3F64A

F17a-g lectin domain with bound glcnac(beta1-o)paranitrophenyl ligand
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
175
structure length
168
Chain Sequence
AVSFIGSTENDVGPSLGSYSRPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSSARYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia coli
doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords F17a-G
total genus 45
structure length 168
sequence length 175
ec nomenclature
pdb deposition date 2008-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 3f64A00
2BS8A 1ZPLA 1O9VA 3F6JA 4K0OA 1ZK5A 1OIOA 1O9WA 3F64A 2BSBA 2BS71 3FFOA 2BSCA 1O9ZA
chains in the Genus database with same CATH superfamily
1F4YH 2NY1D 5CP3H 4BEIA 4XO3A 3RUGA 4ABVA 3HVNA 5ABAA 4WI9A 2AQ1A 4KV5E 3P0VL 1DUYB 5F6HJ 1NAMA 3WDJA 3ZKNC 4XMPL 3SKNA 5JHLA 3FOMA 1NOAA 2A1WL 4F8NA 4AJYV 1EERB 5E0QA 4X98A 1TXKA 3R0MA 2E27H 4W9CC 1SEQL 3BWSA 1T83C 5TE4H 4K5PA 1TQWA 3CU1A 2CDFB 3PQYA 4GQZA 4OV6F 4QHUA 5A7BA 4PJ8C 5EIIA 2ZX8A 5DK3A 2OX5B 5DT1H 3RI5F 3O8XC 4U1SA 1F45A 2P24B 3TT1L 4ZUSA 1Y1UA 1JHKL 4P23D 3L3GB 2X53A 4XCYA 1E28A 1R5VA 4WJ5B 4DVRH 2Z0BA 1A3ZA 1MH5A 3UABA 1D6VH 2F5AH 5EN3A 5AAMC 4GEJA 3T2NL 1YUHB 4YHZH 4FG0A 5EU3B 4YC2C 2FO4B 4DPAX 5DD5H 2VSCA 4XO8A 5ITFB 3T3PF 3JWNG 1ZE3C 4XBEH 5EIIG 3NZHH 3PWPE 4KTGA 1JJUA 2GUYA 3BP5B 5GZND 5DA0B 2J55A 2F7IA 4JKKA 5KYXB 2BOBB 5KANG 2H6UA 2F54E 1ZHNA 2ZOLB 1JIBA 3GRWL 4PJEB 4Y5XA 3QK0A 4CSTA 4OZGA 1KYFA 2D4DA 2VGLM 1QVOB 1J0JA 4KJYA 1UD2A 2QBWA 2BNRD 2ZOTA 5GRXG 4JZNA 5BRZE 1IL1A 2DY2A 4H0GA 4J6RH 1CXHA 3ZTNL 4HKXA 2PR4H 4Y5VB 1G9NC 1K8IB 2HA1A 1DN0A 4Y1AD 4G1MA 3S37X 3F83A 4ERSL 3SGKA 4NLHA 1XZ0A 4OBSA 5IB4A 1R5WA 1NKGA 1RK1A 2EDWA 2DIAA 2NNAB 3IDJB 3MFFB 1B2YA 2E7HA 2VDRB 3BW9A 3QZBA 4YFEA 5JW5A 5CINL 3MCKA 2Z31C 3MLUH 2OK0L 3EFOA 4YIQB 4A55A 1JNLL 2EO9A 4K2UL 5FYLH 3E6FB 5DUBB 3EO0A 4CDGC 3FUHA 3AC0A 1BF5A 2DQIH 5D7KE 1QO3A 1DEEA 3AUVA 1R5IB 4P23B 1JTPA 2NR6A 4RAUA 3BN9D 3UO8B 2OP4H 1A6ZB 3DI3B 1UACH 3GBDA 2TRHA 1RJLB 4NWTH 3SHSA 5FGCB 1HWWA 1K4CB 3CPUA 4GRLD 4H1LG 4DWHA 3ZHLA 1SYSB 5AVYB 1S7RA 4YZFF 1XEDA 5KW9H 1UWXH 4HYTB 1WT5C 3I74A 4DP1X 1HHKA 1UOKA 5CHNB 3LNHA 3NIDB 3Q8BA 5JW3H 3IMVA 5GGUA 2A73A 2WN2A 4JM2C 3X3FH 3I2CH 3GUTB 1XH2A 2DQMA 4X4ME 2IG2H 2WXRA 4NJ9H 3NBNA 3GMOA 1BM7A 3CFBB 4QYAA 4U1JB 3QEQE 1QSVA 3LN4B 4LGPB 5IBLC 1EJ6A 5E6RB 3IFOA 5H8DA 4QRQA 4W68A 1LK2B 4K3DL 1U93A 2J4WH 1X9QA 3Q1EA 1XAUA 4KVPA 4KZ0A 5I1DB 2J8UF 3ALPA 1BGXH 3P73B 4FNQA 4JO2L 2YFOA 3AAZA 3FQRA 1JS4A 3HFML 1N0LB 3PHSA 4E9SA 1UB5B 4N68A 1F3DJ 3JV6B 2R0LH 4P46B 2CDGA 1OQXA 4ZYKB 4JUSA 3HPJA 4QOKA 1C5DB 3GS4A 32C2A 4YE4H 4XC3H 4XVJH 3QE5A 4KK5D 4BE5A 1AQHA 3ZZQA 1YC8A 4WTWA 2HJKA 4M4PA 3PV7A 2XN9D 3OMIB 4H25B 1UACL 4QKTA 2XWZA 4Z0XA 3MREB 4UAOB 3VXQB 3ZL2A 3FTVA 2ADJB 4F37F 4YH6A 2MFNA 3BD3A 4NQTA 1FYHB 3EYSH 3K74B 5IMKB 2A3TA 5C07B 1TQCB 1X7QA 2PXYA 2QSVA 4WO4D 4TLKA 3ECBB 3SE3A 3CN4A 3VM7A 2PYEE 4I18C 5FO7A 1HDMA 2FZ3A 2VMEA 1FFNA 4L05A 2XWTB 1PU0A 1BQRA 5HDOA 4X4KA 3K81A 4NQQA 3PP3K 1WEJH 1C8PA 3N55A 3UACA 1NGQL 3WN5B 4K94H 2B20A 4ZAKA 4MGXA 2XCMC 5L7XL 3TBTA 1QFPA 3JTTA 3MV01 1FL6A 1YYML 5ANHA 1JRHI 3RURA 2NT1A 2F2HA 2ZAHA 1E5BA 5IMOA 1G7LA 3BE1H 1MY5A 3S8WA 1R3KB 1NCNA 3RVVD 3RFZC 1A1NA 4ELKA 2WZPD 1OZTG 3RBSA 2P43B 2YFNA 5EOCH 1PS3A 4WWKC 1NEUA 5F7FA 5JORB 4PCSA 2GJ6B 3WDHA 1NBYA 3IVKB 1OOWA 3DV4B 2YPKA 3OX8B 4RZCB 3NZHL 3ARFC 3ARDB 3KPNB 5EB9A 3GI8H 1KN4H 3R4DA 4YUEH 4BZ2L 3DMMB 1F6FB 1CXFA 4WK2B 2NPLX 4F15C 1VKXB 5C7XH 3PP4H 5D96B 3IPBA 3VD7A 3KDMB 4ODTL 4LLWA 4DGIL 3OR7A 2XQBL 2A99A 5EUKB 4JPVL 2X3BA 5DZ9A 3CUPB 1MJJA 3P9MB 4FQCH 1F8TL 4LRIC 2B9BA 1SHXA 4AIEA 4RLDA 4HLEA 1BBJA 1H9VA 1Z3GH 1RJYA 4OD2A 4PJDA 5LVEA 3GPSA 4FHKA 2QADD 5DURD 1FZKB 2X2YA 5DJ2A 1PIFA 1JZ6A 4NKDB 1OLLA 2X10A 3H9SB 1VDGA 5CCKH 4OJAA 2WVTA 4NX0A 1MAML 2WLYA 4G2AA 4NP4H 4X8JA 3X1FA 4PGDA 3PQYE 2EDTA 4H0LC 5D1QD 2EVFA 3QYMA 1CE6A 1PYWA 2DQJL 2NTFA 3SGKC 2J8UA 1KXTA 1JXKA 3DIFB 1QFWH 2QEJA 4JFEA 4OQTL 1K4CA 1YNTB 4RGOH 4ZW3A 1EPFA 3D39E 3HW7A 3LNEA 4R5XA 1YPZA 3QDGA 4XNBA 2VABB 2VXUL 3CSGA 2IGFH 4XAWH 3IT8D 4RQQB 1YJDC 1E9OA 5IESL 2VMFA 3LRKA 3PHOB 1CWVA 3L1EA 2OCCB 1DCLA 3VXSB 5BUGA 3T3PB 3FH8A 3L4UA 3TVMC 1N26A 2AAVA 3CAFA 4YDJA 4HJIA 4JKWA 4ZX3A 5HYSA 2BJML 1XSIA 3QFJA 1P1VA 3L5WB 1FFOB 3THMH 3IDNA 3RY4A 1BAFL 2I9TB 4RFEA 1K8IA 4WW2C 2V7NB 3WUZA 2NZ9C 2F53A 3DGGB 3G08B 4BK8A 1G1OA 3CFEA 5AW4B 2LOEA 1KGUA 5D4IA 4YHIA 4H7VA 3BH9A 5F0JB 3RPIB 3MV7B 4JFZH 3UZVA 2DYRB 3FTGB 5C2UB 4UIKL 1MELA 4DF9A 3QUYC 5KVDL 2W92A 4N1CA 3T08A 2FYVA 3KPSA 2EZ0C 5F72S 5L9DH 2H1XA 4JHZA 1UZGA 3D0VB 3TA4D 2EDFA 3WL9B 2X4PA 3IRZA 4RMRA 3VNYA 2HVJA 3ZIYA 1R1CA 3KWWB 5TFSL 4XC1L 3RL1A 5MP6L 4EI5B 1OT1A 1U8MB 4QRPD 3TU6A 3MOBL 3MLWL 1G9HA 3RHWK 3FTSA 5C08A 1U2YA 4ONHB 1MLCA 2X2HA 1ECYA 4HBCH 1E3ZA 5GGUB 2X4UB 1KGIA 4MXWH 4O2EB 3CDGA 4ODXB 2BOBA 3QAZC 3QIUC 1OSEA 4FFVD 4NQUA 2L7JA 5C0AE 4JX0A 5I6XC 3TLRA 4O5LH 4GAGL 4L3EA 3HI1B 4XWGH 2DQJH 5SWZE 2FEEL 4Z7NF 4IBQA 1I7RB 2VMDA 9CGTA 2IQAB 5KG9A 1HQRA 4CC4A 4YZWA 3N2JA 5C0CA 2Q86A 3C2AH 3G5XB 4J3TA 1U91A 3K2KA 3OBAA 5HI4D 4QLWA 3QJQB 3TO2A 4AC2A 2XWEA 4HCGA 3AT8A 1DQVA 2B4CH 5CEYA 5JDSA 4IU2A 5BMFH 2AJUL 3MFFA 4FLRA 3X13B 2Q6WA 4WIQA 4PJAF 4GKNB 2A6JA 4MJ6A 1VZHA 1OM3H 4KROB 3ZTEA 2CDEB 1CD9B 1LM8V 1MWAH 5IVZA 3WFBL 5A2FA 4HK3J 5JHDB 3U36A 4M9OA 1VFAB 4P07A 1UWGL 3FQXA 4BZ1H 2ALAA 1AIFB 5JLZA 4UQIM 1W9XA 3FDWA 4E9RA 3LQAC 4GS7B 5AVRB 3WKPA 4BDVA 3S3SA 4ZRGA 2BP8A 4M1CC 4RAUB 5CEZE 3LNIA 2BINA 3P1VA 5HYQB 3KEHA 3O6LL 3CTTA 2SEBB 3C2SA 1N67A 3HHSA 3ZQ9A 1A4AA 3T4AC 1OT4A 2GG1A 4JDTH 5K59E 2UV3A 2A9NL 3L3JA 4F7KA 4DIXA 4YNYB 1XF4A 1WT5A 1INEL 5AEAA 5F9OH 4MYWB 3ILPA 1J9QA 4O00A 1A2YB 3N1FC 4QHNA 3MRKA 2OM5A 4NUMA 3B3IA 3VA6A 3QEQA 4K7PY 3QDJA 4LOEA 5IK3A 4M7LT 4OCWH 1PSKL 1OSZB 2W59A 3BDBA 5D7JB 3S9DB 3CPLB 5IY5B 4HQQH 1K2DA 3CQQA 3ZL4H 5DI8A 4FQXB 3QUXA 5HHMB 3QUZD 4JHWH 1ROWA 1JPSL 3H1ZA 3GTTA 5A1AA 2DWSA 4JFYA 1PLBA 1I53A 1LE5B 3EH5B 4JB9H 1FNGB 2ADFH 2M1KA 2ZCLL 3BSGA 4CAGA 3O9WC 5FYJL 4WSGA 5KVFH 1GH7A 2ZJSH 4WU5B 2WXGA 1EO8L 3ECQA 1UZ8B 3NYKA 3O6KL 3QA3A 3OC5A 3S4SA 4KKQA 4YBQC 3T4YB 5KVMC 1PQZA 4J1UB 3VFPA 3SBWC 2VKWA 3M1CA 4YVUA 4DK3A 2Z8WC 3ARVA 1G7QB 3NAAL 1S6NA 4HIJA 3QG6B 2RQ8A 2E7BA 3EJYC 5CSGA 1X6NA 5F7DB 4KKCD 1TO5A 1HC1A 4FQXD 4MNGB 4FMVA 4V1DD 3W11C 3CXHK 2YD4A 5DEZA 1TMQA 2DQTL 3GM8A 4E9TA 5IFJB 1CC3A 2HJFB 2OMTA 4JO2H 4A04A 2ZNWA 3BO8A 1U8NB 4Q2ZA 5JOFA 3TH4T 3DX2A 1PPIA 2VLRE 4ZAKB 5EZOH 1YAZA 3MOBH 1SN2A 4KPHL 3BUPA 4Y19A 4MVBC 4E9WA 5J1AB 4G9FA 1HI6B 3HBGA 4LE8A 4P2QD 3ARBC 2OMWA 4UOW0 1WGOA 4X7CC 4AQEB 1T4KB 2AQRA 4KDVA 4NC2B 2R1WB 2VDNL 5D6DC 4GB9A 3ILEA 5CS7A 3BX7C 3C6EA 4TVPD 3BVVA 3OKOA 4QCIA 4WFGE 3TO4C 2B1AH 2WLHA 4G6AC 3UROR 3IKCB 1VFBA 2UUDH 3OL2A 1HSAB 2FB4L 4MQXC 4YHYC 1L7IL 1T5WA 5C08D 1Z3RA 3GMMA 4FGMA 4OZHB 3MGTB 5IF0A 2WQUA 1MRCH 3SDCA 4UQDA 5ES4B 1U8QA 3P0YH 1S9WB 4P9ML 3VWKD 1L6PA 4U6YA 4S1QH 1G6RL 1MUJA 4G1EA 4YBLC 2J5LC 2ZOKB 4NUGH 4C4KO 2AJXL 4UZUA 1G7IA 1MF2H 4MAYC 2DQEH 3PL6C 4HGWB 1PLAA 3C6LB 4HUWA 2K78A 5EIVA 1EDQA 1QASA 4ZXBC 3FQWB 2C3XA 3GK8L 4P9MH 3CFCH 3KPRB 4XP4H 7FABL 4JQVC 5CWSB 4KNQA 1Y1DA 4TVPE 2YD6A 1NGPL 2GYSA 2HT3C 3IJYB 3LKNB 4AEFA 5DC0A 4GW4B 4J6RL 2I27N 1KT2A 3B37A 4AZ8B 3IMWA 1K4DB 3FSOA 2WK2A 2C3VB 2Y2TA 2DWEB 4M8UA 5CN1A 1CF8L 3UAJA 3LEYH 1O6VA 2ZOWA 3MOAL 4HKJB 2DM3A 5CMAB 1FZMB 5K1JA 2HZHA 2HVJB 3DUSB 1IQDA 1HL4A 3C9NB 3FFCB 1A9EB 2N7AA 5I28A 5AAMA 3ZT5A 2BIPA 1N3NB 2QVFB 3O2VL 2NRDA 5C1MB 4AIZA 3A3YB 1RIHH 1DDTA 3FFOA 1ZEAH 5F8RC 2XA8H 1G7PB 4OLWH 4XE5B 1XGRB 2UZPA 4LNVA 4IK7A 1QO3B 2E4TA 3NH7H 4N1EA 4JG1H 4Z1PA 3SDAB 1NBZB 3PV6A 5A6MA 5D8JL 1KGCE 4UDTA 4ZX4A 5LCVL 2BCKB 1YMMA 2IDSA 3MJWA 1IM3B 1MZYA 1QWHA 1BZ9B 1JTTA 3DOSA 1H6TA 4RGND 1U3HC 4X6EA 2Q87A 2YOCA 5LQBH 1N68A 4LSVH 3N50A 3X1GA 4R90L 3JVGC 5CHNA 4GG6E 2I9TA 3CCHB 1RUPH 4Q6IB 5DQDH 1RURH 4L1SA 3MNZB 1XD1A 2K3HA 3MPCA 2XFXA 4L3ED 2ESVE 5CEYB 1G0DA 2DQIL 5IEKB 1XB6A 3S5YA 2PPDA 3NZSA 5K9KB 2OZ4H 4QRTB 3BP6A 3EOAA 5FC9A 5A16A 1ACYL 2VIRA 2ADGA 4GXFA 2E7DA 3QEQD 4JFVA 5FYJH 3WE6A 3NZ8A 1OZUA 3NUKA 4XPGH 1JXFA 4NQCE 1GKOA 1OARH 1FL3B 5T33H 1AS6A 4WY7H 4ZOBA 4H8WH 4I0PD 3WS3A 5IR1A 2VCOA 4JZOA 1LK3L 4JFDA 2IPUK 1VACA 1IC4H 3IDUA 1ZGLM 4FQ1H 3HIZA 1TO4A 1P84J 3HR5A 1RI8A 3EHBD 3F7LA 3KPSD 4X6FB 1MCBA 1OGAE 1WF5A 4PRIE 4Z7WA 1KFAL 2FE0A 2HT2C 3O6MH 4ISVA 5D5MB 4AQ1B 3BO8B 3GPEA 2COQA 4YEEA 3MV7E 4G7VL 4ATWA 1X7QB 4XVSL 3DUHA 1MFDH 3GGWB 1AI1H 4OZHF 4WEEA 4PGEB 5LG6A 4IKIA 1UEMA 5I1IH 1F5WA 5CNHA 4EPSA 5IQ7H 1CGSL 1VA9A 4MZIA 4AI7A 3KPMB 1IEAB 4AYBA 1FZJB 2APSA 4P48A 3F6JA 1CXKA 1H6EA 3GMQB 1U9KA 2QL1A 3KLSA 1LO4H 1ACCA 1AZVA 1TDQA 3FFCE 4A2HA 4R7NA 3GFUA 2ENSA 3NVQA 3K6SA 3QRFM 2GJZA 1FCCA 3RTQA 2AQPA 5BRQA 4KI5D 2TAAA 3H42L 4YIQA 2R1XA 1EXUB 1G5GA 3O45A 3PNRB 3RZCB 1EXGA 1TQUA 1WVZA 2PW2A 1OB1A 2IC2A 5FHAH 5TF0A 5DSCB 3S3CB 3BP7B 5LCVH 1SRDA 3AVEA 1OGAD 4F7EB 4WRLA 4FA7B 2V8MA 4ZTEA 4YO0B 1Y6MR 4R4ND 2HTKC 1IB5A 4FXKB 1EVUA 3DRTA 1JF5A 1A1OA 4OIAA 1XH0A 5AVWB 1OAYH 3H55A 3LQAL 4G5ZL 1NWOA 4KKLD 4OFPA 1LEKA 1BEYH 1F4XL 1NCHA 1U8HA 2XG4A 3GBNL 3MBEB 4LSQL 5D4QA 3RX7A 5EC1B 5IIEB 4E2OA 3K6DA 1A3QA 3SPIA 4DQAA 3ALXA 5AVSB 4NN6C 5DMIL 1HOCA 5DJ8B 3AQZA 3OR7B 1KJ3H 1WQVT 1NPJA 3HG0A 4G59C 4DQOL 3MBWB 4MX7B 1THAA 3KPPB 2ILLA 3HUJE 2GUOA 1ZHBA 2Y1VA 4G9FB 5HDLA 3WTSA 3ECBA 1OCRB 2X4RA 5K9OA 5IREA 3CPLA 4TNGA 1IX2A 4C59B 5D1XB 3LXAA 2FSEB 5E51A 4AVKA 5F9JB 5E95B 4GO9A 2FWSA 4ONFH 5A2CA 3CFJB 3TIEB 1NCWL 2H3XC 3SPCA 5GS1C 4ZQKA 5FB8A 4H8VA 3HZKB 4RMSA 4LEXH 4ZUTB 5KYWA 4W70A 5JW4M 1ZAGA 1VB9A 2ICEB 5FGSA 1E6OH 4H2CA 3W5MA 1LWHA 1FVEA 3DURA 4KK6C 1O75A 2VO8A 4P2RB 4OZFA 2BFVL 5FECA 3L3KA 1IGFL 2NW3A 4R2GC 1MWOA 3ZSTA 1NOFA 3LEVH 5HGBA 5F3HA 3K7UA 5AOJA 4P3CH 3WFCL 2C4XA 4DPCX 4HS3A 3TBSB 4X5RA 4HAGA 35C8L 4WKZA 5I5MA 5JMRA 1F1AA 1E4WH 2D3NA 3ME0B 3QISA 1NC2A 4JGUA 3EJQA 4PRHE 4YSOA 4WGVB 2I5YL 3MLRH 4G9DA 3EOTL 3VWKC 2EE9A 4JY4A 3BKJL 1XGQB 1X44A 2CO4A 2FCBA 4O58H 3ULVE 3V6FA 5T1MB 2WZAA 2MPAH 4Z3GA 1DZ0A 3D09A 5F89A 2BNRB 2AMGA 3PHQB 1BEXA 3BGFB 3I75A 1KN2H 1OCCB 4P59L 2YRZA 1J1OH 1QP1A 2V2XB 3BHBA 2NY3B 4QD2E 1DJXA 5B4MD 2EXYD 1FZOB 4WZ9A 1Y0LB 5E6UB 5KJRL 2ROYA 2XUWA 3OAWA 3H7BA 2ZT9C 4FYRA 1KB5A 1I3VA 5CAYB 2O1AA 4NQXB 4N26A 4DO6A 1GS8A 3FT2A 4PJ8D 4LL9A 4MA8H 3WXWH 4DHLA 5BUPA 5JW4R 2OJZH 3RWGB 3CE1A 5BNXD 4FFWD 2YEZB 3QI9B 3X17A 4MJIE 2P45B 2WBWB 2BVOB 3TP4A 5KSAA 3N85H 5DCCA 4E68A 2HRPL 4GRMA 1K6QH 3PWVA 1LYQA 4IW4C 1CTMA 4XVTH 2F5BL 2OTWA 4Z7NB 2DQHL 2XN2A 2ICWB 5D8JH 1JF6A 3A6BL 4CSPA 2JI3A 4Y4FC 3RWJB 1ASPA 3OKYA 4KGJA 1RPQA 5DK0A 4Z7VE 4F7TA 3B2VH 3MZTA 4H5SB 4EOWL 3TBWB 3QUZB 4P57B 2XBDA 3AQDA 1WAEA 4QT5A 5LAXB 3T6QC 4Z3EA 4U3XA 1RAMA 3TS8A 1FL5A 3MNDA 4RIRB 1OSPL 4F58H 2VSKB 4JFHE 1G84A 1WAAF 4OLUL 4FQLH 3INUL 5FUOH 1DBJH 1B9KA 1PD0A 2APFA 1R3LB 1MQKL 5JHDD 4QRUB 3TZVB 43CAB 1L9PA 3DC0A 4XMXA 1YQVH 3NZ8B 5TJWK 4EEEA 3UC0L 2PO6A 3IS0X 1OT2A 4L8BA 3RILA 2J2ZA 1S7VA 2LHAA 2H7WA 4G9FE 3UP1A 2ZG1A 4M00A 3E1F1 2B59B 1SVCP 3V4PH 2QJDA 4P4RA 1A1OB 4WWID 1EJOL 4MS6A 3K71A 4K7PH 5DZPA 2VLJA 5DR5L 5SWQB 4U49A 4NHCL 5JXEC 3TA3C 3HG4A 1I1YB 4KKBD 5A2JH 5BRZB 4GKNA 4PJBB 2VERA 4Y2NA 2APBA 3CMOL 4XPHL 3FT4B 4JFOB 1JZ2A 1NEPA 3AZUA 4IRZH 3GHBL 3QNXB 1ED3B 4I8DA 1DQDH 1G1YA 4JO4H 1AHWA 4XX1E 3FQUB 4OKVB 1U92A 3WAKA 1JK9B 1ZHBB 1AD0A 1WWWX 4K94C 1NDGA 4OD1H 4PJ7F 1P7QA 3LXCA 1OM3L 1XAKA 5CIPA 4EZJA 1NSNH 3DTDA 4QXUH 3MBEC 1F0LA 3CMOH 5LDUA 3KHOA 5F9AC 3EYOA 4MAYD 2BXYA 4YHKL 3MNVA 2ZSVB 4U1HA 1P4IL 5GGRB 3V5KA 4DOHE 1QFWI 4P3DA 4FZ8H 2CXGA 2C5DC 3ALWA 5E9DE 3IGFA 3N5AA 4AT6A 1BG1A 5B3JE 2J73A 2AMUA 4HOZA 3HC3H 7PCYA 4J8RA 2DOCA 4I48A 1IRAY 2OMBA 3BP6B 4JMXA 2LU5A 1DBAL 1OQOA 4Y5VA 4YE4L 4P2RA 5TGBB 5A3IC 2V5TA 5DWUH 5FECB 3GJFA 5LLIC 1SVZA 2VN3A 1QSED 2V9TA 3H2WA 3GSUA 4XT1C 2DQTH 3L4YA 4HFWA 1AGFB 3D4ZA 1FN4B 1HAWA 1FYTB 2D0FA 5GS0D 1UFUA 2AJYL 4ODWA 4JY4B 4Z5RA 4PLOB 1H0DB 3WIFA 4BH8B 4JFDB 1OOAA 1RZKL 1R46A 4HIXL 4ES8A 2D03H 3HC3L 4NYLB 5MEOB 3S4SB 1R3IH 4UBDD 1A6UH 1LNUB 5IQOA 2NSMA 3I6LE 1VFAA 2Y0SA 4U7KA 3TVMB 3L3HB 2PNDA 2Z93B 4AV5A 1MHPL 3U9PH 1P2CB 4JQIL 2WWKO 4YHKH 1XH3B 3VU2A 3UBXA 5JPNB 5AVZB 4UIMB 5FHAL 2J5WA 1GZPA 1F11A 4LRNL 4G8EB 3V0GA 9PCYA 3WTYA 5KVDH 4NQCB 1DP0A 4MNGA 4EUPG 1M6UA 4RISL 1EVTC 5FA3B 4F8LA 1M1XA 2NNCA 4FNPA 2D3JA 2NXZB 4RDQF 2AXHA 4JL1A 5GS1A 5AUMA 1WTLA 2AEOA 4MA1B 5J13B 1QTSA 1CDCA 4NT6A 1A2YA 25C8L 4G42B 3QUYB 4M62H 3QCTL 3B6SA 2L7EA 5IFAL 1GOHA 3LPFA 1PD1A 2FLRT 2JMRA 3VXNA 5IZ7A 3RWHA 1IGCL 2VL4A 4LSPL 5EPMA 4OFIA 1F58H 2FX8H 4OGYH 1JWSA 3FO0H 2WBJD 1IEBA 4OU3A 3VSUA 1OE2A 1SHMA 5HI3C 3H56A 1I7UB 3H9SD 1GKEA 1PCSA 2QQLL 1T0MB 2PPAA 5EBMA 4LCUA 1MCPL 2F1EA 1NLBH 1ANUA 1W0VB 3HAEB 2YQGA 4IOFC 4KC3B 5D1QB 4QYOA 2ZXAA 1CFBA 1S3KH 3DJTA 3U4BH 1QSFE 1GGUA 4HJ0C 4ZSOE 5H4YA 2NUTB 4I2XE 5C0BB 4Y9GA 1AOHA 5HDRA 3QUKA 3PP3H 1ZLDA 5KZCB 4L18A 4KFMA 5IW6B 4JCMA 5T33L 1PQZB 4J1UA 4ZS6C 2UYLA 1C12B 4LLQA 2XKUA 3FU7B 5D2LF 3WNJA 5AAWA 2G3XA 1PEWA 2OI9C 4NZDA 2B59A 3P40A 3QJVB 5HXMA 5C0RH 4Y2DC 1ASQA 2AABH 2AV1A 4NKMA 2AEPH 4Z7UF 3GJEB 1ZLSH 4IRSD 4GO6B 5K9OB 1WZ1H 4ESKA 2ENQA 4P5TA 4PRIA 5TH2A 3AT0A 1GTFA 2CR0A 1MI5D 2MCPL 4OZIB 4JFDE 4QTFA 4WF7A 3D06A 3HLAB 1QHOA 2WVVB 1X9LA 4MZ3A 3B4NA 2PCFB 2UZYB 1KPRA 1Y6NR 3IJHB 3FQUA 4OKVA 5C0JB 3CV5A 3P4NB 1D7FA 4JRXB 2HG0A 3T6ZA 5CD5C 4UYPA 3S36L 3EJCA 2EABA 5F1IB 3FQ4A 2QQKH 3UJIH 5HPMB 4RMQA 4TQ8A 5E5MA 2HVKB 1IFHL 5JHLH 4HBCL 2D9CA 4F24A 1AC0A 4KVNL 4UM8B 4PGCB 1FORL 5CP3A 1WBXA 5DS2A 4XH2A 4HD5A 5CILH 2OQJB 1RUML 2BRRH 3APFA 3AS0A 4HXBH 4S1DD 1DJZA 2CM5A 2HN7B 4JCWA 1FP5A 1QQDA 5B38G 3MRIA 1JWUB 1OCWH 1NMAL 2CIKA 4X9GA 1K5WA 3R06B 1QABA 1ZK9A 4N28A 4YSUA 3EOTH 3P4OB 3OAZK 4Y7OC 5ISZE 4XHQA 5ERWB 1Z1WA 2YIHA 3GSUB 4A38A 2DJMA 1SGKA 3GBEA 1S7WA 1D6EA 4IOSA 1VADA 3ELAT 5I16A 3FU5A 4ORGA 4XCFH 4BM7A 3VD1A 1LD9B 4FQXC 2EXSA 3JVGA 1FA4A 4FLOA 3LYRA 5IKCB 2UZIH 4OB5L 3FUKA 2MTPA 4UT6A 3SPJA 1B88A 5CWSA 2R29H 2Z3FA 5I1IL 4LOFA 1IZJA 2XBTA 1F3JB 3V4LA 2IAND 5L2KB 2WCSA 3BP4A 1G7HB 3V4VA 3IN0A 5IUSA 2MHAA 4LARH 4MLIA 3GD1C 2VLLB 4PM1A 1SFHA 1YUKB 1RIVH 4A7SA 4K3GA 5DHEA 2Z9TA 1FDLH 4WW1B 2IGTA 4KZEH 2PR4L 2WLLB 1JV2A 5J9PB 2IGFL 4XAWL 1N3NA 2XQYK 3MLYL 2WGXA 3TJHC 3I9IA 3QEHA 3PAZA 3QWQB 1UD6A 3EXJA 4FJ6A 1B6UA 4L37B 2YKKA 3NQKA 1LO3H 3LZRA 4DT2A 1MFVA 3IPEA 3KLKA 1MFUA 2EYRA 3BPOC 2JKLA 3T1FB 1BMWA 5FK9A 3SBRA 2BIIA 1WIUA 1S9YB 5AOMA 5KS9E 3HCVB 1EJFA 5KBPA 1JGIA 3H2PA 3VB8A 3US1A 4M3JA 5DRWB 5AOLA 5L8LB 5DS8A 2W95A 3EBIA 1NFIB 2BVQA 1D5ZB 5SX5H 5JHLL 1BBJB 1OEZW 1GZQB 1S7VB 3A6CH 4HWEL 4OD2B 1U6AL 1WFIA 4IEFA 1T0MA 1F4WL 3UTTA 1S9VB 2YPLB 3X14A 2A4EA 2L7UA 4NO5B 1NOLA 2F5BH 4AX3A 3VGAB 1L5GA 4GAAA 1QRKA 2V2TB 1NCCH 1EXUA 2R1XB 4NQEE 5FUZH 3G3LA 5TQ2H 3MMEB 3U7WH 4BK4A 4YWGL 2OAAA 3ERXA 3VI4A 2CKBL 4MD4B 4XXCC 3IAQA 5KBLA 2YD7A 4XN8A 3TN0B 5F0PB 3V10A 2APVA 5JDJA 1FNEB 4U1IB 3RVWC 3EBGA 1HCVA 1OLZA 3NFPA 4Y19E 3ZTCC 4F27A 2IEPA 4L3CA 2H0JA 2YMOA 5TDOA 3V4UH 3BKCL 3AQXA 4Z7VB 3L4ZA 3OHXC 3BCDA 4UTCA 5E03A 2EDXA 2W9EL 5HHQB 5IV2B 2PYEA 5EWIL 5DD6A 3MCG1 2Y5TA 5CBAB 3MNVB 4R5TA 2X09A 1WFOA 3FTUA 5HVGB 3SKJL 4N1HB 4LCCC 3IXTB 4DP9X 4BCXA 4FYQA 2AEIT 4L3EB 5DJZB 2IADA 2Q1EA 5CJQL 1AZZC 3B6SB 2QMKA 2JI2A 1EMTH 3AWGA 5L4JA 3MJGX 5TDPA 2WNGA 4AGMA 4L4VB 3AU0A 1DQMH 2IAMC 4ONOA 2PO6C 4PRDA 1TYEB 3BUDA 4Q9QL 4OJEH 1HSBA 2EEBA 3V0DA 1NINA 4RGNE 4AGNA 4LAJH 1UVQB 1WA0X 1FV1A 4PAZA 1FN4A 4PRPE 2F58L 5CSBA 4I0KA 3VXTB 3F7PC 5DHVH 2TSBA 1DVUA 3VQ1C 2OJEA 4K07A 4BQ6A 3WTXA 1II4E 3D3VA 3JWOC 2H5UA 2FJGA 5D7KD 3KPSB 1RH8A 5C9JA 3PDGA 4RSVA 4FQJH 1J11A 3V0HA 3UZQB 3PAYA 2KLTA 3NCJL 1BA9A 4IKLA 3QUMB 2O5XL 4Z7UE 3Q2NA 3A22A 5AVUB 1SM3H 1P4IH 1MCHA 3RY6A 2YEQA 1Q9KB 1KACB 3FRUA 4PJ7B 1RULL 3ZE2E 1JHKH 1EAJA 3UP6A 4XN1A 1KJVB 2N56A 4KGLA 3IU4L 4GAYA 4D9RD 1OD7A 3A0OA 3I3EA 4U4IA 2WCPA 2NYYC 1IGTB 2QQNL 2XG4B 3MBEA 1ONQA 4BZ1A 3MHZA 4L4TB 4QWWD 2FSDA 3RVUD 1JYXA 3GHBH 4FFYH 4R7XA 4XMTA 4RFOL 4WNSA 3WEMA 5BJTB 2QFRA 1ZT4A 1ODAA 2ZKYA 1JK8B 3QPXL 2R0WH 3IFLL 2P49B 3FB6B 4PLJD 4R4BA 3TWCH 4ACTA 4LF3B 4BFRA 1BJ1J 2ZONA 3TBBA 5E1GA 2PPEA 4GAGH 4BFBD 2JE8A 1AQ8A 3MLXH 1QKZH 4ANWA 2CUMA 2Z35A 4OD3H 4KKRA 5MEQA 2AXFB 5FM4A 3SDYL 4LBEB 3HC2A 2WQAA 2VLME 2ZAIA 1MREH 2A2QT 2DV6A 5F44A 3IMTA 4M6ML 4QHMA 3VX0A 2R2BA 5I76B 3LZOA 3D0LA 1SXZA 1U8OA 3GZPA 2RACA 3WNKA 3P3UA 3HBPA 4MA3B 4ZFFB 4MZRA 5L6YH 4AEHL 1IJ9A 5JLZB 2NW3B 5DRWA 2KS0A 2IH1A 3I50L 1CFQA 2XZQL 4H26B 2D7OA 3FU7A 4PBWD 5FYKL 1ZLWK 4G8GD 1JNLH 1RVFL 1XZ0B 2XX0A 3LDBC 4MS8C 5IB4B 1AY1L 2YGNA 4QO1A 3LVTA 2Y2YA 1U8CA 3KPOB 4P2RE 5ICXA 4BIKA 2FGZA 1T5XA 3D8MA 2AHIA 4AGOA 1T2QH 1RUAH 2C3HA 3HG1A 1YDPB 3KYMB 5DEJA 2ZUYA 1GXEA 4JPSA 3MV9E 2HLAB 2XV6B 3A6BH 4GKZB 1NFKA 4G8FA 3A23A 1H5BC 5E9DA 4EIUA 3WAJA 2OSWA 1FG9C 3AREB 4L5FL 5M95B 1J0YA 3VACA 3WIHL 1S7SA 4LCWA 3EYQC 5GS2D 1C08A 2R1WA 3TYGH 3AY2A 2ZXGA 4K7PL 2VQ1A 2DEWX 3F6LA 2VDNH 3JVFC 1D5XB 1BQSA 4XN9A 4QRBA 3FT2B 4KUZL 4X6CA 3CLFH 1KCVH 3K6NA 3KPLA 4S1RL 4MDRA 4ADGA 2E47A 1A66A 1A3RH 3SKOA 3S96A 2B5IB 2C1PB 4O9HH 1MHHB 4OSUL 2G0LA 1I8KB 4F3FB 1JZJA 1IIKA 2ESVB 4NNPL 2OTWB 1E9QA 5EIQA 3F7YB 3TVMD 3TJHD 4DN4H 1UWGH 4FHBD 4ZMZA 3D52A 4OZ4B 4QRSA 1XF3A 4MDIA 3EKCA 3O11A 4M7JL 4DVRL 3L95B 5AZ2H 5IBTL 4BD4A 1CD0A 1NCIA 4Z0BL 3FU3A 1BCIA 4HUWB 5DLMH 4UNTA 1QFHA 3Q8FA 3PUCA 4X98B 4BKSC 2CHWA 3WIIL 1GMEA 1SHWA 4OCYH 5IHLB 2ARJQ 4QTHB 4DKFH 3KLQA 3OB0K 3LEVL 3U30C 2HFEB 3FQYA 1A5FH 4B5ZA 5IKCA 3ARBD 3FQNA 2OMTB 1PX3A 1R3LA 3MREA 1D9KA 4V1DB 2JJSA 1RZKH 2X7LA 3D39A 2B16A 3F04A 3N1PC 2H32A 5FDWA 1Y07A 3WELA 2P26A 5I6OA 1I7ZB 2OR8A 4MB4A 1MH5B 3O81A 5J11C 2EDNA 1IC5L 3SOTA 1U30A 1UWYA 3MKKA 3PQYD 1OL0A 3IEAA 1OTTD 2C9QA 1JN6B 1JZDC 4OCRH 3T09A 3DLQR 1W6LA 2WLZA 1BAGA 1D5IL 3FSAA 4M1DH 4H5SA 4JPWH 4OQTA 3TBWA 1EHNA 3SKMB 4Z7VA 1NCDH 4HIPA 1U33A 4FFWC 1JPGA 5EUOA 3F58L 1FI8C 5L4FA 2MTAA 4LL4A 4HK0A 3K8KA 4F1ZA 5IOKA 4BA0A 3HC4H 4WDIB 1S5IH 4Q14A 3U1QA 4FYSA 3MRDB 3W9DB 1FJ1A 4OCRL 1VENA 4YHLL 1IE4A 1C8QA 3MO1A 1XVSA 5CUSH 3NSYA 1C7TA 2NR6D 2P8MB 4I3RH 1BXVA 1XCWA 2NY3C 4U1MB 3GSWA 4X80H 1SYVB 1P5UA 4Y5YB 3QZWB 3ZZLA 1L6ZA 1M1XB 1CT8B 2DICA 2XRAH 5DRNB 1X4ZA 3LEXA 1E42A 4IOFD 2P5PA 5IHUH 2YN3A 1ZCRA 2ITCB 2DMKA 4PB0L 4MD0A 5D6CB 1S7UB 3OXRB 4UQ2A 3KXFB 2C9VA 1RZPA 3QQDA 1A14L 4D8PB 4IBWA 1BD2B 4P2QA 4Y1AA 3H6JA 3S3BB 4JQIH 2Y69B 4HHWA 1TSRA 1X5AA 2UY7A 3HRZC 4QUOA 1AO7A 3HI6L 3BWUF 3G7TA 2PXYB 4HWBH 4NQSA 4AY0A 4FYTA 4IMKA 4NZUL 4WI8A 4QRPE 3S88H 3FUEA 1AGFA 4OR1A 5EU4A 3RGVB 2X1PA 3RA7H 1UURA 2B77A 2EDKA 4KQ3L 1BVLB 1LO2L 1N5AA 1ZHKB 5ADOL 2W91A 3VD5A 4LDCA 4X7SL 1ZLWH 4MAYB 3TOPA 2CPUA 4F7CA 3NMEA 2A73B 2F58H 2JTYA 4PV8B 2C9AA 3QO0A 3HI5L 2L8AA 3C60A 4RBPH 3JTSB 3SZ6A 2IWFA 3S8GB 1YMHA 4QR7A 2YK1H 2DI7A 2W81C 3FK3A 4JM0A 1NAKH 4L5FE 6TAAA 2WNWA 1YQ2A 2CHNA 5E9DD 3IJSB 4Y9CA 5MENE 6CGTA 5GGVH 3QDMA 3VD3A 3PAVA 1UT1A 2BIMA 3WIHH 4PJ8B 5F1NB 3KNBB 1QZ1A 4N9GA 4X6BB 1JHTA 3B2VL 4XC1H 4XI5D 4X5QA 3QIWD 3L5IA 1ZIBA 4PRPB 1JXGA 4IIQA 3U0PB 1B0GA 3RVTD 1H5BA 3ZHNA 2ZUQC 4QOKB 1JOIA 2VUYA 3S2AA 2XY1A 2NY3D 1U4FA 3WHXB 3TN0C 3FO2A 3MV8B 1CICD 2PCXA 1PZBA 4AIXA 3IE9A 1CL7L 2Y6TE 4F9LA 3PWJB 4GBXD 4CSSA 3WLBB 3KPRE 1LLAA 3L5WA 1KXQE 5CEXB 1DQLL 2ICCA 4C56D 2VDPB 3ZSSA 3OHXB 4LHJB 1JPSH 3EJPA 3AS2A 3VGBA 2E6JA 4YBQD 1NL0L 1F86A 2V7NA 3DRTB 2X0WA 3LZQA 4KMLB 5T3ZL 1ZDSA 4E41E 5EFIA 2FATH 2YZ1A 3L9YA 1U42A 5IG7A 2J1KA 2PN5A 4A63A 3QIUB 1KCRL 4PJDB 4UT9A 2B0SH 1KC5H 1UB6B 4G72B 3DGCR 4JY5H 4ZFZA 1KJVA 4N5EC 3SDYH 3M86A 2ZICA 1QFUH 4B9KC 4KO5A 3FS9A 1RSYA 3R06A 5E8DL 2IANB 3QXAB 5E2WL 3OR6A 3US9A 1DQML 3N0PB 4EZKA 3ILQD 3M45A 3D34A 4XMUA 4MD5B 4LQFL 4PWIA 2R83A 4MAZA 4Q9RH 1D9KD 1TZIA 1RK7A 4N0UA 1FH5L 1GGIH 3NJNA 1TEGA 2Y06L 2AV1B 3ARED 4N0CC 2F7RA 4F5CE 4QHLA 1UG9A 2P5WB 2IAMA 3DPDA 4DTGH 3B9KC 3QQXA 4FMKA 3SDXF 1AR1D 1YAIA 2JJSC 3CZLA 5DZNA 5EC2A 4ZUTA 5KYWB 1N8ZB 5KUKA 2DQUL 1I7TB 4JRYA 5IMOB 2GIYA 4YSDA 4N8VG 2EIDA 4I7ZC 5C0BA 5FKPA 2NUTA 1SVBA 3BUIA 2C1OA 1WWBX 3QJFB 3EGXB 1ESOA 3BYYA 4NQEA 4TV3A 2EIJB 3QEUB 4X7DC 3GBMH 4IGBC 5L8JB 2BLFA 3WKQA 1L9RA 2Z7ZA 2GC4C 3OG6B 5F88B 4XPBL 3DTUB 2ARJB 4LKXA 2P4AB 3GSRA 1XCTA 4L3EE 5IMLA 3CUPA 3DTXB 2Y07L 1P69B 2GFBA 3DMMC 2ZKHL 4POZD 3CZEA 3OAZH 4ZXBA 1M3JA 5DMJB 4RFNC 4PY8I 4YHIB 3KPOA 3G9VA 1NGXB 4WUUB 4FQIH 3STZA 1FIGH 3GHEH 4OFVA 4PHXA 1X5LA 4LESA 3VWJC 1XGTA 4TSCL 4TUOA 1DDHB 2NCMA 4R6UA 4NHUA 1SXCA 3HR6A 5E99L 2X4SA 2WC7A 4UT7H 5GSRA 4FZEL 3L2LA 1XWVA 3SO3B 2NOYA 3DJRA 3T2LA 1Z5LB 4E5XG 4YFLF 5AW7B 1MJUL 5D7IB 3ZDZB 5MP6H 3FT1A 4L4VD 5EN2A 3KGRA 5E2JA 1AE6H 3KPSE 1KFGA 3HG1D 4Z76B 4OUUA 1WWCA 4NWUH 1N64L 2A0LD 1D5XA 5IJVB 1XFPA 5IBUB 4NO2B 2FNWA 3MUGA 3NRPA 3QZMA 2BRRL 3V0VA 2MSPA 4JFPB 1QR1B 3JWDL 4P49A 2OJ1A 1EGJL 4KRLB 3US0A 5E4EC 5DO8A 3TF7C 3KPNA 4JFZL 1IBBA 1AR1B 4ZW5A 3S37H 4DCQB 1KEGL 1D5RA 2JCCA 4HOXA 1OSZA 5D7JA 3VI4E 1OE1A 1GZHA 3OB0H 4OFQA 5TDOB 1UZ6E 5JNYA 4IBTA 4GNKB 1EQWA 5FYLL 3MUUA 3MI6A 2IDCA 5I73B 3LKRA 2AXGA 1IBZA 3SCMC 1JNNL 4WK4B 1UM4H 1H5BB 5IVOA 2HFGL 2YAHA 1B3IA 3BT0A 3ZT7A 4HCRL 3UPCA 1QUNB 1AJ7L 2VJ8A 3NFNA 2O61B 1ZSDB 5F7HA 5HGAB 1N2RB 2OXHA 1JPTL 4NM4L 4TMPA 1C7SA 3F58H 1F6AB 2M26A 2F53B 1F3DH 3CZGA 3FQXB 3L2MA 4UILH 2HT3D 4P46A 4XNAA 2EIMB 1CE6B 3QSKB 5HHMD 4I3SL 2O6EA 3MFGB 4WHYH 2KT6A 1I1YA 3LKSA 2GJ6E 3V0AC 4Z3HA 5KSUB 3DK2A 4PIBA 1CURA 2OX5A 3ULVL 4FHJA 2UY6B 1DE4B 2W8CA 4ZZKA 4Q9RL 3UAAA 2VN5A 4IM8A 2BO0A 1KLGA 4NM4H 4XXDB 2W0LA 3BAXA 2IPTH 3ISWA 1A7NH 3TFBA 4WW2A 2DLTA 2FQDA 1RP8A 2VQ4A 1VCAA 3RTLA 3W5NA 3ZZSA 4NCDA 5C0GB 3EYOB 3JZ7A 3VO0A 4YMPA 2E9IA 4WNQB 3ZE0F 4IHBA 4DGIH 4IKKA 2PYEB 4KOCA 1CE1L 1W72B 4PJ9C 3KLAA 3MRQB 4PJ9A 5DRNA 3D2TA 2R9HD 4ZOEA 4DESA 5TDNA 2FRGP 3R1GL 2KBGA 1ZT4B 2F68X 4LHUG 4XO5A 5DRZB 5K93A 3WFBH 2H0PA 4MJ5A 5CGBA 1H8SA 3QIWB 2IALA 3K80A 1UJTA 1TG8A 4LRNH 2WANA 5DVLA 3RKDC 2VH5H 3ZGIA 2HG5B 4KHXH 4NAJA 1GJIA 4PJCA 1DN0B 3M8OL 5HI3D 3TJEH 5HSFA 4IQHA 1Z5YD 4HQQL 1F00I 2ZUSA 4HIIA 1MAJA 4OGAD 2EQDA 4ETQB 4F33A 1WITA 2I60H 3BKML 2ZX6A 3PPSA 4Z7AA 3WMPA 4FZEH 3D0LB 4FDWA 2WOBA 1TQBC 4FQ2L 4MSWA 4AH2A 1PX8A 1HXMA 1AIFA 2VDRH 4N87A 1LEIB 2HJFA 2C3WA 5IB1B 4MDJA 3O4OB 3DO3A 1K72A 4G8IA 5IJBC 2ZX7A 3FO0L 4GOSA 1RZFH 2FX8L 4Z7WF 4JR9H 1FIGL 3BQUC 3MLXL 1PY0A 4KZCA 5KSBF 4FULA 1Z5LA 2VN7A 4PY7B 1CI3M 1U2CA 4KK8C 1IQDB 1NIAA 4LK4A 4I18A 2FQEA 3U4AA 1ML0A 4JVPA 1K2DB 2OMUB 3QJSB 4PRDB 3PE9A 4KBPA 3ILQC 2BNRE 1B6DA 5BRZD 4HALA 1RV6X 3C8DA 3SDDD 3NN8A 5SX5K 1XL4A 1VFBB 2EDOA 4R0LB 5AYQA 4N2LA 3U0PA 2WBXA 3EGSB 4GXUN 5JQ6L 3DX0A 2IOMA 1MCWM 2YPVA 2Y1YA 4FTDA 4BSWA 5FKPB 2FBJH 1Z0NA 4W6XB 2K0RA 4L0ZA 3ZYOA 3B2MA 3PNWB 3C5SA 3OKMA 4CNIA 2BC4A 1FWXA 3JQOB 1FC1A 5BZXA 1OCWL 4U6HA 4R2GD 2JQMA 3CFTA 4A2MA 2O4EA 3AXIA 4Z7UB 1AKJA 5TD4A 1M05A 5K9QG 4G43A 5EFIB 1JDDA 1RZKC 4ELDA 4TSBL 5IEKA 5I1EL 1RZJL 2BSDA 4YAQA 5AQ0A 1BX2A 1YEWA 1S46A 3F7VA 4S10A 5D2LB 1UOWA 4E0RB 1R24B 1P9MC 4AQ8A 2AK1H 4L1BA 2P7TA 1GZHC 4J28A 3GS0A 2XI9A 3O0RL 4X4XA 1JNHB 4HUXB 1MCLA 2KH2B 3IFPB 4HJEA 3V4PL 1HJBC 3T6WA 4JY5L 2XYBA 3A24A 4FFZL 4MCYA 1KULA 3EADA 2WXNA 1JFHA 4J23A 4IJ3B 3APCA 1M9SA 4G80B 3RA7L 3VXUB 5E23A 1JXDA 3QO1B 3GHPA 4WWPA 3LV3A 1D5IH 2NY6C 3FU6A 3GYRA 4M1DL 4MCNA 1DANT 5HHNB 2UY6A 4QWWC 3RVUC 1WH0A 1DFXA 2AQTA 1JI2A 1N4XL 4OUOA 2Q7YA 2NXZD 3ASWA 4I77L 4ADJA 2KQNA 5K9JL 1WAAA 3IJHA 2N0MA 5IUCA 2WP3O 5C0JA 3N06B 1HZKA 1G6RH 2NR6C 3T6VA 3SDCB 1MN4A 5E6SB 5DGRA 2AZUA 3WEBA 4G7SB 4D9LL 3T0DA 5JNYB 1MRCL 3SIKA 1H3VA 4IRZL 3OKLA 4LLMB 1J88A 4X6DA 3VTAA 2YD2A 1Z3GL 1BFVL 4X6CB 1Z9MA 4NN6B 1MJ7L 4XHJD 1SMDA 4H44C 4LFHG 3LCYA 4LASL 2QPDB 4NOBA 4QPEA 1DVYA 1AHWC 5ID0A 3J2PA 2GAZB 2HTLD 3KLHD 5MERA 2PW2B 5E6IC 3DBXA 4M6AA 2E76C 2SODB 4P5MA 4PJFF 3UG3A 3WE6B 2FHFA 3E2HB 2J8OA 1C12A 4M9PA 5AW6B 5ADOH 3OD3A 4IRJA 4I4WA 3LNGA 4TVPH 3NGBB 4K5NA 4ZDHA 3VSQA 1QNZH 1VIWA 5E6IA 1QG3A 1DBJL 2WLIB 4NZUH 3ESUF 3S88L 5D5ME 1J8HE 1JCKA 2A6JB 2D0GA 5DQDL 2O5NA 2DJ4A 1ZPUA 3O2DL 1MIML 1ETB1 3VFVA 2EVHA 1RHHB 3BKJH 2FX7H 4OFYD 3TWYA 2XWRA 2YAFA 1T7XA 4N2EA 2PWDA 1PL3A 4MDJB 3FMGH 1NCJA 4OQ1A 2WVVA 3BLPX 4HIHB 4G3YL 3LKOB 5I1JL 7PAZA 4GBXB 5F7LB 3IU3A 1KTKE 1ZTXL 1HESA 2B4CL 3H0TA 4OJFL 4GG6F 1F4WH 4Q6KA 1U6AH 4K8RH 2UZXB 3RUGE 4LIQH 3FTYA 5F7KC 4BGLA 2A1WH 1YNTA 2HVKA 2HXAA 1EAPA 1XX9C 2ZNXA 3PXHA 1QLFB 2X6CA 5D7IE 2VDLL 4JQXA 3ZDZE 1WYJA 1FHNA 4C57C 2AJYH 3VXSE 4DUXA 3PL6A 1N4XH 4R0LA 1FQ9C 1QLEL 3ULUH 4QHNB 5J3HD 3VXSA 3HZMB 5HDQH 4BCYA 5ENWB 2BOCA 4MXWL 1NFDF 1KBWA 3MRDA 3V6OC 5ALBH 1PJWA 2VR7A 1BD2E 3JBG7 3M1OA 4TLTA 4RRPA 4TQHA 2P8MA 4QJ3B 2IBZX 3ZDYF 2AKRA 3SYPA 1S7XB 2EUWA 3NTCH 4N9GB 5C0CB 5KAQG 3TO4B 4HZ1A 3UPRB 4WKZB 4XGZA 5TFSH 4JFQB 2KHAA 3GSXB 4XNZC 5IR1B 2NY5C 4XB8A 3V5HA 3ML8A 1DHKA 2A9NH 2PW1A 2X87A 3GMNA 3INOA 4UB0L 5F97E 2VJXA 3O2WH 4GAJL 3RJQB 1T04B 1OSPH 4LOUC 3PDOA 1GCYA 3BH9B 2BHZA 4BZYA 4MD0B 5BV7H 4QXVA 2P7TB 4C4UA 5EZJA 4OZHE 4PG9A 1MIEH 5T3XD 2CGRH 5HVFB 2VLKE 3DNKA 5LBSA 2F54B 4CMHC 4IBSA 2JKRM 1Y0LA 2KQMA 1SUJA 4Y4KD 3B7SA 1A25A 1VACB 3F65A 5FUCE 1CDGA 4PY7A 4TQEH 4L8SB 2Y2WA 3MKGA 5GZOC 2BWQA 4QXWA 4ALAC 5A7EA 2ICES 2LE9A 4OLVH 2AP2A 4HIEB 5ALCL 3ZE2F 3BQUD 1XHHA 3VXME 3J7HA 4PS3A 1H6UA 1MJ8L 4FOMA 2IXQB 3LRMA 4JO1L 4XOBA 5DVPA 3HE7D 1C5CH 5T1LA 2HRGA 4KKZA 3BDYH 5EF2A 3HS9A 1O7SA 1B0RA 3MRBB 4MMZA 2FNBA 1BFOA 1IEAA 3CVHH 2XPYA 4X0KB 1QSEE 2FLMA 1M42A 3FTXA 3IDIA 1KCVL 4RWHA 5JPMB 3E9UA 1REIA 4QNPF 1DANU 4FXKA 3IKCA 4K5OA 5FM8A 5I6KA 1KJ2L 5IJDC 3SEPA 2GJJA 3NACL 1G7MB 1OM9A 4JJ5A 3BWZA 1ZHKA 4IU2B 2BDNL 4FLQA 3VAEA 1BIHA 1CLYL 3P3TA 4G5ZH 4JRLA 3SE8L 4MBOA 1IGYA 2P48B 2CQVA 4WEUD 3PGCA 1XMEB 1U41A 1JZEA 4UQ3B 1NGZA 1UQSB 5DMGD 5BZDB 4YSAA 2VZOA 3FCTB 3PJNA 1CDHA 3WIIH 1USQA 5ETUB 5I66A 4FE9A 4UV4L 1KLUB 4UZSA 4N2DA 4OIFA 2WXIA 4NQXA 2ED7A 3BJ91 3TPUA 2BZCA 1VEPA 1CG9A 1KLFA 4M62L 1XV8A 1JWMA 3MBXL 2I07B 2FATL 4BINA 5MEND 3BKCH 1GYVA 3HG1E 1ICTA 3V5DB 2VM4A 5JA9A 1MFEL 4HWNA 4AGQA 1YO4A 3QDHA 4Z3TA 1W2KT 3L13A 3UBFA 4YHZL 2HUHA 1F41A 3IWUA 5L6YL 4L8CB 4Y2DA 4EMZA 3FB6A 4FFZA 5F71A 3CH1B 4HWZA 2PYFA 5DGQA 1LXMA 3TA3A 3KGTA 3QEQB 1EGJH 1JGEB 1KXVC 3WLBA 4ZPTB 5C6WH 1N12A 3BWAA 1RK0B 3RFRA 3GMLA 1J1OL 2F74B 3TV3H 3ZOAA 2BJMH 4P59H 1J05B 4IHOB 4OF3A 3IRPX 3JV6A 1T7ZA 1TTFA 5HHPB 4P9HH 1TETL 3OKOB 5TE4L 1QW9A 1FFQA 1JTOA 2FEDD 4HJSA 4FI8A 1MY7A 4JFYB 3OPUA 5K1NA 4DP8X 4AMXA 4DEPB 2O6PA 1E2WA 4JFPA 5ESAA 3DDGA 3B7TA 4R8WL 3FPXA 1I31A 3QQ3B 4UT7L 2F19L 4ZMLA 4IBVA 1X6LA 3W2DH 3BKYL 4KUCD 4KXBA 2EUVA 1YYLH 3IB4A 2CUHA 4UU9B 4QRRB 3QAZB 4FNUA 4AENB 4XNMA 5D96C 4N25A 4PGBA 4R9HA 1SY6L 3II1A 5DUMH 4F92B 4WFGD 3VFTA 1EH9A 1SEBB 1ZANH 4PBDA 2Z6FA 1G7QA 4PJGE 2WKOF 3CFKA 2X4RB 3QIBA 1SM3L 1P4BL 5F7YC 5FW8A 1TTBA 1YMME 3L2NA 3PGFH 3DPBB 4YXKH 2P80D 5JIIA 3X1BA 5D2NB 1C1EH 1Z6JT 1H8NA 1BZ8A 2EZ0D 2FX9H 3SOBH 5ANME 3GK8H 2OXHB 5BO1L 4X99B 1BZDA 1DR9A 3LNDA 2B14A 3NEXA 1GJWA 4OLVL 2JB6A 4RA0C 1I82A 4PJIA 4RNRA 4WTQA 1OAQH 3EH1A 1NJ9A 4OD1L 5D7IF 1QSEA 3ZDZF 4NERA 1KG0A 2P46B 3A4DA 1ZLEA 2GTQA 1BQHG 5DZLA 3U46A 4K9EH 3C9NA 1V55B 2D7TH 3D6GA 1YNKH 3D3VE 1EGJA 1AYRA 1TJIL 2YPKB 3ARGC 3PGDA 2DN7A 3QNZA 2G3NA 2XIIA 1CMOA 3C5ZA 2VUKA 3Q2WA 5D1ZI 1IC7H 5F21B 4HSCX 3ZDXB 3MBED 3T4AB 2JJTA 5I76A 3IGUA 1BHGA 4AGLA 2EE6A 2FECL 4LLDA 4YBHA 2O93L 1EFXB 4GIAA 1JVKA 1DBML 4PRNA 5DHVA 1XMWA 5EEXA 3MLYH 2G75B 5IM7A 2OTUB 4G7YH 5C8JB 5B38B 4MRCA 1E6JL 3KYAA 1YQVL 5EN2B 2YXMA 1G7IB 3PWLB 4MB5A 4UNVA 3GEWB 1LEGB 4HJTA 1IAKB 3P2DA 4QTHA 3CVDA 4LLUA 15C8H 3QC6X 4HZLA 1KB5B 2OYMA 4F9PA 1VZGA 4FMFA 3FQWA 3TZVC 3HG1B 4ODWB 4C83A 3H9SA 4N86A 3FUIA 4Z5RB 1EEYA 3WUWB 1ZA6B 1CLOH 2O26U 3V0JA 5D7HA 1A64A 4X0NA 5KJ7E 1CGSH 2WQSA 3MUZ1 1ULVA 3O9WB 5B1JC 1M71B 4ZAKD 4AEIH 2VERN 4MHHI 3REWA 4RCAA 3K71B 4LGRB 2BS8A 4AZ8A 4MMXA 3QPKA 3CC5B 4ZPVA 4HUVA 3QUHA 1DSYA 1O6SA 1J5HA 3BIAX 1RZFL 43C9B 4L0PB 5ETUA 5I66B 2P5EE 3G6JF 1N7MH 1NQBA 4DVBB 1ZLVK 4AYSA 4EBQL 4R96A 3BPCA 5F1KC 3QPQD 1BP3B 3X11B 5AYUH 1A4KA 1RUKH 1RJZB 4CADB 4ETQA 5B3JF 3QFJE 5B8CC 4NRXB 5TH2B 1NCOA 3UGXA 3QXWA 4OVVA 1R9FA 4O02B 2A38A 5AW8B 3ULVH 2ZSVA 5ITBL 2FECI 2OMYA 2XN0A 4JB9L 3VH8G 3BH4A 2DWXA 1TTGA 1EZSA 1TTUA 4HDIA 3GF8A 4GRLB 4XZUB 2TSAA 5CZXD 1P7QB 4WSKA 2NQCA 3F7YA 4ICWA 4XPGL 4OKDA 3TYFB 1FNSH 2DM4A 2BM3A 4Y2OB 4M5TA 3WO4C 1LO2H 3A4AA 4JKPL 2FSEA 1A7RH 1DQJB 4KZEL 4QF1B 4HKZA 2X89D 3CBRA 2NY4D 4ONGL 1B4RA 4MMYB 4M48L 3DX4A 2EDRA 3F01A 4JPIB 2ITDA 2IV8A 1QX1A 3X12A 1KWKA 1D9KB 4B9CA 1WE5A 1A14H 5C0EA 1ZLUK 1G6VK 1KCRH 4EN2A 25C8H 4IU3B 4ANKA 2GABA 1NMBL 3DDFA 5LDSA 4NQSB 4LLQB 4A2LA 5FLVA 1EWHA 2UZIL 4GH7B 4XP9L 3I3BA 2KYIA 5DD3H 1KCKA 3OZ9H 3QT2A 3WIFB 1NM4A 2LABA 3M17B 4XVOA 3O41A 2CGRL 4L9LC 2VXQL 4JG0L 3RWDB 4WTXA 3Q01A 5FDYA 3MJ9A 2FYYA 1JWMB 1KEMH 3QFGA 4OM1L 1R24A 4O2EA 4MA7H 1CGYA 2B1AL 3NCWA 5FA4A 5K39B 3T0EB 3V52H 3SPHA 5BOJA 2G5BB 4L0YA 1IAMA 3CG8A 3UBXI 1JYWA 3FSWA 3CH1A 4QXTA 2AK4B 3U4BL 4N2GA 4MKTA 3EZ8A 3SE8H 4NZTH 4FEMA 1QMUA 1ZS8A 3MJ6A 4J8RB 4KZDL 2BRQA 5IBLD 4KPHH 3R0NA 3VXNB 1F4AA 2NZIA 4LEEA 2PCPB 1E65A 5BS0B 4LFHD 3PYCA 1Z0MA 4KROD 1A0QL 3S6CA 3U46B 2Z91A 2X41A 3OB8A 1A9BA 3U2SA 5C0CD 2XWBB 4HUKB 2WINA 2CJTA 2YEZA 1F58L 1O6TA 3MN8A 3QHFH 2LVEA 1JNNH 4YDVA 2ITCA 3KMDA 1T1XB 3BZFA 5LBVA 3SDXE 5D2LE 4HW6A 2CD0A 2ZKHH 5I1LB 2AW2A 4IIQC 3O3UN 1F1GA 2GTZA 5IFHH 1F90H 2OMZB 2FUQA 3CFUA 1OF2A 5EA0L 1QW8A 4ZMXA 3TVMA 4DKFL 5DZOA 5ERWA 3JTBA 2R0KL 3DYOA 4UM9A 4DP0X 1SMAA 4FABH 5B7FA 2BNQA 2FT6A 1XB3A 4FJZA 1PDKA 3NABH 4KO9A 4N22A 4OGZA 4Z7UA 2VN6A 5BS0D 5ID1A 1P53A 3D2UB 2R7EA 5E08H 2A9AA 4ELMB 4K3EH 4TQPA 2GAZA 1AGBB 3QUXD 4KK9C 5DK2A 4PRIB 2ZPKH 1FVCA 1LP9F 5EC1A 3MUY1 4FQQB 4B9PA 2E7LA 4ZOAA 5AAPA 3C2AL 3KS0J 1KYOK 3G9AB 3DGDA 3V0WL 1MCEA 1H15A 1KY6A 5F0LB 5I9QB 4LSQH 3DX1A 4Y2DB 4N8VA 5TF1H 2W0KA 3TH3T 4NT6B 1A3LH 4JRYD 4L23A 2FWOA 2YHGA 4AEEA 4KK8D 1O6SB 4JFSA 1MCPH 3LVEA 1CUOA 1G87A 1NFDB 4PW3A 1IFHH 1NUGA 4ZODA 1IO4C 1NMCB 2F15A 4IHOA 4L8DB 4JR9L 3GHEL 4XMKL 1AGCA 4PJXA 2Q76A 1NCGA 3IDXH 4WWKD 3HA0A 3VDCA 3DX8B 1HE8A 1ZHNB 1EZLA 1U8IA 3MA7B 4EIBA 1T21A 3MRJA 1E90A 5FYKU 1HHIA 2HN7A 4WW2F 3T65B 2AJVH 3MR9A 5I8KH 2EDYA 1AD0B 4ANUA 5HDQL 1AZUA 1WZ1L 4JAMA 1BQ5A 4K3HA 1T2QL 4P05A 1T22A 3P4OA 1BECA 3GXMA 2W94A 4TTGA 1AKJD 2Y6SD 3HKZA 4E5XA 5F6IB 1RJCA 3WKML 4NP4L 5JIMA 2YKLL 5IT2H 4W9DC 3MRIB 5CINH 5LKNA 4PWGA 3ZYIA 5J13C 2X05A 5KN5B 2VDPH 3NZUA 4QJ5B 2CRIA 3QIBB 4K8RL 5LAPA 1CICB 4R0LC 1BQKA 2WJ7A 5IOPB 4NLAA 3KD4A 3CQFA 4NENB 4TNVF 3PY9A 1NCBH 2HH0L 2QLVB 2R39A 4LSVL 5C0AA 3KCPB 5HGHB 2MHAB 2NW2A 1QBAA 5AVTB 3RJOA 3OKNB 4P4RB 4XWGL 1MFCH 3OAYH 2X4NB 5I1KH 3GMNB 4PJ5A 4YFDB 4NI6A 3UTQA 3AWFA 4K7FB 1GHFH 1A4KB 3BP5A 5B1BB 3T2QA 1KIQA 4I9WD 4BJLA 5MENB 3P69A 4G82A 1WZMA 2D7MA 4H8PA 4AQZA 3NSDA 4DKEL 3EJSA 3MYJB 2G9HA 3M7OA 1XR8A 2NYKA 3GO1L 4PGCA 4H8QA 5F93C 4FA6A 4GUOA 3FQTB 3EJTA 3EGDA 4WI4A 5IF0B 1TQCC 2UX6A 5FX3A 2DM2A 1NBQA 3ZRCC 5D2NE 2AK4A 3TBYA 4OQTH 1OAJA 1F56A 1UA6H 3GSQA 3C5JA 5I1KL 3CNKA 1TJMA 3K0YA 1G6RB 3GMPA 3UTSD 2CZNA 2UVFA 3U4EB 1V7ML 1IM9B 3AG3B 1LJMA 5E9NA 3R18A 1NDMB 5ICYB 3P4LA 1HKLH 1HK6A 5K9QI 5I6NA 2CBTA 2VXSL 4XR8C 5DVNA 4A2DA 1LEGA 4CA4A 5I16B 2Z65C 2BS9A 2HSIA 2DL9A 4YX2L 3KLHC 3X1NA 3DWTA 2HJKB 4G42A 4YL9A 1RIVL 5EA0H 5T1LB 5HJ3B 1FGVL 3JYBA 1NAMB 1G0XA 5AG8A 3MMEA 4UOZA 2BVPB 3M6DA 3LKOA 4HT1H 1QZNA 1FRGL 1GGBL 3O2DA 3QXDB 3ULAB 1BOGB 3FQ2A 2W65B 5FCUH 4ODTH 4HP5A 3ZE1B 2MNJB 3HZYB 4W9HC 2ZWYA 4GUQA 2ZTBA 4FFTA 5KSUA 1QBLH 1WIOA 1QI3A 1SYSA 3GI9L 5DJ6A 1CF8H 1EAPB 2DKMA 3O41B 1S7QA 2C4FU 1VESA 3OWRA 5AZEH 3WTTA 2PWHA 3ARXA 1WC7B 3NCYP 4JDZA 1AD9B 3PRZA 3PFUA 1ZD6A 1HN1A 2DI8A 2N0KA 4X5PA 5EZLA 1MSPA 4XN5A 1WICA 4HMEA 4GEIA 3BZEB 3HFMH 3KYKH 5JPNA 3HS0A 3GSNL 1J8HA 1IC5H 1Q72H 3PXJA 2WBJC 1UM5H 1E8XA 4JFFD 5FGBC 4GP5B 3DO7A 1DSWA 4GMTL 4P5SA 5D7LD 4I13B 1KBKA 2R69L 2E86A 2ED8A 4NNXB 4RZCA 2V9QA 3OZ9L 3UTPE 1DQDL 4JO4L 1AMYA 3S96B 1EUTA 3FC8A 2GCYA 5D7SL 3WNOA 3HNVH 2QQNH 2WBJA 2AZAA 4GSUA 4Q0XL 5GRJL 3ZKQD 4JLRA 1N6UA 3FSZA 4XB3A 5DLML 2A9BA 2HFTA 2BSED 3MU3A 1XIWC 4KK5C 4KJWC 2B15A 4DETA 5KSBB 2Y07H 3MRFB 5J6GB 4GBXC 1R47A 4KAQL 4U0RB 3STLA 4Z3IA 2N59A 2J21A 5KVEE 1VGEH 4YHMH 2Z4QB 3NCJH 3U7AA 2DDQH 1RJYB 4FXKC 4ELMF 2V7HA 1E40A 4HMDA 2WZ6A 3O6KH 3IDYC 3BMWA 1BFSA 2XWXA 2R4SH 3D4YA 4I2XA 4MS8D 3QC5X 1UJ3A 2HJLA 1YDPA 5DQ9B 5F7NC 1CK0L 1AGBA 1HYRC 3CIAA 3ZR6A 4J5VA 2R15A 3I9GH 2R0LL 1AQMA 3IAGC 2WZ5A 4JFWA 5SV3A 6FABL 1IC1A 4K5MA 2LGNA 2WY3B 4QXGH 5GZOD 4YDKH 4LEOA 1LD9A 4WO4C 4AUYA 4CGUB 2DKUA 3GUTA 1CGTA 2CMRH 3BQUA 4L4VA 5DYFA 1KLFB 1CG9B 1LWRA 3GLZA 4CDHA 1YA5A 2ZUWA 4RQQA 5E2WH 1T5KA 5SWSA 4D9LH 3KJ4C 2XXCB 3O45B 2F6AA 5ICZB 1E4XH 1PD6A 1KJ2A 1BFTA 3AAZB 5KS9B 2JB6B 2CIIA 5EEUA 4MNGE 3C5ZD 3IBEA 1JAEA 2OP4L 4NWTL 3RGVC 2XZQH 3U9UB 1XXDC 3V8CA 3GZOA 1ODUA 1ID2A 2FIKB 2GJPA 2IAAC 5AL8A 1V10A 4G43B 4D3CL 4L8SC 3DGGA 2R2HB 3Q1SL 3H53A 4PP1D 5HYJA 1E6JH 3VFUA 2JKSA 2VXTL 3CIQA 4MASA 2ZF8A 4X8GA 4G7RB 3WLWD 1AGDB 2DQCH 4ZO9A 2F8OA 2R2EA 1JGLL 1OTSC 1KTDB 4L3FA 3T0XA 2W38A 4FX5A 2Y6SC 3T6XA 3TNMB 2QLYA 1N64H 2ISDA 1IFGA 2Z8RA 1QKZL 3L45A 4NNYA 4B6ZA 4HPYH 4PJHA 1JPST 4N5ED 4RMUA 5C6TH 1KCWA 5DTFA 2GUOB 1RZ7L 5D1ZC 4FQ1L 2H1PH 2XV2A 4WJG3 1O5PA 1IT9L 4B96A 1A4JA 3CQPA 1UT2A 3IYLW 2AC0A 4XP6H 1SXAA 1TJIH 3JV4A 2X4NA 3N1QC 2XYCA 4JZJC 3T04D 4NO0A 4MJ4A 3VXPB 3HG2A 2J8UB 2DM7A 3OJ2C 4G6AD 4X2UA 5T1JA 4RX4A 2OV0A 4LP8A 1KNOA 3Q48A 3Q5OA 1JZ7A 4U1NA 3O4LD 5EU6B 5EEZA 1ET7A 2M2DA 3TFKC 5ESVA 1J10A 3II2A 1N7ML 1ZV5A 4C58B 2X4OB 3Q2CA 4X9FA 5EO1B 4JRXA 2GVYA 4AK2A 3TBSA 4WW1A 5IHWA 2WSKA 4XNDA 4BV1A 5INDA 3HZ3A 3QUZC 2X9ZA 3A6OA 2V33A 2DQUH 2OMYB 1A6WH 4DO4A 4PB0H 1M7UA 3FB7A 1AQKL 5EUKA 5FYJU 3O0LA 2Q20A 1HAUA 4BXSV 3OPZL 1ZGLB 1DVZA 2FDBP 1GW0A 1IEHA 1SOQA 5IOPA 2A9CA 2MQCA 4XX5A 2DIEA 3RE0A 2WTOA 4U7SA 3WLWC 1FZKA 2VR5A 3D18A 5DJ2B 1I8IA 1SPDA 2GB2A 1CFSA 3NCYS 1F4YL 2P8PA 4H2AA 2X1XR 4ZTOH 4YK4B 5LGKA 2UWEE 1WV7T 5DU7A 3WS6C 1O7VA 3HBZA 3O3EB 3PWPA 3VQ2C 4CUCA 4RMVA 4U3SB 4KHXL 2V2TA 5A2AA 1ZA6A 1UJ3B 2HJLB 3IU4H 1CZ8L 5DQ9A 5J12C 3U48A 4Z7QF 1IC7L 1KC5L 4ADIA 5TE6L 2NLJB 3RY5A 3BLBA 3X3GL 2FL5A 1BOYA 3LH2H 4GMSH 2E9GA 2CCLA 5GIRB 3R1GH 2YRPA 1V7NH 1F42A 2X2UA 1WPCA 3F85A 3KPQB 5DD3L 2ALWA 2ZXQA 4G7QB 3OAUL 4XBGA 4PYHA 5B22A 3ZMRA 1I7RA 4RFNB 2DLGA 5F9WC 4PRNB 4OZGF 4K55A 5JOEA 1E8ZA 4CU8A 3O11B 2HP4A 4YHOH 2MMXA 1GVIA 2LU7A 3JWNE 1QPKA 3BVXA 4GI8A 1N59B 1E4XL 1ILUA 4PJ7E 5F7MC 1GCFA 3AT9A 4Z18A 3H4HA 4TNEA 4WSJA 4XI5C 5E6YA 4C83B 3HC0A 1WAPA 3SO3C 3S5LA 1P7HL 4HCRA 2W9DH 2WKLA 5CGTA 4JG1L 4JG5A 1SYVA 2ZXDA 4DNLA 3FQNB 1XQ4A 3AW5A 2ID5A 3T71A 1IAIM 4LDOB 3H9HA 4HIXH 4Z0BH 4A68A 4Z8FH 1DJYA 2I69A 1VJSA 4PS8A 2PWGA 3FB8A 2WINB 4JHVA 3LQMA 4HH9B 3SZKC 4YDIH 4JFUA 1RJZA 4CADA 3X14B 5JW5B 3BKYH 3S5LG 3VFVB 4MZ2A 5HVHC 3LRHA 3C08L 2JCCE 5TE7L 4P2CG 2CO6A 4C47A 1X5JA 1GIGL 4NQCD 4MAYA 1HHGA 3FH5A 2ADJA 3L1FA 2EVIA 1J9RA 4OI9A 4LHQB 2B4CC 4W81A 1JPTH 3ZKMD 4NZRL 3BH8A 1TENA 2L4OA 2XSKA 1INEH 2AV7B 3D33A 3A4EA 3WY2A 3QDJB 2AANA 5IK3B 3OMNB 1SJEB 3WENA 1T6WA 3KEDA 1J48A 5DD0H 3ZTJH 4B3EA 4OI7A 1X4YA 5LCVA 1JFQH 4YWGH 3CN3A 1EHAA 1XDTT 3TT1H 2AXJA 4QCIB 4IOIA 5EBWB 3N0AA 1GY1A 2VL5B 3OJVC 3BVUA 4JPVH 1P4UA 2OLDA 3VG0L 1DBKH 1MNUL 1T0NB 1OPGH 2VAJA 5C6PB 4P3CL 3WFCH 1QOKA 5CJ5A 2A83A 2V0AA 3BGAA 3P0YL 4G6ML 4XNXH 3V4VL 3G6AA 4X6CE 3LN4A 3OGCB 2IADB 5DI8B 4W9JC 1X5XA 1ZEAL 4ZW6A 4Z23A 5IT2L 3KXFA 1NEZB 4X80L 1GRWA 1PY4A 4XPHH 2VDMH 5E1AA 5FYKH 4HC1H 1U36A 3CK0L 3GIZH 3U36B 3QG7L 1DBMH 4NN7C 2X9YA 4RH4A 5BVPH 4XCCH 2QSQA 4D2NA 3WFEH 4PVNA 4HS6A 3CVCA 3RZCC 4OLZH 4K71C 2GFBB 2NNFA 4B7IA 2VDOL 1N5YL 3RWDA 3OSKA 4NDMA 4WGKA 2WTPA 3FCBA 1M7DB 1PSKH 1RUMH 1CLYH 1MG3C 1W0YT 2EO7A 3RYMA 1OGTB 1TNNA 2DLFH 5GJTL 5JXAH 2G4GA 2NXYC 4I2XB 5C0BE 3FYIB 3MA9L 1G9EA 2YAPA 1NAMH 1X5YA 3OKEA 4NQVA 2RD0A 1HL9A 2VDKH 5JOFB 2QQKL 1I1RA 3EJZD 2MRYA 1LE9B 3BCFA 4PJHB 3U1SH 1RY7B 2WSDA 1LVEA 2SEBA 1M6OA 3OXSB 4Y19B 2FVNA 3IFNL 5BS0A 4UINL 4BGDA 1RZJH 3HAEG 2GSMB 4R3SB 2AQ3A 1M3IA 1JMZA 2MCPH 2P8LB 3T3MF 4GO8A 3UJTL 4X6DF 5E4AA 2YD3A 3C8HA 3B7RL 3KM1A 2OYLA 3FT3B 5DJYA 1XCXA 4OJFH 2QPEB 1INDL 3PFQA 1N8OE 3SY0A 3S3DB 3VA2C 2OW7A 1DJGA 2RBLA 2WYHA 3L7FA 1AR2A 1CVSC 3CHPA 3WDIA 1UZ8A 2YRBA 4Y4KB 2YN5A 2XJKA 1JD7A 3G6DL 2YPVL 1XZWA 5IW1B 5EPMB 3WCYA 2XA3A 3ATDA 3I9AA 3OKNA 1IKOP 1YMMB 1BG9A 4RETB 2OJZL 5GGQL 3IDYB 3DV6A 1UA6L 4KX9A 4E41A 1UA3A 2VABA 2LV4A 3T3PE 5TQ0H 4V2CB 2DQGH 5HY9B 4WU5A 5IQMA 3CDZA 4N2KA 2Y23A 4Z77B 2B1HH 2QTVA 3KPRA 5G4OA 1TJGL 2IPKA 1ZA3A 4OAWA 4Z6AT 1QSFB 4ZSOB 3TJPA 4TUOB 1NANI 4D7BA 4N9OB 2WO2B 2JB5H 2DQCL 1T22B 1CFQB 2V3EA 3H85A 4HF5H 1E5ZA 2Z31D 1OVZA 2B0SL 2FJFB 3D18B 3UEZA 2RAMA 1QD0A 3GXDA 5ADPH 4XMZA 5E2UL 1GYWA 3WYRA 5D72L 1MQKH 3RB7A 3FCSB 1BREA 1HHJA 2CCWA 3GI9H 4GLRH 4P5TD 2BSTB 1MNNA 1CI5A 5A40E 5FWQA 3D9AL 2VDPL 3P9MA 1U8IB 3MA7A 3LS4H 1CJYA 2EYSA 3CLEH 3LIUA 1XF2A 3DX9B 1W16A 2W9EH 3SDAA 4XBEL 5I15H 3HB3D 4P4KC 3GGWA 2MNUA 2DTML 4A1RA 4ZTPL 3BAKA 2OSLA 1Y18B 4F2ME 3Q8CA 4G6MH 2C9PA 4L1TA 2GBVA 3SE6A 1CQKA 1J1XH 3B83A 4RMBA 2LVCA 3LZFL 3FN0L 4KXZH 3UEQA 4Q6YA 1A1MB 3W0WA 1H8LA 8PAZA 4B3VA 3LH9A 3MRRB 5JMOC 1IM3A 2ERJB 3BAJA 2JLLA 3QIBD 4OTXL 1EFXA 2ZOKA 2R9HC 3ILDA 3BPOB 3N40F 4UCFA 2E27L 2XPZA 5E00B 2RFXB 3GI8L 4JCLA 4YUEL 5C8JA 2J20A 3LH2L 1AZRA 2ZZUT 3IMRA 2ZKXA 4HUNB 4JANB 5DD1H 4PR5B 1OAYL 3LQAH 1UWEH 2P9RA 3GT6A 2BVUA 5BW7C 2JJWA 3CFKB 4JO3H 4OTXH 5FUCC 4YHML 3NJKA 3ZQWA 3ARWA 4K23L 1T3FB 4P04A 1X5ZA 4ZFGH 1CFNA 4O2FA 1E8YA 4FN0A 3A47A 3KWTA 3VI3A 3DVNB 2GBTA 2IH8A 3GUFA 4JFEE 4UOJA 1P6WA 2F18A 3ARSA 2AGJL 4NS0A 3KL3A 1NGQH 3APDA 4NKOA 4G8GB 5DHYA 2W07A 3N04A 3ZE0E 1NICA 3UZVB 4UDTB 3HZYA 4HCRH 2DWYA 3HE7C 1S9KC 4TLSA 5INCA 3SKMA 4AZUA 2AJSH 1BZQK 3AM8A 2CJ3A 2EXWD 1CL7I 3H3BC 4HC1A 2MPVA 1DLHA 1ZTXE 1H3PH 2E4FA 3QCUL 4M8QA 2K9FB 1WDAA 1JZ8A 3VW3H 3F5WA 5LBSH 2VZ1A 4LEXL 5I17B 4QAWA 1YEHH 2Q8BL 4EI5D 1W0WB 3ATFA 3ZRSA 1AHKA 2Z7YA 2NX5D 2CSPA 4NUQA 2HKFH 1X4XA 2LTQC 3L7FB 3EOAB 2NY1C 4YDJB 3TV8A 1F2QA 1JERA 4Y4HC 5IB2B 1CBVH 2R69A 2WVSA 4M6MH 4OY9A 1FFOA 4POYA 2OKMA 3ATBA 4EI6B 3ULVF 1WK0A 3LPWA 5DJXA 4QIRA 3EOBA 4TUUA 4AK1A 5GGSY 4BRVA 5HY9A 2J12B 2PMZA 1QLRA 3QFDA 3RWEA 4AIOA 3I6SA 3V6FB 2AEQL 3EIFA 1T1ZB 4U6XB 4F57L 4FTVE 4PJHF 4ODVL 1HXMB 2X6BA 3QQDB 4HPOL 3KBEA 3BVWA 2H6PB 4M61A 3H7BB 2W0PA 3IJ7A 4YX2H 4F93B 4MXVE 4DJMA 3RPKA 4YDLB 4LSTH 3CXDH 1UXSA 3M46A 3GC3A 5HYSG 2XWJB 4PSRA 1HCFX 2PTTA 2N7BA 3N85L 4HXAL 2WXOA 4XMLL 4PVBA 1UYWH 3STZB 1JRHH 2G30A 3IS1X 3ZKND 2O5YH 1UM6H 1MWAB 5JQ6H 2Z7UA 4NHCH 5HHXH 4J3OG 4IBUA 4BQBA 2RB8A 1KTBA 3MNWB 3IDGB 4JFFE 4LVHC 2DLIA 3U30B 3I6GA 5HYQA 2Y7LA 5DJAA 3NH7L 5DEFB 1A9VA 3OM3B 3B43A 2AFNA 1KN4L 3OGCA 4K3JL 3QULB 3CFDB 3IJ9A 3K6FA 3MAWA 1T03L 4KNTA 1F13A 4QHPA 1SOXA 3BD4A 3TONA 4IYKA 4I5BB 3QDJE 5FUOL 3IM1A 4DH2A 2ICEA 2G2PA 3L81A 1UADC 3V2AR 4EZMA 1LE5A 4GFTB 4UMGA 4WHYG 4YLCA 3MOAH 4FTVB 1ND0B 3BJLA 4Y4HD 2CMRL 4XP5H 3ARZA 1JUFB 1RSFA 2KZWA 1G7JB 4UILL 4CL7A 5JDSB 2LAAA 4HKBA 4K15A 2Z92B 4IKJA 4M02A 5J6HB 1ZA3B 3EFDH 4O4YL 4XHJC 4YPJA 2XICA 4N85A 5EU6A 4LAQL 4FL4B 5C6TL 2P47B 3GIVB 1L9QA 5LBGA 2Z1KA 3DXAE 4HUMB 4JFTA 4P2OA 3DUUB 1XGPB 4N2AA 3VFOB 4NZ8A 3VMNA 4KUCF 3EF7A 1YNLH 2NY4B 1MFAL 1UHVA 2HMID 2PW1B 4EAEA 3RWIA 4JN2B 3ZGHA 1D5MB 4D94A 4F5CA 4HA1A 4XO4A 1HHJB 5GHWL 2BOLA 1FFRA 2FIRT 1CYXA 4MCYB 1AGEA 5CLWA 2Z31A 2DMBA 3GTVA 4FADA 4KQ4L 4X5LA 4AM0B 4LIQE 3UO1L 1MFNA 1E9PA 2XIBA 2WXKA 4JZJA 1MCIA 2YPLD 3IF1A 4L8SA 4GYBA 3WD5H 5ACLA 2QKIA 3G5VA 2NY0D 2UXGA 3ECUA 3K91A 2IO5A 1SF5A 2CKBB 1QSZA 2WLJA 4ZMNA 3MRGA 2R2HA 1RZGA 4QHLB 4W9GC 5K1VA 6PAZA 1ZIAA 2XPGB 1N9PA 3CFQA 1INQB 4APXB 2V6HA 3RWJA 2JJTC 2OMWB 1GGCL 4OFYA 1RIHL 4AQEA 5HYJD 1U8OB 2AQQA 5EBLB 3ARFB 4S11A 2BMKA 2QZ5A 3NDYE 5CFHA 5C08E 2W5PA 4YL4A 2J56A 1WEJL 5I19H 2NZ9D 3R8QA 2C7UA 1OWWA 2F7OA 2E5EA 4UM9B 1VHPA 3UG4A 3ETTA 4FXLA 4RAVB 3EOBB 3HNSH 1DVTA 1SMOA 3L16A 4AYDC 2BSCA 3W39B 3LRSB 2OMVA 4UUJB 2JKTM 1XSKA 1INDH 5EF1A 4PWJA 1PAMA 3HC0B 4U1GC 3UAFA 4M4RB 4QRTA 1U58A 1SBSL 1VPOL 5C0IA 4KXDA 3APNA 4FI6A 1XF5B 2YXVA 4IRJB 4N2IA 3IJYA 4F9LC 4G6KH 2DQFA 1LNUA 1CFNB 1Q38A 1H15B 4KAQH 3VI3B 2BVOA 4DKAA 5C0AD 3ETSA 3DX9A 2VLJB 1F02I 1C08B 4KH9A 1CD8A 2JTDA 3RVXD 5LN8A 4UTAA 2JKNA 1PZ5B 2X3AA 5JXEA 3S98A 2CO1A 4W9KC 3UL4A 1U8HB 4F33B 5D6DA 1ORSA 5INDB 2J88L 5DJDA 1X5HA 2EILB 3D3VD 3GZQA 3GXTA 5B7MA 3KJ6L 2DF3A 2YSSA 5LN4A 3P77A 4S2SA 1PKQB 5H4ZA 3THML 1MI5B 2NY0C 2CRMA 1FLTX 2VZSA 2UVEA 4OLZL 4NWUL 4IJ3C 4H8WL 3BWAB 1UT9A 3IDMB 3ARBA 4H1LA 1KTCA 1NEZG 2Y3NA 3ULUE 1OARL 5HD8D 2GY7B 3N9GH 3T0WA 1G43A 3WXVH 3Q8AA 3IDIB 4UT9H 4Y1TA 4EUPA 1JZHA 2YUWA 1FC2D 2VXQH 3QQ4A 3S34L 5CR8A 4TTDC 4WK0B 2EIBA 5ESAB 2RCSL 4LHUB 3EGSA 1AK