3F6AA

Crystal structure of a hydrolase, nudix family from clostridium perfringens
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
LNRHFTVSVFIVCKDKVLLHLHKKAKKMLPLGGHIEVNELPEEACIREAKEEAGLNVTLYNPIDINLKKSCDLSGEKLLINPIHTILGDVSPNHSHIDFVYYATTTSFETSPEIGESKILKWYSKEDLKNAHNIQENILVMATEALDLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, NUDIX family
publication title Crystal structure of a hydrolase, NUDIX family from Clostridium perfringens
rcsb
source organism Clostridium perfringens atcc 13124
molecule tags Hydrolase
total genus 31
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3f6aA00
4S2VA 2RRKA 1SU2A 4YPHA 5FSLA 5DD4A 3BAPA 3H95A 3O6ZA 2QJTA 4JZUA 5GHMA 1OW2A 3X0NA 5FSIA 3GRNA 1GA7A 2AZWA 3GZ8A 3SONA 3X0MA 3X0SA 2I8TA 1QVJA 3AC9A 2O5WA 2YVPA 3DUPA 3O8SA 4IJXA 1PUQA 4V14A 2JVBA 3ACAA 1JKNA 5GHIA 1F3YA 5FSKA 3I7UA 1SJYA 2YVNA 3QSJA 1HZTA 3N77A 3E57A 1V8NA 1MQWA 1V8UA 2VNQA 3Q1PA 3SHDA 2FKBA 4KG4A 1V8WA 1G9QA 5GHOA 1XSAA 1X84A 3MGMA 1XSCA 3EF5A 3P5TA 5IW4A 1Q33A 2KDVA 1R67A 2YYHA 5HZXA 1V8RA 1U20A 5DPKA 3FFUA 3MDGA 2YVOA 3X0OA 2A8SA 2A6TA 2O1CA 4KYXA 3X0LA 3X0JA 4DYWA 1V8IA 4JZSA 5C8LA 3GZ6A 5BONA 2FMLA 3A6TA 1V8LA 3ID9A 3KVHA 4HFQA 4KG3A 4MPOA 5ANWA 5FSNA 2A8PA 5GHJA 3GZ5A 1VHGA 4YOQA 3R03A 3A6SA 5ISYA 3DKUA 1NQYA 1MQEA 1V8TA 2KDWA 3F13A 2DSDA 1G0SA 2A8RA 4N1UA 3X0PA 4HVYA 2J8QA 4NFXA 1XSBA 1NFZA 1V8VA 2GB5A 4S2YA 3MDIA 2I8UA 3I9XA 2FVVA 3FJYA 1SZ3A 2G74A 3Q93A 3EXQA 2I6KA 4K6EA 2B0VA 1VIQA 3Q91A 1X83A 3X0KA 1PUSA 1VK6A 2B2KA 3FSPA 3FCMA 1VHZA 3FK9A 4C9XA 1KTGA 1VRLA 2DSCA 4ILQA 3EEUA 5DEQA 1IRYA 2DSBA 3O61A 1VIUA 1SOIA 1NFSA 3N9UA 1PPWA 1RYAA 1PVFA 3O69A 5IW5A 2YVMA 3BHOA 4JZTA 5ANVA 1X51A 3MCFA 3P6YA 1VCDA 3G0QA 2ICJA 3GWYA 2PNYA 1RRSA 2A8TA 1MK1A 1Q27A 2DUKA 5C7QA 3A6VA 3Q2TA 1VC8A 1RRQA 3COUA 1PPXA 3HYQA 5C7TA 2G73A 2A8QA 3ZR0A 3ZR1A 4S2XA 3A6UA 1Q54A 4S2WA 1V8SA 3EESA 3OGAA 4ZG0A 1MR2A 1V8MA 2VNPA 1I9AA 3Q4IA 2O5FA 3J7Ye 1PPVA 2R5WA 3WHWA 5ANSA 2GT4A 1KHZA 1PUNA 2Q9PA 1MUTA 5FSOA 2CL3A 2W4EA 5I8UA 3X0RA 2PQVA 3X0IA 3O52A 2QKMB 5FSMA 1VC9A 1JRKA 1HX3A 2QJOA 1MP2A 3BM4A 3U53A 5BS6A 4YPRA 4N1TA 1TUMA 4ICKA 3RH7A 2XSQA 2B06A 3SMDA 1K26A 5CFJA 1NQZA 4KTBA 5GHNA 3L85A 5ANUA 3X0QA 3F6AA 3HHJA 4C9WA 1K2EA 5ANTA 5GHQA 1V8YA 2ICKA 5DDGA 5CFIA 3CNGA 4NFWA 4JZVA 3GG6A 2DHOA 5GHPA 2GT2A 3I7VA 5LPGA 3Q2SA 1KT9A
chains in the Genus database with same CATH superfamily
4S2VA 2RRKA 1SU2A 4YPHA 5FSLA 5DD4A 3BAPA 3H95A 3O6ZA 2QJTA 4JZUA 5GHMA 1OW2A 3X0NA 5FSIA 3GRNA 1GA7A 2AZWA 3GZ8A 3SONA 3X0MA 3X0SA 2I8TA 1QVJA 3AC9A 2O5WA 2YVPA 3DUPA 3O8SA 4IJXA 1PUQA 4V14A 2JVBA 3ACAA 1JKNA 5GHIA 4J7HA 1F3YA 5FSKA 3I7UA 1SJYA 2YVNA 3QSJA 1HZTA 3N77A 3E57A 1V8NA 1MQWA 1V8UA 2VNQA 3Q1PA 3SHDA 2FKBA 4KG4A 1V8WA 1G9QA 5GHOA 1XSAA 1X84A 3MGMA 1XSCA 3EF5A 3P5TA 5IW4A 1Q33A 2KDVA 1R67A 2YYHA 5HZXA 1V8RA 1U20A 5DPKA 3FFUA 3MDGA 2YVOA 3X0OA 2A8SA 2A6TA 2O1CA 4KYXA 3X0LA 3X0JA 4DYWA 1V8IA 4JZSA 5C8LA 3GZ6A 5BONA 2FMLA 3A6TA 1V8LA 3ID9A 3KVHA 4HFQA 4KG3A 4MPOA 5ANWA 5FSNA 2A8PA 5GHJA 3GZ5A 1VHGA 4YOQA 3R03A 3A6SA 5ISYA 3DKUA 1NQYA 1MQEA 1V8TA 2KDWA 3F13A 2DSDA 1G0SA 2A8RA 4N1UA 3X0PA 4HVYA 2J8QA 4NFXA 1XSBA 1NFZA 1V8VA 2GB5A 4S2YA 3MDIA 2I8UA 3I9XA 2FVVA 3FJYA 1SZ3A 2G74A 3Q93A 3EXQA 2I6KA 4K6EA 2B0VA 1VIQA 3Q91A 1X83A 3X0KA 1PUSA 1VK6A 2B2KA 3FSPA 3FCMA 1VHZA 3FK9A 4C9XA 1KTGA 1VRLA 2CZRA 2DSCA 4ILQA 3EEUA 5DEQA 1IRYA 2DSBA 3O61A 1VIUA 1SOIA 1NFSA 3N9UA 1PPWA 1RYAA 1PVFA 3O69A 5IW5A 2YVMA 3BHOA 4JZTA 5ANVA 1X51A 3MCFA 3P6YA 1VCDA 3G0QA 2ICJA 3GWYA 2PNYA 1RRSA 2A8TA 1MK1A 1Q27A 2DUKA 5C7QA 3A6VA 3Q2TA 1VC8A 1RRQA 3COUA 1PPXA 3HYQA 5C7TA 2G73A 2A8QA 3ZR0A 3ZR1A 4S2XA 3A6UA 1Q54A 4S2WA 1V8SA 3EESA 3OGAA 4ZG0A 1MR2A 1V8MA 2VNPA 1I9AA 3Q4IA 2O5FA 3J7Ye 1PPVA 2R5WA 3WHWA 4J7GA 5ANSA 2GT4A 1KHZA 1PUNA 2Q9PA 1MUTA 5FSOA 2CL3A 2W4EA 5I8UA 3X0RA 2PQVA 3X0IA 3O52A 2QKMB 5FSMA 1VC9A 1JRKA 1HX3A 2QJOA 1MP2A 3BM4A 3U53A 5BS6A 4YPRA 4N1TA 1TUMA 4ICKA 3RH7A 2XSQA 2B06A 3SMDA 1K26A 5CFJA 1NQZA 4KTBA 5GHNA 3L85A 5ANUA 3X0QA 3F6AA 3HHJA 4C9WA 1K2EA 5ANTA 5GHQA 1V8YA 2ICKA 5DDGA 5CFIA 3CNGA 4NFWA 4JZVA 3GG6A 2DHOA 5GHPA 2GT2A 3I7VA 5LPGA 3Q2SA 1KT9A
chains in the Genus database with same CATH topology
4S2VA 2RRKA 1SU2A 4YPHA 5FSLA 5DD4A 3BAPA 3H95A 3O6ZA 2QJTA 4JZUA 5GHMA 1OW2A 3X0NA 5FSIA 3GRNA 1GA7A 2AZWA 3GZ8A 3SONA 3X0MA 3X0SA 2I8TA 1QVJA 3AC9A 2O5WA 2YVPA 3DUPA 3O8SA 4IJXA 1PUQA 4V14A 2JVBA 3ACAA 1JKNA 5GHIA 4J7HA 1F3YA 5FSKA 3I7UA 1SJYA 2YVNA 3QSJA 1HZTA 3N77A 3E57A 1V8NA 1MQWA 1V8UA 2VNQA 3Q1PA 3SHDA 2FKBA 4KG4A 1V8WA 1G9QA 5GHOA 1XSAA 1X84A 3MGMA 1XSCA 3EF5A 3P5TA 5IW4A 1Q33A 2KDVA 1R67A 2YYHA 5HZXA 1V8RA 1U20A 5DPKA 3FFUA 3MDGA 2YVOA 3X0OA 2A8SA 2A6TA 2O1CA 4KYXA 3X0LA 3X0JA 4DYWA 1V8IA 4JZSA 5C8LA 3GZ6A 5BONA 2FMLA 3A6TA 1V8LA 3ID9A 3KVHA 4HFQA 4KG3A 4MPOA 5ANWA 5FSNA 2A8PA 5GHJA 3GZ5A 1VHGA 4YOQA 3R03A 3A6SA 5ISYA 3DKUA 1NQYA 1MQEA 1V8TA 2KDWA 3F13A 2DSDA 1G0SA 2A8RA 4N1UA 3X0PA 4HVYA 2J8QA 4NFXA 1XSBA 1NFZA 1V8VA 2GB5A 4S2YA 3MDIA 2I8UA 3I9XA 2FVVA 3FJYA 1SZ3A 2G74A 3Q93A 3EXQA 2I6KA 4K6EA 2B0VA 1VIQA 3Q91A 1X83A 3X0KA 1PUSA 1VK6A 2B2KA 3FSPA 3FCMA 1VHZA 3FK9A 4C9XA 1KTGA 1VRLA 2CZRA 2DSCA 4ILQA 3EEUA 5DEQA 1IRYA 2DSBA 3O61A 1VIUA 1SOIA 1NFSA 3N9UA 1PPWA 1RYAA 1PVFA 3O69A 5IW5A 2YVMA 3BHOA 4JZTA 5ANVA 1X51A 3MCFA 3P6YA 1VCDA 3G0QA 2ICJA 3GWYA 2PNYA 1RRSA 2A8TA 1MK1A 1Q27A 2DUKA 5C7QA 3A6VA 3Q2TA 1VC8A 1RRQA 3COUA 1PPXA 3HYQA 5C7TA 2G73A 2A8QA 3ZR0A 3ZR1A 4S2XA 3A6UA 1Q54A 4S2WA 1V8SA 3EESA 3OGAA 4ZG0A 1MR2A 1V8MA 2VNPA 1I9AA 3Q4IA 2O5FA 3J7Ye 1PPVA 2R5WA 3WHWA 4J7GA 5ANSA 2GT4A 1KHZA 1PUNA 2Q9PA 1MUTA 5FSOA 2CL3A 2W4EA 5I8UA 3X0RA 2PQVA 3X0IA 3O52A 2QKMB 5FSMA 1VC9A 1JRKA 1HX3A 2QJOA 1MP2A 3BM4A 3U53A 5BS6A 4YPRA 4N1TA 1TUMA 4ICKA 3RH7A 2XSQA 2B06A 3SMDA 1K26A 5CFJA 1NQZA 4KTBA 5GHNA 3L85A 5ANUA 3X0QA 3F6AA 3HHJA 4C9WA 1K2EA 5ANTA 5GHQA 1V8YA 2ICKA 5DDGA 5CFIA 3CNGA 4NFWA 4JZVA 3GG6A 2DHOA 5GHPA 2GT2A 3I7VA 5LPGA 3Q2SA 1KT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2V A;  2RRK A;  1SU2 A;  4YPH A;  5FSL A;  5DD4 A;  3BAP A;  3H95 A;  3O6Z A;  2QJT A;  4JZU A;  5GHM A;  1OW2 A;  3X0N A;  5FSI A;  3GRN A;  1GA7 A;  2AZW A;  3GZ8 A;  3SON A;  3X0M A;  3X0S A;  2I8T A;  1QVJ A;  3AC9 A;  2O5W A;  2YVP A;  3DUP A;  3O8S A;  4IJX A;  1PUQ A;  4V14 A;  2JVB A;  3ACA A;  1JKN A;  5GHI A;  1F3Y A;  5FSK A;  3I7U A;  1SJY A;  2YVN A;  3QSJ A;  1HZT A;  3N77 A;  3E57 A;  1V8N A;  1MQW A;  1V8U A;  2VNQ A;  3Q1P A;  3SHD A;  2FKB A;  4KG4 A;  1V8W A;  1G9Q A;  5GHO A;  1XSA A;  1X84 A;  3MGM A;  1XSC A;  3EF5 A;  3P5T A;  5IW4 A;  1Q33 A;  2KDV A;  1R67 A;  2YYH A;  5HZX A;  1V8R A;  1U20 A;  5DPK A;  3FFU A;  3MDG A;  2YVO A;  3X0O A;  2A8S A;  2A6T A;  2O1C A;  4KYX A;  3X0L A;  3X0J A;  4DYW A;  1V8I A;  4JZS A;  5C8L A;  3GZ6 A;  5BON A;  2FML A;  3A6T A;  1V8L A;  3ID9 A;  3KVH A;  4HFQ A;  4KG3 A;  4MPO A;  5ANW A;  5FSN A;  2A8P A;  5GHJ A;  3GZ5 A;  1VHG A;  4YOQ A;  3R03 A;  3A6S A;  5ISY A;  3DKU A;  1NQY A;  1MQE A;  1V8T A;  2KDW A;  3F13 A;  2DSD A;  1G0S A;  2A8R A;  4N1U A;  3X0P A;  4HVY A;  2J8Q A;  4NFX A;  1XSB A;  1NFZ A;  1V8V A;  2GB5 A;  4S2Y A;  3MDI A;  2I8U A;  3I9X A;  2FVV A;  3FJY A;  1SZ3 A;  2G74 A;  3Q93 A;  3EXQ A;  2I6K A;  4K6E A;  2B0V A;  1VIQ A;  3Q91 A;  1X83 A;  3X0K A;  1PUS A;  1VK6 A;  2B2K A;  3FSP A;  3FCM A;  1VHZ A;  3FK9 A;  4C9X A;  1KTG A;  1VRL A;  2DSC A;  4ILQ A;  3EEU A;  5DEQ A;  1IRY A;  2DSB A;  3O61 A;  1VIU A;  1SOI A;  1NFS A;  3N9U A;  1PPW A;  1RYA A;  1PVF A;  3O69 A;  5IW5 A;  2YVM A;  3BHO A;  4JZT A;  5ANV A;  1X51 A;  3MCF A;  3P6Y A;  1VCD A;  3G0Q A;  2ICJ A;  3GWY A;  2PNY A;  1RRS A;  2A8T A;  1MK1 A;  1Q27 A;  2DUK A;  5C7Q A;  3A6V A;  3Q2T A;  1VC8 A;  1RRQ A;  3COU A;  1PPX A;  3HYQ A;  5C7T A;  2G73 A;  2A8Q A;  3ZR0 A;  3ZR1 A;  4S2X A;  3A6U A;  1Q54 A;  4S2W A;  1V8S A;  3EES A;  3OGA A;  4ZG0 A;  1MR2 A;  1V8M A;  2VNP A;  1I9A A;  3Q4I A;  2O5F A;  3J7Y e;  1PPV A;  2R5W A;  3WHW A;  5ANS A;  2GT4 A;  1KHZ A;  1PUN A;  2Q9P A;  1MUT A;  5FSO A;  2CL3 A;  2W4E A;  5I8U A;  3X0R A;  2PQV A;  3X0I A;  3O52 A;  2QKM B;  5FSM A;  1VC9 A;  1JRK A;  1HX3 A;  2QJO A;  1MP2 A;  3BM4 A;  3U53 A;  5BS6 A;  4YPR A;  4N1T A;  1TUM A;  4ICK A;  3RH7 A;  2XSQ A;  2B06 A;  3SMD A;  1K26 A;  5CFJ A;  1NQZ A;  4KTB A;  5GHN A;  3L85 A;  5ANU A;  3X0Q A;  3F6A A;  3HHJ A;  4C9W A;  1K2E A;  5ANT A;  5GHQ A;  1V8Y A;  2ICK A;  5DDG A;  5CFI A;  3CNG A;  4NFW A;  4JZV A;  3GG6 A;  2DHO A;  5GHP A;  2GT2 A;  3I7V A;  5LPG A;  3Q2S A;  1KT9 A; 
#chains in the Genus database with same CATH topology
 4S2V A;  2RRK A;  1SU2 A;  4YPH A;  5FSL A;  5DD4 A;  3BAP A;  3H95 A;  3O6Z A;  2QJT A;  4JZU A;  5GHM A;  1OW2 A;  3X0N A;  5FSI A;  3GRN A;  1GA7 A;  2AZW A;  3GZ8 A;  3SON A;  3X0M A;  3X0S A;  2I8T A;  1QVJ A;  3AC9 A;  2O5W A;  2YVP A;  3DUP A;  3O8S A;  4IJX A;  1PUQ A;  4V14 A;  2JVB A;  3ACA A;  1JKN A;  5GHI A;  4J7H A;  1F3Y A;  5FSK A;  3I7U A;  1SJY A;  2YVN A;  3QSJ A;  1HZT A;  3N77 A;  3E57 A;  1V8N A;  1MQW A;  1V8U A;  2VNQ A;  3Q1P A;  3SHD A;  2FKB A;  4KG4 A;  1V8W A;  1G9Q A;  5GHO A;  1XSA A;  1X84 A;  3MGM A;  1XSC A;  3EF5 A;  3P5T A;  5IW4 A;  1Q33 A;  2KDV A;  1R67 A;  2YYH A;  5HZX A;  1V8R A;  1U20 A;  5DPK A;  3FFU A;  3MDG A;  2YVO A;  3X0O A;  2A8S A;  2A6T A;  2O1C A;  4KYX A;  3X0L A;  3X0J A;  4DYW A;  1V8I A;  4JZS A;  5C8L A;  3GZ6 A;  5BON A;  2FML A;  3A6T A;  1V8L A;  3ID9 A;  3KVH A;  4HFQ A;  4KG3 A;  4MPO A;  5ANW A;  5FSN A;  2A8P A;  5GHJ A;  3GZ5 A;  1VHG A;  4YOQ A;  3R03 A;  3A6S A;  5ISY A;  3DKU A;  1NQY A;  1MQE A;  1V8T A;  2KDW A;  3F13 A;  2DSD A;  1G0S A;  2A8R A;  4N1U A;  3X0P A;  4HVY A;  2J8Q A;  4NFX A;  1XSB A;  1NFZ A;  1V8V A;  2GB5 A;  4S2Y A;  3MDI A;  2I8U A;  3I9X A;  2FVV A;  3FJY A;  1SZ3 A;  2G74 A;  3Q93 A;  3EXQ A;  2I6K A;  4K6E A;  2B0V A;  1VIQ A;  3Q91 A;  1X83 A;  3X0K A;  1PUS A;  1VK6 A;  2B2K A;  3FSP A;  3FCM A;  1VHZ A;  3FK9 A;  4C9X A;  1KTG A;  1VRL A;  2CZR A;  2DSC A;  4ILQ A;  3EEU A;  5DEQ A;  1IRY A;  2DSB A;  3O61 A;  1VIU A;  1SOI A;  1NFS A;  3N9U A;  1PPW A;  1RYA A;  1PVF A;  3O69 A;  5IW5 A;  2YVM A;  3BHO A;  4JZT A;  5ANV A;  1X51 A;  3MCF A;  3P6Y A;  1VCD A;  3G0Q A;  2ICJ A;  3GWY A;  2PNY A;  1RRS A;  2A8T A;  1MK1 A;  1Q27 A;  2DUK A;  5C7Q A;  3A6V A;  3Q2T A;  1VC8 A;  1RRQ A;  3COU A;  1PPX A;  3HYQ A;  5C7T A;  2G73 A;  2A8Q A;  3ZR0 A;  3ZR1 A;  4S2X A;  3A6U A;  1Q54 A;  4S2W A;  1V8S A;  3EES A;  3OGA A;  4ZG0 A;  1MR2 A;  1V8M A;  2VNP A;  1I9A A;  3Q4I A;  2O5F A;  3J7Y e;  1PPV A;  2R5W A;  3WHW A;  4J7G A;  5ANS A;  2GT4 A;  1KHZ A;  1PUN A;  2Q9P A;  1MUT A;  5FSO A;  2CL3 A;  2W4E A;  5I8U A;  3X0R A;  2PQV A;  3X0I A;  3O52 A;  2QKM B;  5FSM A;  1VC9 A;  1JRK A;  1HX3 A;  2QJO A;  1MP2 A;  3BM4 A;  3U53 A;  5BS6 A;  4YPR A;  4N1T A;  1TUM A;  4ICK A;  3RH7 A;  2XSQ A;  2B06 A;  3SMD A;  1K26 A;  5CFJ A;  1NQZ A;  4KTB A;  5GHN A;  3L85 A;  5ANU A;  3X0Q A;  3F6A A;  3HHJ A;  4C9W A;  1K2E A;  5ANT A;  5GHQ A;  1V8Y A;  2ICK A;  5DDG A;  5CFI A;  3CNG A;  4NFW A;  4JZV A;  3GG6 A;  2DHO A;  5GHP A;  2GT2 A;  3I7V A;  5LPG A;  3Q2S A;  1KT9 A; 
#chains in the Genus database with same CATH homology
 4S2V A;  2RRK A;  1SU2 A;  4YPH A;  5FSL A;  5DD4 A;  3BAP A;  3H95 A;  3O6Z A;  2QJT A;  4JZU A;  5GHM A;  1OW2 A;  3X0N A;  5FSI A;  3GRN A;  1GA7 A;  2AZW A;  3GZ8 A;  3SON A;  3X0M A;  3X0S A;  2I8T A;  1QVJ A;  3AC9 A;  2O5W A;  2YVP A;  3DUP A;  3O8S A;  4IJX A;  1PUQ A;  4V14 A;  2JVB A;  3ACA A;  1JKN A;  5GHI A;  4J7H A;  1F3Y A;  5FSK A;  3I7U A;  1SJY A;  2YVN A;  3QSJ A;  1HZT A;  3N77 A;  3E57 A;  1V8N A;  1MQW A;  1V8U A;  2VNQ A;  3Q1P A;  3SHD A;  2FKB A;  4KG4 A;  1V8W A;  1G9Q A;  5GHO A;  1XSA A;  1X84 A;  3MGM A;  1XSC A;  3EF5 A;  3P5T A;  5IW4 A;  1Q33 A;  2KDV A;  1R67 A;  2YYH A;  5HZX A;  1V8R A;  1U20 A;  5DPK A;  3FFU A;  3MDG A;  2YVO A;  3X0O A;  2A8S A;  2A6T A;  2O1C A;  4KYX A;  3X0L A;  3X0J A;  4DYW A;  1V8I A;  4JZS A;  5C8L A;  3GZ6 A;  5BON A;  2FML A;  3A6T A;  1V8L A;  3ID9 A;  3KVH A;  4HFQ A;  4KG3 A;  4MPO A;  5ANW A;  5FSN A;  2A8P A;  5GHJ A;  3GZ5 A;  1VHG A;  4YOQ A;  3R03 A;  3A6S A;  5ISY A;  3DKU A;  1NQY A;  1MQE A;  1V8T A;  2KDW A;  3F13 A;  2DSD A;  1G0S A;  2A8R A;  4N1U A;  3X0P A;  4HVY A;  2J8Q A;  4NFX A;  1XSB A;  1NFZ A;  1V8V A;  2GB5 A;  4S2Y A;  3MDI A;  2I8U A;  3I9X A;  2FVV A;  3FJY A;  1SZ3 A;  2G74 A;  3Q93 A;  3EXQ A;  2I6K A;  4K6E A;  2B0V A;  1VIQ A;  3Q91 A;  1X83 A;  3X0K A;  1PUS A;  1VK6 A;  2B2K A;  3FSP A;  3FCM A;  1VHZ A;  3FK9 A;  4C9X A;  1KTG A;  1VRL A;  2CZR A;  2DSC A;  4ILQ A;  3EEU A;  5DEQ A;  1IRY A;  2DSB A;  3O61 A;  1VIU A;  1SOI A;  1NFS A;  3N9U A;  1PPW A;  1RYA A;  1PVF A;  3O69 A;  5IW5 A;  2YVM A;  3BHO A;  4JZT A;  5ANV A;  1X51 A;  3MCF A;  3P6Y A;  1VCD A;  3G0Q A;  2ICJ A;  3GWY A;  2PNY A;  1RRS A;  2A8T A;  1MK1 A;  1Q27 A;  2DUK A;  5C7Q A;  3A6V A;  3Q2T A;  1VC8 A;  1RRQ A;  3COU A;  1PPX A;  3HYQ A;  5C7T A;  2G73 A;  2A8Q A;  3ZR0 A;  3ZR1 A;  4S2X A;  3A6U A;  1Q54 A;  4S2W A;  1V8S A;  3EES A;  3OGA A;  4ZG0 A;  1MR2 A;  1V8M A;  2VNP A;  1I9A A;  3Q4I A;  2O5F A;  3J7Y e;  1PPV A;  2R5W A;  3WHW A;  4J7G A;  5ANS A;  2GT4 A;  1KHZ A;  1PUN A;  2Q9P A;  1MUT A;  5FSO A;  2CL3 A;  2W4E A;  5I8U A;  3X0R A;  2PQV A;  3X0I A;  3O52 A;  2QKM B;  5FSM A;  1VC9 A;  1JRK A;  1HX3 A;  2QJO A;  1MP2 A;  3BM4 A;  3U53 A;  5BS6 A;  4YPR A;  4N1T A;  1TUM A;  4ICK A;  3RH7 A;  2XSQ A;  2B06 A;  3SMD A;  1K26 A;  5CFJ A;  1NQZ A;  4KTB A;  5GHN A;  3L85 A;  5ANU A;  3X0Q A;  3F6A A;  3HHJ A;  4C9W A;  1K2E A;  5ANT A;  5GHQ A;  1V8Y A;  2ICK A;  5DDG A;  5CFI A;  3CNG A;  4NFW A;  4JZV A;  3GG6 A;  2DHO A;  5GHP A;  2GT2 A;  3I7V A;  5LPG A;  3Q2S A;  1KT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...