCUH 1TXKA 4Q0XL 2ENPA 5HJ3A 43CAB 4KRNA 5I8EA 2FWSA 1AQMA 2VAJA 3GXPA 3MLTB 2OXGA 5F2FA 5GSRA 1Z6JT 5DK2A 2CJTA 4OZGB 5ITBL 3O2DH 2HTKD 1QSZA 1ZLUH 4ES8A 4EI5C 1YJDC 1MG3C 2VR8A 1R5VB 3K80A 4G1EA 4TTDC 3IMUA 4UB0L 4LCIH 4JGMA 1MOEA 5C0AB 3KGUA 1RJYB 4NQDB 3BP6B 3CNKA 3TASA 5KSAD 3DMMD 5DJ0B 5I8CB 3OGCA 3EGDA 4OSUL 5EOCL 5JHDD 3GDBA 1QBAA 3FOLB 4WFFE 4A68A 4ODSL 3SCMA 3GFUA 5DVKA 5EA0H 4OBRA 2AJSH 4JO2L 3D0AA 2HT4C 5IVNA 1A7PH 1SUJA 2F5BH 1YN6A 3CFKA 3H2PA 3O9WA 2WSPA 1MCKA 2XZCL 3SKJL 3UPCA 4N8PA 4GYBA 3GSNH 5E1AB 5B4MD 3WKMH 3ZYIA 5EFIA 3X14A 1A6TA 3KHOA 5I71B 43C9B 5EHFA 3M88A 1BZ7A 4NFBA 5IEKA 3EFDH 3RNKA 4CDHA 1GIGL 2YSTA 3DXAE 3QXAA 4ZNCD 1SDDA 1F02I 2ICWJ 3KGSA 1TR7A 1G6RB 4NBXB 4UT9H 1XCWA 1EHAA 3FT2B 3QJZA 3MJ7A 3OSKA 5B7MA 1M1XA 5IUCA 5FYLL 3TS8A 1EJOL 3QZMA 1IAOA 5AVRB 1JPST 1B6DA 1IGFL 1RZKH 3K72A 2E76C 5CJXC 1EQWA 5DFAA 3VGGA 4K3JH 3VFWB 4QRSB 1FAIL 2FK9A 2JF1A 2YK1L 4EI5B 3GHBH 1I7TB 2F18A 5EZJA 4K8RC 3WTYA 4KGLA 2VZVA 3VGAC 1C5DB 2DQDH 5DLMH 5KG9B 1BDYA 4BCXA 4QWWC 3ZHKA 1R3LA 3D85A 4KVNH 4L8BA 1N8ZA 4X9BA 3PHAA 4Y2OB 1CT8A 5CGMA 5GZOC 1KTDB 4GKOA 3KS0J 3QRLA 1CDCA 3OAZH 2UY7B 1ZXQA 5IFJB 1G7LB 4PRNB 2EACA 2A6DA 1WAAF 3L3OA 1PJ9A 4AQAB 2V6HA 4P23C 1YPZF 1JWSB 5M95B 4PV9A 4YIQA 3S88H 2HX7A 1UGKA 4PJCF 3FFCA 1ZLWK 4KPHL 2Q2EB 3BXNB 3SE3C 4GXUM 3HE6C 3D39E 4JFEA 4DZ8B 4ZO7A 1K2DA 3MXWH 3NMEA 4CAGA 4ZX4A 2EYTB 4P2RE 4NO2B 3KR3L 4BA0A 4UIMB 1JOIA 5DUMH 2IH9A 5FV1L 3ULVH 2LGNA 4WKZA 2EUXA 4QF1A 3F12B 1YMHA 1TZOA 3DSNA 3H9HA 1XH3B 4P2OD 4OF0A 5T1LD 2XN9E 1QSED 3LIZA 3V2AR 4QLWA 2GCYB 5H2BB 3C08H 3U0WH 5EUKB 4LL1A 3NJKA 3MNWA 4YFDB 1HNGA 2F19H 2OXHB 1JZEA 1PKQB 2ZD0A 2CUHA 1E5ZA 2HFEA 4JBSA 4ORGA 1WUZA 1Y0LA 1X7QB 2PWHA 1JGVH 3PHQB 5HHOD 4MXWH 2A6JA 3VGHA 1LO2L 4DK5A 1ACXA 3WEBA 3IS0X 1C08A 5L2KA 4PRPB 3Q44A 1JDDA 3GMPB 2ROXA 3V5HB 3VGAB 3VXRE 3BRDA 3FB8A 3L3KB 3NG5A 4GEJA 3OBAA 4LKCB 5EIIG 2CO7B 4KZDL 4OW6A 2HAZA 4QCIA 1LO5A 3FSOA 4DP4X 5JOFB 1I7RA 5ACLA 5BRZB 1SXBA 3ERXA 4FLOA 5F1NB 4WZ9A 1B3JA 3BHBA 1CDYA 3D3VA 4LPUA 5D1XD 5F9OH 4Y4KA 2HG5A 3SQBA 2FZ3B 3S2CA 1W72B 4AXWA 5I1IL 4G6MH 3SOBL 1E4KC 3M86A 3MODH 1XGYL 4P23B 4GI8A 1KSRA 1A6WH 4BSWA 2WZ5A 2Y2TA 4OGZA 1U4FA 3O6LL 1BX2A 2HRPL 1U8PA 5FK9B 3HE6B 4APQA 4U33A 3AQZA 2MPAH 2E8ZA 3D05A 4N68A 1FNFA 3FO0H 1BMGA 2VDMB 1HOEA 1R24B 2Q7YA 4HZLA 5HJDA 3WJJC 4FQ1H 4XWOD 3V4PB 3VXPB 2B2XL 1JN6B 3NN8A 3FUIA 3JV6A 3MSPA 3EDFA 3JTSA 4XO5A 5IJVB 5J9PB 2I24N 3EOYG 1R3JB 3SDCC 3IMBA 1XIWC 2V3EA 3QUYD 1H3VA 2YD7A 5E8PA 4LBAA 1U8LA 4OD1L 4R9HA 4CSSA 4OFQA 3H7BB 1KJVB 5HYJE 4WTQA 3Q8AA 3WTSA 3UAJD 2FGZA 4CA4A 3NACH 4CW1A 6PAZA 5FO9B 1CFQA 1CXEA 3TPUB 1YN7B 4DKFL 4EI0A 3Q7JA 1E6OL 2R59A 3ZT6A 4W1TA 4HUNB 3PWPB 3EYSH 3T2OA 1TSRA 3LDBC 1S7SA 5E00B 1U6AH 4NRYB 5MERA 4NFDA 2VQUA 5JHLL 3KHQA 1OWRM 4ZMVA 3LQZB 3DPBA 1GYAA 4GJTB 3BI9X 3O3EB 4DVRH 5HVHC 2A4CA 4GB9A 3MMEA 4KI5D 4BFKA 4RESB 1UADC 2FLBT 4K23H 2B4CL 1GW0A 3APNA 5IP4A 5C9JB 1KYOJ 5LGHL 4ZSOB 4YO0B 1HHKA 4JM4L 1XFPA 2AQTA 1C16B 5AVUB 2YJQA 3QE5A 3G5VB 4XBEH 2ZCHH 1S4IA 4FZ8L 4UV4L 4PB9L 4YN3A 2GKIA 5J12C 1AXIB 2CO1A 4JCLA 1JS4A 4K2UH 5CCJA 2IC2A 3BESR 2R1WA 1DBBH 3SDCB 2AK4A 3GSOB 1XIWB 2LTQB 3GSQB 3FUMA 4FQJL 3ARDC 3M1BB 4YHOL 1CGVA 3PXHA 3H4HA 1PG7W 2EDXA 3I9IA 2ZICA 4M5ZH 3GRWH 3A5VA 2A83B 3WEXB 2LW3A 3SGDH 1S7WA 4Q97A 4RRPM 4HKJA 2A4EA 3APDA 3L45A 2Y25A 4P3CL 5CKAA 1TQSA 3TEYA 3OKLA 4ZI8A 4X6FA 1JTTA 5DS2A 4D8OA 2C3VA 2HCZX 3DTUB 2IPKA 3MQIA 3K8MA 4FA8A 2IFFL 5HVHB 3DGCR 2EDOA 3FH7A 2R29A 1ZHNA 4N0RA 4C58B 4O58H 1K85A 1CURA 3CJJA 2OMUB 5IBUB 4KRMB 2R0WH 4B9KC 1XAUA 1BBJB 2UVFA 3GO1H 4NBYB 5JR1H 5I28A 1CGSH 1AD0B 3F5WA 4Z7UA 4OQTL 4F7PB 2X9XA 4MQTB 1Z3RA 3LH9A 1B0RB 3IGKA 5FWRA 2Q0ZX 4OZHE 4MBRA 4Z3HA 3CLFH 4FFWC 1WJ3A 1UZ6F 1BWWA 4N0UA 4X6DE 5AW9B 5BW7C 3ILEA 1KBKA 4F9PA 5JHAA 1NWOA 5JUEH 1YY8A 1E27A 1MQKL 1FIGL 5DMGC 5DFTA 4NKOA 2EEXA 5LBVA 3NCJL 3SY6A 1QSEE 2IALB 2A4ZA 3UTTB 2VC2H 1FNGB 3ARDB 1F45A 4UTAH 1MHEA 3TT3L 1KJ2B 1JNNL 4KK6D 3OWRA 3DX6A 3RVXC 4FXLA 2D31B 2BNUA 3K74B 1OPGL 5HHOE 4DW2L 2WUBL 4AT6A 1VERA 4HIEA 3WY3A 5T5FL 4AOFA 1NCWH 4KQ3H 3K2UL 4LCUA 1EEYB 1FI8C 3FQWA 4P9HL 2P24B 3LNFA 2O4EA 2V8MA 4LMQE 5AEAA 4TVPD 3R8BB 3UMTA 2IANB 2R7EA 5GS0D 4K7PX 2ZP8A 4XBGB 5IB2A 2GFBB 1FV1B 4JKKA 4X7TB 3TBVA 3D12B 2CJUL 1OCWH 2I9LA 3SJVE 1MCOL 3UZVB 1Q9LA 5C0AD 1GOHA 4HBQA 4NQDD 2VABB 5D1XE 5DMIL 5B39G 2FVNA 5GSVB 4HPOH 4C4KT 2XG5B 3DLQR 2CUMA 2ZG3A 3BP7A 3EOTL 4H5SB 1NDTA 5DZNA 3BE1H 4GG6F 5D1ZB 3D25B 4ABQA 4MDIA 1LEGA 2IADA 4ODXA 3DX9A 4OLZH 5EBLB 1QLRA 2WXNA 2XA8H 1JV5B 3S37H 1LEIA 1N64L 1I8AA 3SYAA 4FNTA 3VXME 4AJWA 4UQ3A 3UJTH 3OXSB 1EXUA 2JELL 4WHTB 4X8JB 5TH2B 4ETQA 1LK2B 3DVFA 3E0GA 3FQRA 1MH5A 3TONA 1NCHA 1E4WL 3OXRA 3GRGA 1S9WB 3VMOA 5FUZL 3B7RL 1VRSA 3JWDL 4WENB 2EH7H 3DVIA 4XH2A 1I75A 1GGCL 3WXVL 3QYNA 2F8VA 3CZEA 2BH0A 3BWSA 3HZMB 4Z9KB 5DRXB 4FFYL 1GZPB 5AW5B 3ESNA 4H4NA 3WFDL 3S36L 1RZQA 4PGDB 4ANXA 3A6BL 4OLEA 2FJFB 1FG2B 3CDFA 3H55A 4F5CE 1B2WH 1UACH 2NRDA 4PVMA 1FHNA 2OQJA 2WYTA 3LQMA 4HHGA 4EI5D 4TTDD 2FX7H 4DGIL 1RZ8A 5LXGL 2I27N 4UAHA 3H7LA 3O4LB 4HOMA 4KY1L 4JKPH 3EDKA 4ZPVB 2O5XL 4OZFG 2VRAA 5EOQL 1R5IA 1KGYE 3QARA 1AQHA 3ARGB 3TGXA 3ARZA 3PAVA 4TNVK 1GYWA 1IM9B 1OD7A 5AOMA 3FU7A 3PCYA 1TDQA 3V6OE 3WDHA 3OKKB 4EE2A 5HPOA 4G9FA 3PLYA 4DUXA 4ZW8A 4TVUA 2HT4D 1IFGA 1U42A 4XMKL 2OSLA 4PJBE 4UMGA 3UP6A 4PMEA 2IO5A 3NJXA 4ZTEA 1GZQB 3PWLA 1DSWA 3E38A 4WNQA 1NFIA 4F33B 1MFUA 2Q10A 4WW2F 5JA8B 1IAII 2FBOJ 3SPVA 4XNZC 3VH8G 4JN1L 1OSYA 4L5FE 3BIKA 1GC1H 4QHKI 2W92A 4MX7B 3CN2A 1D7CA 3FULA 1UB6A 2FUQA 1S9VA 5CMAA 3VD9A 4U6YA 2NY7L 5IJDC 3A67H 4OJFL 3VXUB 1NGYB 2VN4A 1FGNL 3AXLB 3IS1X 4PJFF 4XPAH 1KIPA 2FE0A 3CU1A 5EEUA 3EXLA 3VFVB 1CDIA 1KBPA 4LEXL 4CMMB 1JNHA 1WA1X 4MB3A 1CICC 1IGCL 4P07A 4QJ5B 3CFJB 5DWPA 1I8MA 1A6ZB 4JPKL 1P5UB 4M7JL 5E9DA 4PRPD 3SBQA 4U1LA 3VXSA 2P44B 4TSBH 3ZXAC 3V0IA 1LK3L 4QWWD 5K1VA 5H37H 2WXKA 4NM8L 4PRAA 4GW1A 4PJGE 5BRZD 5GZOD 1YPZB 3BPLB 2XN0A 1KUMA 2D03H 4PS7A 2RACA 4PY7B 3I74A 4PJCB 2CNZA 1IGMH 1HCYA 3DV4A 3FTZA 1KYUA 1QWUA 4P23D 2AK1L 2AEOA 4MGXA 3SKNB 1OP4A 5DJ6B 3WI9A 2IV9A 1L5GB 2X42A 3PFQA 1DUZA 1E9PB 3OMAB 5KVGE 1WQVT 3WHXA 3HE6D 1FDLL 4IHBA 1QEWA 4QHNA 4DQOH 1J12A 2YGVA 1CYXA 1CF8H 2CUAA 2VH5L 3QHZL 3BW9A 4FYTA 3H2QA 3CUPA 1E7VA 3WUZA 4N2OA 3MOBL 2P80D 5ANMB 1QNZL 2NQDA 3QCUH 3ZKSD 1YEHL 3KPRB 3EH5B 3NFSL 1UM6H 5G55A 5DT1H 4OGYL 1MIEH 1BW8A 4LCWA 4ES9A 4W9GC 4YSOA 2AQ1A 1TU2A 3WSQL 4A6YH 3AG3B 1KACB 2WBKA 4DVBB 1CLYH 2VDQH 4YJZL 1OVZA 3VSQA 4MNGA 1CICB 1KXVC 5I23A 3QUZC 4Y8DC 5JDSA 4OLVH 3X17A 4XGZA 4YR6A 2NW2A 3IFLH 5D7IE 4EMZA 5F88A 3P9LA 1OT2A 4LU5H 2EC9T 2P5WB 2VLJD 4KWUA 4TVPE 4I2XB 1XD0A 2JB5L 3FQXA 5E4AA 3N06B 3PWPD 2I07B 3QEQA 1HVXA 2DMHA 4A37A 1LDSA 5KYWB 4HKBB 2DIJA 1QI5A 4WTZG 5GJTH 1RCYA 2ZJSH 3WFZA 4M9PA 5EU7C 1HHGB 2Y06L 5FHAL 2FHFA 2BSSA 3KYKH 3S5ZA 3P3TA 4KKZA 1WC7B 2COQA 3C8KA 4OZ4A 2BS8A 2Z4TA 2VXSH 1R46A 3SE8L 4F37K 3BO8A 2KPNA 4W9JC 4W6XB 2XPYA 2NXZC 4FHBD 3MREA 2OJZL 3H42H 4FQXA 3HLAA 4QUOA 3FTSA 3QCVL 4NENB 1MFDH 5C70A 3DX1A 3SDCD 1JPFB 3CV5A 4AL8L 1XIWD 1RFDL 1EAJA 1HL8A 4ZO9A 5F7YC 1IZJA 2HKAA 3BVUA 3L9BA 4XHQA 3QUZB 4JQIL 4X99B 2Y1VA 4J3OG 3PL6C 3UJIL 5I5MA 2Z93B 1IFHH 5JHLA 3CN3A 3OLDA 2ZIDA 2FECI 3PDOA 5ICZA 3A4DA 4B53A 3LJ3A 3RA7H 5FX3A 1FYTA 4LRNL 4D9LL 2MKWA 4XZ4A 5JW3L 1JHTB 3F84A 2QR0A 2P48B 1NCUA 1OF2B 3QJHB 3CZGA 1E4XI 3N42F 5DJDB 1YEFH 1T3FA 1RU9L 2ZSWB 4RWYH 3LEYL 1G9NL 3U83A 2A74A 1CXKA 1HHHB 3IF1B 2ARJQ 4PJ5A 4X7DC 2AQRA 3IJ7A 3I3DA 2W9DL 4V33A 3QXVA 3IDXL 2YWYA 3AZUA 3L17A 2DLTA 3UL4A 4IGBB 1IC4H 2W5PA 1RERA 4G8IA 1PZBA 5IT2L 3LQAC 4JDZA 3MFGB 4GRWE 4RMTA 2JKTM 2F53E 5DLLA 3ARQA 2BY0A 4OZIA 1HEHC 2QHRH 1O5DT 2VN3A 4YDNA 4N1HB 5BZDB 3L1OH 3LHPL 2X7LA 1BIIB 2NXZB 5SX4H 2A6IA 5AALA 4XCYB 2WXLA 4BCYA 1F3RB 4G11A 2VXQH 1QRNB 1S46A 3GKZA 1YQVL 5D70H 3SPHA 4CVZA 3JVFC 4L0PB 1EFXA 2RBLA 4XB7A 5CEXA 3ARDD 1F0LA 3B2UC 2VAAA 4UYQA 3C09C 4N87A 1K6QL 5I1CH 3PL6B 1NL0L 4IHOB 4IRZH 4HXBH 1G7HB 1UGNA 4N2EA 2JQZA 3VFMB 4BFNA 3E1ZA 3TBBA 2Q8BL 1IBHA 5AWNL 3IJ9A 1ERNA 2IAND 4BQ9A 1I8LA 2ZKHL 3BUBA 5FDWB 3WIIL 3R4RA 3GJEB 4OQTA 5MP6L 3EJYC 3NPSC 4ANUA 3MX0B 1AGEA 3S0PA 4GIPD 2V3DA 2VQ1B 1AS6A 4YX2H 3TIDB 1SM3L 3P4MA 2IQAB 1GVIA 2OMZA 3L95B 1M9WA 3RX8A 2FYVA 4WFHD 3GMOA 7CGTA 3PHOB 1JDAA 1SXAA 2BW5A 2WQUA 1KN2L 3X2QB 2G2NA 3NQIA 4FFWD 1DHKA 5ICXB 3CTTA 1E9OB 4CSZA 3MYJB 4I0PC 1A9VA 3KPLA 4ACTA 4FOMA 5FOBA 1KIRA 2CLRB 4UILL 1KZYA 2EDNA 3JV5A 4WVRA 5DMGD 1A02N 3BYYA 2A1WH 3H0TB 2BFVH 2QFRA 5CGTA 5T5FA 3BRGC 4WEUD 1QKZL 3F7YA 3BVVA 1WBXB 4I48B 4FI8A 4YHKH 1TJHH 3C09B 1AGFA 3NCFB 3RVXD 4O02B 4UU9B 1R3KB 2OR7A 1ZHBA 2QSCH 4WK0B 1JCKA 4PCTA 1TVHA 3Q8FA 4J3BA 3GK8H 1MHHB 1UASA 2Q3XA 4EF3A 1UURA 3WFHB 4JQXA 5I24A 5K9OB 2CM6A 4I3SH 4ZW3A 5FUOH 1M7IA 3RPKA 3U9UB 1LL1A 5D7HA 5DGRA 3VA2C 4Z3TA 3GSUB 5EZIL 4MCZB 4IBWA 1ZT7B 3FCUB 1J0JA 2VLJE 5DD1H 4FG0A 1HXKA 4GIOA 4GG6B 5GRYA 3O4LD 4WU5A 3FONA 3D34A 4JB9L 4WWNA 5E2VL 3GZKA 5H8DA 1XCXA 3NPSB 3PWPE 3D2TA 2ZWNA 2F9BT 1U91A 5CP3H 2OK0L 4GKZB 2ITCA 4HKXB 4DZBA 1RZFH 2RCSH 1IM9D 3HG5A 3IDUA 3WS3A 2R1XA 5C71A 3NA4A 3QNZB 4WW2C 2EILB 2K7QA 3HG1A 3HOGA 5DVMA 4PLJC 1ZK9A 2G5BA 2V7NA 4HPHA 3EH4B 3FT1A 5FV2A 4JPVH 2V37A 4S1DC 4ZFZA 3VG9C 2N59A 2NLJA 2CO2A 1JRHL 4WSKA 3CBRA 4ZSOE 1XR9B 3U7WH 5FXCH 4ELMA 2DRUA 3O3DA 4I0PB 5E99H 1PAZA 2BCKB 2WVVA 1E43A 2AXHA 4FFYA 2DQMA 5E6IC 3SPGA 5CGBA 5K1NA 1NFDE 2VDKL 4PTUA 5B3JE 2VE6A 1N5YH 1HHIA 2APXA 2J8OA 1T0NA 4K7PY 3U79A 2EDKA 4LVNC 4FKEA 3VXUD 4FX5A 4HK3J 4BHUI 2PW1B 3LS4H 2VN5A 5HGHA 4WDIB 1ZHKB 3L4VA 4M43L 5H37G 2B1HH 5IF0A 1IGJB 1IQDA 3IRCA 5I1GL 5F96H 4Z7UF 1MXDA 4HS8L 4ODWB 2VLKB 5F1IB 3WDJA 4A7SA 4WU7A 2VOTA 4O9HL 4Y19B 3HZKA 2UWEF 2YKKA 2X4OB 5BQDA 5IW6B 2A9BA 1IAIM 1P1ZB 1JZ5A 4EDWH 1RMFL 2NX5B 1EUUA 4TXVB 4V11A 4PP1C 1OK0A 5FA4A 1SYVB 2X1OA 4DP0X 2OMXA 3BZEA 2N1TE 3UYRH 4X80L 1AIFA 4WW2B 1Y1UA 2J44A 5ISZB 5ENWA 4OCWH 3ZSTA 1ACYL 3UBXG 1JWUA 3PWNB 2MQGA 3KL3A 3RWJA 3UTSE 3VG9B 3CVIH 4ADIA 5I1KH 4H26B 5GGSB 1KYFA 4E0RB 3N41F 1XF5A 4LVOC 3TXAA 2VZUA 3HG2A 2P43B 4B7LA 1ZTXL 4FQLH 2X4PA 3BN3B 1J18A 4PJFB 5DC9B 3S5YA 4P46A 1KTBA 2CLVB 3CVDA 4LVNB 1VCAA 1ECYA 3OLIA 3KPRD 4PJEA 4FQIL 5FYJH 4XAKE 5LDUA 3L5WB 4HJIA 3BRFA 4PG9A 5C07B 2Y0SA 4WFGE 5KSBE 3BWUF 4B9ZA 4PREA 5HGAA 2VDNH 3T2LA 4L2LA 3LPPA 2ADIA 2H32A 2X38A 1PDKA 4XN5A 4A2HA 2FD6H 2OR8A 5B39A 1CICD 1R1CA 3QHTC 4U1MA 1ZT1A 4U1JA 1BGXL 3SPJA 4BQ6A 4JDVB 4F8PA 2XBTA 5GGUA 4OF5A 3NCXA 4DIXA 1F1AA 1ZEAL 4PR5A 1LQSR 2P5WD 1M7DA 1PX8A 1P4BH 1S5HA 3QUGA 4IOIB 3RWGB 3B7YA 1U93B 2P5ED 5HJ3B 4DEPB 4FEMA 5GXBB 2VXTL 5I8EB 5D71H 3GIVA 5T3XH 5ADOL 2BNQA 1AXSA 2OXGB 5D72H 5GSRB 1M4KA 2QQQA 5DK2B 4JFFA 4G8GA 1JI1A 3QG7H 3QNYA 3GS4A 3O3BA 1T2QH 4RETB 3HAEA 1X5XA 4G1EB 1DN2A 4HF5H 1MW1A 4HWEH 1V05A 4LVOB 4ZW6A 3CHQA 3MNZA 4WFHE 3SBWA 3H3PH 4HXAH 4Y1TA 3DJRA 3OGCB 4QRQA 1AQ8A 3V4UH 4K9EH 3EGDB 4BFIA 1N26A 1RK7A 1I9RH 1TYEB 3IFOA 3SCMB 2W9EL 1IC7H 2Z34A 2WLZA 2WWKO 2C9VA 5IFHL 1YN6B 3CFKB 5EO0A 2Y07H 3O9WB 4YXLH 2VISA 4JO3L 1P7BA 1G9MC 5A2LH 1IGTB 3II1A 3CDGA 4W9FC 1FIEA 4FA7B 3WFCH 4LAQH 1A8ZA 5EFIB 5KOMC 3X14B 5I18L 1A6TB 1FWXA 1AXTL 3ZMRA 3H9YA 4OZFA 1AQDA 4DGUA 3QUZD 2DQIH 1MVYA 1BZ7B 2BP3A 1DFXA 5IEKB 4JPQA 3RNKB 4ZMOA 1FO0L 5CR1A 3QXAB 1SDDB 1NBCA 1NPNA 1C12A 2WQVA 4YSUA 1MKFA 2YPLA 2D7TH 3MJ7B 4JFTA 2CJ3A 4GBXA 4ZUSA 1M1XB 2NUPA 1MNUL 5G4NA 1IAOB 5FC9A 3VH8A 2FEEI 3N50A 1FE8H 2BY2A 3U6RA 3SEPA 3UROR 5EZJB 3SD5A 2N01B 3ZZQA 3NFPA 5DQDL 3QDME 3F8UB 3VJ6A 3RJOA 4JVUA 2VYRE 1R3LB 3B9AA 3D85B 4L8BB 1N8ZB 5EN2A 4ZMZA 4Z7QE 3L9YA 1CT8B 4JUSA 4NZUL 5LWYH 1KXTA 2QV4A 4IIZA 1PY0A 1TEYA 2FTAA 5C0ND 4XP6L 2LV4A 1A7OL 3T2NL 2A6DB 2NXZD 3L3OB 3V0AC 3BPNC 4JQIA 4Z7VF 5BRQA 2CR0A 2JH2A 5FFOA 1XX9C 1QRND 3P0YH 2N0MA 3PJSA 4PV9B 4YIQB 3FFCB 2YD1A 4OIFA 4FCHA 1CPUA 4JFEB 4APQC 5A2FA 5I15H 1K2DB 4NJAH 3QDGA 5DHYA 1FQ9C 1USZA 3TWCH 3PL6D 4BZ1L 4WKZB 4FHKA 4QF1B 2X12A 3N42B 1YMHB 2D0FA 2QGBA 3DSNB 3H9HB 3ILDA 3NJVA 3Q8CA 3RKPA 1SY6H 2G30A 2V2TB 4PLKC 3S35L 3NAAL 3MNWB 3F6IA 3JWOL 2HFEB 4ORGB 3CPLA 4E36A 1WAAE 4AH2A 1Y0LB 2VNCA 4XOEA 2N4IA 1X9QA 4NCC2 3ARTA 2A6JB 1CK0L 4JG9A 4NZRL 5IY5B 1H9VA 2NNCA 3CCHA 5LCVL 1HQ4A 5L2KB 1C08B 5TJWK 2VMCA 1U8OA 4ZOBA 3FB8B 2QMKA 2CDFA 4QCIB 1LO5B 1I7RB 2YMXL 4GAJL 2KT6A 4QAWA 5HHMD 3KYOA 1ODAA 4FQ2H 3I02A 3V0VA 1J5OH 3PQYD 4NO3A 3BHBB 3QDJA 5CBAA 3D3VB 3KLQA 4Y4KB 4HIIA 2HG5B 5DD6A 5FHBL 3SQBB 2EXYC 2O72A 5JIKA 2ZX6A 1IV8A 3BPNB 4AXWB 4L0ZA 4I1PA 1K4CA 1QLEB 4M8UA 2ZXGA 4BSWB 5DEJA 3QUML 3P0VH 4JANA 4K0OA 1K9TA 2FT6A 4XPBH 2XVLA 1BX2B 2F7RA 1U8PB 3L4TA 4APQB 4EI6A 4TF4A 3ZKXC 4ZD3H 1T1ZA 3B2UD 3HPLA 5KVFL 2X10A 1PZAA 5AW4B 2Q7YB 4IBUA 3CXDH 3U4EA 3L4UA 1WVZA 4HZLB 5LUMA 4BV1A 2XJLA 3NN8B 5ABDE 3JV6B 1BD2E 3JTSB 2ZOUA 1E28A 1RY7B 4WTZA 1N0LA 1ETA1 1DDTA 1Y7VA 2O93L 1BZEA 2P5WE 1SFHA 5E8PB 3BWAA 2Q8AL 5DF0A 1QA9A 3VRLE 1U8LB 4H8WC 3WS6A 4F8TA 1G7PA 2P5EE 3EJYD 3WY1A 5TDNA 1H8OA 2H8PA 1MHPL 1CVRA 1FZKA 1CDHA 3BMVA 2DQTL 4CW1B 2WXPA 5EOCJ 1CFQB 3PP4H 1AO7E 4H8VA 4WK4B 5T33L 4UCFA 1NC2A 3FH5A 3LY6A 2VZ3A 1FFOB 5TQ2L 2V9QA 4KROB 1S7SB 5J5EA 3KBEA 1ZWIA 2VMFA 5MERB 2CR6A 5D7KE 3VU2A 4JGJA 3CSPA 5FLUA 5I1HL 5KANG 5SV3A 3DPBB 2HA1A 4OLYH 3PG2A 4WF7A 1ZLDA 4I0PD 5CJOH 3EXJA 1PX3A 2VLME 5F70A 3X3FL 3MMEB 3WDIA 1BVKA 3SGDI 4GI9A 3PXJA 4JFZL 2A9NH 2R69H 4BK5A 2EXTA 4HEME 3MRBA 3BSZH 3ZKXB 4B9PA 4PVNA 1EFQA 1HHKB 4U2ZA 4ZMPA 3WLBA 1PLGH 3ZMEA 2DYSB 2JNZA 4JZJA 1ET7A 1KT2A 1RZJH 4KK8C 3B2DC 1HWHB 3WTXA 4UINH 2YAFA 4TN9A 3R18A 3LZRA 2R1WB 4JY6A 2VLKD 2AK4B 1QBLH 1WCBA 4ZX5A 2GC4C 5BMFH 4JZOA 2IF7A 4Y19D 3AUVA 4IMKC 2QT6A 3QFJA 4A66A 1R6VA 3U7YL 5HGGS 4IBLT 3THML 1Z32X 3ZE2E 3HNSL 3F83A 4KDTA 4AE1A 2NX5D 2QKSA 3ZVVA 3IETA 4KVCH 2HVBA 3EUDA 3S3JA 1V7NH 1S7WB 4DN3H 1JL8A 3HG3A 4HKJB 2Z92A 8PAZA 5BV7H 5ISZD 4PLJD 2ENYA 5E5MA 2CE6A 4S1DD 2G60L 3OKLB 1Q0XH 4X6FB 3P4OB 5IUSA 4FYSA 3F85A 1Q38A 5G2NA 3PJNA 3DGDA 2C3VB 1OY3B 3OZ9H 2H47C 2IPKB 1KB3A 3B83A 3T71A 5I1LA 4WY7H 3HR6A 1KB5H 1ZHNB 2XIIA 5C86A 2CZNA 4MLIA 5E6ID 1U8JA 2DJMA 2GITA 1RHHA 2XWCA 3FAWA 4AMXA 4C4BA 1Q0EA 2K78A 4XXCA 3BWUC 3MLYH 5L0QB 3FZUC 3BEVA 1MN4A 4OH2A 4Y9EA 9PCYA 4HX1A 3VTAA 2GT9A 4NRZA 1ASQA 3F5WB 2OP4H 4Z7UB 3VI3F 4GW5A 3ZKQD 4HIQA 5C07D 2Z31C 2DDQH 4ODHL 2Z9TA 2JTDA 2UWEB 4N0UB 5GGRA 3RG1C 4WTWA 1OARH 1CZ8H 4XPTL 1PF3A 5AB2A 1YY8B 1E27B 5CUSL 2GY7B 4OKVA