3F64A

F17a-g lectin domain with bound glcnac(beta1-o)paranitrophenyl ligand
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
175
structure length
168
Chain Sequence
AVSFIGSTENDVGPSLGSYSRPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSSARYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia coli
doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords F17a-G
total genus 45
structure length 168
sequence length 175
ec nomenclature
pdb deposition date 2008-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 3f64A00
2BSBA 1OIOA 1O9VA 1ZK5A 2BS8A 4K0OA 3F64A 1O9ZA 2BS71 1O9WA 3F6JA 3FFOA 1ZPLA 2BSCA
chains in the Genus database with same CATH superfamily
4LHUA 5ANMA 1RPQA 4U1MB 2CKBB 3HUJF 1BBDH 2YXFA 4W4NA 3TBBA 2V8LA 2FTAA 4GRLC 2WBJB 4OGQC 4Z3HA 5I0YA 4UAOC 1FGNH 3NSJA 4IHOB 3T6XA 2YAMA 4D7PA 3L6FA 4KNQA 2WLKA 3T4AA 4CSZA 2X5PA 3NIFB 3K6SB 1HWWA 1MHEB 4AJVA 2FSEA 1DBKL 2G9HA 5ISZB 1WDAA 3NIDB 5D7EA 1PZ3A 1R3JA 1D5MA 4AUYA 1X5XA 2WCPA 3OL2A 2H1PL 4KKBC 4PJCF 3CX2A 3MLZH 2VE6A 1ZLSH 4R0LC 3IN0A 4N5UA 4K94L 1YMHB 1P9MC 4LMQI 1HDMB 3KPSD 5DHEA 5KYXA 3JTSB 1GYUA 1MJ7H 2FJUB 5B3JE 4MXQC 5K1JA 4X0KA 5AB9A 4XBPB 4WI4A 3TYGL 2CCWA 2F68X 4HBCH 3U9PH 4PG9B 1JPSH 5C08B 1I1CA 4FG6C 2BP8A 3P69A 4JO4L 2C4FU 2CWRA 1OOWA 1NDGA 1R47A 3A4AA 4RAUB 5I1JL 1KC5L 1KCBA 1L9QA 3CLEH 3INUL 3L4ZA 2O4EA 4IKNA 4ZQKB 3V4VH 1MHCB 1PMYA 3NSYA 1ACXA 3ARGA 4KMLB 3BKMH 5D1ZA 2GSIA 3BH9A 4O2EA 5DDHA 3U7WH 1NIFA 2UVEA 2Z34A 1QUPA 3P4OA 2IADA 4K8RH 4PG2C 1WA2X 2P8MA 3D07A 2JLLA 3ILQD 2ED6A 5GS2D 4A6YA 1KLFA 3BW9B 3QEQA 4J23A 3ZN6A 5AVRB 1FV1B 3M45A 3CQFA 3IPEA 4UZUA 2N1KA 4X99A 3E6FA 3P4NA 4LVHB 4U1NB 1CGSL 4JFYB 3WGUB 1YEKH 2H3XC 3NZHH 4NZRL 4JFFA 4FZEL 1HXMA 1HYSD 5CHNB 2R7EB 4UZGA 1EVUA 5FYLE 4FXKC 4Z3EA 3OJ2C 2XX1A 4N2FA 5DHYB 1Q8MA 2JKIS 1F1AA 3WLBA 2R0ZL 2RBLA 2ZOKB 5G2NA 1ZDQA 1SY6L 2DWXA 3BW9A 1S7VA 1DSYA 1MCFA 5G5DA 1SJHA 3VFUB 3QAZB 5A2IH 2FIKA 3HB3D 3MRQB 1N5YH 3HRZA 3FUNA 5FGCB 5E2UH 3N40F 4EI6B 5GJTH 1I7RA 2AFNA 3OV6A 5E03A 5IJKC 5D2LB 1G7MA 4HPOH 3VYOA 1JZGA 2LLNA 4KK5D 1M1XA 4XC3H 4PG9A 2R23A 1JGDB 4YNYB 3QIWB 5EUOE 1NC2B 4RGNC 5D2LE 1VCBC 1IC5H 4RWYH 3ZMEA 4YE4L 2EIJB 4U0RB 1WLHA 5KN5A 5J13B 1U3HC 1MY7A 1V3LA 5MEND 5E6IC 2V2WB 3FHAA 4Z7OE 4HCFA 1G9MH 4OBRA 4G3YH 5JIPA 2B16A 2ZXQA 5AOIA 3WD5L 1X6LA 4YHNA 1DBAH 1AD0A 3G5VA 1ETJA 3OSVA 3WKQA 3MV9E 5GGUB 1UGNA 3KBFA 1XGPB 1YQ2A 3WEOA 3FCBA 2C1PA 3Q5OA 4F8LA 4M93C 4WI5A 5HI3D 3EH1A 1XSKA 3AAZB 3RA7L 1X4ZA 3FFDB 3ZTDC 3NJHA 2CK0L 1NC2A 2ZG3A 3F5WA 4KZEL 1QASA 4LRIC 1SVBA 1U8OA 2X4UB 1NBVH 4I2XE 4LL4A 3TBWB 5ANMB 4AEFA 4BSJA 4EZKA 4MA7L 3PNWB 4HUUA 3EADA 1FNSL 1FBIH 1RJYB 4YDMA 3AUVA 3ABGA 1DJXA 1URZA 1YYLH 4LKCB 4IIZA 1DVUA 1IAIM 1B88A 1KIRB 4N2OA 2FECI 2A4ZA 1JRHI 3RBGA 3IFOA 2VLKB 3RE0A 4JG5A 2HFEB 4G6MH 1T21A 4JFHE 4F1SA 1O6VA 1E8XA 3HG2A 1FFNA 5FK9B 3SCMC 3OKOB 2WM0A 1M57B 1XH2A 3AC0A 1TITA 1M9WA 3UZQA 3CPUA 4LLQA 3NIFE 3IMSA 2WMPB 4BZ2L 1LE9B 4NUGH 5CLZA 4A66A 4OJCA 1MPAL 1OAUH 1TENA 2Y7QB 2E86A 3K5SA 3PXLA 2JI1A 4PTTA 2HWZL 3CN0A 5JA8B 1P7QA 4ELKB 3L4WA 3QYMA 5GXBB 4OQTL 1W72H 2OSLB 4DZ8B 4AGQA 2NYYC 1B90A 4PRIB 1HOEA 1RUKH 5FCSH 1RIVL 2IAND 4JRXE 3VB8A 1I8IB 4ZFGH 5E5MB 2NY0C 1EO8H 3I02A 2E6JA 3HC4H 5F7LB 3DI3B 4LNVA 3VH8B 1DQJA 2DWYA 4L1DA 5F7DB 4KNTA 3QR2A 4Y4HB 1KCSL 2ARJB 1FHNA 3K71A 4OI8A 4WV1C 3EGXB 4H1LH 5ALCH 4BK5A 2EE2A 1BVKA 4WO4D 1W0WB 5CJOH 4DO4A 1KCVH 1O9WA 4ZQTA 1DQIA 4OZHB 5LCVH 5J4MA 2CLRB 3LXBA 3S8WA 5BO1H 2MHAB 1IBFA 3KYKL 1JCKA 1N12A 1ZT7A 1RUPL 4ZUUA 5SX5K 5C3IA 1X7TA 5E8NA 4YAQA 5A3ID 5IB2B 1AXTH 3DA0A 4IK6A 2DF3A 2X3CA 4OTXL 1RPKA 4P5KB 5JZ7D 2CDGB 2YQBA 2K6YA 3MLTB 1OP3H 4Z7NB 4XVJH 1IGMH 4WSJA 4ZMVA 2WV3A 3QC5X 1BXUA 5DK0B 8PAZA 2GAZB 5CN3A 3ME0A 1JBJA 1QLEB 3QI9C 4LT7A 4PJGE 4R5XA 2GY5A 2CDFA 3WUZA 1M3IA 3TNNB 3L5IA 2K8QA 4HIJB 2NY6C 4WENB 4WSGA 3PPEA 4PJEF 5FFGA 2K6ZA 3CDGA 4PCYA 3VWJA 3DUUB 5DTFA 1T04A 3HZMB 4FEIA 1M53A 2EDRA 4Y8AA 5CEYA 1TMCB 3QJQB 1X5GA 3HI6H 1OXYA 1AHWC 3QI9B 3W9DB 1SNRA 5D1ZD 1E3ZA 2OMZA 1B2WH 1QW8A 1NEPA 5HPOA 2D7TH 2X4TA 1Q9KA 2H4EA 1QPXA 1LJMA 1DQDL 2AQ1A 4FZ8L 2BWDA 4JFQB 4AM0A 4CA4A 4EDWL 2M83A 1IU1A 4ODHL 4K94H 2AZAA 3FUMA 4OZIB 3VGAB 3H4HA 5KS9A 4P2QD 2UUDH 4N24A 1W0VB 4ZAKC 5EZLB 1IGFH 2AABL 2P8LB 5GGRA 2D73A 2XV2A 4IMKC 5ITFB 3UG4A 4ETQA 4A7TA 5DR5H 3EYSH 2DQTH 1UD3A 4EE2A 5DRXA 1QPPA 2MTPA 5H35A 1EGJL 4TRPL 4AEIH 2WIMA 3WTTA 2ADJA 2Q9OA 1BVNP 5B39G 3SBPA 1Q9WA 4X80L 1IEAB 2BK8A 4MA1C 1MNUL 1ZA3A 4O02A 3T0XA 1FHGA 5CAYB 5E08L 2X6MA 4DETA 2D31B 3MR9B 4HPOL 2YJQA 3CVCA 3TIDB 1PZ5A 3DRQA 1N26A 3QUGA 1Z5YD 1K8DB 2KMWA 4DKFL 5DQDH 4E9XA 4KVNH 2DLFL 5IQNA 4G7YH 3ZO0A 3CLWA 1TYJA 2WCGA 4YHIA 2NY5C 1GH7A 1KLFB 2DQJH 4UT6L 4QYOA 3V6BR 1NPUA 1JDDA 2V7HA 4EKJA 1KNOB 4BSWB 3TTSA 1AGFA 1AHWA 1FO0L 1R5VB 2EDBA 3S35H 1KEGH 4GP4B 4OQTH 3CSGA 2GSIB 3BH9B 4JZOB 4O2EB 1X9UA 1E5YA 1FLRH 3LYRA 4S1RH 3WNIA 3AS3A 2UZXB 2F58L 4E68A 3TN0D 3QUYC 4ZBJA 1TQCC 2Q8BH 4Y2OA 1EZVY 2MCPH 5C6PB 3NFSH 5T5FH 1N18A 2OMNA 2XACC 4PAZA 3SOBH 1MF2H 1NFIA 4QWWC 5AALA 1A2YB 3VVWA 2CRIA 5D1QE 4GO9A 4W9ZA 5C0AD 3BJ91 4OLWL 4KJQC 5I0DA 4S0HA 5E8OA 1C12A 4DK3A 2XZAL 3MVSA 5ALCL 1IQDA 3FT4A 3DX7A 5EOTA 3FQUB 3GHEH 1UXSA 1CL7H 1VF5C 2NLJB 3ILPA 4K3DH 1JGEB 2FVNA 2NY1B 1ZWIB 2ADGA 2VM4A 4YK4B 3US1A 3QUYD 3I50L 1J0YA 3FDWA 5DFAA 3RWHB 3ZTJG 2BNQB 1NCBL 2NY2C 1B0WA 2Q5BA 3HZVA 3NCMA 2BSED 1NMAL 1UM5L 2IWGA 3FOMA 3EJYD 3TVMA 2HFFA 2N0KA 2CR0A 5E4IA 4K7PY 3RIFK 4KHTH 1UWEH 4MQ7B 1K3IA 1QLEH 5DK2B 4FQQB 4HC1H 2VLME 2WNKA 4GB9A 1RZQA 4LARH 4ENEC 5T3ZE 1SN2A 4WHTA 3QUXD 5TDPA 3QJSB 1FNGB 4YZWA 2FX8L 4BFRA 5DT1H 1IZJA 3RL1B 3MA9H 1L9TA 2ZNXA 2DWDB 5IBUG 3PWUB 2CD0A 3MRNB 4Y5YC 1KT2A 4N3TA 1KTJA 3BWZA 3DGDA 2PUQT 3C5ZD 4YSCA 4K94C 3IRZA 4JFEB 5E4EC 3ZMRA 1ZHKA 3HW7A 3TPUB 3IS1X 5TD4A 2ZUWA 1BV8A 1YEHH 3BCFA 3LIUA 1KLUB 3SGKC 4JJOA 1OCRB 3QZWG 2ED7A 5F96L 5B1JC 3ZYIA 1AY1L 1SXZA 3ULVL 2HZHA 2Q6WB 4MA7H 2QTVA 3LEYH 2VN7A 4AQAB 5KSBF 3F01A 2G5BB 3PP3H 2YR3A 3WFBH 3BSZH 2AV7A 4LAQL 3ARQA 3IB4A 1GC1H 4AGLA 1YNKH 1OWWA 2FWSA 2Q86A 4PJIF 5I1IL 2BVPB 5EOQL 4PVBA 1LWRA 1TZOA 4Z7VA 5DFVD 4HUWB 3US9A 5AZ2H 3V0FA 2R29H 1TU2A 5KANG 3OJDA 4AMWA 5BNXD 4H26A 1UENA 3LV3B 2RQEA 2R1YB 1TTAA 4F7PA 2RIKA 1HQRB 4ONOA 2CLVB 1IC4L 1R3IL 3QZNA 4N2BA 3SE8H 4NENA 1MCPH 4EEEA 3N0PB 5GGVH 1NSNH 3LS4L 3TO4A 2ZAGA 2UY7A 5TF0A 3C5JB 1HZLA 2FH6A 4DGWC 2EE3A 3FS9A 5IV2A 2YSSB 3D85D 2FHCA 4AJWA 5IGXL 3AWEA 4XO9A 4HT1H 5HHVH 2OTPA 3ZRFC 5AWNL 4AI7A 4YDJA 4ICWA 2P24B 1J1XH 2H2SD 1MRCH 2CUAA 2NTFA 3EYUH 4YVNA 1JZ5A 1OTTC 3VXPB 3MRIA 5FEBA 3GUFA 1KZYA 2GABA 1BPVA 2AK4A 3VXME 3VFOA 5IOPA 2BIOA 3A4EA 2GK0A 1OSPH 3WNJA 5J6HA 1A14H 3RVVD 5IMMB 2PF6A 1OSZA 4OSUL 2WYTA 4KJPC 3I6KB 3JT2A 3AT0A 2W59A 4PIBA 4UT6A 3X12B 5IHHA 2BJML 3IJEA 1MREL 2JNZA 4JQVC 3K2KA 3RI5K 1VACB 1TJHL 2XBZA 3QHFH 5JXAH 1CT8A 1W91A 3CVHL 2BIPA 2FYYB 4Q7DA 4C4UA 3BWSA 3QIUA 4PFEA 4MA3B 1XSIA 2BHUA 4Q0XH 4NEHB 1E3XA 4ZUTB 3ARDB 2ZXWB 1JK8A 5I75B 4JK0D 1KGUA 3V0WH 3KYOA 2D4FA 3NH7H 1G7LB 3LXUX 4LLDB 3SDXE 1M05A 1TDQA 5J7CC 3WTVA 5IHUH 2R0KL 3VFOB 1Y1DA 4TN9A 1TZGH 4YXLH 3MREA 1Z9PA 1ED3B 2VDOB 3KPRB 3V4UH 3Q7JA 2FR4A 2VLKE 3WDJA 2Z4TA 3PWLA 3RBSA 1ERNA 1M1SA 2J8UE 3EDDA 4AGMA 5AW7B 5TH2B 1HSAB 3X11B 5J6GB 1QBML 1BF8A 1IC7L 2H3NA 2ZX7A 1SMOA 4IIQA 4N5ED 4PJEA 3T0ED 3Q9PA 5JPNC 4IBYA 5HHMD 2QVTA 3O6FD 4L4VD 5I6XC 2XY1A 4KGLA 4FLHA 3TCXA 2XWXA 4HS3B 4N90E 3T6WA 5E8EA 5E5RB 4Z7UE 4ZI8A 4AUUA 4KO9A 5GS0L 2IBBA 2WQVA 1LO2L 3SZ6A 1O6SA 4JFZH 3BJLA 5DUBB 3QT2A 5FYJU 4TTGA 4O9HL 3ZZQA 1ZANH 4JKNA 2JB6B 5C0CA 4HZLA 2VSCA 4PB0L 4XTRD 1BD2B 3EOTL 1O7VA 3MA9L 4JFOB 4N0YL 4X5XA 1UB5B 4Y4FD 1AE6L 5FHAL 1R75A 4RMTA 3O2WL 2WZAA 3WE1A 4E5XB 5EFIA 4BWTA 1NOFA 2Z7YA 4ODVH 3TESA 3HHSA 2GC7C 1FO0H 1QVOB 2HAZA 3PU7A 3FO2A 5ERWB 3VI4A 4EVNA 1O7DC 3LJ3A 4X7SL 1WF5A 2H0PA 4ZXBB 3QZBA 1ZXQA 5A6IA 5EB9A 4XPGH 1KCUH 3ESNA 3BRGC 2HT4D 2R4RH 5D7KD 1J7VR 4CVXB 3BZFA 1FFOA 4CW1B 2EO9A 1DZBA 1TETL 1YNKL 5DWUH 2P8PA 4U6XB 2CMRL 2J8UF 1IKOP 4K3JH 1JNHA 1RZPA 3D2UD 4F2MB 2X4PB 2R0LH 2GT9B 4ODTL 4UV7L 3JVGA 3ZQWA 3EJRA 1IM9D 4IU2B 4UQIM 3HG4A 3HS9A 1RIVH 4FNLH 1I3GL 2JSFA 3GGWB 4WWPA 3TT1H 4B60A 2HFFB 2ZAIA 4IRJD 3C09B 2Z91A 3N1MC 3US0A 3OR6B 4G5ZH 3HNSH 4MCYB 4BQCA 3WNKA 2ICWJ 3EUUA 3P40A 1C16A 5JUEH 4G8EA 5KJ4A 5D55A 3CXDH 4P3WA 1UWEL 3DX2A 1YY8A 5ICYB 2AQ3A 5IVZA 4CN1A 2C9PA 4K9JA 3WKMH 4ZT1A 4MA8H 2X05A 1JYVA 5D1QC 4DNLA 5LAXB 2Y5EA 2ZKHH 1IQDB 5JIMA 1CBJA 4LSRL 3G5YA 1L7TL 2RCSL 3H9SE 1G9NL 2O30A 3P3RA 1NGYA 3ET9F 4TUKL 2C3VA 5DVKA 3I6LE 2CCVA 1HZHL 5CUSH 1A4JB 3S3JA 2CGZA 4PGEA 4C54A 2KS0A 3EGDB 1G9EA 5DS8A 4HJJH 1L9PA 1DDHA 5AOKA 5GS1A 1IAIH 1WE5A 1TTUA 5TE7L 1O5DT 2YZ1A 4IU3A 3SZKC 3WTWA 1UD8A 3C5ZC 1B0RA 3FN0L 3NGBC 5FA3B 1NUNB 1XQ4A 3QHZH 4NKIL 4NUJA 5AVTB 2JJVA 4OD3H 3O8XC 4LGSB 4CADB 3H42H 4LSVH 1XX9C 1KY6A 2TRHA 2AJZB 3DGGB 3F00A 4G9DB 3ZE1E 4EZMA 4JN2B 5BJTA 1UKTA 1YA5A 2R2HA 4L4VE 3FB8A 1QLFA 4DFIA 3QFJB 5BOZG 2EXYC 1U92B 3FRPB 2RQ8A 3JWOC 3K2IA 12E8L 4RMBA 2NXZC 2R0WL 3CFCL 2WYIA 4K71C 1MIEH 3MUHL 4GI6A 3WYRA 5H37G 5T1KB 4EPSA 3RFZC 2V5TA 1QHOA 4GKOA 4KQ4L 4UINL 3Q6GH 1NL0H 1IB5A 1ZIBA 3M07A 3U4BH 1QLEL 5C0IA 3A6CH 3SOBL 4BDVB 3NQKA 3Q2CA 4YZFE 1XD0A 4N6QA 5D6CA 3RB5A 5KSBE 5IREA 3EAKA 4JO3L 4CAGA 5IBLD 3A21A 4BHUA 4JG0H 4G9FD 3NFNA 4YSTA 5EU6A 1KIPB 3BAYA 3ZVVA 5CJBA 1NMCC 4PJDA 3D4YA 4XODA 1QI3A 5AUMA 2OULB 1QFWI 1T2QH 1QO3A 2FATH 5AVUB 3VG9C 1UXWB 3CZLA 3ZYZA 3OB0K 3V52L 1S7WB 1JGIA 1OAKL 1R0AL 4JPKH 1JMXA 2Y7MA 3O45B 1FG2B 3QXUA 5T3ZD 1B4TA 2DQTL 3MLWL 3M8OH 1EXGA 1BQSA 3BUYA 1OK8A 2PWFA 4HUMB 3QUZC 2L7EA 2JK5B 3MGTA 4JG1H 1UZGA 4KO6A 4GNKB 4YWGL 4B9YA 1H6UA 2AK4D 3IMUA 3FUIA 3KBEA 1MOEA 5JIKA 2G60L 2CNYA 1ADQH 5CKAA 2BVQA 1A6TB 1JFQL 3CHXA 3VGGA 5DEGB 4NO0D 4F37F 5LQBL 5IMKA 3MX0B 1RP8A 1R3HA 3A6BL 2X89D 1CDUA 5EOCL 3MNWB 4ECNA 5IHUL 3F05A 3GSNL 1J5OH 4WK0B 2CRYA 3U4AA 3QA3A 3Q05A 2VLJD 2HJKB 2L4OA 1GGTA 2QFPA 4JZJB 2VXTH 4M00A 4MMZB 5D7KE 3SN6N 1DJGA 3MGOB 1FL3A 3IFNH 1MXGA 3L5XL 4TPRL 3MC0A 1OQXA 3O3UN 1BYOA 1XCTA 1JE6A 3ZHFA 4G43A 5I8CB 2C9RA 2DIEA 3T0VA 1MXDA 4FLQA 3QQDA 3H9YA 3UPRB 4M6OH 4I87A 3QJFB 3NQIA 5E95B 1RZKH 1URLA 3FTWA 3UTSA 3GRWH 2R1WA 4HCRA 2XZCH 2R1WB 2QQNL 3IK2A 2AK4B 3GJEB 2BY1A 3BOVA 3P3UA 4JBSA 1WO2A 3IXTA 5BXFB 2A73B 5JPMB 1NCBH 1QSEA 1F6LL 3WMSA 4OGAC 4NPYB 4WY7H 1MDAA 3MN8A 1A7QH 3RPIB 2AJXH 2K8MA 2F15A 4J1UB 2BSDA 1FPTH 3NSCA 5E5MA 5FWQA 4N8VB 5C92A 4FKKA 2FJHB 4X4YA 2Y07H 2J2ZA 1RH8A 1L0YA 5EZIH 2X1OA 2R1XA 1IC5L 5F6HI 4AK1A 3IJ9A 2R1YA 3SKUD 3HUJE 4DVRH 1INQB 2R9HC 2V5SA 4KHXL 3QFDA 4DHLA 5EORL 2C7FA 1JJUA 1D6VH 1EZSA 2Z31D 1KPVB 4G9FB 1F0LA 3QWOA 2AQSA 2HPOA 3NACH 1XMWA 4FX5A 4IMKA 3CZGA 5IFHH 3IF1A 3C6EA 4BZ1H 3ZL4L 1HHIB 4CU7A 4TLSA 3QUZA 1A6UH 3GJFH 4G8FA 4UM9A 2ZUYA 3RA7H 3BYYA 3P9MA 2YA0A 2J6EH 4H8UA 1G4RA 1GOHA 4PMEA 5HYJA 3O4LA 4AGNA 5CEZD 1MI5B 3OPUA 1AYOA 2B4CH 3V55A 5D72H 4B96A 2Q2EB 1I3UA 5BMFL 1HXYB 4JFXB 2HLFC 3VNYA 2J56A 1UD4A 3CFNA 3N9GL 3WHXB 3WL9B 5IEHA 4AT6A 2XN9A 4XRCA 4X7DC 2Z0BA 2FO4A 3OKEB 3QIWD 3TXAA 1RZGA 1NCJA 4Z7QE 3QGVA 3VXSA 2ADFL 3P3TA 1PZBA 3ULSB 4L2YA 4XP1L 5E9AA 1UHVA 3D85A 4HS8L 4JFFE 3KPQB 4X7CC 1I1AD 4UB0L 2NY7H 1UWGH 2A6DA 4OM1L 5C0BE 2NUPA 3LZQA 1JXKA 2NX5B 4MD5A 4XMLH 4M02A 1MH5B 2YD8A 3LZPA 5DHDA 1XH3A 1A1OB 4AENA 1HHKB 3HPLA 3S4SG 3S5LA 3VD5A 5D2NC 3IDYC 5DD0L 3MJ9L 1MDTA 1TJGH 1XVSA 3ARFB 1YEGL 4NRXA 1UXSB 5D7SH 1JNLL 5DMIL 3PWNB 4QDGA 5I30L 1FZOB 2CPCA 1KFAL 2BNRE 3MBXL 1XZ0B 4FG6D 2IH3B 1RLWA 1PFCA 2WLLB 2GIMA 3MFFB 4MRCA 4PRBB 2Z31A 4R5VA 3EF4A 3M1BB 5FDWB 1B0RB 1SQMA 3IMVA 4XNXL 3S5YA 5KJRL 5CEZH 2V2XA 4Y1AE 3BKJH 5D4HA 4NQCD 4YSRA 2H47C 1CVSC 1T1YB 3NCBB 5AW1B 4FQJH 3RWEA 4ODTH 4KK8D 2X88A 2CU9A 4FFYH 4QHUB 2YEZA 4RLDA 5HY9A 5GJTL 4X98A 1SZNA 3B2UD 1OAZL 3KPOA 3Q44A 4MD4A 1BYPA 3B5HA 4X98B 4JPVH 3FCSB 3CFEA 5C08D 4LPVA 3KYKH 4G8IB 2HLFD 3V5HB 5DYOA 2CXGA 2HG5A 4F8QA 4IOSA 4AVKA 3QQNA 2IALB 3Q2NA 3SQBB 4RWYL 4W9DC 3STBA 4KTYA 3HN8A 4A2HA 1OB1B 2WLZA 4D94A 2A77H 1QWUA 2K70A 4NRYB 1ND0B 3ZKMD 3UBXB 1E8ZA 4R6UA 1M7DB 3RZCD 5J0BA 2MNJB 4KHXH 5F7FA 1AE6H 4EDXB 3W5NA 3IFLH 2YWYA 3MCLL 1KWGA 3EYVA 4FQXC 5I66A 1MG3C 1Z7JA 3GSOA 3O6FB 4L4VB 4KZCA 1Z3RA 1O7DE 2P7TB 1MEXL 1A21A 2VWEC 3ZL4H 2NW3A 1W72L 3AQXA 1MZZA 1GMEA 1S7RA 2X2IA 3CN3A 4JGJA 1F45A 3ZE2E 3ARZA 2X70B 4GUOA 3VD3A 1Q9OA 1YEEH 3BHBA 4NPKA 5HHXL 3IGKA 4RSYA 2O6EA 3EJZD 1KULA 3VMPA 4IOFC 5JHLH 3E9UA 1S9VB 4JFFD 4XO8A 1HHIA 2UX7A 5HPMB 4HV8B 2HTKC 4HUXA 4BFBD 1QATA 2PTTA 1BA9A 4JL1A 1ZS2A 4FNQA 5GGTH 4FQHA 4GJTB 1DQQA 2VCOA 5DSCA 2FJFA 5DC2A 1WFMA 4XN2A 4D3CL 4P2RA 1H3TA 4X6BA 3S97C 5D96C 5KVGL 5T3XL 4B9IA 1A47A 2JKTM 3LNDA 3QBTB 2DM4A 2NNRA 2AGJH 3RVTD 5EF3A 5I8KL 3TZVD 2Q8AH 3WIHA 1QG3A 3VDAA 4U1GC 5DRZA 4PJ8C 3AG1B 4IHOA 2DI9A 1PPIA 1V7ML 3LH2L 4P5KA 5JIIA 5L7XH 2R4SL 2DAVA 5AG8A 4HQQL 2VR5A 1WBXB 5E8NB 2FX7L 4DGVH 1MVUA 4M9PA 3E2HC 2X40A 3BUQA 5JW5A 1YPZF 2X44D 3IRCA 1C1EH 2JQMA 5HXMA 3KPRA 1EUUA 1Q4NX 1FYTD 2WXQA 4DT2A 5EF2A 3PUCA 1ZOXA 4CC4A 4XO4A 4PJFE 3DSNA 3ZIMA 3WJMB 2GTQA 4PYHA 5FUOL 4B9GA 2A9AA 1BXVA 2WQRA 5ID0B 1YPZA 2EVFA 1USZA 4YWGH 1A0QL 4OF0A 2FIRT 5BW7C 3MV7D 3BEWA 1F90L 3HR5A 2BIQA 5IHZA 4TQEL 3IS0X 2FYYA 4EO5A 4J28A 2E9BA 2ETWA 1VIWA 4FQXD 4WTZA 3GINA 4R83A 2KQMA 4YBHA 1AJ7L 5IVXE 1NANH 4I18B 1HESA 1GOFA 3KLKA 2J2ZB 2EXTA 2N7AA 3V9CA 1WPCA 3FB5A 4I7ZC 1A9BB 5I73C 3MCKA 1KJ3H 2EDNA 3HTLX 2QGCA 1YUHA 4JREB 1BQHB 1IBGL 2H8PA 4KTGA 4ZYKB 4QTHB 1CFTA 4NQUA 1W6WA 4G3YL 4G80A 1RP9A 4PJ6A 1SEBA 4LNRB 1BM3H 2NTFB 3H6AA 4GSDL 4K8RD 4MJHA 1DLFL 2IWKA 4C58B 5ECGA 3SPVB 3KDPB 1VFBA 2VQ1A 2CBMA 5C09B 4KQ4H 4BEIA 4NQCA 4PTUA 2GSGA 3UTSB 4PV9A 4AYMC 3IJ8A 1J8HB 3DIFA 4M3JA 1IEBA 2B1HH 4ZTPH 4KTEL 2CLVA 3NP4A 4NN6C 1U8HB 4RRPG 5EWIL 3UAJA 1WSST 1E6OL 4DVRL 5KG9A 4J3BA 5F72S 4FABL 1MAML 4P4KC 3R7RA 1D2OA 2ED8A 3GI8H 3QUXB 5DD1H 2O93L 2Q2LA 3WY2A 3BSGA 4PS4H 2AQ2A 2YD7A 4MMZA 3VFPA 2UWEB 3MYJB 4IDJH 1LDPH 3APNA 4PY8I 2EDQA 3BPOB 1F6AB 1YDPB 2GJJA 1WCBA 2IQ9H 3HE6A 4F5CA 2C7UB 1IIKA 4OUUA 2MKLC 4TNVF 4Q9CA 2VRKA 3D25B 1E43A 2F53B 4WV1B 3IETA 3SPHA 2B0SH 4ZTOH 1N59B 1KBBA 1VDGA 2DD8H 1A6TA 2R2CA 3OKKB 4Y2NA 1GJUA 1FAIH 3FUEA 3N55A 4PJCB 4KBPA 2PR4H 1XGPA 4MNQD 4WW1A 3FO0H 5F0JB 2C3HA 4ZNEE 5D1XE 2WZ0A 1J5OL 3C12A 4UQ3A 2H41A 4HUVB 3HI5L 5J11C 2HB0A 2XZAH 3GEWB 3VXMB 4Y5XA 4ZD3H 5E2TL 3L3KA 1PKQE 1JRHL 1UWGL 2FBOJ 1NM9A 3QEQE 4RVBA 4P9HH 1KG0B 4M43H 1DQTA 4FQQA 3MUY1 2JKJA 3BZ4A 4ZO6A 4NLHA 5DD3L 5E5UB 2Q76A 1U8CB 1S9XA 32C2B 1NSNL 3LS4H 4DN3L 5ACLA 4G6KL 3ARED 3QUHA 5C0EB 3HZKB 3EFFA 4XC1L 4PB9H 1RMFL 2FYVA 2GQHA 1K4DB 1FVDA 4IBLT 4LCYA 1B3JA 4LCWE 3FSWA 2I9TB 4BIKA 1DVXA 3ECWA 5KSUB 4LRNL 1W15A 4A7GF 1ACCA 1NIDA 1MUJB 2NNXA 3QUKB 2DLEA 3TTYA 4JCWA 3U0WH 1NOAA 2QADD 2XRAH 2D0HA 3OD3A 4AYEC 3UP1A 3DROB 2AMGA 2J55A 1KB3A 4NO3B 1A65A 1MLBA 1UXMA 5L4IA 3V5KA 4JPSA 2IH8A 3HNTL 4NYLA 2W60A 3V4VA 2VXVL 5E99H 2NSMA 2R27A 3F7PC 4WHDA 1CGVA 1PDKA 1A4KB 3O3EB 3OAWA 5ESVB 3LQZA 1AXSB 2MCPL 4OCSL 1CD8A 1WT5A 2Z91B 3Q2VA 3BKJL 4L3AA 4ZFFB 4CADA 5HDBB 4XWGH 2E7MA 1KIUA 5JR1L 3J27A 2QPSA 1G1KA 2ZYSA 4C56A 4FQJL 2AKRB 2VXQA 1TG8A 4J27A 4U1NA 2PCPB 3QNXB 3V7AE 2IDSA 2BSSA 2R0KH 4V2CB 4Z7QB 1BEYL 4OZHF 3V5KB 5C6TL 4QRPD 5DHXB 4LCUB 5HGAA 2JJSA 3ZRCC 4JZNA 3NIGB 1LNUB 4NFCA 5IMLB 1B4LA 3EHBD 4KHTL 3MRFA 1YEJL 1UATA 2ZOOA 3JBG7 5JYMA 4X4MA 3MA7B 2EDOA 4YFEA 3DOIA 4YHOL 3EJCA 2IFFH 1FI8C 4PBWD 3ISWA 1A22B 1VZGA 3MUJA 3IAPA 4KQ3L 4KK8C 3DVGB 4EDWH 3MNZA 5FA4B 1UT9A 4L4TE 1JHTB 5K69A 1J87A 2CQVA 1CWVA 5C7XH 4OCWL 5E1GA 2Q76B 4IKIA 4JM4L 4AG4L 2P43B 4WVRA 4WHYH 3C08H 4UTBH 4L3EA 3EYUL 1Z9SB 5KSUA 3A67H 5T1DH 2E6PA 3VI3E 4I48B 1TKWA 4LCYB 4NO0A 2X9ZA 4JDTH 3RL2A 2AQTA 3TYGH 4G83A 4P2RD 2VN4A 3BYTA 3DTDA 1EQWA 1MHEA 4DN4H 1XCXA 4MDJA 3LHAA 5DUPH 4BFJA 3SGDH 5GS0D 3BPCA 2M26A 5KBPA 3GMNB 1CDYA 5AAWA 2DPKA 1NAMH 4PJ9C 4YHZL 3WIIH 4CVXA 2YRPA 3NUKA 5FAAA 1JL8A 1P7HL 5FYJE 3C2AH 3EYOA 2CKBA 5B3NA 4RNRB 3U83A 1T83C 1GPOL 3IETB 5AYUL 4G2AA 2JMRA 4POZD 2V9UA 1KIQA 4ZO9A 1H0DB 3GLAA 4HIJA 5A1AA 2H0FA 3X3FL 1NPJA 4AIEA 5I76A 1I9JH 2FQDA 1ET8A 4PJXA 3MBEC 3IDNA 3VXUB 1LK3L 1Q0YL 1D5RA 1FL5A 2J1WA 2W9DH 3D3VD 1JRHH 3SQRA 4X6CB 1M05B 1XF4A 1JCVA 3T3ME 3EJQA 3MLXL 3WFHB 3EO9L 2VLJB 5LN4A 1QSVA 3DHPA 4MA3A 4FQLL 2E8ZA 3GS0A 3S34H 4JS7A 1DVFD 3RU8L 1FGNL 2DKSA 4M62H 1NDTA 2KI6A 3E3QC 1U8HA 2EEDA 2NUTB 1FUNA 2W8CA 3NCFB 5D93C 5DHMC 3CH8A 3BDYH 3PAZA 1BZ8A 4J6RH 3CUPB 4AZUA 2AK1L 2GJ6B 1VGEL 1EIBA 5JMOC 1DLHB 2DWEA 1Z6JT 1H9DA 1W0WA 3SE4C 4M1DH 1NICA 2PTUA 2XN0A 4I89A 5KEZA 4OZFG 4CILA 3IKKA 4O00A 4UTCA 3VXTA 1HHJA 3GJFB 4FDWA 3ULUL 5D7JA 5MEQB 4P4RA 3UAJD 1BVNT 4PJCE 4LSTH 1IRAY 2WCSA 1KYAA 5L2JA 4NO5A 2DS4A 1V7MH 2WVSA 1F13A 5KYYA 5D7IB 4LVNB 5TQ2L 3VU2A 3B4NA 5ABAA 2CA3A 1X9RA 3AXHA 4M7LL 5L2KB 3RWCA 4Z76B 1L9SA 3ZYJA 5DVPA 2OX5A 1E6JH 2XWBA 2BVOA 1HQRA 3NJGA 3RHWF 5C70A 2JKSA 1S7SA 2FX8H 2X42A 5BRZD 4KJWD 4XVTL 4XN4A 2UZPA 3IJEB 5PAZA 3U1SH 3JV6B 2VDLL 4PRDB 5ALBL 2OYPA 4Z3IA 5J11B 2WINB 5TDOA 4Z3GA 4YH6A 3EXJA 1GYAA 1OSZB 2W07B 3CZSA 1NCTA 3OC8A 4FLSA 4U31A 1YEHL 4GBXA 3AADB 1CFQB 3WXWL 2OMUA 2XY2A 1DL7H 3H56A 4TVUA 4R2GC 1YEEL 5HHXH 4Y5VC 5I17B 4RDQF 3I6GB 5EWIH 2C9AA 1P1VA 1XF3B 2Z31C 5IP4A 2DQ6A 4NJ9L 3EOBA 5I1EH 3WFHA 4WO0A 4NKOB 4YQXL 2WBWB 4M4RA 5KSAB 3TEWA 3UL4A 5E2VH 1NIBA 3S3PA 3B5TA 4DAGH 1N0XH 1LLAA 2G2RB 5I82A 1NMBH 3T65B 4IGBA 3O2VL 2NDFA 2FO1A 1IQWL 4N86A 3HRZC 4UNIA 3ESMA 2F7PA 2IQAA 4OV6F 2PO6D 5J1SC 4TVPE 1HKFA 4LEOA 1KIQB 4N2GA 4UMGA 1G6RH 1KB5B 3QFJE 3EFDH 1BAFL 3ZKQD 2DBLL 4HOZA 1K6QH 1E4KA 5DJCA 4X5WB 4QNPE 4V2BA 4ZPTA 4V11A 4FQPA 1NFDE 3EDFA 5JTWA 4R7LA 4DWHA 1JPFA 4ELDA 2LT9A 3QZMA 4WGWB 5DUPL 1NCHA 5F88A 4BCZA 4FP8L 5D7IF 3ARDC 3NA9L 5AAMC 3UJTL 4OCMC 4W6WB 5C8JB 2ICCA 5F9WC 3B7YA 1ZVSB 1TETH 2FX7H 2OQJB 3WY4A 4A55A 1H15B 3CNKA 3JWOL 4M6MH 1KGIA 1GYCA 4EN3B 1RIHL 3D52A 1OZUA 1VKXB 3K6NA 3IBEA 3U0TB 2GUOB 2BSEA 5TFSH 2OJZH 1KB9J 3RNQB 4UNTA 3DJRA 3LX9A 2A83A 1OL0A 2ZTBA 4R2GB 5EG6C 1ZHKB 4S10A 2XTJE 3BDXA 5FUCE 1K9TA 4GKNA 5G4NA 3MRMB 4PJ5B 3SDCA 4G42B 1LK3H 1H9VA 3M7OA 4GAJL 2CALA 4CC1A 1D2PA 4WFEE 2ORBL 4XNZC 3WKPA 4GEIA 4EZLA 4B7IA 2W0KA 5EBLB 4RQQA 4J7RA 5D2LA 1YEDB 3ISYA 3X1FA 2UZXA 3BWUC 3Q8AA 2BVYA 3AMKA 3T3PF 2PWEA 4JFUA 4F8NA 3RJDA 3O6FA 2HVJB 4L4VA 4W6XB 5TDNA 4MNQB 5E9NA 2HTLD 4NQVB 1NGWA 4IRZL 1I9IL 5DD6A 4P23C 5C9JA 1RJLB 2IGLA 4ZD3L 4WWKD 2GJZB 3U79A 2V7HB 4Q9QL 3UCRA 2XZCL 4G70B 5GRUH 4LQFL 1PX4A 1U4FA 4HWBL 5E6IA 1JGUH 1WWCA 5D1QD 3RJQB 3V4PH 3ZKXC 4HFUL 4AQ1B 1IBBA 2VDML 4I3SH 4MRBA 5F6IC 1QBMH 2G5UA 3DO3A 2MCG1 1ZRUA 1D7DA 2I5YH 4D0DB 3BP4A 5CLXA 4WAFA 5JHAA 1CFBA 4OZGB 1IL1A 4OH2A 2OYLA 3SE9H 5EEYA 1HILA 1X4XA 4I77L 4Z0XA 1RZFL 4KWUA 4C55A 1INEH 3CLFL 4HCIA 4ADGA 1F3JB 4NO2B 3VO0A 2X6VA 3N85H 4N0CC 4YSEA 2BS8A 4Z7WF 4X99B 3GZOA 4P57B 2OMVA 4Y9GA 4NYLB 4K3EH 1RCYA 4M7ZC 2AERT 2BP0A 1ADQL 1TJXA 3U4EB 3V0VA 1WC7B 4NO3A 2ZSWA 1ACYL 2DI8A 2J5LB 2X6BA 3KW8A 2IADB 3JWNG 2P45B 2VIRA 2WBXA 4F33B 4HKXB 4QYOB 4YDZA 3HC3H 1IT9H 1AZVA 3U30C 3MRCB 5AB1A 3T0AA 3L81A 2WKOA 2WW8A 1CICB 1DE4A 1NDGB 3HS0C 2OMVB 3ARFA 5DS2A 4RQQB 5KYWA 2ZCKL 1PD6A 1V10A 3BP5B 3KL0A 1LE5A 1E2ZA 2YFOA 2X12A 1LWJA 2AF2A 3N42B 2EVJA 1EO8L 2E9IA 1HL9A 4M7JH 4DGYH 5L9DL 2XG5B 3BX7C 1SDDA 2XJKA 2BOCA 1CZ8L 1WAAF 1CI3M 2OLDA 1XTMA 3OX8B 2YC1A 4KUCF 4BUHA 2A3TA 2KL6A 2A0LC 4GW4B 4ORZC 5IK3A 3BVUA 5CBAB 5LDSA 1LO0L 2I07B 3KYNB 4AYBA 3L3JB 3P0YL 4XE0A 3IGAB 1YMMA 4XB3A 2PLTA 1S3KL 5KTEL 3ME0B 4F93B 4D8OA 3IGLA 4KFMA 2P1YA 4I5BB 5DD6B 1JGVH 1SEQL 4QTIH 4OJYA 3GXTA 2AJXL 3NA9H 4LLMB 3PP4H 1OE3A 1I1AA 5DJCB 1ROCA 5EBLA 2NNFA 5IESH 3U30B 3C08L 4UTBL 5D7LE 5HYQA 3NCYP 4HUKB 3A4DA 1E42A 2B3IA 3QWNA 1U95B 3SYCA 4JFPB 3C60A 4XH2B 1KB5H 3GMRA 2EVHA 2Y3AA 2O6CA 3EGXA 2VDLH 2DIJA 2ZOLB 3GBDA 3QUXA 1EHAA 2OJEB 3B1TA 1CICD 3IJHB 4XWOD 5B8CA 6FABH 3TYFA 1GOGA 1MI5A 4MQTB 4XNUL 5LNGA 5DVLA 1X7SA 3TV8A 1EA9C 1ZGLM 2QKIC 4PJBF 2MPAL 2OKMA 1WWAX 3K6FA 5J5EA 3NIDE 4G8FB 4UM9B 4PS7A 3D39E 1TNNA 2P5EA 4XNXH 4Y9CA 3QXTA 3KPSE 4K71B 5T5FL 2GCYA 1CLYL 1TVBB 2OMYA 3MV11 3ARYA 2AAVA 5FO2A 3KXFB 2QQNH 4XHJD 1JXFA 2CO7B 4YC2C 2IF7A 3PREA 2BY2A 3AXLA 5KZCD 5E7FA 1DJZA 2FWLB 3FU7A 3QNFA 5IROD 4PHZA 3RLSA 3TF4A 5C07A 1BVKB 5KS9F 3C5ZB 3OMNB 1P1ZB 2BSCA 1AGDA 4NP4L 1K85A 2VR7A 4EJ1C 3EOBB 4FG4A 1K2DA 4XNMB 5DZVA 4JG9A 4H0LC 4XP9L 4BUQA 1E28B 2QZQA 1FCCA 4NX0A 5DJ2A 5D7JB 4PJHA 5MEQA 1HHJB 4LCCC 1WD8A 3KZ8A 5CCJA 2CG9X 2ZOLA 1U0QA 3D1MC 3MJWA 4OJEH 1EXUA 1GGIH 5GSRA 3WSQH 2JH2A 3Q1SH 1KGWA 3TFKD 5IFJB 4J2QA 3GMRB 4JUSA 5E1IA 3BEVA 4O02L 3CSYA 4PJFA 4W9HC 4HU8A 5IFHL 4RA0C 4RDQG 3UAFA 4FXGB 2G3ZA 4K5OA 3JTTA 2NY4C 1JUFB 2WXMA 3HUJB 3HPJA 4X7TB 4ELKA 5AW3B 3QXDA 4GSXA 3VSTA 4JY6A 4M5ZH 2EDTA 5BV7C 4NXKA 3MRKA 5IMKB 1AIFB 3KXFA 4NNPL 4M5YL 3FQTB 4Y2DA 2X9XA 1WRFA 2LABA 2C9UA 3QXAB 3K3QA 4Z7IA 4R2GD 3O3DB 4QHLA 3GRBA 4DAGL 1HCZA 2ZE0A 3UGEA 3JV0A 4W9KC 2H7WA 4TSCH 3VGHA 1T66C 2AJVL 4MNGA 4Q2ZA 2EEAA 1XEDA 4CKQA 2UV3A 5L88L 1QWHA 4OU3A 1PG7W 2EZ0D 4UIKH 1EMTH 5EIQA 2I25N 3M17A 5E6ZA 5F0PB 4U7KA 4ORGB 2A6IA 3LIZL 4WGKA 2F7IA 2KYIA 2UVFA 3T2LA 4ATTA 4DKDC 3D08A 1I3RA 3MROA 3QEGL 4X4ZA 2XG5A 4AEHH 4LKCA 3HAEH 3T6QC 1EFQA 2XVKA 4YL9A 1I31A 1IM3D 4JUTA 2I5YL 5B38A 1MWAH 3L48A 3ZR6A 3BE1L 4ZOBA 4G71B 4K7FA 1P0SE 1OCWH 3RGHA 3T2QA 5IKCA 3RL2B 4JPIA 1TJGL 3QUYA 1U30A 4UOW1 4NPJA 1C08B 4KTDL 3GRWL 1ZV9A 3H2WA 4XN7A 4JDVA 3G6JA 2J3SA 3CV5A 3M6DA 2IANA 3SQOL 5HHPA 5CD3B 2QGBA 5MEOA 5I8EA 3K81A 1OSPL 2EACA 1THCA 2LFEA 1JHTA 4HJIA 4XNQB 3VA2C 3O3BA 4KUZL 1B0GA 4LSTL 4MDIA 1U92A 3MLPA 3FO9B 3B8YA 3UJTH 1GW0A 5B1JA 2BJMH 4AJYV 4BSVA 1HHGA 5IB3B 1INDL 1NCOA 5EUOA 1DBJH 3GTTA 4AZ8B 4LBEA 4P2OD 2EC9U 2DQCL 5FDYA 3QJHA 2VAAB 1E4XI 2G5RA 1WFOA 4ABVA 1PJ9A 3QE5A 4JHBA 4M7KH 4B50A 5CS7A 3IWUA 4DPCX 1BWWA 1S46A 5HVWA 5GS1B 2YEZB 2ZT9C 1XFPA 1N7ML 3WNPA 2UZYA 1GZQA 3LHPL 4HG4J 4GKZA 4GSDH 4CSSA 4FLOA 5AZ2L 2BINA 5BS0A 2H26B 2VXUH 4Z7OB 1ODAA 1ORSB 1WS7A 2FIKB 3MRQA 1E40A 4B9KC 4HVBA 5D1ZB 2ZSWB 4BFGA 2IAMB 1QX1A 2XQ0A 5I0WA 4YBQD 4OQTA 1UD6A 3KM2A 1WD9A 2KZWA 1X5KA 1CE6A 1G5AA 3C8DA 2F0CA 3O6LL 4MB4A 2Z31B 3M1CA 3EGDA 1ZS8B 4RWHA 2EO1A 4H88L 4M5SA 3NN8A 3PL6A 3K5RA 2HX7A 3GZPA 1T4KA 4D0DA 1BIIB 2XXMB 3NIGE 3H7BB 1QEWA 2WQUA 4I85A 4N8VG 4OLYL 4P3CH 1T6VN 5EU5A 5IF0A 1A9EB 3ASNB 2PP8A 3MRLA 4Q9BA 1MCEA 2A83B 1UOWA 1EEZA 1GIGL 3WO4C 3FUJA 5F96H 4HJ0C 3ZE0E 3PQYD 4FQIH 2FX9L 4N2AA 2PCPA 4Z0BL 4WKZB 5T33H 1NBYB 4PCKA 3LEYL 4PJ7A 1RJZA 1NGWB 1IAKA 4XNYL 2ICEB 3EO1A 3LRHA 3WHE0 5A7EA 1PY0A 4FKEA 1YEFH 4U6VH 5F0MB 3ARGB 2BVTA 3TO4C 4QJ5B 3X3GL 2OAAA 4G8GD 4HWNA 4W81A 2EDWA 2GJ6D 2JCCF 4DF9A 2LOEA 2E7LC 2E8YA 4YDNA 4XOAA 2LW3A 5IG7A 3BGAA 4LEOB 1OAXL 3GDCA 1JNLH 3HG0A 4H13C 4UOQA 5HGBB 5EZJB 5EU7E 1KXQE 4Y19E 3FBKA 4P2OC 2EYTB 4APXB 4F37K 4YXLL 3LRKA 1OQOA 4G8GE 5CD3A 3BZFB 2Z92A 2IANB 4TSAH 2W1NA 5F7WC 3FTGA 1CS6A 3O0RH 3FTZA 5CU5A 3I75A 3D3VB 1XR8B 2EXSA 1EAJA 1PYWB 3NEXA 1I4FB 3PNRB 4R96B 4ZFZA 3G08B 1K4DA 4UQEA 4D0CA 2CIKB 4NQDE 2DM3A 3ZTJH 4EN3A 4N2NA 5EH1A 2AEOA 1NUGA 4P5MA 4L37B 3LPPA 3SDYL 2HT2C 3SDDB 5LN8A 1T0OA 3BPNC 4QRRA 1AKJD 1WCBB 1CBVL 3ECVA 5ACZA 2W07A 5IT2L 1Z5LB 3VD9A 1IE4A 3RGVC 3VA6A 4HETA 1CD9B 1QSEE 1AVAA 2VH5H 3BFQG 4N90D 1XBRA 5DUMH 2YGNA 1T5KA 3L45A 1HEJC 1ZTMA 3VJ6A 4EIGB 1NZRA 3HNTH 2XFGB 2LU4A 4JO2L 4MB1A 4IGBB 5DUJA 4PJCA 3D9AL 2G75A 4HS3A 5AVYB 3SEPA 5BO0D 1IEHA 2VLKD 3UGUA 4IIQB 4NKOA 2C3XA 3ARDA 5AAMA 1UT2A 3VXRD 2CLZA 5FKAA 4WDIB 2OMBA 4WNSA 3VNZA 3IU4L 4G80B 4HLZH 1EAOA 3EBGA 4PD4J 5AW0B 5LO7A 3RWIA 1ZGLB 2O5NA 3ARWA 4PJXF 3I3BA 4ZMNA 4K3JL 5F1KC 1FZMA 3KS0J 3FCTB 1IT9L 2EDFA 2LAAA 3DTXB 1JK8B 3Q01A 1YJDC 1E4KC 5DZLA 3QG6A 3ABLB 2KKQA 4F2FA 3ALXA 4TMPA 2FBRA 1CLYH 4LFHD 3VG0H 4N85A 4ODWB 5AW6B 4Z8FL 3GSQB 3RWCB 5JIDA 2DQIL 5HYJE 3QIBB 5CLWA 1Z9NA 3L9EA 5LGHH 4NERA 1PCXA 3DVNA 4GBXD 2NDGA 3VXSE 1IKNC 1BX2B 4NO5B 4PLNC 5E8PA 5T3XH 3WUWB 4ZMTA 4HSQA 2BM3A 4FQXA 2ZAHA 4V1DA 3HG5A 1WBXA 3S3DB 1G9HA 1TEGA 1VPOL 5D7LD 4GRWB 1HZHH 3IRPX 3X1EA 1GTFA 4KUZH 1KC5H 4TL4A 1KELL 2DJMA 3TX4A 3LXCA 4HJGB 4Y9BA 4DP7X 1VEOA 4IDLA 4PBXA 4Y19D 4L37A 5IVXB 3HMWH 3FT2B 3DDGA 5KAQF 5HHVL 3WTYA 3RYMA 2DQUL 1D6EA 4MNHB 3DMMA 1L0XA 3QEHA 4RFNB 3FT1A 1DQKA 2PYEE 4EQ2A 3QISA 3T2NH 1KN2H 3LD8B 3MV9B 3UZEA 1Z32X 2JI2A 4CRPA 4WTXA 1Y0LB 4P23A 3WY3A 4OGZA 4XO3A 4UV7H 2AVFA 2J72A 3SYQA 5ACZB 4UV4L 4XXDA 1CDIA 4PJXB 3MRNA 4HEME 3VXUA 5EEVA 1BEYH 1SUJA 4FFZL 3BUDA 4XPTH 1O7SA 1CDGA 2HT4C 3LS5L 4A7SA 3BUBA 3NZSA 3P3SA 1WS8A 2X70A 4XCFL 3KLDA 4Q0XL 5D6CB 4OTXH 4FQLH 3KLQA 4KKAD 4KAQH 1OW0C 4QOKD 3CVIL 5CZXD 3ZKND 5GZOA 5KVMC 2J1XA 1LNUA 4TNEA 3KAAA 1RVFH 2EYTA 2DTSA 5MP6H 1E9OA 3GBML 4XP6H 1HINL 4WJG3 1F11A 4NFBA 1XIWA 3GM8A 4AGPA 2XXGA 4Z3TA 4X6DB 4P46A 2ENQA 2VH5L 2Y2TA 3MACL 1EEZB 4QIRA 4MJ5A 5DUML 4JPKL 5IW3A 1FE8L 4FQHB 5DK2A 3B3IB 3HKFA 2FK9A 1A7QL 3O81A 3TWYA 5E4AA 4M8VA 5ICXB 4IJTA 2WWOA 2ICEA 3T4AC 4EI0A 3HE6D 3I9IA 1E0OB 5ESQB 1NINA 3FMGL 4AL8C 5KSVB 5MHSD 1MRDH 1U3YA 4Y4FB 3CHRA 1F41A 3OM3B 2YKLH 4JHWL 5DO2D 5K9OB 4M03A 4KOCA 5CFHA 1B6DA 1K4CA 3FT3B 3S96B 4BK8A 2A9ML 3W1ZA 1T7WA 2AXWA 3QDGA 12E8H 1MVFA 1MPAH 1U3HA 4GQRA 2CIIB 5CIPB 5EORH 2FEDD 3WV0A 1W80A 3MV01 4OD1H 2IPTH 2KZKA 2VIRB 1MIEL 5SWZE 3KWUA 1EBPA 2BNRA 1RZKC 3EYVB 4KX9A 1DVYA 1GZPA 2RB8A 1M4KA 4Y4HC 1EGJA 1A7OL 4M7LT 3EOYG 2WJ5A 1TNMA 1HQ4A 2EINB 5IQOA 2IFFL 1MCJA 3BZEA 4NNYA 1HIMH 5HI5D 1U8CA 3HN3A 5F7AA 1U4EA 4F91B 1FNSH 3LTVA 4OCWH 1MFVA 2H26A 4GAGL 1YYLL 1KG0A 1NWPA 1P7KB 2BZ7A 4O4YL 4NM8H 2F74A 3CFQA 3O3EA 4MVBD 1JYWA 1GYVA 1HC1A 3QDJD 2A74A 3FRUA 1GIGH 4CMMA 3IMWA 3H9SB 4U1HA 3V4PA 4O5LL 3OKMA 1AGEB 3GB7A 3PHQB 4TLUA 3CX5J 4X9BA 3SO3C 2P48B 5H8DA 1CFVH 3UTZA 5HGHB 5L8KB 3DARA 2GJZA 3DROA 3QS3A 2YRLA 4QRFA 2CJ3A 5K59E 5MEOB 2X09A 3AACA 4O02B 2VXQH 4GRMB 1YMME 1J1OH 3I2CH 3QB7C 4A6YH 4ZMXA 1TQSA 3FQXB 3SCMB 3OGOE 2QADC 1SVCP 4U1KA 3DYOA 3FKUS 4NM4L 4PHXA 1OF2B 1XBDA 4YE4H 2VDQL 2A4EA 2BIMA 2YD3A 2QVIA 3L9RA 3MJ7B 2PCFB 4L8SA 3OWEA 2OJZL 3W57A 2XVLA 2EVIA 1M2VA 3DJ9A 1DVTA 4WWID 2ZD0A 4G1MA 5K1VA 3L13A 2X28A 1I3RB 1I1FA 3ESVF 3S35L 2GIYA 3H9HA 4GG6A 3UG5A 4W9LC 2NY6D 1CE1L 3W2DH 5C0CB 4E41D 1MFMA 3MOBH 3TZVB 4HX1B 3WAKA 2XHNA 4GAAA 3UJJL 2WUCH 3CSTA 2VDPL 1C5CH 4XC3L 1E4XH 2DQFA 2OMZB 3HC0A 4XCFH 5E4OA 1GW6A 4GKLA 3RX7A 3SDYH 4OCLC 3RY4A 2DQCH 1JFHA 2ICWA 2CSPA 3QI9A 3W9DA 2O61A 5HDRA 3THML 1LO5A 3PDOA 5EBGA 2Y7OA 5C0FB 5B4MC 3RZCB 1HSBA 1BVLA 1XL6A 1SBSH 3RKPA 1OD9A 2FGWH 3QH3B 4ZPVA 2ICES 4ZZKA 1FZKA 2EIDA 5D70H 3O41B 5DO8A 5DJ0B 2XZQH 3KPQA 3QXDB 4XVOA 4X5PA 5AYQA 2J20A 4W6YB 2GFBA 1E67A 1R3LB 4WY7L 3CZUB 3F83A 1OAZH 4GAYB 2XETA 2VDKL 2BHZA 5PCYA 1PFOA 3FB5B 4HWZB 3OKDB 3O4LE 4UANA 2PPFA 4HXAH 4KXAA 4QHMA 3WIFA 3EYQC 5L4MA 3FQTA 3NEOA 1U8LB 4K2UL 3SODB 4I77H 5IBUB 3VI4F 3CZJA 1TLMA 1E4HA 4JM2B 3UO1H 3S3BB 3VFNB 1E28A 3O4LB 4R26H 1CT8B 3MSPA 4F8OA 2B3RA 2QPEB 3BLPX 3GTVA 3I02B 4H7VA 1MFCH 3IXTB 4NZ8A 3JTTB 4IHBA 5ID0A 5DZOA 5FKPB 2XWTA 4RMWA 3SDAD 2I9LA 3VQ1C 4NQCB 4QRBA 4ZS6C 2VQ1B 2EDEA 4QOKB 5GIRB 3IDGB 3KH4A 1SGKA 3KPPB 1FFRA 3HI6L 5HHOD 4FTDA 4PP1D 3HI1B 5G55A 3VXPA 2P47B 3IMRA 1SDAB 2B39A 1SMAA 5I30H 1I8MB 2JJSC 3DNKA 4YDJB 2D7TL 4LPXA 2C9VA 3S0PA 3G6DL 1WT5C 1VFUA 3NGBB 3D4CA 5EZOH 4HJ1A 1P1ZA 1Q38A 4U6VL 3OHXA 4JM2F 1SXSA 5L2KA 2VZVA 2EC8A 3AY2A 3ZT6A 2E7BA 4Z7NF 4JQIL 3QPXL 2OMWB 3D2TA 2VTFA 4HT1L 3LRLA 1QTSA 1EHKB 5F1SA 4XMKH 3FUKA 5CZXC 4LASL 3BSZA 3GLEA 5FHBL 5C0DA 1BAFH 1SBBA 1N0LB 2WY3B 3CFUA 4HUWA 3SPGA 3RPKA 5CCKH 3NIGF 1U8PB 2XA3A 1W2KT 2K3TA 5I28A 1T03L 1LMIA 1C7SA 2Z65C 2YGPA 4LF3B 3S9DB 5DD5L 2PWGA 4HK0B 4NQCE 4WHCA 1JK9A 2YD5A 2DQFB 2G5BA 3HC0B 4NXSA 1T5XA 4AIZA 4XAWL 3ETBF 2K0RA 1SN0A 2CO4A 2JLPA 3VFNA 1WIOA 4HX1A 4L5FH 2NT1A 3N41B 2WD0A 2DLFH 1U8LA 3AWFA 3BAEL 2PYFB 4RFEA 1HCYA 4OZIF 2P7TA 1LEGB 1TSRA 3BD4A 1IGIH 4O58H 2WXLA 1ZT1A 3CFMA 5HGDA 3RP1A 5JW4Q 2NZ9D 4E0RA 1F3RB 1F4XL 2XV3A 1P9MA 4Q9RH 1FL5B 1RUAH 1QAWA 4JFPA 1IM3A 4WUUE 4WFHE 5B39B 1GGCL 3G5VB 1ZE3C 3Q0HA 3QCTH 2K9FB 1PVHA 4RBPK 5DJ0A 2FL5B 3NTCH 4JGUA 3MX0A 2V2WA 5F7KC 1XH1A 4U1KB 3W39B 3GXMA 1CLCA 3OHXC 1M71B 5HJDA 2HUHA 1H6EA 3FU3A 4AE1A 1HI6A 1NH6A 3MBED 1YECL 1CXFA 5EZIL 3RHWK 3QIWA 5DYOB 5K9QI 4ZUVB 3E1ZA 3EBIA 1ZVHA 2ZWSA 1NEUA 1KJ2A 2X2UA 1SBSL 2B14A 3MNVA 3GHEL 3PL6C 4H0HB 2D2CC 4M1CC 5H4YA 2AS5M 2WQSA 4HWBH 3P2BA 4HPHA 3H9HB 4ELMF 2AABH 4GG6B 2QL1A 3QCVL 5LWYH 1PKQA 4WTWA 4F33A 3BKYH 1GCYA 5D4JA 1U8MA 1MY5A 2ZG2A 4LGPB 1F3DH 3SBWC 4YBLC 4GXFA 4XNBA 4IGBD 2Y1ZA 5D8JH 1MWOA 2HKHL 5E9DE 2GY7B 1NFIB 4JMNA 3QDJE 3ZKNC 4RX4D 4HLJA 3SKNB 4PJDB 3BP5A 3FN9A 5GPRA 2D03L 5ID1A 1P5UA 4KITB 1N19A 4RMVA 4YO0A 1T1ZB 4HGKC 2QPDB 3PQYA 4I18C 3MNMA 1P69B 3T6VA 1F4WH 4P59L 3ESUF 4XE5B 4LCIL 5CCHE 1WBYA 3AZUA 4X8JB 5DC4B 1DN2A 2A38A 4MASA 4ZDHB 2ARWA 1II4E 1CD0A 1FL6A 1KDJA 2X4OA 1J1XL 4K8RL 4JEGB 2CIIA 5E8DH 3RVTC 1BWMA 3JUYA 2PP7A 4WSKA 3GB7B 3P4NB 1XCWA 4PJ5E 3FTXA 4U1HB 4BM7A 4Z77B 3FRPA 4H40A 4K3HA 2AV1B 3WN5A 2H45A 1RJLA 1Q0XL 4NN5C 4DPAX 3DHUA 3SGKA 4Z0XB 3G5ZA 4PJAE 2CKNA 2F58H 3AU1A 5D6DC 1MREH 3U6RA 5JXAL 1G6VK 1QR4A 1X5AA 2EEXA 3UJJH 5J3HD 1ZVYA 2LAGB 3NCEB 2C9SA 2P5WE 4HOMA 4MJ5B 4M93B 4OCRL 1UYWL 4G1EA 4PJ8B 4K55A 2COVD 4U1GB 5DC0A 4NQXB 1T6BX 1G7IA 2XQBH 4UV4H 2XV6B 1U8MB 2XXCB 1BOGB 2WO4A 4U4IA 3WTUA 5DDHB 3HA0A 4CKVX 4JQXC 1U3HB 4PRPB 4DP5X 4AM0B 4YHKH 1VCAA 2P44B 4KOBA 1WEJL 4L29B 4FA7B 4HISA 4LGRB 1EJ8A 1ZSHA 4GXUN 4G8EB 1XEUA 1QA9A 2ZX8A 1J11A 2XTJD 1WUNT 4JY5H 1XIWD 4ZUVA 4OCNC 1FGVL 2XPYA 4PB9L 4LIQH 2JV6A 3H42L 3X13A 1J1PH 2WO3B 4ZMAT 2K4WA 4XB7A 2CO1A 4MD5B 2O5XL 2OK0H 3GHBH 3P1VA 3EIFA 5DLML 2W9EL 1KJVB 3C2SA 4OJAA 3FAWA 3QWOB 2G2PA 2ZX9A 3K2UL 3OKNB 3VXRA 5AB0A 4HFUH 2VM3A 4KKBD 4WF7A 4LIQE 2Y23A 1LDPL 5CUSL 1H15A 4GSQA 4P06A 3CVHH 1ZLVK 1MJ7L 2VDPB 5GZOD 4HIXH 1P4IL 1UM5H 2XN9B 5LBSA 5D5MA 3UYOD 4N8VA 5IVXF 1KCWA 1LEGA 1A7PH 1MHPL 4K5PA 3U9WA 3DECA 2WOBA 1P5UC 2YEVB 4KZEH 1JI2A 2Q7NA 4LHUD 5D96B 2X9YA 1YQVH 2YAOA 1ZT7B 2QHLA 5I17A 2XZQL 1S5IH 4DIXA 1EO5A 1OLZA 3L3DA 1E9PA 5T1MA 3GSWB 2CKBH 1YY9C 2AJSH 4OZHA 1EWHA 1ZHNB 1S9KC 1T7VA 1TFHA 3VRIB 1UEYA 1AHMA 3FSZA 4MXVE 1F6AA 1YDPA 1AKJA 2EDMA 5KVFE 4Z78B 4U3HA 1B2YA 2D7QA 4UILH 3N43B 1FIEA 1JXJA 1Z9OA 3VFPB 3MV9A 4Y4HA 1UADC 3T71A 2MTAA 1SXAA 1TO4A 2FBJH 5E6YA 4UINH 2WWKO 4MNHA 1BQLH 1URIA 3DJTA 3BLKA 3C09C 3RUGB 3F12A 1CK0H 1ZIAA 4ZX4A 2MEJB 1JD7A 4UAHA 4QRRE 2BS9A 2HLAB 2XN9E 4G5ZL 4HFWB 5EOQH 4HH9A 4U1JB 1CFSA 5T5NF 4J1UA 3SPVA 4PJEB 5L2JB 1PLGL 5JQIB 4Y16D 4YX2H 4WUKH 7FABL 1J10A 5TQ0H 3D05A 2A1WH 2V17L 3WUWA 3VXNA 4UNVA 1N5YL 4S2SA 3B2XA 4QTHA 5LVEA 3B9EA 3EBHA 2VL5A 4U2ZA 4NJAL 4GQPH 3RQ3A 2XX0A 4U6TA 1LQBC 1T1WA 2VERA 4AUJA 3BZ5A 4ZAKD 3SD2A 4R3SB 2MJWA 4LPTA 2Z0UA 3QIUB 4N22A 2DQHL 4WFFD 1QFUH 1ZDSA 2WQWA 3MZGB 4GAFB 1FFNB 4N2KA 4PJIB 4C59B 3C2AL 1I1AC 5GZOC 3SGJA 4AQEB 4LE8A 3O45A 3OKDA 4QY8A 3FJTA 5C07D 3QQ3B 5J12C 4Y4KC 1L0QA 3QZWA 4TNVK 1FZJB 4IRJA 1AQDB 3G6DH 2AW2A 4K7PL 4I88A 3HS0A 1BZ9B 4POZC 2HH0H 3H85A 4JRFA 4PJHF 3G9AB 3L4TA 2LQRA 3DV6A 2QSCH 4BINA 4RZCA 2Z8RA 2YJLA 3BXNA 1PG7L 2WQ8A 3FXIC 1YEJH 3SE3A 4I4WA 4X6CA 1X3DA 1E90A 3L3IB 4JLRB 3FOLA 5SX4I 4MDJB 4XPBH 1AFVL 1BG1A 3O4OB 3LV3A 2KPWA 2BPBA 3C60C 3FTUA 5JXED 1G7PA 3ZDZB 3F65A 4I3RL 1FNGA 2VXVH 2X6AA 1BQKA 3TBCA 4YFLI 3PE9A 4QRRD 3MRRA 4L5FE 1UT1A 2VYRE 2HLEB 1UXWA 1N3NA 1CTMA 3CN1A 2FE0A 4GUCA 4P4KD 4XP4H 2XA8H 4X7SH 4PR5B 5TTRA 2YK1H 3LIZA 3S7GA 3D9AH 3MJ7A 4Y2LA 2XTLA 1NPNA 2VN3A 2H1XA 1V05A 3A3YB 5DJ8B 2Z8VC 3ISRA 1O0VA 3UADA 2ZP8A 3U4KA 3WY1A 4XNYH 4UUJA 3GNML 5ES4B 5B1CA 3TGXA 4L8SC 2OMTB 3WO3B 1I7RB 4HHAB 1XR8A 4YBLB 1NAKH 1A4JA 2GBVA 4RZKA 3BISA 1LM8V 4NZFA 5G4OA 3SJVD 3H7BA 5MHSE 5DZPA 1KB9K 1DCLA 2WXIA 1EJ6A 1S4IA 3IGFA 2E27H 1REIA 4HJTA 4UM9D 4BE6A 4MJ2A 2R0LL 2YMOA 4KMTL 5I1CL 4NKMA 5AQ0A 2WBJD 5DHYA 5IG7B 1JHKL 3BVVA 4NNPH 4AQZA 1I1RA 2AXFA 3UEZA 1I85C 3B1UA 4PSPA 1A6ZB 2C3WA 3AT8A 3KPRD 1MN4A 1EZVX 4NJ9H 5F7YC 4P59H 5I1EL 5AVQB 2J25A 2Z64C 1SXNA 1O6TA 3O9WC 3QDMB 3L5JA 3L17A 4KKZA 2MFNA 3V5HA 5L8JB 1UA7A 5LWYL 2OS7A 3HZVB 3PGFH 1FV1A 3HI5H 3MUGB 5GGSA 5D8JL 3BPOC 5EU7C 3TH3T 3FZUD 1HE8A 1EEQA 4OKVB 2VAAA 4ODSH 3W9EA 1KIUB 3R06A 1CTNA 1PZSA 4Z7WA 1BGXH 3ATEA 4XTRC 5I5RA 3P73A 2WAHA 1X44A 1YEFL 3QDGB 4JMXA 4CSPA 4OAWB 4N0UB 1HHGB 4PP1C 3FO9A 1RK0A 2YIHA 1VADA 5A3IC 4WEBL 2DQHH 1NIEA 2AXHA 5DJ8A 5IQLA 3RGVD 3HHSB 3KCWA 2J7LA 3MXWL 3IM1A 3ECBA 5BUPA 3DRTB 2EDKA 1AQKL 43C9A 1DDTA 3DBXA 4PV1C 3IU4H 4NQEE 4FEMA 2NY3B 4FI6A 4F9LA 4ONHA 2SEBB 5FYKE 4JFQA 3WIAA 3MLXH 4JDEB 2ENYA 5FXCH 1LP9B 4QRUA 3DX6A 3GBNL 3DWTA 4U3SB 3ZLQC 3C75A 4K15A 3DX0A 2P8PB 2O5YL 2R2EB 1J48A 1KYDA 3IDIA 5JR1H 1JN6B 4XMXA 1KBWA 2VO8A 2DM2A 3F58L 5HDBF 4JRYE 3BVTA 4J3TA 2GTZB 4NBYB 4CGTA 4U6HA 5HI4D 2JIXB 1P53A 3KWXA 3O6MH 5IB3A 5C09E 1OK0A 1NCGA 2LU3A 3LSOA 4RX4A 3V52H 1QBLL 5GISL 2HKFL 4TSBL 2EVGA 4RFOL 2JJTA 2EE6A 2KLRA 2EH7L 3HE6B 2ZUSA 3X1BA 2PWDA 3DJZA 3D0LA 1U8NA 4W9GC 1D5ZA 2ADFH 1TR7A 4B6ZA 4X5XB 4MMXA 2Y0SA 2X1WL 2PYFA 2V3EA 3MKKA 1E5BA 4RFEB 1DJWA 1IGML 5JW4N 3QUYB 2OYMA 4WFGE 2QQKL 1DQMH 4A38A 4JY6B 2GHZA 2VZUA 4B95C 4JJHA 2MHAA 3O8XB 4L8DA 4Z7AA 1D6VL 4MJIE 2E7DA 4FMFA 1ZLUH 5E0QA 5I1IH 2YEQA 5I19L 5B3JF 5DLLA 3MLRL 5FO9B 2YXMA 3EH3B 3PAUA 2MQGA 3NFPB 1T04B 3HZMA 1H19A 5FGBA 3HNVL 3VXNB 4ODUA 2I32A 1GCFA 1P5VB 1ASPA 4Y1AD 5AOLA 2CZNA 2ALAA 2BOBA 1Z66A 3GMLB 1ED3A 4PS3A 2Y3NA 3TEUA 2MSPA 2WNXA 2CM6A 1GAFL 3ENEA 1PX8A 1UFUA 1J8HA 3DIFB 4MA1B 3HC4L 3QC6X 2QZ5A 4PJAF 4AIXA 1W8OA 2HJLB 3U7AA 2V3FA 2E75C 1IGYA 3KHQA 1ILUA 4PJGA 2AEWA 2FDBP 4AL8H 2M1KA 3PDDA 5ACMA 1SVZA 4RGMC 3RPIA 1JYNA 1KYOK 2CJSA 3OKLA 1TQUA 2OCJA 4Q52A 4XAKD 4FADA 4HS8H 4N2LA 1IJ9A 4Y1SA 5D9SA 3HI1A 1BFSA 5LBSH 2NX5D 5GRUL 2Y1YA 3RWIB 4XMLL 5GSRB 5IFJA 1PZAA 3G04B 5I8KH 3IFNL 1CFNA 2Q3ZA 3CFBB 1PLCA 4FQ1H 1P4BH 5IVNA 5EEUA 4KPHH 4FQ2H 3VXSD 5BRZA 2YD0A 1M9SA 5KVEH 4Y16B 3WBDA 3WEXB 4LVHC 3WNLA 2P26A 1M6OA 3RTQD 1XF2A 3MV8A 3EJYC 1YEGH 5CSGA 2PWHA 2EC9T 2HFEA 4JFDE 1CVRA 4TTDD 3KVPA 3OXSB 5E94A 3LVEA 4JZJA 4L1LA 2CO6B 2FQFA 3F6IA 4WGVB 2HJKA 2OSLA 5I26A 1IE5A 1TT6A 3CMGA 1KB5L 3OGCA 4LSDA 4BD4A 3ZTEA 1LTXA 4WNJA 2QMKA 4DK5A 4MFHA 5DA0B 3KS0H 2FJGB 1F58L 4HW6A 3GUTB 4HEPA 3ZE1F 1T0MB 1IGCL 4EXPX 3HC3L 4KROC 2BVQB 5JA9A 4YGAB 3FCUB 5L2KE 4M6NL 4XCNA 2MKWA 1AY1H 1RVFL 2UXTA 4KNSA 5K9JL 2DH3A 3BGFC 4JFZL 5LBVA 4QXGH 4P46D 3CHPA 3ZZLA 4OKDA 3TZVA 4FFYL 3J07A 3NCJL 3I75B 4ERSH 1ETZA 2OJEA 1QWNA 3MNDA 5GRVL 2YAQA 5BS0E 4PIRF 4N0YH 4AH2A 1OO2A 3FFCB 2HRHA 4JQXA 2YFNA 2VLRD 4TNFA 1DN0A 3ZQXA 5I6NA 1MFEH 4TNWK 3AU0A 3IVKB 2XN9D 5KVGH 3ZHKA 2YK1L 4JGMA 1EGJH 4G1EB 4PJ8A 5D2NB 2BSTB 2FBJL 4R7DB 3PNWA 2C4FT 5KYWB 3LZLA 4NRYA 2EZ0C 1TZIA 2VW4A 1Q72H 3KJ6H 4Z7UA 2DD8L 3HMXL 4CMHC 3LH2H 1TVDA 2B1OA 3M1OA 4KK6C 4GIPD 1UC6A 5F0LB 4MWFA 5T3XE 3BQUD 4GRMA 1BF2A 4WHYG 2F9BT 3ABMB 1UXLA 2J71A 4I3RH 3VI3A 4EDXA 2VMEA 5LGJB 1OTSC 3PLYA 5DMIH 4HAGA 2ZOKA 5E56A 3ZTNH 4GKSA 1DVQA 3CJJA 3WLBB 3KPOB 4MD4B 4WFGD 3WFCL 1S7TB 4MQSB 4QHUA 1QLFB 2HFGH 1A14L 4RAVA 4I1PA 4GG6F 3FQUA 4PV8B 3QS2A 3FU5A 1L4IA 4FTVE 2IAAC 3GIZH 2O5ZH 4FMVA 4YHPA 1L7IH 3WCYA 5GS2H 2BRRH 5E8OB 3TM6A 1WH0A 1Z9LA 1BLNA 4BGLA 3LKQA 1FWXA 1JV5B 1UH4A 4GW5B 5JLZA 4GAGH 1YEIH 2CHXA 1AZBA 4YO0B 4APQD 4WO4B 3ULVD 1KJ2H 3PABA 4LAJH 2IIJA 2YBRB 5DFWH 3MZTA 2WLHA 3MRCA 1JTTA 1OP4A 4HBQA 4A2LA 5GQBA 3JZYA 3D12B 1WFIA 4MQXC 3K0WA 1JHKH 3KVQA 2I24N 1KJMB 4IS6A 4HJUA 1MCIA 4M29A 5J1AA 4CC4C 5JHBA 4KZ0A 2UZYB 1VESA 2ZWNA 5EEZA 2EH7H 2PYED 4L05A 2WANA 4M1CD 3P0VH 3FU6A 5AD0A 1ZA6A 2D9QB 2RHEA 2BP8B 3UABA 1FG9C 5TF1H 1JF6A 3S5LB 1GC1C 5IESL 1H5BB 1PJWA 4YHMH 2HMIC 4LSSL 4BE5A 5F89A 1YYMH 3BVNA 2FD6H 5TE6L 4NHCH 3D48R 4OIAA 2TSBA 1QHPA 3S36L 3EOTH 4N0FA 1T3FA 2Q3XA 3AS2A 3LKPB 1LD9B 3W11C 3OLEA 5E4EB 3VMOA 1GXEA 2P8MB 1IV8A 4BQ8A 3V5DB 3ELAT 1XSJA 3JWNH 4JDVB 5KS9B 1ZGLP 4ONFL 1B0IA 2Y36L 3CC5A 2BIHA 3GXDA 4GIOA 2AXGB 2FEDC 3NEEA 3U36B 3MOAH 2PXYA 3FCGA 3MXWH 2OR9L 1Q1JH 2ZZUT 5BVPH 2JJUA 4EN2A 4GS7C 3VRLE 4KQ3H 2C1OA 3UAJC 3DSFH 1P84J 1T5XB 2HKFH 2VERN 2N56A 4XCEA 5C7XL 1A7NL 3RDTC 4EQ3A 2DL2A 2FO4B 3OKEA 3ZT7A 5ANHA 4XN8A 3WHXA 3WL9A 5IEHB 3KMDA 1KXQA 4Y19A 3KLAA 1ET7A 1NGPL 2A6IB 3PCYA 3BKYL 3PG2A 4HALA 1NUDA 4MCZA 2WN2A 1KV7A 3HBPA 4TUJA 4BH8A 4M48L 3EG9A 2BY3A 1SLUA 1D5MB 2ZIDA 3F6JA 5J6SA 3P9MB 3IAQA 3MRDB 1T89A 1FO0B 5IW1A 2A0LD 3P30L 4NQSA 4LPCA 4MQXD 4KPHL 4MNGE 3KVDD 3IF1B 4WI6A 3V0AC 1BJMA 3T4YA 4L5FL 5IJCC 3NJLA 5GGTA 4Y2DB 3RB7A 3PGFL 1CYXA 2QV2A 3GUTA 2H3NB 2YMTA 1H3GA 3GMQA 4P3CL 5I6KA 3PHSA 3OGCB 6TAAA 1JAEA 3D0VA 4XI5D 3VWJC 4GPVA 5CSZA 4BK4A 3GJEA 4H8HA 3B56A 3BEVB 2BWQA 1B9ZA 3BPLB 3TV3L 4QTIL 1EXUB 5HHQB 5KVDH 3RWFA 3D2UA 4ZZFA 2N3JA 4PJ9B 3GSQA 3HB3B 2Z9TA 1EJOL 4LCVA 5DVOA 2VKWA 1ZA6B 2NW2A 3IPFA 4JKWA 4X2UA 2QDVA 2V9TA 1MCBA 2DLTA 2OV0A 2H32A 4OZFH 5MEPA 2AQRA 4DQOH 5K9JH 1AS7A 4K5MA 3CHOA 3CZFA 4ZS7L 1A02N 1NLDL 4JKLA 2F19L 4GRWH 4M1DL 1I9JL 4TQIA 4ERSL 3IFPB 3K1KC 1HJBC 5L8LB 1HEZB 1BBDL 2JKWA 4JVUA 3EZ8A 5TGBA 1IVLA 2JCCE 4N0RA 3WFDH 1XCTB 3CIAA 3CZEA 3S2AA 3KH3A 1NDMA 2YPLD 5I71B 2OSXA 4B27A 1OGAD 1R34A 2ICEC 2VZSA 4GG8A 4IRSC 1TVBA 3AG3B 1R5WA 3Q6GL 4NQDB 5FO7B 3S34L 3FTVA 2ZONA 4G6FD 5A2KH 1DBKH 4UTAL 4HCRL 3N5AA 3SDAB 3ULUE 1BREA 4RAVB 3UYRL 3OJMB 5CP7A 1A9VA 2P52A 3NAAL 4F15C 1DFXA 5ISZD 2XTJC 1F4WL 3DETD 4P4RB 4TUKH 1A4CA 2ZOTA 5FHAH 4ANXA 3MGAA 1VHPA 1YCSA 3JYCA 1X7QB 4QRTA 4ES8A 3GO1L 3PWPD 5FO9A 3RY6A 1UB6B 4YUEH 3KPNB 3P4LA 4LP5A 1ZK9A 3NRFA 5KVEE 3QRFM 4H8QA 5KBDA 2XFXB 4JO4H 4EXKA 3SDDA 3ZTCC 1XWVA 5CP3H 1CD1A 3CBJB 3QZPA 5E6UB 3KJ4B 4KV5E 2GG1A 5MENA 2WOYA 4KVCL 1OE1A 1AYRA 1MAMH 4J3UA 3ECQA 4FGMA 4FZ8H 3D3VA 3H0TA 1FG2A 2ZCLL 4KY1L 5DYFA 5BMFH 5FGCE 4OCXL 3AAZA 2VDKB 2Z92B 2C9XA 3ARDD 2XKUA 1CXKA 3QORD 4D8PB 5KYUA 5HD8D 3CPLA 2X3AA 2L0DA 4NCC2 1AGEA 3PHQA 4ISVB 3HFFA 3KM1A 3BH8B 4PJ7E 1UM4L 4GQ9L 4ALAL 4GRWF 4UB0H 2B2XH 2XOTA 4XHJC 4E41B 5C0CD 1N5AA 2QGDA 3O2DA 4QXUH 2R2HB 1IFRA 4WHTB 2XWEA 2UXFA 2CDEB 3MA7A 3P0GB 5TDPB 4J3OF 4H8WL 1J0ZA 2WVTA 4JRLA 3NPSB 1MNNA 3MQIA 3ZE2B 5ADPH 5J8OA 4QMEA 4E9QA 3BRFA 1RJZB 2V9RA 1BLIA 3E80A 3UMNA 5FA3A 1NCIA 1A5FH 4U3SA 5AL0A 2YMXL 4QT5A 1ICTA 3O2VH 1ZTXE 3DO4A 3M8OL 2EDDA 3Q3GB 4IRSD 3MRLB 1KJMA 1J5CA 3OWRA 4NAQA 3MO1A 3S36H 2E7HA 3DX7B 3FL7A 5EOTB 5F7UA 3GMMA 1IFHL 2EDXA 2F08A 3OPZL 3IMTA 5INCB 3I3DA 3RVWC 2J1YA 1U3NA 2DBJA 3V0JA 4IRSB 4NT6A 2D0GA 4TVSa 2IMMA 3ZBMA 5FUZH 3BUIA 5GS0C 1NGXA 4HKBB 2YO3A 2DL9A 4FXLA 4UM8A 1NJ9A 2C8NA 3GI9H 4L9LA 5MERB 5KSVA 2D3NA 4E41E 3NCYS 1JV2B 3AG4B 5ICXA 3D50A 3Q48A 3G5YB 4YHPB 5I0ZA 4EMZA 1ZJBA 1NBZA 2HN7A 5DK3A 2IVFC 5KYXB 4AGOA 4A2EA 4KC3B 3F7VA 3G7TA 5GGQL 1U91A 5I8OL 2PXYD 1DP0A 3BGFB 3CH1B 1CCZA 4B7LA 1C16B 5D5ME 1F11B 2DDQH 2XWDA 3TVMC 3HZKA 4DPRA 3E3QE 2EAEA 2DLIA 4J12A 3KPSA 1VEPA 3TIDA 4EOWL 3K1DA 5I6PA 3QORB 5GGVY 5GRXG 1FJ1A 5KOMC 4QTFA 1FLTX 4IJ3C 2WN3A 5IHWA 4AZ8A 2F53E 2XIBA 1MCNA 2CRZA 2NTSP 2YPVH 5FYKH 3E6HB 3K8KA 5AKSA 5HHNA 3UCQA 4YDIH 3O11A 1QNIA 3ULUC 1BQHG 1N5AB 2YRZA 2MH4A 5FF6B 2PW1B 4NGHH 3VDCA 3FU0A 1EFXD 3LKSA 3CPLB 2V8MA 1CB4A 1SLXA 4NNXB 5HI5C 2FSDA 2PN5A 4R90H 5GGRB 4CW1A 7CGTA 2XWRA 1OCOB 3FFCA 2ATPA 3DV4B 1K5NA 4LCCB 2V33A 1OF0A 2OR7A 4JG1L 2DTMH 4JRXA 3ULUD 3QPQD 1UA3A 2ZUVA 3PWPB 5D71H 4NWTH 4YDLC 2CNZA 2G60H 5DUBA 3MLSL 5JHLL 2YKLL 4JHWH 3K6SA 3KG5A 1Y18B 5DRWB 3STLA 4HS6A 2ZJSH 2OZ4H 2TRYA 3GXUB 1BVZA 3HEIB 3RWGA 1BQRA 4G6FB 2R56H 4EI5C 3GSNH 5DO2C 1CDHA 2BHFA 4P49A 4YR6A 2HJFB 4HEPG 3CBRA 1XGTA 3DOSB 1UACL 3E2HB 4U6HB 1O6SB 3CVDA 3H53A 3E6HA 1FN4B 2VT0A 3HCVA 4GAJH 3FQYA 3CFJB 3VTMA 2EICA 1BSIA 4XVSH 4LOFA 4PU2A 4AIOA 4LL9A 5J1TC 4R4NC 1RI8A 3TBVB 1F8TL 3V10A 2CR6A 4EI5D 4OLEA 4M4RB 1QMUA 4ENZA 3UTTE 1COBA 3NJKA 5DQ9B 4PY7A 4DGYL 4F2EA 5CEZL 4JDEA 5IB2A 1QSFE 4ZX3A 2IPUK 4JY4B 1U8QA 2VZ3A 2PCXA 2ATAA 3VI3F 3VWKA 3LMJL 5ELIA 5IMOB 3VXUE 1OGPA 2CLRA 2DBLH 2Z7WA 4LXFA 4R0LA 3WKNA 3ZXAC 4FXGA 1FNEA 4NI6A 5BO1L 2BOLA 2WINA 4QYAA 5D7LB 5DMKB 5DZAA 4XX1E 1VADB 1MNUH 4LVOB 4QR7A 4IMLB 3QXVA 2MPAH 3ARBC 4CU6A 4KKPA 3LNEA 4FI8A 5CMAA 1I8KA 4P2QA 2HCZX 2HJLA 5KW9L 4G7YL 2YLHA 3KL5A 3N42F 3NMEA 4HC1L 35C8L 3NESA 2O5XH 4Y2DD 1ES0B 5IY5B 2OK0L 2Z7ZA 2CCLA 4XVTH 1IJNA 5K59F 2GK0B 4X9IA 3LQMA 1CI5A 4NENB 1V3JA 4H1LB 1WBZA 4JFDA 4F57H 2ILLA 1ITCA 2AEPL 2EIEA 4YK4C 4ZUWA 5JZ7C 3W37A 2DQEL 1FVEB 1TQWA 2HYMA 4C4KO 3D6GA 1AZRA 1KPUB 4BWUA 2IPTL 5LLIC 2MMXA 2YKKA 1KF9B 3SDXB 3WXVL 2WXHA 2VRAA 5GS1C 4E9TA 4HH9B 3D0AA 3UP6A 3HHMA 5L0QB 2P5PA 4TTDC 1AO7D 2WK2A 4I2XB 4P05A 1RHHA 4XAKE 3NFSL 4JHVA 3ZK0A 4EOWH 4LEBA 1DYZA 1JHLL 2A5UA 3OZ9H 4QXTA 2AI0L 1FDLH 3DO7A 3MRDA 4N1HB 5MP6L 1E6OH 4ODHH 4WI7A 4YDIL 4FABH 3VWKC 3WEAA 1I4FA 3QUML 4ZFZB 2EYRA 2VO5A 1R3KA 3H3PL 4PG