3F6CA

Crystal structure of n-terminal domain of positive transcription regulator evga from escherichia coli
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
132
structure length
129
Chain Sequence
SLNAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNRFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF N-TERMINAL DOMAIN OF POSITIVE TRANSCRIPTION REGULATOR evgA FROM ESCHERICHIA COLI
rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
molecule keywords Positive transcription regulator evgA
total genus 44
structure length 129
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3f6cA00
2YHAA 4MR7B 3KG2A 3CU5A 3NNSA 2L2QA 3LUJA 1USGA 4PZ0A 2HSGA 2MSLA 5KC8A 1EAYA 2CWDA 2N9UA 4G0PA 5KI6A 2CHEA 1C0EA 2E4YA 4MR9A 5JNRA 1RNLA 1Z15A 3H5OA 4O1IA 3BREA 2VUHB 4L85A 4EYOA 1U2QA 1BVHA 4MAAA 4HNQA 4WWHA 1E2BA 2PE5A 3IP7A 2E4XA 2L19A 3MM4A 1NXPA 3LUAA 1ZN2A 4TLLB 5EWLB 3QLVA 3F6PA 4TN5A 4G0XA 1NXSA 3CNBA 4RWEA 1VPWA 1DZ3A 3LKBA 1SXGA 1DCMA 2NZUG 3LUKA 2FKAA 4LDZA 2WWVD 1SD5A 4JAVC 4F3TA 4Z4HA 3N75A 1EFAA 3EQ2A 1K66A 1DRKA 3TD9A 3VNAA 4MR8A 1RXEA 3QLTA 2JRLA 3RVKA 3MYYA 1RPJA 4DQDA 1K68A 3CHYA 3NHZA 1GCAA 1P6QA 1ZAYA 4G0QA 1GUBA 2AYXA 1HEYA 3RH0A 4MS1A 2QU7A 4OBBA 3R0JA 4G0OA 3FMVA 5GQSA 3KJXA 3TX6A 3KHTA 2MYTA 3GBVA 3JPYA 1MAVA 4NCBA 4N0QA 3HSYA 3OO0A 3OLVA 4LE2A 3M6MD 4KK3A 1DJMA 3W9SA 2V0NA 3G1WA 4TMYA 3T6KA 3RVOA 2PUGA 2PL1A 3DGFC 1URPA 4QYWA 1ISRA 4MS4B 5HSGA 4N0PA 3SM9A 4WT7A 4QPJC 3GT7A 2R25B 1D5WA 1QNLA 2FMFA 3FDFA 3P9YA 5HKOA 4YS6A 2PUAA 1FFSA 1FQWA 4F06A 1USIA 2LP4Y 4XAQA 1TJYA 3QEMA 1RZRA 2E4UA 3BBLA 4IRXA 3I45A 4RY9A 4MLDA 2PUDA 4KREA 2IPAB 4RK4A 5HQJA 3Q41A 3JS5A 3LFTA 3GBPA 3URMA 1YTUA 5C5EA 4RXMA 1ZHHA 1Z18A 2HQRA 3HZHA 4Q6BA 6CHYA 2PUBA 4TLMB 5TE9A 3SNKA 4JB0A 3OQOA 3C3WA 1SXIA 2RGYA 4JOQA 2QXYA 4O1HA 4OATA 3E3MA 2FLWA 3GL9A 1WETA 3SAJA 3DLHA 4G0MA 1JBEA 1DRJA 3Q15C 2L17A 3K9CA 1E6LA 4P98A 1Z2EA 1QO0A 4D6XA 5C5CA 1JF8A 2DRIA 4KRFA 3N0RA 4RK6A 5IUJC 3OQMA 2FQXA 4QYMA 1Z26A 2A9QA 2E4WA 1I3CA 4Z4IA 4EGSA 4E7PA 1U04A 1MB0A 2FN9A 4MR8B 5FBKA 1U0SY 2KYRA 1ZITA 3I5AA 3QEKA 1XWWA 1DCKA 2Q5CA 2IPNA 3L6UA 4G0ZA 3S99A 2OQRA 5FWYA 4IF4A 2RJOA 4WXMA 4JB2A 4W5TA 4N41A 7ABPA 5BRAA 2M1ZA 2XDYA 2WJWA 1VKRA 1EWTA 4MR9B 4EUKA 2NT4A 4DADA 1MIHA 3EGCA 5KQLA 4H60A 1FSPA 1JYEA 1NY5A 3Q7TA 1JWLA 5E3JA 2FN8A 5JS1A 4KPYA 4MYRA 2NUBA 4MS3B 5IEBA 3C3MA 3RVQA 1CHNA 4YV7A 1BA2A 3NNDA 3EULA 1P2FA 5TQ2A 2B1JA 2MYUA 1YMVA 1NATA 1EWKA 3KSMA 4HNRA 3ILHA 5EWMA 4LE0A 4E7OA 3C3KA 3KLOA 1JLKA 1A2OA 3L49A 5EWJA 5DKFA 3GYBA 2NT3A 3I42A 4EVQA 3MMNA 5IBQA 3A10A 5GOTA 1KRXA 2R48A 3D8UA 3H5LA 3KYJB 4GPAA 1E6KA 5KQGA 5IEJA 5BQ3A 1EHCA 1JFTA 3BILA 2JK1A 2QVCA 4H3HB 4ZPJA 3F73A 3T95A 4LRQA 4UHKA 5FWXB 1EWVA 1W9HA 3UKJA 1KMIY 1JX6A 1JYFA 1LBIA 1NTRA 3Q7RA 1ZGGA 2E4ZA 3MF4A 1AB5A 3BRQA 3IPAA 1D4ZA 3OMXA 2QV0A 3FFWA 5CNIA 4Z9BA 2WMYA 4Z0NA 4ZYLA 4N76A 4Z4GA 2FEKA 1QQAA 1D1PA 1YK1A 2LPMA 2HQBA 2LIVA 3FGZA 4YP9A 4O5AA 5DGCA 1JDPA 5JNVA 3EAFA 3EQZA 4HNSA 1QP7A 4H3KB 3CFYA 5KQPA 3F6CA 1H9CA 2H0AA 1GUDA 4JP1A 5IX8A 4IGAA 1P8AA 4YR7A 5CNJA 1USKA 5B3JA 2JVJA 1Z16A 1IIBA 3H6GA 1XHEA 4NCAA 4Z4FA 1PEAA 2VYCA 3N53A 3O1HB 3QX9A 3RVRA 1Z13A 4MS3A 2FW0A 2P9HA 2GBPA 3TB6A 3K4HA 4W5RA 1TM2A 1NXTA 2RJNA 5ED4A 3T38A 1M2EA 1YIOA 3FFTA 3RQIA 5JNTA 3OLWA 4MQFA 2L18A 2FEWB 2VK2A 5DTEA 2JB9A 2F8TA 3HEBA 3GWGA 1YVUA 4MRMA 2NZVG 2PUCA 1L5YA 3CTPA 4RK7A 2GKGA 1C4WA 1FFWA 3JTEA 5JNUA 2FEPA 3VNBA 4MLCA 1VLZA 4QICA 1ABFA 2QZJA 2QW1A 5IULC 1YK0A 1DCFA 5PNTA 2YHBA 2GX6A 4RXTA 4MQFB 4KK4A 1LJUA 3CS3A 2PUFA 1VRVA 2IPLA 4LDAA 4XARA 4Q6WA 3HUUA 3HJFA 3OLYA 1S8NA 2ZAYA 3EDCA 4MQEB 1F51E 4PYRA 1A0OA 2A9RA 2LUOA 1Z12A 3IP9A 4D6YA 5T7BA 3HS3A 3OLXA 3ILYA 4MGEA 1DC7A 1NXVA 2MYPA 3H5IA 4G97A 5F64A 1M2FA 3SG0A 2HJ9A 4PEVA 3B2NA 3T8YA 5EWLA 3CZ5A 3H1FA 2R4QA 3H1GA 3LKVA 2A9PA 5TPZA 5ABPA 3OQNA 3H5VA 3MQ4A 4RK1A 5FWXA 6ABPA 4KVFA 2PL9A 2FMIA 1QQBA 3F7NA 3LUDA 1DG9A 5TQ0B 5HM6A 3LUFA 4RY8A 1PUXA 2FMKA 2H3HA 4YO7A 5TPWB 4MR7A 1L5ZA 1T34A 4NQRA 3KCNA 2IKSA 2PLNA 1NXOA 3NBMA 3QLUC 4YGXB 4L4UA 1ZESA 1E6MA 3KS9A 2MSWA 4W5NA 3GV0A 3O1JC 8ABPA 3HO1A 3O21A 4XXHA 4XASA 4OTZA 1JHZA 4GNRA 4F12A 1U2PA 3D02A 4S05A 2MYNA 2JBAB 5DCLA 3JVDA 3QX8A 3H5TA 1DBQA 4RSMA 2QSJA 3HVRA 3SQNA 3GA5A 2CD7A 3HV2A 4ML3A 3N8IA 1OXKB 3CG4A 2M98A 4MS4A 4RKRA 2FSPA 2P4UA 2ZWMA 1ISSA 5FBHA 4YLEA 3QELB 2W42A 4EVRA 1CEYA 4XFKA 1DBPA 4HYEA 4KNYA 2X7XA 4M88A 2I6FA 4KQ9A 4Q7EA 2ID9A 4FB4A 1BDJA 2PJUA 4LZLA 1DC8A 2OENG 4RZSA 3QEMB 3OMWA 4IILA 3CRNA 4RY0A 4G0YA 3ROTA 3ROFA 4FE7A 5CNMA 1RZRD 4EYKA 3O1IC 1LJLA 1RXIA 1JDNA 3QK7A 4JA2A 5EWMB 1SRRA 3CG0A 3KYIB 3H6HA 3LUCA 4OG2A 3SY8A 1GLGA 1AB6A 3O2QB 5EWJB 4KFCA 3O75A 1QMPA 3O74A 5B3JC 3FFXA 1PHRA 2QR3A 4ETIA 1BDIA 3CZCA 1LBHA 3CLKA 3M9WA 3OO1A 1YMUA 4RDCA 2GI4A 2IYNA 4F11A 1Y1LA 4EY3A 4YRZA 4D74A 1JFVA 1QPZA 3RVSA 2IPMA 3A0UA 1D2AA 3DGEC 3A3KA 3KKEA 1PNRA 4MRMB 2J48A 3G85A 3RVLA 1JL3A 1D1QA 4LE1A 3JY6A 2LBPA 2R47A 1J56A 4MS1B 3RVJA 4W5OA 4RK5A 3N6VA 5JS2A 3BRSA 3KTOA 5TQ0A 3IP5A 4WZZA 1FFGA 2O20A 3IPCA 1A04A 3QELA 3CKMA 1MVOA 1PEYA 1KGSA 1NXWA 5TPWA 5JNSA 2PKXA 3EODA 3HCWA 5FWYB 1ZY2A 2E4VA 1ZVVA 3QLVC 1TVMA 4IMJB 1NXXA 4MQEA 3O2SB 2PAFA 4RXUA 2A9OA 3UUGA 3LUGA 5JNWA 3RVPA 5CNKA 9ABPA 2PUEA 2FLKA 3HM9A 3GRCA 1B00A 2HQOA 1KRWA 3DLBA 4LX8A 4F8JA 5IUNC 1TMYA 4N47A 3IP6A 4W5QA 1APBA 4IMIB 2AYZA 1CYEA 2FMHA 3HDGA 4KQCA 3UK0A 4P1ZA 3OLZA 1M5UA 2VUIB 1DP4A 4RS3A 4Y9TA 4Z4EA 1M5TA 2FTKE 1ZGZA 2F8SA 4S04A 5KWSA 1ZH4A 4Z99A 3NHMA 3EJWA 4EYQA 4ETNA 3MA0A 4KZKA 4XLTA 3TMYA 1PNTA 3HDVA 3HK2A 4G86A 4YCSA 4RV5A 4Z4CA 3H5WA 3Q7SA 4UHJA 4EVSA 2GWRA 4B09A 3JVIA 5TQJA 4RKQA 1BAPA 2JVKA 3JPWA 1W25A 3LOPA 1R8JA 5IUKC 1XHFA 2HPHA 2WY2D 3E61A 4ZMRA 1DBWA 2JCGA 4KV7A 1QKKA 3RVNA 3I09A 1ZDMA 2BGGA 1F4VA 3IDOA 5D2CA 1LK0A 2B4AA 5TPZD 1YS6A 1Z25A 5KQMA 3KLNA 4KMRA 5CHYA 4WUTA 4JASB 1QP4A 3RVMA 2WRZA 4PE5B 4ETMA 1QO0D 2WB4A 2IOYA 1OXBB 3C6QA 4DN6A 2IDMA 3Q9SA 5T3YA 3OM0A 5TQ2B 3HUTA 4RU1A 4RK0A 3MIZA 2MSKA 1Z17A 4FE4A 1BDHA 4OLAA 1MB3A 3C97A 4NV3A 5DLEA 1P6UA 2QVGA 2FQYA 4Z9AA 3N0WA 4PICA 5KC9A 4WXEA 3A0RB 4ZJPA 2CHFA 4NICA 4CBVA 2FQWA 2FVYA 1QP0A 3QLUA 2PMCA 2FXIA 1ABEA 3LTEA 1ZH2A 4N03A 1JFSA 2JVIA 1GCGA 4YWHA 1SXHA 2JBAA 3OM1A 3NNNA 3DBIA 3H75A 3N0XA 3TO5A 4OLBA 5BRJA 1Z2DA 2TMYA 3LMKA 5IC5A 3H1EA 3O2JA 5BR1A 1YS7A 2WJAA 1JH9A 4EYGA 2ID7A 3DZDA 4ZMSA 1TLFA 3LUHA 3HXMA 5I4CA 4MPTA 1UDRA 3M9XA 1U8TA 2RDMA
chains in the Genus database with same CATH superfamily
2D13A 3DLCA 3PC4A 4G8JA 3KKLA 1XKTA 2O8BB 5I5EA 2PA0A 3EUFA 1BHQ1 3UUFA 1KOJA 1KOGA 3EXIA 2RGEA 3AKCA 5BYBA 4DZZA 1EAYA 4PLPA 1WD5A 3IEPA 1MO3A 4MOWA 4R16A 2PZJA 5CYOA 2D2FA 3HP7A 4IJQA 5AKKA 3NTRA 3CF6R 1JKXA 2XCOA 3EMKA 5EJ8A 1KJIA 1Y9EA 2FPIB 4TLCA 3A6HA 4EYOA 2RBEA 3GUYA 2WQ7A 1HZZA 3COWA 3DDSA 4NFLA 1SHJA 4EUHA 5ITSA 2G3YA 1TMKA 4FS8A 1GZHB 2EL7A 1U0TA 5MN4A 1Y3AA 3BB4A 2V58A 4NARA 3BMCB 2P68A 3KQOA 4HWSA 5ARCA 3SEZA 4DDMA 5M34A 1WF3A 3SXUA 1XPJA 3QFTA 4P7FA 2FLVA 2VWGA 4RABA 3PLNA 4BGDA 5GADl 3VJRA 1GRRA 1M7HA 1QYCA 3FRHA 4M99A 3JZIA 4X6YA 2I8CA 3R4VA 1RYYA 3TQHA 4Y0VA 2HZBA 3T7TA 3AESB 1YOBA 5B7QA 4FC6A 1WCWA 2XWSA 2OD2A 5D8DA 5D3MA 3HBFA 4RHXA 3STYA 2PAAA 3DZKA 1T9DA 4N0EA 2LW7A 1P4RA 2VF5X 5BV8A 3Q87B 2QJTA 1P6QA 1YI1A 2P6OA 3H05A 5GZ6A 2AYXA 1G5PA 2AVNA 4XTCS 1OPRA 1PGJA 1QG4A 2J1LA 3KVRA 1G20A 1PV1A 1BFUA 2J87A 2V9PA 1H0KA 1UADA 3TX6A 2G1JA 3CEJA 4P0PB 3NDPA 2GNPA 1RBZA 4N6GA 1AQUA 1FRZA 2EFYA 5DSTA 1D03A 2QT1A 4Z49A 1CB7A 4GYYA 2OXCA 2XB9A 3FI0A 3IDQA 4C3UA 5KKAA 4C0HA 5KX5F 2C4VA 4L8WB 1URPA 1U7OA 1HDCA 4O3MA 1ZJWA 4WLOA 2ZRGA 1QC5A 2C3MA 1FMFA 2A1UB 1AURA 4H6PA 4FNGA 2JFWA 3KUUA 3Q40A 4AF7A 3GT7A 3W5SA 2C1ZA 4RKWA 3A6PC 3KT6A 1Z74A 2PD6A 3NHWA 4F86A 2O8DB 1VP9A 5DN9A 1TT7A 4I4IA 4A9AA 1YFLA 2QLFA 4QOJA 3V32A 4UOZA 4G84A 1L1RA 1H0RA 1ZVJA 2HTEA 4MWOA 5ENDA 2QW0X 3O4RA 1D3AA 3MWEB 5GP1A 3ND8A 3V8EA 4YASA 3IXMA 1PAUA 3RJMA 5KBYA 1XQ9A 2OHIA 1MIOA 1EWRA 1TCVA 2Q4DA 2Q6KA 2QTGA 1CLEA 2YZMA 4LF6B 5HDQA 1EDDA 1EYZA 1F14A 1ISGA 1QG0A 2HQ1A 5DK6A 3UT0A 2VLIA 2PGIA 4B34A 1HDZA 1QRSA 2CC2A 2B1QA 1MB4A 2Q6TA 1R0BA 4KFTA 5JO9A 5D3MB 3HYNA 2DBQA 2OCGA 4O59O 5FBVB 3VR3D 2AC2A 3WGZA 5EHZA 3GUHA 3C5WP 4IR7A 5LJIA 4LX0A 2UVQA 5IVPA 5L6LB 1M1NA 1JW9B 4EG5A 1YCDA 3DLHA 4ZU6X 4BWFB 2R8PA 4NBVA 5KNBA 3VR6D 4P98A 2VATA 1Q0TA 2QENA 5D3KA 1BHJA 2RKWA 2BEWA 1EH5A 4ZYZA 2WQ6A 1FS5A 3ESXA 4F71A 3U3DA 1SC9A 2P90A 1S8AA 2YHIB 5J9FA 3ZV3A 3ORYA 3PFNA 4H4DA 3FTFA 4I55B 1Y3HA 2JNWA 3AKEA 1U0HC 3Q8KA 3ODGA 1ZK0A 2O1SA 3QTLA 3N70A 3RJ5A 2QDKA 5I4BA 1L8OA 3GHHA 4PYNA 4MR8B 1QX4A 3U09A 3L7YA 1T3TA 3D7KA 2Q1TA 2K87A 1TM1E 4LY9A 3QBDA 3N2ZB 4MLPA 2PU7A 5IXYA 2OCYC 4IF4A 1IB6A 2OFFA 2GLTA 5F51A 5F9MA 4OHWA 2BLNA 5GMOA 2Y99A 1GNQA 3K9WA 1SBNE 4Q7MB 3GFQA 2XDWA 5DX1A 5EZYF 4D9MA 1LSSA 5TT0A 1MW9X 3HYSA 4MI6A 3KJNA 4PYQA 4B76A 1B15A 2X1LA 4ZYVA 3J81k 2PL3A 3SOPA 4LXHA 3O8LA 1JYEA 2OB1A 1Z4JA 3ORSA 4Z51A 4V1CI 4JWKA 2F55A 1QLJA 3IE0A 2NUBA 5AESA 1N0UA 3RVQA 2CKDA 1EVEA 2ZANA 3NGMA 5K8LA 3NIWA 1W6RA 3AU8A 2OYRA 3W34A 3W8RA 3D6JA 1FU7A 1ODKA 1XU9A 5EIBC 4CIWA 4KE7A 3RU7A 3MBIA 2HEIA 1NU8A 1UJNA 2C9CA 3BRWA 1X1BA 4MEAA 4XYGA 1QRDA 4IDNA 3TSCA 4B3FX 2UUOA 2JHFA 3DTVD 4PRLA 4RNCA 4NMHA 2MHCA 4FIDA 5FL3A 5KOYA 2HBZA 4W5JA 2JK1A 4MWTA 2P6MA 3A1TA 2ZSBA 1NAHA 2IZZA 2IQ5A 3BQ9A 3EVCA 3UKJA 3EY4A 5EN4A 5G40A 1VMEA 1QOZA 2R84A 1FC0A 3MF4A 1BX1A 2PXAA 3HFJA 1CR2A 4EHJA 4I50A 5CNIA 1V5IA 2NO0A 1WXXA 4ZFNA 4YMWA 1D1PA 4I46A 3ZDFA 1KSGA 4H7IA 4O5AA 4YRNA 4TQ9A 2HWKA 3LHFA 1OLXA 4HDMA 4YJKA 3EAFA 1V9SA 4AFNA 1PJBA 2OBYA 4H3KB 1QO7A 2IC5A 1C4XA 1UBOS 3G2NA 1QLWA 2K7FA 3SYLA 1JIVA 4PS0A 1IL0A 2JVJA 5JSFA 1WPRA 3M6FA 1CX9B 4NIMA 5D6OA 1IRIA 2F1RA 2OZLB 4FEYA 4DV5B 1C3JA 3KEOA 1XMXA 4O4IF 5JAOA 1SZJG 2OFOA 1NQUA 1H8EA 2B7CA 4MPRA 4NS1A 5LLTA 4L8LA 2VHWA 1VIDA 3G5TA 2V1UA 1TGVA 1JVBA 3GU3A 3WB1A 3L7IA 4F92B 1RVV1 5EJMA 5JXIA 3DMNA 3UIEA 4C4AA 2I6QA 3FPGA 3IESA 3KEQA 2ACKA 5CXSA 2AKYA 3AY3A 2W00A 3FOZA 5G0WA 3AG5A 1OXXK 4IDDA 3WX0A 1N7JA 4MEBA 4MK4A 4HSEA 4HAYA 1GN9A 4LOHA 1T6YA 3OFVA 4OOFA 2DLCX 3DSRA 5IULC 1OV6A 5J23A 2XZLA 4GMGA 4F2WA 3BWCA 3R75A 3A1UA 3IIJA 2W8BA 3ZY6A 1YB7A 4UDXX 4Y2SA 1TD9A 2H4XA 1GHTA 1NMXA 2PD3A 2ZBUA 2V6FA 2F59A 1Z8DA 2XQIA 4MQEB 2QNIA 3OMLA 1ETUA 1ECGA 1COWD 1Z12A 1E2KA 3O6VA 4JY7A 2VWQA 2QRVB 2ZSHA 3TIVA 2B34A 1ZOLA 2QAIA 3DXZA 4K1LA 5E8JA 3HA2A 1W88B 3IAHA 3C1AA 2YS7A 5IWCA 4I4NA 4JXJA 4MUKA 5G1PA 1XMVA 1QS0B 2A9JA 2QSUA 3AF5A 1FVXA 3NM5A 3R0XA 1VHJA 4M9UA 4RKFA 2ZUDA 4C03A 3OLQA 5AM4A 2O3SA 3NRJA 3UK6A 1A1SA 2BI7A 2HREA 1O9GA 2BMDA 1E5LA 1SQFA 4RY2A 2QTNA 5ENVA 4MGYR 1T1JA 1EQAA 4AVYA 3HVIA 5IW8A 5BV0A 3SXPA 1GOTA 2OORA 4ND7A 4EY4A 1XAHA 2CVOA 1B2LA 5EOVA 1DFIA 3F5MA 2CFRA 4GBED 5AOAA 4GFDA 2Z98A 4C3OB 4CM9D 4JQZA 2ZG6A 4IY1A 5A0TA 1E6MA 2H8GA 4RZ2A 4NZNA 4QLAA 2HJWA 2CXTA 2PTHA 1EFUA 4EGAA 8ABPA 5AOCA 4CDNA 2V6GA 5FJJA 5M7EA 5AKGA 2ZRQA 4A4DA 1AZTA 1OGJA 1K3FA 2I80A 2JBAB 3B8EA 4BEWA 4X66B 4QBFA 1L0BA 2GJKA 5F78A 2ZUTA 4Q4AA 4X84A 4X3CA 4Z54A 3F1LA 3HVRA 1A5AB 4EB6A 3V8MA 1Q84A 2PPLA 4OHFA 1KBQA 2C5LA 1PLKA 3KKNA 4ON9A 5AI9A 4FVTA 5AVVA 3GJ6A 1WOYA 3KTDA 4UM9B 1G3MA 2QW8A 1G4UR 1NMQA 2OCBA 3EIHA 5JDIC 5C51B 3SYNA 1K89A 1XEAA 1T5LA 4A0QA 3EXHB 4YY3B 4PCVA 4HB4A 1W44A 1P1JA 3I8SA 3H1AA 5CFOA 4CL0A 1MMFB 2QSZA 1GV1A 3BGOS 1VL6A 2R44A 1HDOA 4NZZA 3K94A 4HGNA 1Z7WA 5FBZA 1J0BA 4FE7A 2REBA 3IAM1 4YRLA 1A8PA 2PBFA 3FSGD 3QENA 2CLHB 3U7IA 4LOJA 5I6DA 2ID8A 3HJAA 4D9EA 1XD9A 4PSKA 3ECCA 1LWNA 4NE9A 4QUBA 1GA6A 3HBMA 3BHJA 1GAWA 3HJTA 3MQFA 1QZUA 4J1QA 5ALYA 4KWIA 3GCXA 2I55A 1Z5ZA 3RVBA 2N42A 1J33A 1JPVA 1VL8A 4UKDA 1UMBA 1LS1A 1EGQA 4GP6A 4EY3A 5MHTA 3EXFA 2CL7X 3N8KA 2P3SA 5CDGA 2C00A 3AXTA 4HEHA 1QPZA 4G0UA 1IMJA 1U5BB 3AESA 4R2IA 4ASUA 2R60A 3IAM6 2Z58A 4QEKA 2FUNB 1PR0A 4F72A 3N58A 3VH4A 4BUCA 1ZC4A 3GD7A 3R3ZA 1KARA 4RL6A 4DQLA 3KX2A 1TUBA 1NJGA 2ZIFA 1BE6A 3FETA 2HSDA 2PKEA 4JYCA 3ZTYA 3HCNA 2NUPB 5IASA 1KJZA 1ZJYA 2O20A 1G8SA 2DYKA 3LDGA 3R40A 1FYFA 5KWIA 4BWGA 2I7CA 2BGLA 2M9MA 1X92A 3R3JA 3DZCA 4EI7A 1ZIPA 1GPNA 2B61A 1LU9A 2CXHA 5CJ2A 3UTDA 5HJ7A 3QJ5A 3N2LA 3E03A 3CLSD 4YI5A 3PGVA 4IICA 4BWVA 3L0DA 2LDXA 3FHJA 4ARZA 1L8QA 1OSNA 1NOIA 2VPTA 2XE4A 4YJFB 1A9QA 4FZ3A 4K88A 1ZM9A 3MJ4A 3JQBA 4INZA 4JDUA 2C58A 3SQOA 3ZU6A 1VJTA 1X13A 4KYUA 1AN9A 3W6NA 4RKEA 4R6XA 2FSIA 4M1KA 4Q3LA 5KKCA 2ILTA 3GDFA 2JLYA 1MH9A 2ZWIA 1EG7A 4RZIA 3KEGA 3KKPA 4IG9A 5FADA 3L02A 4X8MA 2FTKE 2XMGA 3BF7A 4WNCA 3DFIA 1BDBA 3ZWOA 3DE4X 5A05A 5KWSA 1V1JA 4QM7A 5K0SA 3WLLA 4CYMA 1JR2A 3U4QA 3JZFA 4FFWA 3SN6A 1B23P 1U3DA 3ZG6A 4BLUA 1JHQA 1EBFA 1VSUA 1ZA2A 4ERNA 3TSYA 1N0WA 3O8RA 3ZU5A 1MTOA 5TQJA 4RKQA 3NLLA 1WM1A 1W25A 4JQSA 5IUKC 2PGXA 2XF8A 1LVUA 1YV9A 2JCGA 3K09A 1L9KA 4KV7A 4MV6A 5IDQA 2G1UA 1ZW6A 1H3FA 1MRNA 2YIJA 5CFPA 2BKVA 3C48A 3IDOA 1LK0A 3NB0A 4IJ5A 1NUPA 4I5GA 3HVHA 3GMTA 4JFRA 4PXAA 1XTJA 1ZNWA 1BC5A 1AHHA 3RVMA 5LWHA 1RE0A 2DOKA 2IDKA 3IIIA 4QBIA 4Q1VA 3TSOA 5JAQA 3WJ2A 1KR5A 1W75A 4R1SA 1WKVA 1X2EA 2N0SA 2GN6A 2CNNA 3L1KA 2DR2A 2QMYA 3HUTA 4RU1A 1PR3A 1OA1A 1Y5MA 3KVOA 2YC2C 1IG3A 1XR3A 3K1YA 3MXOA 1BDHA 1IWOA 4G24A 5F3RA 3KQUA 3PX2A 4D4HA 5B1HA 2Z8ZA 3GJYA 2QAGA 2JI9A 5KVQA 1A9OA 2XUHA 3VR5D 1WHTB 1V11B 2AKEA 3ZK9A 4US2R 2BKEA 3ZU2A 4ZOLF 2CJYA 2VQ3A 4Q1AA 2FXIA 4V0KA 1Y7IA 4F85A 1I94B 4EFDA 3DVAA 3OT5A 4WFKA 5AWFC 3DP9A 3B70A 2C4UA 1XEWY 2XT9A 4BKRA 3UUWA 4CIXA 4EECA 3H75A 5DTJA 2F4NA 2FW7A 5AM2A 5C37A 2VLBA 2UV8A 5E7MA 1PFUA 4WKBA 1PRYA 1EZ1A 4E5PA 2OTCA 2I6SA 3WGQA 2RB4A 3LMKA 1E77A 4HLUA 5ANRB 4HYQA 3GXBA 5D87A 3ZQKA 3NYWA 2ZRKA 4ECAA 2WKSA 5F73A 4AECA 4AMBA 5IHPA 4MVJD 3OZWA 4FZ5A 3ZQUA 4Z4QA 3IDAA 1XTTA 2TECE 4LJLA 3RTCA 4IDHA 1JDZA 4DLBA 4Z0PA 4JNCA 2C5AA 3X0DA 1G17A 3M34A 3ED1A 1RLJA 4KXXA 3ZHUA 4QLOA 4B17A 3JWPA 1GUFA 5K0EA 3FM9A 3EA0A 2A67A 1GRVA 1R66A 3AMVA 2CFTA 4Q3DA 1TA9A 3KZMA 1JHVA 1UDCA 5KI6A 4JBHA 5DXJA 2WTBA 1KQ3A 3DEHA 3L41A 2FAXA 4BX0A 1PGQA 3AP2A 4PC7A 5CLFA 1E4EA 4CUZA 1K86A 1MQ9A 1PZNA 1RRGA 2J31A 4MAAA 3PE6A 4R0VA 5CCEA 4QBGB 2CLIB 1G98A 3IP7A 2CLKB 2FG6C 3KJIA 4EIWA 2O7SA 5CP8A 3LUAA 1T8RA 3ESYA 3TZBA 4K6HA 4G01B 5I47A 2AEJA 3FRIA 4ZVKA 4OKNA 2H1HA 4BNUA 4R7TA 2WLTA 8ATCA 1IVSA 1DZ3A 3LKBA 1NR7A 4ZEWA 1XB2A 1HY3A 1ULUA 2V8BA 4HGPA 1L8XA 2W2KB 3P26A 4W7HA 2IUEA 3UAXA 3MFYA 3L4JA 3I1JA 1QYXA 3GJSA 4L95C 3CW9A 1EFRD 3CLRC 2GPNA 3SSOA 3UUEA 3CVVA 2RCYA 1ZX1A 3MYYA 3QE0A 4WX2B 4R7GA 3QXSA 3O9ZA 1SO8A 3GDWA 4HX5A 3JU3A 3PDJA 1GU1A 3VQTA 4C7BA 3IPXA 2E82A 3L40A 5AK3A 2VYND 2ZXUA 1U9IC 3BUSA 5FLXA 1MJ5A 3VPAA 1RD4A 4EDFA 1POXA 1BD4A 2J9RA 4P92A 2VP5A 4C01A 5KYXB 1WZIA 5JCPA 4ZJUA 1NW9B 2V6BA 2C1EA 4MVJH 2HRBA 4TMYA 4YRFA 3VBEA 4JJIA 3RVOA 3VV3A 1W0JD 2CZCA 4A8JA 2VRWA 3WIOA 3TLXA 2CHVA 3IXLA 3CEMA 1ECLA 2J9YB 3FXAA 2G1PA 4KDRA 4JITA 2JBHA 3II6X 1L1QA 3HACA 2FMFA 2F3UA 4BKUA 3ZCRA 4TYYA 4OI2A 3O31A 2PUAA 2D59A 5DI9A 4OM7A 2FRDA 2OQVA 4F06A 5BW8A 3ER9A 1PWXA 4ZV4A 2RHCA 4IINA 4PTYA 2I7VA 3VO9A 3VPGA 4CMAA 2G9ZA 1VMIA 2BHNA 1XZNA 3BH7A 3PXGA 1BWQA 4RY9A 1ZEJA 4WN3A 2F1HA 5DE3A 1X3SA 4EJSC 5K8CA 2ZI6A 3WWEA 3KPUA 3LPNA 2HSZA 3MOGA 1RRVA 4BZXA 1D0IA 2G76A 3T4UA 1D4AA 2I7XA 1ZHHA 4Q6BA 1JVNA 3WLPA 4DCUA 1EFRA 4KOAA 2V4UA 1RLOA 4JB0A 1QONA 2HV9A 1I14A 4ARUA 5B58T 1Y8ZA 2ATEA 2RGYA 3C3JA 5HCIA 2PH7A 3W2FA 4QYXA 3GL9A 3NBZC 4KYIB 4YCCA 4EPXA 2PWPA 1I3OA 3JYLA 3U44B 2JI7A 3MJRA 1ENOA 1Z2AA 1G1AA 3BN3A 1O87A 4QASA 3W5CA 2C54A 2OZVA 1XQXA 2PGJA 3CLRD 4BNWA 1JF8A 1N78A 4IJKA 4KRFA 8MHTA 3OFKA 2I7TA 1QKIA 1ODTC 4BKOA 5I3ZA 4A0GA 1MPXA 4AMUA 5GINE 2ZUEA 1VA5A 5JJBA 2VJQA 4JLMA 4KH1A 4QEDA 1TW3A 3IAS1 4WJZA 4FHEA 2VS1A 2J8ZA 3I05A 2NU6B 3H2HA 4GEKA 4IFIA 4OHBA 3F8TA 5ALUA 4KUEA 4UVGA 3UMSA 2FWAA 5LM3A 1QX3A 1KK0A 1ZITA 2OHOA 4WKPA 5DP2A 2DUWA 3UYKA 1JEEA 1NVKA 3V1KA 4EQ6B 4YUYA 2D0OB 3B3QA 5FWYA 5JROA 2IHKA 2CSUA 4ZT4A 1CY2A 3WLOA 4E2XA 1OWMA 1SC3A 4TS1A 2AUTA 2EZ4A 4B0PA 2IHBA 3OLCX 1L5HB 3IB3A 1FP4B 4OJYA 2M1ZA 3LDAA 3UK1A 3ZGNA 1WB5A 4DLVA 4MR9B 5CVTA 5LD2B 1TUIA 3D0QA 4AF8A 3HFSA 2HA2A 3ACCA 2ZR0A 4LYJA 3HRHA 3ACDA 4RDHA 3I4FA 3ZDEA 4AM8A 4MRVA 1A2BA 2Z56A 1NI4A 2WWGA 4H60A 3FHTA 3OUZA 4ERXA 4KI0A 1SC4A 1WXFA 2H1LA 5P8WA 2DKNA 2V3CC 3MGGA 1JQEA 2CNLA 1J42A 1RKVA 1J99A 5AXAA 3A6KA 4I1RA 2Z2JA 1QYVA 3E9CA 2HLDD 1EWKA 3OETA 3DULA 4QU8A 3VSDA 3D4IA 2EWMA 4DR7B 1J8DA 2P9YA 4QJBA 1GPLA 1P0IA 2DF8A 1KRXA 1MABB 1PR5A 1AKUA 1W36B 1NHWA 1E6KA 2JHCA 1XCOA 5FTMA 5CX4A 4EAAA 2B8EA 4IJVA 3H97A 3NKFA 1FDIA 4X20A 5IWAB 4OK6A 1E2HA 2AC7A 3GQBB 1W9HA 2GBCA 5CGZA 1KMIY 1K7YA 2Z4SA 1DV2A 1I5RA 1ZGGA 2AQHA 2ZRPA 3QLJA 3OWHA 4H27A 3OOEA 4B4VA 4E70A 4BJ1A 1P45A 3IPAA 2KPOA 1SU7A 4OO3A 4Z9BA 2WMYA 4B2IA 4CV3A 4N76A 4Z4GA 1X1DA 4G2NA 4B8WA 3N8HA 4S3MA 3KOZA 3CUYA 3NWBA 2DETA 4IUDS 4DNPA 1U28C 3IOBA 4GGMX 1DOAA 2WP8J 3CWZA 2X5NA 4KV9A 4Q4DA 5F4BA 1FP2A 1X94A 4ZRMA 2ZW9A 1C7EA 3KD2A 5EPEA 2NMVA 4LOIA 4CQMA 3FWKA 1GUDA 2ZJ7A 2RGRA 5L7YA 3WRXC 3KC2A 4JWTA 2AEMA 5TSDA 5BMVB 1YNOA 4ZCPA 5HF8A 1Z16A 1KMHA 1RQLA 4CU2A 1BXZA 2DQKA 5A9SB 4G9EA 3EGWA 2R1VB 2W4MA 1QVWA 1RKUA 1ZZGA 1FFBA 3WGMA 1GSHA 1OKKA 1KDVA 2OBLA 3R7DA 3SS8A 1K92A 4NY1A 1R74A 2OM2A 4O4LF 1OB5A 5JPDA 4G4GA 2AF3C 4QGGA 5FPPA 3T38A 4FOPA 4KWCA 2Q5JA 3SIPA 1RI2A 2AXPA 1T3LA 2EDCA 3HJCA 3EVFA 6REQA 4BASA 2JB9A 2ORYA 1QHXA 1SIUA 1VYHA 6YASA 3T5MA 1MABA 1JMKC 2BGJA 2CHGA 1SWWA 2EEZA 1FMLA 4BTVA 1X1CA 1J2JA 2GKGA 5ECWA 1O77A 3EEQA 1Y4DE 3R7SA 1FSFA 2VSQA 1AQ6A 1IYZA 4MLCA 1ABFA 4GM1A 1YK0A 1K1EA 2C92A 4PXYA 1WXHA 5DWVA 1P3JA 1RT9A 4IWNA 1F4PA 2TYSB 4DTCA 2HX1A 2PFGA 4IOJA 2VWPA 5LQJA 1MAAA 2H18A 2XOKA 5J1TB 2PO7A 1X9IA 5INTA 1Z63A 3W8DA 2PUFA 2C9BA 5DEIA 3AIKA 2BM8A 4MV5A 4XD7A 1O5TA 2I6TA 4N7BA 2FJUA 3FVRA 4UCFA 3OD5A 4PYRA 1OH6A 3WK8A 4BO3A 2BH9A 3AHGA 4PRZA 2Z6VA 2IYOA 2WV9A 4YECA 4ZOQI 1VE5A 3ELBA 4C4XA 1THMA 1F17A 1GZ3A 4P86A 4D3SA 4J90A 1X7XA 4JI8B 1LTHR 5JHGB 3V6LA 1XQWA 4PLGA 3TD6A 1A4RA 2DFPA 2HJ9A 2B98A 5EMHA 3ULKA 5G4KA 5ES4B 2AEFA 1Z2PX 3GEIA 4BKQA 3I01M 4K26A 4EPTA 3VPHA 2CUNA 3Q0IA 1N9ZA 4GP7A 5FWXA 5ITWA 2JLWA 3GJ0A 1NVXQ 1VHLA 2I2DA 1AXGA 3CPJB 3UZUA 5AVZA 4Q3CA 3BORA 1W8IA 1VSTA 4H18A 4N5LA 5KAPA 2ZS7A 3X1XA 3LBIA 4KQIA 4RY8A 2YUTA 1HL3A 2Q2NA 5ADUS 2XWBF 2H3HA 3A4LA 4EDHA 5TPWB 2C2XA 3ZS9A 4CQMD 1A3CA 2HNBA 1K88A 1AS2A 1VJ5A 2EKPA 2W6OA 2BL4A 3G13A 1I9CA 4IS2A 4C7KA 1HDGO 4NZMA 1PNVA 1JEQA 2SKEA 4GRAA 5ALXA 2ZSFA 3EGOA 3SF8B 3O03A 3SHQA 3NWEA 2HCJB 2WHYA 1QP7A 2JGRA 2GPYA 3E3OA 1CS0A 1G5TA 2JCSA 3LT1A 1G2OA 1IPEA 3NBQA 2CCKA 2ICAA 2XCSB 2MDTA 3T3IA 2FFHA 2CB0A 1XEXA 3K8QA 5IVIA 4OHKA 5AJWA 2QPLA 2QSJA 1FBNA 1Z5OA 4KQ2A 2QP4A 1U02A 1HT1E 2LVBA 1W49A 4ZICA 2WFZA 3R6TA 4B75A 1OXKB 1II0A 3AVPA 4BRZA 1NP7A 1CC1S 4FHZA 1QQ7A 1W5EA 4KO8A 1OIWA 5ESXA 4N3GA 3EFHA 2AE1A 3NG1A 4O25A 2H65A 2R96A 2XQVA 2XHZA 4KLZA 3WK5A 1C5KA 4MICA 3UOWA 4R8MA 4DR2B 1G3UA 1PE0A 4TTRA 4XQGA 2IV3A 4D7AA 5K01A 5ICMA 3N2GA 2PSFA 3A1WA 4B2PA 3ROFA 3OMWA 4U63A 3M4ZA 3SC2B 4LF4B 1GA4A 2GZSA 4EY7A 3RAJA 2R8YA 2B0JA 2YINC 1U8UA 4QOFA 2C8LA 3QK7A 4ZARA 4I36A 2IOFA 2XADA 4HPJB 1LSUA 1AKRA 4C3ZA 3BWYA 3O75A 4JJZA 3A4IA 3C5HA 3LL7A 1JQ5A 3PC2A 4I9NA 4L22A 3FFXA 1UFRA 3MUFA 4JYMA 4V0NA 3CA8A 5FQOA 1CY0A 4C0XA 4J43A 1BDIA 3ND5A 4PO8A 4IOKA 1QTQA 3O9VA 1O4WA 1YMUA 4RDCA 2X9VA 5HMLA 4YMHA 1JR3E 3SQWA 4M49A 3UMBA 1FRQA 2RONA 3FZEA 4HGRA 1DRVA 4CF3A 3A1SA 1LJ8A 4Z8YA 1GUAA 2R65A 1BXGA 1DUVG 2Z43A 4AP5A 5G0VA 3MRSA 4XFJA 3OI7A 1D6SA 3D2AA 1CEQA 1GNSA 1PNRA 1PT8A 3ER6A 3C8ZA 3HV0A 2F7SA 5HZMA 4QC2A 3KYDB 1XFAA 221PA 4CLRA 1MKYA 2R97A 1UQRA 5BV1A 5CBKA 1K6IA 2CXQA 5JS2A 3RTAA 1NUHA 3AFHA 4PBRA 1TM7E 1P2BA 2XGGA 4WZZA 3VM6A 1IHUA 3LC7O 3CKMA 3NHJA 1XCGB 4LJ4A 3VU9A 3U3XA 3MMSA 2YVUA 1ZD1A 2E4VA 2O7VA 3HO6A 1NKTA 4M46A 2WM2A 1W52X 1CUWA 4ZGWA 4MQEA 3G7UA 3NANA 4O8ZA 3NPAA 4RL4A 3LUGA 3JW8A 5KB3A 4IVNA 5DGHA 4BNVA 1I51A 4E4TA 3G5AA 3PD7A 3B89A 4BV8A 2AH5A 4MINA 3PXBA 2ZUCA 1TTTA 3F90A 1V1RB 1TMYA 1ZNQO 3ZNOA 3HNRA 2M6SA 4X60A 3MPOA 3G88A 2YWCA 3AWDA 1LF5A 4RQBA 3V48A 3LX6A 1WD7A 3MQ2A 2PWBA 2KX7A 3D5QA 1MB9A 3BA1A 1X7ZA 4NP6A 4ZU3A 3GLVA 1YDHA 2PD4A 1MF7A 3LPCA 4Z8XA 3IE2A 2VZ8A 4GG1A 4JCOA 1JEYA 4F4FA 4ETNA 3MWJA 4KZKA 2QB5A 1U65A 3CE6A 3HXTA 4G86A 2Y1XA 2HV8A 4UREA 5LUAA 2XDQA 5JTUA 4QVGA 1NR1A 1AHNA 1W85B 4W6ZA 2B37A 2GN8A 4FUTA 2O1WA 1J97A 3KSZO 2EHJA 5TEWA 1TM4E 2OT3B 4JS0A 4MUEA 4P3KA 4Q1DA 4B71A 3B53X 4KW7A 4H9GA 3THXA 5C9ZA 4HAVA 2GS9A 4LI3X 5BP7A 3YASA 3F6SA 5D2CA 2V5UA 1SC1A 1QHEA 2YRFA 4ND8A 1X39A 1KY4A 2B2XA 1QAMA 1G3RA 4Q1CA 5FHRA 5DM2A 5E95A 4YMUA 4EW1A 5LA6F 2AQ8A 2HC9A 1AGPA 3FF1A 4AYWA 1D2HA 4MO9A 1WUYA 1Y8QA 2IOYA 2GAOA 2J67A 1G8GA 2AMVA 2Y68A 2Q9UA 4GNKA 5H5JA 1NRWA 1R0YA 2PX5A 3AKDA 4LBVA 1P17A 2RFLA 1N2GA 1P1BA 3F46A 3U3KA 3OE4A 1P6XA 1V3QE 3IUBA 4FE4A 2FFAA 1XD2A 3LY8A 4AYTA 1MD9A 3VMFA 2QVGA 4R98A 4AUMA 3NVKI 3DVLA 4FJ0A 3EEYA 3OPMA 4MUNA 4KYVA 4RCZA 1P3Y1 1T2FA 4E32A 3OICA 3K0BA 5T41A 5DHFA 5KS2A 4UZEA 4Y1GA 1EFDN 1P7PA 3RJTA 4FLMA 1NYTA 4XX1A 1WTAA 3CURA 4GO1A 5IG2A 2AN1A 2OHJA 2YV5A 2ZE5A 1E2NA 5TB5A 1RPNA 5A1TA 2C5GA 1IXSB 4P4SB 1M67A 3ZBQA 4DYDA 5K0LA 3UWKA 3PWSA 3ZE2B 5JI2E 1K9VF 1JHUA 3QKIA 5DGDA 5HQTA 3D7RA 5F23A 3AJRA 2QX8A 3HLYA 4RYDA 1XDGA 4JYPA 4EFLA 4V1CA 4JYBA 4RLFA 5C7OO 5I4CA 5C1OA 3M9XA 3I1FA 2LZ0A 3PIIA 4G8CA 1TIKA 1JIUA 1ZH8A 5GJVC 4HNUA 2QD4A 1D6NA 1UOQA 4BP9A 3N2GB 2OXRA 3IUMA 4KXVA 3BRWD 2N9UA 2RGBA 3GFFA 3RFUA 4BPRA 4TXNA 3D6TB 1VXRA 3JQ9A 1E9DA 3WNDA 2N1BA 2QXUA 3AP1A 3VOAA 1T15A 5LMNB 3P45A 2IV7A 2OHGA 4CJXA 1U2QA 1N6OA 1TUEA 2Y1KA 1GTG1 4OGWA 2P91A 1BVHA 2GSWA 1RAGA 5A04A 2YN2A 1R0WA 2GEBA 4CHGA 2YWRA 4PAQA 5G53C 5JD6A 1Z0SA 2VYVA 4FMCF 4ZANA 1R4MA 4G1MB 3SLGA 1LDBA 2W6PA 2NZUG 4I5DA 3O4GA 3WGVA 3I3SR 4F3TA 6AT1A 1ZNYA 4WIAA 3RUIA 3NH6A 1K66A 5J2TB 2FA9A 4A5SA 3U6BA 3X1JA 1KZ9A 3NT2A 2DFDA 1OZAA 5JZVA 1JILA 1RKQA 3AL2A 4NOKA 2B21A 3JAWA 4L4SA 1XQVA 1M6VA 3WLSA 5CT5A 4UAVA 3QNMA 4E1AA 1XRRA 5H1YA 3LL4A 4EKEA 2EW1A 1R27A 1HL7A 5CLIA 4C5BA 10MHA 1TFRA 5GOZA 1G5QA 3WLFA 1GRQA 4IRUB 4X95A 3IKLA 2HI0A 2QT9A 1FVHA 1E0KA 3AFNA 3EDOA 4TV9B 3MIIA 4DV1B 2V0NA 2HA7A 1A2QA 5AT1A 1UKZA 4QYWA 1T1RA 1ISRA 3PT9A 4GWGA 3DEFA 3OZUA 1GFIA 1ZSNA 4PQRA 3WK6A 4CV2A 3BQNB 3KSAC 3ZXIA 2I22A 1R9GA 1BEEA 5C52B 4DR5B 4QQ8A 4LXYA 1DUIA 1E6EA 2QUBA 4L5BA 1ZUD1 3IRUA 1KXZA 3BGSA 4YALA 1WSBA 3ISJA 3KOYA 4RTSA 3OEHD 2WF7A 4YAUA 1TAQA 2PQ2A 3WSWA 3FSRA 3GLFB 1BO6A 4HRXA 1U6KA 2A2ZA 4JQOA 4B79A 2O8EA 4GWLA 3EXG2 5B7PA 1H2RS 3KM0A 1MJNA 2UZ1B 4MYCA 2OV2A 4E1BA 2IXAA 4BP3A 5FF9A 4DCTA 1I24A 2ZVPX 2BDEA 3GBPA 1DEAA 5C5EA 2PH3A 3W1EA 3E1KA 1AA6A 1ZQ1A 1ZCFA 1AKMA 1MH1A 2ZIUB 4HGQA 1L4LA 4RENA 2BGTA 4WV3A 5CX1B 3BXGA 1U2GA 3NCHA 4ZZIA 5JXHA 3FUTA 3I9KA 1YQGA 3V8PA 3A6FA 1KU0A 1AQJA 1F0YA 1AQLA 4C2BA 1MG0A 1WMSA 1N77A 2JEZA 3NIFB 4OKSA 4BNJA 4ND8B 4CKBB 3LT0A 4MQBA 5IUJC 2EW8A 4XDYA 4F8EA 2MMCA 1BRTA 2CL0X 2Q3EA 1HE4A 1K75A 3PXAA 1KEWA 1CY6A 1L4NA 1C8VB 3IALA 5IBCA 2PZGA 2GA9A 4JMLA 3WO1A 4DIKA 2XD9A 1DQPA 4FJ1A 3W9BA 4DIDA 1PV4A 2VH2A 1OFGA 1JRLA 3PDIA 5BWNA 3X43A 5TEVA 3PXXA 4HX2A 4OHRA 2ZQZA 4NHOA 3O84A 4R9SA 5KOHA 2BBSA 4S1OA 2X0EA 3O4JA 2QF7A 3E9NA 4NBNA 1AXRA 1ANKA 2OQRA 3K16A 3OT4A 2RB5A 1A7KA 1OCEA 1R10A 4ZO9A 5ERYA 4ESVA 3H8WA 4C4RA 1XMSA 1ZK2A 4U7PB 4XCXA 2JH3A 1V96A 1WW8A 3AF2A 2R1UA 1FYEA 4DAOA 5B7NA 1QR6A 1Q57A 1W0KD 1R4AA 3NASA 3OZDA 4NEGA 4OKIA 3CX8A 3LH5A 4B74A 4CMIB 5FNVB 1ES9A 2J32A 4WOKA 2QYOA 3Q7TA 1DAEA 1G4HA 3D1LA 3V9AA 2QM8A 3TLGA 3WKEA 4KPYA 3ENZA 4MYRA 5JMPA 1DKLA 4WK0B 4DV7B 2WDZA 4G0NA 4YV7A 1FS6A 4PLHA 1OPXA 5CBPB 2ONJA 4Y9DA 3B3AA 5AW2A 1P19A 1J2UA 2XRMA 5AR1A 3RYFB 3CVXA 1YZTA 2H3EA 3I6ZA 4C0QC 3RGGA 2A0UA 2HHAA 5L9AA 3QVJA 3ZKWA 2RGXA 4INPA 1QVAA 5JXJA 2K2WA 2AI2A 4XYEA 5KQGA 4QZVA 1G8KA 2JGMA 4QTYA 3C0KA 2YMPA 1G5HA 2AC4A 5K0GA 3MT0A 2AG1A 5KNLA 1JDJA 2FPPA 5HUJA 5DYIA 1CR4A 4RV4A 5CEJA 4Y2VA 1VMAA 1IEVA 1E8DA 1QSGA 2E4ZA 2MJLA 3FIUA 3VDRA 3KQLA 2ZYRA 3CB4A 3EB9A 4OIMA 3JCZA 4KR7A 4PG5A 5ALVA 3CX7A 4A91A 4E3ZA 5AVQA 2FFRA 1KVSA 3WWOA 3AVVA 2FGJA 1Z4MA 2JFPA 3RREA 5JS7A 5BSTA 1SG0A 4WFQA 3HL0A 2XB6A 4FFSA 2QUIA 4J1NA 4LY3A 4NCNA 1D5CA 4LMAA 2TMDA 4RAQA 4JKYA 3TB4A 3RHZA 4V0RA 2H0AA 2PR7A 2WF5A 4JP1A 2Q3LA 1H9CA 2NTVA 4OI1A 2RI6A 3AUTA 3C98A 4UPEA 1QDLB 5JS6A 3EE6A 3ZI4A 4DCOA 4QTZA 2VSXA 1E3WA 3P9KA 1NI5A 4L72A 4TYQA 2FCRA 5KHAA 3WYFA 2ZT6A 4BMCA 4J75A 3DHWC 4BO2A 2BVNA 3WYNA 4Q02A 4C06A 3ZY3A 2CXXA 2FW0A 4Q82A 1YHYA 4MUGA 2D0PB 2G6BA 3K0CA 3QMMA 1D1TA 4XUCA 1US8A 3DFZA 1TQ2A 1T35A 5EFOA 4EHIA 4L4XA 3IV9A 3N3AC 4YJFA 1U1IA 1WABA 4R2JA 5AHRA 4YTEA 4HYYA 1HH4A 1H9BA 4MGKR 4N0DA 3RQIA 4V3BA 1JBQA 1P91A 3PJRA 2ZRNA 1M6YA 3IKMB 4ENVA 1PJ4A 4LRXA 3LCMA 3D4PA 5CLHA 1WSWA 2GLXA 2CNOA 2GT1A 5JNUA 3G3EA 2FMXA 4YRTA 1QIIA 3V2IA 3W5AA 4O8CA 5LOVB 1RW4A 1TYDE 3HG7A 4BCBA 2GX6A 2ZJ6A 1I4LD 3W9UA 1I1QB 4XWWA 4DY4A 1Q0SA 3MTBA 4YHBA 3OKCA 1Z07A 2IPLA 4LDAA 5JDCA 2FX2A 2JATA 2NZJA 3WBBA 2ZJ8A 3TIFA 1F6WA 1U90A 4UAGA 4CM3A 1XTIA 1TO6A 1ZCAA 4GX5A 4A2CA 4Z9XA 4BX8A 2XA1A 4BDSA 1I7LA 1V5FA 2OBMA 3RYTC 3ZWBA 2WNIA 3TNJA 3HS3A 2VPWA 5J47A 4MGEA 2GESA 1NXVA 2GAFA 1EK1A 1J07A 1FNDA 3TQIA 1YDFA 3E5NA 1H0HA 1JWBB 1CQIA 1B26A 3FYUB 3HB1A 4V24A 3KWFA 3K3PA 5FFFA 4C0KA 3OQNA 1FFXA 5TC4A 4S0XA 4IL5A 4K6GA 4KRYA 2YZ2A 3CEAA 4J3FA 4U9HS 4CKEA 2P6RA 1FRFS 3DJYA 5IHXA 4FLFA 3T3DA 4OD0A 2O8FB 5EP2A 4NWIA 3T7SA 1RLMA 4I1OA 1AUPA 2AMLA 4DCPA 4JN6B 5C1IA 2YX1A 1XRLA 1EGHA 1FCJA 3EXG1 3PV0A 3GIDA 3ZY4A 5B4UA 3QVVA 1U6JA 1YQEA 2EP8A 4TPKA 2HTFA 2VI5A 5L7TA 3PLAE 3P2YA 5KU7A 4B6OA 2IVFA 1DTWA 2CJPA 4G8BA 4IEIA 3ZD6A 2IDZA 4Q3OA 1VE6A 2C2OA 2GBIA 4YP5A 3VHQA 4L5YA 2DG2A 4I19A 3WFJA 4FYJA 2FSGA 2OORC 2C2WA 2VDPB 4CMBA 5U1PA 3MGBA 4LYAA 4JXKA 4AMYA 3QX8A 5H3LA 3DT9A 1Q77A 1RWXA 1UMCA 3CRZA 1KEUA 5ICSA 4QKQA 2CD7A 2FG5A 2GF0A 1ZG3A 3EZYA 3GY0A 3COSA 4JUAA 4N01A 3GOQA 3Q9UA 4BEBA 3NI2A 5ALSA 4FNOA 4AMVA 2WR8A 5EHIA 3E05A 2GBLA 2QG4A 1Q7EA 5LVAA 2LTAA 3WYGA 3NHPA 4N7JA 1IBRA 3M4JA 1KC1A 2IUYA 4CMIA 3FCEA 4FYIA 1GYPA 2OKGA 3MXTA 5DDIP 4YMLA 4DLTA 1XBTA 4H16A 3M4NA 4BY9E 2CY0A 2ECQA 3RASA 4JENA 1ESMA 2EF1A 1UC5B 4D9IA 3IMEA 5MF6A 2C4KA 3PA8A 3ISTA 1RXIA 1OXSC 2OLJA 5KDLA 3R9XB 2JLSA 1JHDA 5EWMB 3CF2A 1ZJ5A 1VMKA 2JHGA 4FYXA 5BOSB 3LUCA 5CB8A 1EINA 3OPVA 4W7SA 3P9CA 1I2AA 5B53A 4NEQA 3VJLA 3ZD9A 4HOYA 3BFJA 4BLTA 2AZMA 4UNQA 1JQJC 2IP2A 4YXWA 4QQKA 1C3XA 1QGOA 4EABA 4J6EA 3FBWA 5CA1F 2IQIA 3WAJA 3FLBA 4AO8A 4EI9A 1FTGA 3GMIA 3MB8A 3ZNPA 5KYUB 2HHHB 1IQUA 3O38A 3B3GA 1BH6A 3IVCA 3PIDA 2DPXA 4XB1A 5AM5A 2EJUA 4JJ7A 721PA 2J9XB 1KQGA 5E6SA 1NNI1 1VB5A 2R79A 2V4MA 3OIDA 5EC8A 1W5SA 2BDTA 4LSGA 4UE3S 3B6EA 3NTUA 3ZZNA 1DX4A 1DARA 1KS2A 4QGSA 3LGAA 5CW1A 4P80A 2XUAA 2ZIEA 1MENA 3QG1A 1XZPA 4RTNA 3NTLA 3RVJA 4L51A 3SYMA 3KV1A 3ADOA 3CEPB 1PJ8A 5FH9A 3IPCA 4DZTA 1A04A 1NW8A 3T3GA 1NBIA 2ZOSA 1PL8A 3PP8A 4G3XA 4TMFA 1YFJA 1MBZA 4BRWA 1AGYA 3HN7A 1UFQA 4YCBA 2UUCB 3CISA 3DOEA 4F91B 3ZJTA 4NVRA 4X1YB 5G1NA 3GFOA 1D2EA 5CFRA 4CLRB 1RJDA 4QRIA 2PZ8A 4P7JA 1ZD3A 3D64A 4IX1A 3Q0EA 4ZI7B 1W0KA 4FT2A 2AB0A 1HDYA 1XMQB 1RYFA 3GHYA 3VC3A 4ANFA 4QBTA 3T3MB 1X7XB 2B6HA 4D3XA 1ZU5A 4LX8A 2B92A 2GAIA 1N75A 1LXCA 2HXSA 3LP8A 2Q5HA 2R85A 2TMKA 3R20A 5H7XA 3KL4A 4N47A 4W5QA 2FDCA 4GL4A 3WMWA 1ORRA 4MCJA 4GD3Q 1KI8A 3KZKA 3MCWA 1BNCA 3E7XA 1KHTA 2GRAA 4FXOA 4GI1A 2OWEA 5AHXA 2V54A 4IIJA 4J29A 5JAMA 1JR4A 4AZ3A 3JZAA 5DNAA 4OSPA 2NQ8A 3NTOA 2G9NA 1C9YA 3A1FA 2H92A 3RYFA 1H4SA 1VI2A 2DBRA 1CZUA 3SS7X 4DSAA 1SHLA 2BGUA 3K53A 1AGXA 1OAAA 2A3NA 2CUKA 4YCSA 2FZWA 3DONA 2EATA 5JZBA 3HDHA 3HYTA 3O4FA 1UZLA 1P2GA 4WGGA 1L6RA 4FN5A 5CT4A 4L4ZA 3TTXA 3UH1A 1GDTA 4OX9Y 3JPWA 5PGMA 2DBYA 1XHFA 3LWBA 1D0SA 2I3BA 2MMGA 1DAIA 2E5FA 3AR4A 3E61A 4Y9SA 2BGMA 4HVCA 5DLYA 1ZR4A 3PI7A 1CF2O 1L1EA 3L3BA 3PJDA 4UTZA 2BGGA 3HNPA 3CTMA 3T15A 4IIDA 3LBNA 2WHPA 3ZGOA 4W9MC 1T2VA 5E2IA 4HG2A 5TGDA 2GM9A 2IYWA 2XB4A 1KI6B 1IHDA 1GPMA 5HIJA 3IVRA 1U8EA 1A9RA 3U3MA 2A9KA 2GM3A 2IEBA 1A9PA 4L16A 4MI1A 3WZLA 2HW8A 3OIUA 3ZDAA 2VTBB 1ZD8A 2VDOB 2PANA 3WOVA 5HQ3B 1DE0A 1VSQA 4JL8A 4G5FA 3TNLA 1MCZA 4NCKA 3FNFA 1HPLA 2MSKA 2PFKA 1JJFA 4ZOBA 4Z7JA 1UM9B 3SP1A 1RJGA 2JG3A 1IU9A 1EFPA 1P6UA 2BMWA 2X19A 3F5QA 4X7PA 4BO5A 2NYRA 3ZI7A 1NBMD 3PUXA 2ZBGA 4LN1A 4IDQA 5KYYA 1CTQA 2OOSA 2HA6A 2PLFA 2HY7A 3G8YA 1Q5PA 3ZDBA 1T2UA 2BBOA 1PZEA 2OSBA 3VPCA 2W9XA 2PMCA 5C80A 1U2EA 2ZR8A 4CEIA 4REQA 4BMSA 3O8CA 1IHPA 3I28A 1Q0HA 3AETA 4C2TA 2IEDA 3VVCA 2E87A 3KETA 3VYRB 1ZK3A 1HOXA 2D2IA 2RGAA 2WZQA 1YFZA 2Z2KA 5HA5A 1XTZA 2H85A 3HFGA 2PV0A 1MRSA 4U39A 1MA0A 4A26A 5FI3A 3GPIA 2OFPA 3CXRA 1YA8A 3G79A 2GNAA 1F0PA 3ZE7A 3DZDA 3KBOA 1JXMA 3WLQA 3WQBA 2Z3VA 2ZBFA 4HH0A 4OQMA 3I61A 3DAGA 1GG5A 1VPTA 3LQYA 2NZYA 4H4CA 4TZKA 4NZYA 1DWPA 1L7OA 1N2XA 2GZRA 2YHAA 5ILGA 4DA6A 3EVAA 2DM6A 4BS9A 2R86A 2AOXA 4WASA 2BFEB 4GH5A 3EGIA 3MRVA 2HSGA 5ER6A 4F04A 1OX4B 2ASVA 3A4TA 4OBXA 3V4RA 1SR8A 3MLEA 5EUMA 2WTNA 3JWEA 1BX0A 3M6LA 1WULS 3JQGA 1GQSA 4UEOA 1TK3A 3R9XA 2J6HA 3E82A 3BSSA 1V3VA 3BXOA 2JIZD 4YCAA 3OTWA 5JW6A 5CK4A 3EIQA 1I0LA 4DLYA 1ORVA 3PCTA 1EZZA 1JALA 2ZU6A 4L9AA 2PEZA 4MUBA 1NXSA 3IBFA 3CNBA 3LXXA 1OLXB 4FW9A 4K3VA 4CKEB 1HYEA 3BEOA 3HDQA 3JQ6A 4FDVA 2QRGA 4QUEA 1JLLB 1RWOA 2EARA 2WSLA 3DBVO 4PSCA 4RPJA 5ELLA 5HJ2A 4N8EA 3GK3A 2AD1A 4FB5A 1DRKA 1VPVA 2O3RA 1NONA 1P61B 2GFQA 2QVBA 1XVAA 3GRPA 1Y1QA 3QLTA 3LPMA 2Z6QA 3JAMA 4I1UA 1QTNA 3KOWA 3PDUA 1Y3CE 1DGQA 1GXSB 2X6QA 3IAXA 4ENSA 4V0MA 4LCBA 3NTVA 2ZPAA 1GUBA 3Q8XB 3K70D 3MS7A 4AMZA 1Q7RA 1EG2A 5C4IA 2ZXFA 1NBMA 2KBFA 4GMHA 4GXTA 4YUWA 2ZYUX 2P9FA 3MUOA 2GZMA 1F8XA 3AJEA 3RK1A 2IW1A 1IZ9A 3GFVA 2Y4NA 1E3MA 4XH9B 3FTDA 1UZNA 3W9SA 3HPQA 4KQFA 4OXIA 5IN4A 4ITUA 2IZOA 1XK7A 3BXFA 1D1SA 5IKXA 4DILA 4ZOLB 1YIAA 1OH7A 2XCLA 3ERCA 1IHYA 5H70A 1SHZA 1YRAA 4KWHA 3DNMA 1XTVA 4ZU1X 3AR7A 3FDFA 4D25A 1M1YB 4S35A 1CG6A 1RQGA 2Z8YA 1WMEA 4PQGA 4B7CA 2F1OA 1UZUA 3AIIA 3TZ6A 5T4EA 2ZROA 1W9MA 2BCGY 3SE7A 1GR1A 1YR3A 1EFLA 3L0SA 2BLLA 1SHUX 4XAQA 4KODA 2PGNA 1RZRA 2V65A 4AXBA 2P65A 3T1TA 3E53A 1G0OA 1NQTA 3MBOA 4H77A 3I45A 4BGIA 4TT3A 2O23A 2GXUA 1SMKA 4PAMA 4M0UA 2IDJA 4K6CA 3BB1A 1GGFA 4NEHB 2Y27A 4UU1A 1DINA 2F4VB 3BT7A 4A1OA 3LQKA 3ZV7A 3P2MA 4IJ6A 2V9ZA 3ND7A 2MINB 1OTHA 4D8VA 2YNMA 1L4BA 2OECA 4JLAA 4U2BA 5E9QA 4RNDB 1A4XA 3TL3A 4CPDA 4G0VA 3SZLA 4EMBA 1GZ5A 1WCIA 2JIZA 3E3AA 1UPBA 1NX9A 2OV6A 4GQIA 5EJAA 4G63A 4BE9A 4B8ZA 1KP3A 2EG9A 1PL0A 3H9CA 2VJPA 1J0DA 3H16A 4QELA 1CNMA 1VBMA 3RFFA 1XP8A 4ZA2A 1HFWA 4DDUA 3DFMA 5BT9A 1CR1A 1ZISA 2HO5A 2DRIA 4F45A 3LY5A 3OF3A 4KFUA 4DG5A 1XQ1A 2OGWA 3FF4A 3PDCA 2Q6LA 4QYMA 1GFZA 1O95A 2IY8A 2COKA 1YJAA 3HLKA 2NU7B 3G1TA 2E4WA 3BL6A 1L5RA 3GUZA 3IP3A 5ALMA 3SF8A 2FX5A 1KNQA 3SZ3A 3DVRX 3ZLJA 1BKSB 3FLAA 1G5IA 2Z4RA 4R1TA 5L53A 2XZDA 4PQFA 4QDJA 4U8HA 4MRRA 1BQ3A 4FS3A 2YYAA 4YDSA 3ZE9A 5HRUA 1Z5GA 4AY5A 5EXPA 3QX3A 4BJ6A 2HWXA 5KTMA 3ZWAA 3M4YA 2PLWA 1YNSA 4KCGA 2VDVE 4WXMA 3CUSA 3IOCA 4JB2A 4GGOA 1DAOA 2Q1YA 3O3CA 3S0JA 5IDXA 4UOQA 4KIGA 3HB5X 3ZUGA 3PPIA 1IXRC 5DF1A 1VKRA 2AUNA 3SDSA 1OZGA 1Q3HA 1OYYA 4KN8A 4DMGA 1UJMA 2WM8A 3C5VA 1HR0B 1L4FA 2NADA 1MIHA 2W2PA 3PFIA 4PWZA 5B6IA 1U3FA 1JWAB 4J2TA 2EKDA 3MWFA 3RDPA 1ZIOA 2HYDA 3C3AA 3MSCA 3FNIA 3N2IA 1P72A 3TR5A 4QDUA 3OURA 2VYQA 3H8SA 4IUCS 1D2RA 3S8YA 4KG7A 1BA2A 1NW3A 1Q7CA 4NYIR 1MOZA 4R6WA 2PS9A 3DR3A 1FMTA 2QG9A 3QPAA 3BHIA 5EWMA 1EVYA 3L49A 3WYBA 3CVWA 3VA7A 4KR0A 5GOTA 3W78A 2B25A 3N59A 4EHNA 1UBUS 3QVTA 2O06A 3PGMA 4LTMA 5DULA 5TMDA 2V55B 4QGHA 4OQNA 4CCWA 4E5DA 3WLJA 1KXJA 2YVAA 1RRPA 2JH8A 4LRQA 2MWMA 4EHDA 3LPDA 3OE1A 4RD0A 1NJ8A 3Q7RA 4R3WA 2BYTA 3F8WA 3KOMA 3EXFB 5ICGA 3S27A 2VL7A 1KPHA 1X8KA 2ZRIA 3GFPA 4CUKA 3OMXA 1U5BA 1Y1SA 3A6LA 5ILQA 4DREA 2ZXEA 4W99A 5EINA 4GX1A 1YK1A 2X0KA 2WA1A 1WEKA 1BEUB 2WPDA 4OLJA 4YN3A 1K27A 1RI3A 5J2UA 2O59A 3H9BA 1DU4A 2J59A 5JNVA 3PDHA 2CV0A 1PK9A 1BCRB 1U0OC 1EUYA 2AFVA 3F6CA 1JAHA 1UXHA 4PZDA 4GQAA 1U1CA 3KKZA 4QQNA 4JC4A 4D41A 2J41A 1E9CA 5KNDA 1LLUA 3WLIA 1NQ5A 2CD9A 3FCXA 2ZQ5A 4LMRA 4B3GA 2Y1EA 1NKSA 1Z8HA 1E63A 1N6NA 3EG5A 4PSUA 3O1HB 4RVUA 4D79A 5CRIA 1WU7A 1LLQA 1SXQA 4NSNA 3P20A 1O0CA 3D1VA 2Z9BA 5FOQA 1Z4IA 3NM6B 2ODQA 1NXTA 2JFVA 1T1GA 4GPTA 4PFSA 1SKBA 3AY7A 1BKYA 3O3MB 2XPCA 2QOEA 4KIUA 4XZ3A 2XUZA 2ERCA 3Q5GA 3ZV4A 3M2TA 4MAFA 5L3VA 1HA3A 3DZ8A 2QHXA 1TIPA 3EW9A 4FMPA 1GPAA 3OESA 5ECDA 4RK7A 5K51A 4YCNA 3LDUA 4G1VA 3WI7A 3O1LA 5BUQA 2WTMA 1MEOA 3MWYW 2OA0A 2C5SA 1POWA 2JLQA 3HKCA 1XLTA 4M54A 1XSEA 2OO3A 1LDGA 3BH0A 1VLZA 3B1FA 4O29A 1XAGA 1I30A 4XDGA 3TBFA 4D96A 1LWOA 2XGMA 1NBHA 2WU0A 1XVLA 3HEMA 1W1IA 4YAEA 1WY5A 2VDKB 1YQWA 1N5KA 4FIZA 2GJ4A 1Z2OX 2D06A 4C76A 1PJLA 4QUDA 5HZHA 1F06A 4KX3A 1VPLA 2QL9A 3TVTA 4XWKA 2X58A 3A6DA 2IEAA 3JQGB 4JI3B 1OFVA 5SY4A 4K40A 1JNXX 1HLFA 3I2YX 3IBTA 1M0TA 4UEWA 4K1XA 1NF9A 3CQ9A 2HJVA 3OM9A 3PTZA 4L4RA 5F64A 2H1OA 4BOYA 4C2UA 3NIBA 4YMSA 1P7CA 1OT5A 2H5IA 3G89A 1AKTA 2GA8A 1HQYE 4XVHA 1RFGE 4U5XA 4DBLE 5JXGA 2R4QA 1M9NA 1TYAE 1IFXA 1B0PA 3OCZA 5CVEA 3ZGLA 1R4MB 3JRWA 3D6NB 4LV5B 2V7VA 3QVSA 5TJ9A 3UXEA 2JRCA 3DMYA 4UDYX 4QG3A 1N3LA 2XCUA 5FORA 3DZFA 4LBYA 2PT7A 2BEWB 4HD8A 5KDDA 3WAKA 3R8FA 5K05A 4BIMA 1RWVA 4Y2PA 3QSYA 4GGPA 1ORHA 3BSFA 3IIKA 3NHLA 1ISHA 1XA4A 1DAFA 1T4GA 4MQLA 2FPKA 1L1FA 1FFXB 5HE9A 1D9XA 1TMOA 2IZ1A 3CZRA 4OAPA 4PC6A 4YJ2F 3ZDZB 4U7WA 2BHTA 2YKGA 2NZXA 1BW9B 2ECPA 3E70C 3IULA 3DCYA 3FYDA 2JFBA 3W4JA 3IV7A 3IQZA 4FPXA 3K5HA 4LG1A 3AKYA 3ZQ6A 4OFXA 2PMWB 2Y1LA 1B6TA 1RS0A 4DBVO 1W4CA 2QJOA 1VG8A 1RYZA 4GIBA 1TW2A 1JMVA 1WAMA 3DD5A 2DHDA 3DUFB 5JJIA 2E1RA 3AHCA 2V8OA 1X8JA 4KQGA 1RRKA 4ZT7A 3JZMA 3PKJA 1M1YA 2PGDA 3JYPA 1QWOA 4JJEA 1EIWA 2Q3FA 2NXNA 2B5WA 2IV2X 1NQVA 2Y0PA 1DBPA 3D3QA 3H2IA 3UV6A 4Y0NA 3SI7A 5CIQA 4Q7EA 2B5VA 3F98A 3K1JA 3NX4A 1PF7E 2DAPA 3QV1A 3BMQA 1DC8A 2BFEA 4YRGA 5F2NA 3ROTA 1WOMA 1OH5A 4JOSA 4ASUD 1CVLA 1IZYA 1XCLA 4M6WB 3QV2A 1XF1A 5D7BA 5TR9A 1UKAA 2RHWA 5CA1A 3BC1A 2PIAA 2H6EA 1ZM4A 2I62A 5BNTA 1FJHA 5JANA 1L5MA 1FXUA 1VCNA 3W79A 5JU6A 4DGQA 2XTNA 2P4EA 1BGWA 3K0EA 1OIXA 3CLKA 4UTRA 2BWJA 1GZ4A 2RAUA 1OMOA 3OPXA 5LMCA 3VH3A 2DR0A 4TWRA 1KJNA 2A1IA 4WNYA 3RSGA 5JAHA 4YRZA 4CKZA 4CKYA 2R68A 4HQ6A 3LV8A 2FPRA 4YFYA 2Q46A 2XKBA 1LTQA 3UJNA 3BK2A 3KHUA 1Y1RA 3LFUA 4MW1A 2BMAA 3ROKA 1M8GA 1EDZA 2J48A 3NONA 4L1KA 2DLNA 2F9MA 4UHEA 4C7JA 4BC1A 2F3PA 2OV4A 3ZJ4A 1ENYA 3Q7IA 3SXUB 3A1EA 3BRSA 4CMEA 2VAXA 1O0BA 3CN9A 5TQ0A 3WS7A 4YRIA 1XNJA 1FFGA 5KSZA 1E3EA 1HDIA 5P21A 4BTEA 4FD2A 5KOHB 3G5LA 4HFJA 1KYTA 3E0QA 2CZGA 4XGKA 1L7MA 3HNOA 1R2QA 2XWPA 3I4CA 3DMFA 1E7YA 3JVVA 1JEQB 2G70A 4KAJA 4ZO8A 1X1QA 3FJOA 5FEMA 3ZW9A 4YDQA 4ARBA 1WW2A 2RHJA 3Q1KA 4LS3A 3RVPA 2JPDA 2Y1DA 3DB1A 4CL3A 4EKNB 1E0AA 1X8XA 4KN6A 1JI3A 4DRZA 4EUSA 1B00A 1O6CA 1XC7A 3O82A 4DRYA 5I7VA 3DLBA 1IJEA 5A7GA 1WUIS 1Z2NX 4IHKA 1MAUA 3PIRA 4KXYA 3I9NA 4DR3B 3WLNA 2B8NA 3QKSB 3SNHA 2ZTMA 3D8NA 4WLFA 4ZVMA 1GPWB 2HMAA 4OU5A 4LJKA 1AKWA 2VNAA 3LWNA 2AI1A 2WM9B 4LWQA 4WNIA 3T5PA 2N46A 2C04A 1EFVA 2EZ9A 3DV0B 2DC1A 2WDPA 1ST2A 5LBIA 4XSVA 1ZRHA 4EF4A 1ZOOA 1KMHB 1PNTA 1Y33E 5DLQC 4K86A 3BIFA 2Q1WA 3S8MA 2CE2X 2R1VA 1ZGJA 2ZIAA 4JLBA 3IJEB 1P81A 2JJ2D 1ONPA 1VE1A 4FGSA 2NXCA 4UVEA 5E6UA 1I5EA 4ZQCB 1CIJA 4DJFC 2PS0A 2ZT7A 1TQ6A 1R0KA 3TJZA 4FFMA 3OIVA 3RVNA 4NNOA 4E5VA 3LX5A 1Y8RB 4E22A 4JT4A 1IEWA 4FDMA 3FZNA 4KO4S 3I6IA 3MB5A 4QULA 2YFYA 2B78A 4A2WA 3DFFA 4JASB 1JSRA 3AEXA 5AJTA 2F3TA 1HNXB 3FDIA 3WJ7A 2VBIA 3CGWA 2G9QA 3K73O 3WISA 4Z9YA 5IM4A 2Y0EA 3BXZA 4MQMA 5T3YA 1Z68A 1G20B 3CZ4A 1A8UA 4ID3A 5JAIA 4YUVA 1TM3E 2Z8XA 2G9VA 3U49A 2JLXA 1Z17A 1J24A 5DI3B 5C31A 4NU8X 3HL4A 2QVXX 1DXOA 1LZKA 2D1TA 4GOJA 1ZLXA 1ZXBA 4R7ZA 5EXTA 5A0VA 3B1JA 2NU9A 4B35A 2BR4A 4YV0A 3FPSA 1PI3A 2CHFA 3QG5A 2FWMX 4UUBA 4WCFA 2ORED 1BWRA 2CVFA 3ANTA 3IMFA 3T7IA 1JXQA 4BXOB 1V5EA 1PGOA 4CG1A 1CQZA 2Z8YM 3EJ6A 4N03A 1YULA 2AQIA 4O4JF 3DL2A 3IMKA 4QA9A 3L7KA 1B7GO 1FW6A 1J1IA 1HMPA 4MHOA 5CYPA 2GN9A 5FA6A 4L0MA 4Q5IA 2Q7XA 4LF7B 3F9CA 2X4GA 1U31A 1VIMA 4FC7A 5EEGA 1GG8A 4ZI5A 5J4VA 3V4LA 3WICA 3STUA 4JKOA 4L9WA 2XT0A 1IQRA 4PZAA 1V45E 2VT7A 5A4MS 1PWHA 4I4CA 1YS7A 2PKQO 3ELYA 2XTAA 3CUVA 3H2SA 3MOIA 4UJ5A 2AFIE 2IYYA 2IVZA 4G56A 2KHZA 4ROTA 5DM4A 5FULA 1HV8A 4GOLD 3QXXA 3L01A 3RYIB 2G67A 3SC6A 4QBKA 1TEZA 4WK4B 4X8LA 3SU8A 5CMLA 1W59A 1EA7A 4PG4A 3O4IA 2XA9A 4RIGA 2YDYA 3RYHA 2EIXA 3FR7A 2GEFA 3PF9A 4WI1A 5B3LA 1ZCZA 3JQQA 3ORHA 4HP8A 3VR2A 2X23A 5EE9A 2HADA 2MSLA 2DPHA 1T4MA 1TZ2A 1UDXA 4LZPA 3CJQA 2I1WA 5IKMA 4UVIA 3L7LA 2GZDA 1Z15A 4HDCA 1SZDA 3HDYA 3HXPA 3QU4A 1UPFA 4RMHA 4Y6LA 1FQJA 2DTXA 1DPGA 4HN4B 5M5BA 4CLOA 3Q3HA 3MJFA 3K7EA 4DC0A 3OG9A 3C87A 1DIAA 2E4XA 2NAPA 3CRQA 1ZJJA 3QUTA 4KBFA 2ZUVA 4HZGA 3RS2A 2ZIGA 3SJBA 5HS4A 1J2TA 2I2WA 2WLSA 4DA4A 1WHSA 2CXNA 5LYYA 2SHKA 2I3ZA 3C6ZA 4YR9A 5M04A 1SXGA 3PGXA 2PWZA 2WWXA 4F21A 3IT3A 4UMDA 3Q2IA 1ZMOA 4WLUA 1TU4A 2Y71A 4ER5A 1H1LA 1SUCA 4FCCA 4MR8A 4NF2A 1M6HA 1UUFA 3K2BA 1DHRA 4IH1A 5I9IA 5JY6A 1SVKA 5KYKA 1NOJA 1RU3A 4NABA 1FY2A 1LS6A 2G72A 3BCUA 4M60A 3CNEA 5H02A 3U4DA 3TF5A 4DCSA 3RYCB 4G0QA 2WQZA 3JX9A 1HEYA 1UK9A 5CUQA 1MAWA 4XKJA 4Q7KA 4MUAA 1AK9A 3CIOA 2D5IA 3GGCA 4KDCA 3PU6A 3CMCO 4X71A 1MC8A 5GQSA 1UPXA 2I6UA 2P5TB 3UXYA 3WLEA 2BFBB 2P2CA 1E6WA 4DMFA 1ID1A 2BGIA 3E84A 2ZBRA 4DA0A 1YZVA 3G1WA 3L7DA 3W7VA 4F3KA 4U7DA 3PKIA 3TOSA 1J39A 4MVJI 1KBOA 3TLGB 2H0QA 3WGIA 4MRNA 1YS4A 3QUCA 4FZJA 4F1WA 1ODCA 1X1EA 3B6ZA 3KXLA 4LYGA 3KELA 4XQEA 4WT7A 2WU8A 2YICA 4TVSA 4G5SA 1TECE 1GPBA 4Q9AA 4O0LA 5FFNA 4ZTUB 1C14A 1B8NA 5C5DA 2IW3A 5EMKA 5AUOB 4U2DA 5AVRA 1WSDA 2EXXA 1VCMA 2VZ9A 1K08A 16PKA 4JP8A 4QRDA 5LA6A 2W70A 4BEJA 2QLBA 5J1SB 3PHCA 4ED9A 4EGCB 4IVRA 1FTSA 1USWA 4K03A 2YXBA 1XWIA 4M1SA 4OHCA 2DCUA 1V16B 4PPNA 4Q03A 4RD2A 2IHNA 2ZRAA 1XZGA 3CC8A 1H1TA 1TAGA 5LU9A 3AM1A 2WSSA 3DF7A 3BSWA 1FFCA 1SELA 4WOCA 2OVBA 4BCCA 5KREA 5F3WB 5ICEA 4KIWA 3CW8X 4FWBA 3MCUA 5LLSA 1WUTA 3OIWA 2VA9A 1M1UA 3G7NA 3EMBA 1ZVQA 1N2OA 2ZIWB 2CEAA 4TSFD 2G28A 1AF4A 3DXFA 5HVNA 4BLWA 1YE3A 3MCTA 4R5MA 5F1PA 2VRBA 4OFBA 2CF6A 3E3MA 5HM8A 3I62A 4N0MA 2HD4A 2WJVA 4ZCTA 1UKBA 1DRJA 3P19A 4Q05A 3OBBA 1S3SA 2O2HA 2WF8A 2Q5FA 3BIOA 4KO2S 4U1RA 4P83A 4OX9B 5IT4A 3WA7A 3KQVA 4CZ2A 1DL5A 5C5CA 3AVTA 4IGEA 4I3HA 3NDBB 3GAZA 1DHTA 4QECA 2AG5A 4ZYWA 1BJTA 3UWSA 1C4OA 4GHWA 1MPTA 1CDDA 4ISBA 2XVYA 4ZCRA 4M22A 2AOTA 3OZCA 2XYHA 4UPVA 4WOJA 4BFLA 1OYWA 1SZCA 2MTBA 1KEEA 1IM8A 3UBMA 1G7RA 3RABA 3GNSA 3T0FA 2ZWPA 1NVDA 4GICA 1GAEO 1CE8A 4DSOA 3ZW7A 5JYDA 1WB9A 3IUQA 3QIVA 4LDQA 3G8AA 3P2KA 3AF4A 1C7IA 3EN0A 3M83A 5E1DA 5K6TA 3DT8A 1A77A 2YVKA 4ETWA 3ZWVA 4NXMB 3FX2A 1JHPA 3K4PA 3TRIA 1C7JA 1NBME 2VRNA 2OCKA 4HL6A 1J20A 4UMVA 5EY5B 1FSPA 4OAOA 1Y7HA 4GKVA 4V0ME 4XGIA 5KIAA 1CY1A 5E3JA 3R8CA 1VJDA 5L6MB 5JS1A 2QNRA 2GYWA 4YBRA 3T5CA 1JG1A 1YOVB 1M8FA 3IERA 1G7TA 3SX4A 3WXBA 3PNVA 4TSFA 4KDEA 3KALA 1PYGA 3T4XA 3UV3A 1IPHA 1DQNA 2G8NA 2WMDA 3WLRA 1J1UA 3DMGA 2QRKA 5B7GA 1UDAA 4X5OA 1KYZA 2ZB2A 3T9BA 1AKQA 5AUQA 3GVIA 4NBTA 3KYCA 1XVIA 2B7BA 4BV9A 2WMOB 1COWA 1Z0FA 1RWNA 2ZU0C 5B36A 4KH0A 2ZYAA 4LECA 2X9QA 2H48A 3TI9A 4JP2A 3H04A 1JAIA 2PTGA 5ARDA 1HOTA 4ZGGA 1CDOA 3LT5A 4NZ9A 5DHAA 3T95A 4DDTA 2O0KA 2ZGVA 1CF9A 4YPFA 4RHEA 5EJ7A 2D62A 4PONA 2ZIZA 3T9DA 4EO7A 5LQRA 5AVWA 4YO8A 2IK8A 3V33A 4YAGA 1RRMA 3CPEA 4FDAA 4LHYA 4MKRA 1FTQA 1XVUA 3OWOA 4RPLA 1C1XB 3FFWA 1UBEA 4QJ5A 2EZTA 5LP1A 1PYDA 3IB6A 1PT5A 1M34B 1QZXA 3ENVA 5A9SA 3UJHA 1GG9A 3ICEA 2OV3A 3NORA 2R1TB 2EOAA 3DFUA 4KO3S 3SIXA 4XYLA 3D4BA 1P0CA 1Q22A 1EU1A 2G04A 4OXKA 3TRDA 3S55A 2WFMA 1L7RA 2AA3A 3HMQA 1V9LA 3GBSA 4UXIA 1R12A 4U2FA 1YHZA 3U7JA 4JLKA 4Z4FA 1G21B 2CXUA 2BI4A 2HMTA 2J6CA 2W2NA 3KB2A 1E3SA 1U4OA 4R8LA 1Q0ZA 3QYFA 2JJMA 2W7TA 4Y2XA 1A96A 1V5WA 5EQTA 2ZI9A 5MN6A 5ER9A 1NNLA 3ID6C 3TB6A 4JYAB 2O0HA 3OE7D 1R18A 5T8KA 3R77A 4QLBA 4KKXB 5KQSA 3TM5A 2BEKA 1OW3B 3B38A 4N5MA 5I9NA 2YFQA 4ZAZA 4K7JA 2AZDA 3ETGA 3UA3A 3CWQA 1E3DA 5EMNA 1G3QA 1K6JA 2WUEA 2DPLA 2VK2A 5AK4A 2NGRA 2Q45A 3GWGA 3GG9A 4KLCA 5CHEA 4RGVA 1YONA 3OCJA 4MRMA 4ALMA 5BWLA 1CJTC 1NW7A 3P9NA 1AG9A 2GN0A 4W1QA 1GDDA 1O9BA 1TTHA 1X9GA 2BAGA 2YQ5A 3ONEA 4RIIA 3NBYC 4AZ3B 2OAQ1 1IMOA 3OHPA 4FQ7A 3OY7A 4MLZA 3A4VA 3N28A 1QHNA 3A2NA 1DCFA 1U0EA 1WXQA 4QU5A 1ZI8A 5SZIA 2VDLB 4W9RA 4DDHA 1CK4A 2GLUA 1GGNA 4KK4A 2IYSA 4PGMA 1OAOC 1LBTA 1LJUA 1NZJA 2C9DA 4IGIA 1VZ2A 3PXEA 1F48A 1RAEA 5CTAA 3K0AA 3AVUA 5TV2A 1GARA 4C43A 1ZN7A 4N7RA 1DELA 1MHPA 1S6YA 1F51E 2AS0A 5BNFA 4EO9A 4EMSA 3IE1A 1EVLA 1E1MA 1ULSA 2Q41A 3OM8A 4II7A 1R9NA 3E18A 4I08A 4R68A 1E3TA 1E7WA 1H6CA 4UD2A 1GPYA 1TL7C 2WU1A 3DEYX 3KHSA 2C7GA 2HSJA 1Y80A 3L9XA 4JL5A 4RKYA 1DEHA 3FSEA 3M6IA 1I4OA 2FUEA 1K3UB 3FB4A 4A2PA 1SQGA 5HKBA 4CN8A 4DL9A 2IX3A 2D00A 2W22A 2O07A 3C8UA 3TW8A 1GNTA 3MQ4A 3RRJA 4HWOA 3VHRA 3KPJA 1I7NA 2PN1A 1NN3A 2FMIA 3GF4A 4OQ4A 4R0MA 2FOLA 2ZUWA 3R3YA 3WJ1A