3F6JA

F17a-g lectin domain with bound glcnac(beta1-3)gal
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
176
structure length
167
Chain Sequence
AVSFIGSTENDVGPSLGSYSRPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNARYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17a-G
publication title Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 46
structure length 167
sequence length 176
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 3f6jA00
3FFOA 1ZK5A 3F6JA 2BS71 1ZPLA 4K0OA 2BSBA 2BS8A 1O9WA 2BSCA 1O9VA 3F64A 1OIOA 1O9ZA
chains in the Genus database with same CATH superfamily
2CCLA 2BVUA 2WSDA 3FB6A 3FULA 1UTDA 1WWCA 5I6MA 4LHUD 3AMLA 5L7XL 2OQJB 2APBA 2C5DC 4FLHA 4XP4H 4X7SL 3CK0H 3P2DA 3DSNA 3IF1A 5JA8B 4FMVA 3K81A 4LKXA 1QYGL 2BVQB 4OQTL 4YHOH 3VO0A 1HFUA 4JRLA 3SGDH 1S7TA 2FQEA 4L18A 1MPAH 1WBYB 4FFWD 1EEYA 4P23D 4PB0H 3BGMB 5KS9A 2XWCA 4W93A 4MQ7B 1Q9OB 4O02B 4S1QH 8PAZA 5HY9B 2MPAH 4PJDB 3CHRA 3KL5A 2VMCA 3BP7A 4PVLA 1UATA 4HSAC 4X2UA 2R27A 2V7HB 5GISL 3SPHA 3TONA 3PL6D 5BQDA 3AY4A 3V4PL 3WFBH 1KJ2B 4AL8L 4HUVA 1JZEA 3PHQB 3RWCB 3H7LA 2XCMC 3QQ3B 1AKJD 2RCSH 2UY6B 3BX7C 2C9SA 3E0GA 2C9VA 2NXYC 3V0VB 1DQLL 2X42A 5F1NA 2ZG1A 1FO0L 3SSGA 4V33A 2XA3A 4TQHA 1JMZA 2F1EA 5DFAA 3HVNA 4JRYB 1XTMA 5BV7C 3CPUA 4JGJA 1RLWA 2VKXA 2WQWA 1NKOA 2QFRA 2OZNA 2F74A 4PWKA 3RJOA 3MRQA 3IN0A 4BGDA 5AZEH 4PRAA 1KYUA 3MJ8B 4TRPL 3SKMA 3TJHD 2Y5EA 2KZ1B 3T65A 5E2WL 4WTZA 1IM3D 1WQVT 2X89A 3BDYH 1PIGA 5DMJB 3PAYA 2Y36L 1T1ZA 1QBAA 2QVMA 4EI5B 2GITB 2CUIA 2HKHL 3K6NA 4FLOA 1TTGA 3LQAH 4OV5A 1G7HA 3L5WB 3I75A 1PKOA 1R3LB 2R56H 3QUZD 3UYPB 3TEZA 3T0DA 3ZQWA 5FA4B 2J1KA 3EF7A 4XMLH 1YEGH 3QNZB 3EG9A 4LSQH 1FZKA 1YPZE 5F7BA 1NAML 3EOTH 5ACZA 3CFDB 4F8QA 5JQ6H 2VN4A 4YHPA 2ZSWB 4P2OA 1IBDA 1CDJA 4GAYB 3MRPA 4L3EE 2ARJA 1PYWB 2YPLD 2H8PA 4B96A 5I0VA 2X4TB 3T2OA 1QR4A 2BWQA 3PP4H 3OC8A 1W0VB 2G5BA 4G70B 4OAWA 1G5GA 5ECGA 4MB4A 2NMSA 1MIEL 4PYHA 4CC4A 4GG6B 4OQ1A 5D7LA 1JPFA 2ENYA 1TQBB 3P4OA 4JFDB 1ZTXE 5HI4D 1QWUA 4LLMB 3CDZB 1HSBA 1G7IA 1T2XA 4NKOB 5B39G 2OMYB 1SOQA 1D5XB 4E9VA 1RU9H 3SO3C 1XV8A 3DX7A 3ULUC 1OPGH 4GRLA 4RMTA 1A7PH 3BWAB 2V2XA 3OF6A 4HOZA 3UTTA 2QLYA 5FB8B 4Z95H 3QFJA 2QQLL 2A83A 1T83A 2WZPD 2DBLL 1PJWA 2ZAIA 2GT9A 3ZL4H 1H6TA 3AB0C 4KKBD 4LHUB 4OCWL 1O7DE 3OAUH 4JRFA 4NPKA 2OMXB 2B15A 1GOFA 3HR6A 2G4EA 2DQFB 2ZKHL 1J9CT 3DUSB 4PVNA 5GS1C 1TMQA 5IB3B 2WXLA 2YAOA 1T5WB 4HPOL 4KKCC 1FORH 1RUPH 3VW3H 1BYPA 2R83A 3AZUA 2EE6A 1N68A 1L6XA 5E5MA 3VDAA 5ID0B 5IB4A 4W6XB 4Z0BL 3TNMA 3UIYA 4CADA 1FCGA 1ZK9A 3FTGB 3OXRB 4PV8B 2Z31D 4JO3L 1F58L 4QYOB 4JW3A 4AG4L 2JCCF 2BVEA 2G75B 4WEUD 2CO3A 3EGSA 3ZQXA 3LD8C 4PJXB 3ROLB 1UEMA 1SLWA 2PW1B 3PL6B 3FUMA 1IB5A 2BNUA 3GXIA 1IT9L 4Y4KD 2LR4A 3VFSA 5BZDB 5KSBA 5ADPL 2W0LA 4HC1L 1AKJB 3DLQR 3ESOA 1I9IL 5AYUH 3TEUA 4FQLH 2BVPA 1MWAL 4JFYA 5ERWA 1Z9MA 4A67A 5CLWA 3PV6B 2WKOA 5HGBB 3C09C 4O02H 5DQ9B 1FE8L 2JJTA 4OM0H 5DJ6B 2YGOA 1ZK5A 5HPMB 4LFHD 3ZRCC 3WNNA 3DHMA 4Z7WF 4XOAA 4XMWA 3AG3B 5T3ZE 1UYWH 5L0QC 1TEGA 2A2QT 1KJ2H 3TU6A 1CU4H 1G7PA 1JFHA 3NSCA 3U9PH 2X9WA 1JZJA 1NC4D 1RQ5A 3A47A 4N22A 1IM3B 5HD8D 4AQEB 4NQDA 5DD3L 8FABA 4FLQA 2AV1B 5CU5A 3U9WA 3T8XA 3PHOA 1VACB 5EBLB 4XMPL 2ZCLH 3BN9C 3PDGA 5IBUG 4JQXA 2XTLA 2G4GA 3L9RA 3D51A 3SKJH 3FF8A 1KIPA 3FH8A 3L7EB 3QUZB 4BIKA 3K2UH 4WWPA 3LEYH 2HLFC 4OZIF 3NJJA 4ZUWB 1WC7A 4AZ8A 1EZUA 3E6HA 3EF4A 5GHWH 1GL4B 3QORD 4Y1AD 3BE1H 1SXSA 3AITA 2DI9A 5L4IA 3T4YB 3TFKC 4XCFL 2EICA 5BZWB 5C08D 1MUJB 1R1CA 2E4FA 2X3AA 2DI8A 1SQMA 3CV5A 4LOFA 1KTDB 2F54D 4LSSL 1A8JH 1JPSL 1VDGA 2H1LM 1KPVA 3DX3A 4OCXH 2QADD 1NIFA 5J1SC 3M17A 4I2XA 4XPTH 2YMXH 4QXGH 4P46C 4CC0A 3GFUA 3HB3B 4MNHA 2IALB 4AYDC 1MCCA 4NPJA 5T3XD 2OSWA 4MD4B 4IBUA 5DZNA 4FXGC 1CR9L 3EZ8A 5JUEH 1BF2A 4GW5A 2BS71 5CIPH 2FJSA 3D0VB 5IESL 1HILB 3T6XA 1S9WB 5C86A 4JFWA 2DLTA 1LO3L 2YEZB 3OBAA 4NWUH 4KUCD 3L1GA 1VADB 2ZX8A 4QHMB 4CA4A 1Z9SB 1X9LA 2WO2B 4W9LC 3UTSD 4RFNC 2YZ1A 2GJRA 3UJTL 3C6LC 1NGWA 4X8GA 4UUJB 2DQJL 3C5ZD 1W91A 2X4RB 1QBBA 1DQDL 2DWDA 3LQZB 4IRSD 5AVSB 3WMQA 4Z76A 5A6IA 3HPJB 5F3FA 5KJ4A 4YK4C 4NQCD 3R18A 2FWLB 3LKNA 4KJWD 5DHVA 3ZK0A 4C54A 1JWMB 2HG5B 3B1TA 3A24A 2R2EB 3QDJD 3HZKB 4PMEA 2V5TA 3QRGL 2X7LA 4GQ9L 1WCBB 2K8MA 4JFEB 4BSWB 5DZPA 4DCQA 1JV2A 4MWFB 1G7LA 4U1NB 1FZJA 1IKNA 3EFFA 1CQYA 2GTZA 1GZPB 1IJNA 5G5DB 2WXIA 2IANA 5TQ2H 4YSDA 3FT1A 2Y5TA 4TNWF 5F0PB 5L2JB 4AQ1C 3ZW3A 5JIDA 5GGRA 3RE0A 2CE6A 4AVHA 2VM4A 3OM3B 1Z5YD 1WUZA 3PWLB 1GZQB 1IL1A 3WUWB 2K0RA 1FFQA 1NCCL 2XBZA 1BXXA 1IC4H 2X4NB 3BC9A 3EJZC 4X6FB 5E4IA 5HHMD 4PJDE 2DH2A 1HDMB 1PFOA 1RIUH 4PHXA 5CINL 2R0ZH 3FUFA 1MCNA 3L2MA 1KTJA 3GZKA 2WIIA 1VENA 2VZ3A 3OWEA 5ETUA 2JELH 5AAMA 3S7GA 2Z7WA 4ZT1A 2WKLA 4XZ4A 1MZZA 1BJMA 1XF2A 1WISA 4UQ9A 3NJKA 4ZO6A 2DMHA 1JL8A 1PZAA 4DZ8A 1A3LH 3FCGA 4WW2C 2CDFB 3IFLH 5AUMA 5EF1A 3RI5F 1YY9C 1DBBL 2Z91B 3GKZA 1ZLVH 1AGEB 5D9SA 4JRYE 3NJIA 3AG4B 4KKRA 3O6KL 4P2QB 4QLWA 1BG1A 4F7EB 1SOSA 4N24A 5D2NC 5B38B 4AM0A 4XXWC 3M07A 4HFUH 3TBSB 3ARED 2KQMA 4ZYKB 4ANUA 1NEZB 5FC9A 4HX1A 5FV2A 1FNSL 5EUOB 1QW8A 4ODXA 3AGWA 4IBSA 5I8OL 2BIMA 1EX0A 2JNZA 3WCYA 4IRJC 1UM5H 5I1LB 3O6LH 3CC5B 4L4VA 4N2LA 1O6SB 1QTSA 3SN6N 4LDCA 4QO1B 3K7UA 4KGJA 4K7FA 2CIIB 3RY6C 3WDJA 1PAMA 4DH2A 5E2UH 1MJJB 1HHJB 3PCYA 1U3HC 3LXAA 1V3KA 1Q94B 1RUQL 4LOUD 1NFDF 4JY4B 3WO3B 4E5XA 4J8QA 1HXMA 3GMMB 3INOA 4GRMB 4IEFA 4MJ2A 3GEWB 4HGWA 4CDGC 2FUTA 3TV8A 3X13B 5M94B 4YEFA 4LRNL 1QFUH 3FB8A 1YYLH 4P5RA 1N59A 1PZ5A 3HMXH 4NOFA 4XBMA 1YNLH 4G6KH 4MMZB 5D2LB 1FNGB 5E1AA 2H2PD 2XRAH 4ISVB 4L0ZA 2IQAA 1LK3H 2DEWX 4JLRA 4N1HB 1CURA 1JYNA 2O6FA 4XVSH 1IKOP 1JHLL 2YQ2A 3O4LE 3FSOA 1EVTC 2RGSA 5I1CH 3SE3A 2ZZUT 2NUTB 3MLZL 3NCMA 5FKPB 4PY7B 4BZYA 5DZ9A 5LWYH 2GSGB 4LSUH 3KMDA 4X6EA 3CSYA 4GG6E 4RAHA 1DUZA 3RA7L 1CDCA 3H2QA 3RBSA 4U1SB 2WOYA 3UTSB 1EHNA 3I9AA 2GEEA 3AY4C 3TF4A 3QIBC 2H1PL 2KZWA 1LYQA 5IHBA 5HYJE 5C0BD 1F2QA 1RJZA 4UIKH 5ALBH 4H44C 1OANA 4IRSB 4JQVA 3CPLB 5JHAA 3GB7A 4LCWA 3JT2A 5KSBF 4GBXA 3FK3A 1TQCC 1ZTXL 3V55A 1KCSH 4ZXBD 2CGZA 1GXEA 2PO6C 1TT6A 1M6OA 3F6IA 3FTSA 3QDJB 4JDVA 4TQEL 1KENH 5EZOL 5T5NG 4IDJH 3DXAB 2AABH 5E8NA 1JWSA 3ULVD 3VYNA 3CCHA 1CDIA 1LEGB 2E74C 5G55A 1ZTMA 1ZHKB 1JRHH 5EA0L 4G8IB 3WHE1 4LMQI 5G2NA 3IJHA 3PJSB 3QUXA 3CK0L 1I1YB 1C12A 2R1YB 1CGYA 5E94A 3ZY7A 4NZRL 5CEXB 5I28A 5F9JA 2AEQH 4JDEB 4L8DB 1AD0B 2ZKMX 4MVBC 4OFIA 3BP5B 1UM4L 4DUXA 4PB0L 4GW4A 2HFEA 1Y7VA 2ZUSA 1ZHBA 4JFFB 4S1QL 3WS6A 3B2PA 1KT2B 4GQQA 4PJXE 2EE3A 2EXWC 1UZ6E 3KDMB 4XOEA 2Q2LA 1ACCA 4ODSL 1R75A 1OP4A 1S5HB 1NFIB 4RWYL 3L4ZA 1WBXA 1I1RA 2FGZA 2XKNB 3LV3B 4NZTH 1U3JA 1ED3B 2ICWI 4YHZH 1K4CB 3LKOB 2Y24A 3KYOB 4LF3B 5EF2A 3VFWB 1VFMA 4E41B 5IBLD 2VLKD 1KIRA 5C71A 4RSVA 3S34H 3CLFL 2C1PA 3JT0A 4HK0A 3ECVA 5JMOC 1BVZA 2PKDA 4OF8A 2IBGA 5HPOA 3R06B 4F1SA 3OTTA 5GGSA 5TF0A 1E9OA 1JXGA 3W9EB 4JDZA 1XL4A 3HNSH 3QWRA 4PJ6A 4YQXH 3REWB 3SE8L 3IKCA 3FN3A 4RDQG 4C56B 1WG3A 1QA9B 5SV3A 2F7PA 2K45A 3I84A 4K7PL 4M5TA 1T20A 4BZ1A 5AZEL 1JF6A 3HHSB 3CNKA 1U93B 3DK0A 2G9KA 4XCYB 1A9BB 1J0KA 1JGLL 3I85A 3RJDA 4Z3HA 3H54A 1JYXA 2XWBB 4JFSA 3J7HA 2WTPA 4BH7A 4YDJA 1I31A 5T3ZL 1CMOA 4U0RB 4FFZA 1RZ7H 2J1XA 1V3JA 2M83A 3HG4A 1SJVA 1HZHH 2P8LA 3BUTA 1DVZA 1BYOA 4N0CC 2WCSA 3VFPA 5GZOA 1F4WH 3RPBA 4XBPA 5HHNB 1BFOA 1T83C 4UBDC 3MI6A 1BOYA 5C97A 4F7PB 4E9WA 5DS8A 4OZHB 1AACA 2OJ1A 4HWEL 2XQYK 2R56L 3MXWH 5BVPH 5HYFA 1PD6A 4XMLL 4F15B 12E8H 2X4OA 4UZUA 1NUNB 5D6DC 1WVZA 1ZPUA 5I24A 1S7VA 2WTRB 3L13A 4X4MA 32C2A 5JQ6L 3BUDA 5D72L 4WVRA 1KGJA 3F7PC 4IRZL 3K80A 3V0WL 4DFIA 1YMMA 2W95A 2ITFA 5KYXB 2L7JA 4R84A 1M05A 4X6DB 3RQ3A 3MJ7A 4NQEA 3SQOH 3DJZA 3FQUA 5TDNB 4B9KC 3B9EA 4H8WC 1D3CA 5DR5L 1QVOA 4F2MA 1TYRA 1S7RA 2NTSP 2CLVB 4UIMB 4JANB 2NY2C 4HAGA 5C0BB 3VB9A 1BREA 2WVTA 2NXYD 1AI1L 5T3XH 3OJMB 3WFZA 4XOBA 4ZZFA 4KZCA 3BVWA 5DMIH 3H4HA 3O2WH 4N0YH 4ZW7A 3TESA 5KSUB 4QRPE 4ZXBB 1OAYH 4LPTA 1UB6A 5DHYA 4Z95L 3SDDB 3MACH 1OXYA 3Q6GH 4MDIB 3R7RA 3VTTA 3EDDA 3ZTEA 3V0GA 3ZL4L 4LLDB 2HFFA 2UVEA 3K6OA 1L4IA 5EG6C 3IRCA 5DVPA 2W9LA 2XG4A 4PP2B 2J43A 4Z7VA 2PYFB 5J1AA 3FL7A 4BKTC 4ACTA 3KPLA 3IAGC 2UZXA 4X6CA 2J21A 3B2XA 4U49A 5DRXB 1FORL 4ODHL 4OJEH 3D69A 1LVEA 3BDBA 3E8UL 3VD3A 4YVUA 3NYKA 4JFEE 4WW1B 2G2RB 2GCYA 3ZKND 1JE6A 1NBZB 1UJ3A 3FB5B 4OZGA 2YAHA 2E7BA 3IFNL 3T0EE 3PGCA 4WU5A 1QRKA 1YUHB 1GIGL 3VRIB 1CS6A 4NPYA 2IXQB 2H41A 3SPVA 2VJXA 5A2AA 5LNDA 4F7CA 1C7TA 5I74B 3NK3A 2EABA 4KKLC 2WQAA 4ZTEA 4ZFOA 3EDJA 3NMEA 1DJSA 3WG7B 2LV4A 4FQLL 3NCBB 1MI5E 1ZRUA 3TIDA 1JZ2A 2DJMA 3NCCB 1OP3K 1AFVL 1MCPL 1A6TB 1OSZB 3WSQL 1YVLA 4HUKB 2NNXA 1UURA 3O41A 4JRXE 4ACPA 3D07A 1BD2E 1C5BL 1IKFH 1OHZA 3UOAB 1FZMB 1UYWL 4IIQA 4GKNA 3UPCA 1T5XB 3WOVA 2YGQA 1KV7A 2Q8AH 2XG5A 4E9TA 2FX8H 4KFMA 4CKQA 1FNEB 5TDPA 1ES0B 3QQXA 3WLWC 3NP3A 3O11A 4BSVA 3ULUD 2B2XL 2WLIA 3NCJH 4P2QE 5IQMA 3D0LB 4DPAX 2WO3B 1G7QA 1TZGL 4IJTA 1S8DA 2RH0A 3TX4A 4FZEL 3APDA 3MNZA 4XVUD 4KOBA 2BY2A 5IB1A 1JPGA 4AQZA 1I7TB 4UILH 2EUZA 3E1ZA 1X5LA 5TE4H 3SKJL 1DP0A 3M1OA 5E9DD 2VWEE 5EUOE 5C07A 1GOHA 5LCVH 1IVTA 4PJAB 3C9NB 3LZLA 1HYSC 5LGHH 4IKLA 3UBXA 2ITDA 5DMKB 2WSPA 1TQWA 2UYLB 3DBXB 4CN6A 1F00I 3BP4B 5DI8A 5FFGA 3NIFF 4I9XA 1BVLA 4I13B 4M7KL 3CSTA 4XN5A 4XMZA 3F83A 4JM2F 1J8HA 3O8XC 3SDAA 1R0AH 2Z64C 5IMMB 3H42L 5JHLL 4BQBA 2ZOLB 4ZW5A 2ICWA 2YMXL 4LCCC 4LCUB 1CVSC 5IROA 4B50A 2WBXA 4U4IA 5FXCH 5D2LE 1EZVX 4JDTH 2NY6C 1A6ZA 1VKXB 2R15A 4QIRA 2JF1A 3M8OH 4CDHA 4J3OF 1OD9A 2NXYB 1TENA 1EMTH 3G08B 4NHUA 4C8XA 3DYPA 4GAJH 6PCYA 4IS6A 4N2IA 1A6AB 3KGUA 5CD5C 2PWGA 3D0AA 1D5MA 3ZDZF 4JO5A 4WWNA 1H3GA 3UTSE 5C2BH 2FJFB 2C9XA 5GRXG 5BV7B 3MROB 1P1ZB 4WSKA 3SPGA 2H3XC 3HHRB 5IQ7H 3GSUB 2DD8H 4HS8H 4XNYL 5CEYA 5ITFA 4K3JL 1NC2A 1UQSA 1F86A 2O30A 2NRDA 4YNYB 3HVDA 3K2IA 4Z6AT 1F13A 3IYLW 3U2SA 2BCMA 3QDJE 2GIXA 4G6JL 3DXAE 1VSCA 1MZYA 4WGWB 3BN9D 3DUUB 3LKPB 3CU7A 3S5LB 2WB7A 1Y0LB 4ETYA 2HJFB 2I7SA 43C9A 3ULVH 2HLFD 2X1QA 3DPDA 4XNMB 2OR8A 3JTBA 2AAVA 4MLSA 4L8BA 3KVDD 3QO1B 5E6RB 4LRIC 3I02B 3KR3H 3Q2CA 1GC1H 4XB7A 3IDIA 4JFFE 3RIFK 3RVWC 3QJFB 2WJ5A 1HAUA 2ZSVB 1K6QL 3L3OA 3GRWH 3Q9PA 1RIUL 1CICD 1J18A 4Y4FC 3PABB 1HNGA 2R0ZL 1KCUH 4DQOL 1M71A 4C4BA 3P3TA 2D4FA 4TYUA 5C0CB 4J1UA 3VDBA 4P46D 3CQQA 2ZP8A 3EOYG 5FHAL 4Z3FA 4QHPA 3RNQA 7PCYA 3UXFA 2D2OA 4E41E 2C9UA 4U6VH 3ULSB 2I5YL 3SO3B 3VVWA 3CFEB 1IBHA 4OTXL 3F6JA 3RL2A 2VXVL 2X6CA 5F9DC 4YMPA 3M86A 3QZLA 4N2GA 1HL5A 1KG0B 3D52A 3JWDL 4C56E 3L5XL 4X50A 4NO5B 4UQAA 3GBLA 3AB0B 3MRNA 2VXQA 3MBEC 1XGYH 4EKXA 4RGND 5J5EA 5DT1L 2FIRT 3OGOE 4JZNA 5EU7E 5C0GB 2R7EA 3FU9A 1AANA 5GS1B 2GSIB 2OM5A 3WMPA 1DR9A 4DN4H 1IQDB 3D9AH 1OTTC 4H20L 2P5WB 4ABUA 2GBTA 3VWKA 1AMXA 5EZLB 3QZBA 4OZHE 1DQVA 4FQQA 5DSCA 1WPCA 3HZ3A 1MFAL 2D31A 4PG2C 5E6IC 3T2LA 4BA0A 4MJIA 1W72B 3LD8B 5AW8B 1U58A 2KPWA 3B56A 4L8SA 4YJZL 1HH6A 3ILEA 2A6IB 1U8IB 2OLDA 3QEGL 4FE9A 4U6YA 4P3CH 1QFUL 4UYPA 1UXLA 2X70B 4Q8BA 2R4SH 4GAFB 3KYKL 4OF3A 3TCLB 2GTWA 3HMXL 3UTQB 1CIDA 4L4TA 3H6AA 5C09A 3EJZD 3TBTB 4JFZL 3GSRA 3NCWA 1G4MA 1XGQB 2BHUA 4X6DE 4YXKH 1V7MH 3U30C 1LEKB 4HLZH 5T1JA 1IC7H 4ONGH 4XXCC 2YWYA 3GBNH 1YEHL 3HZYA 3CDGB 3WS6C 3C09B 2CK0H 1GJIA 1DZBA 2IDQA 4OZGF 4LSUL 3L1EA 3ZR5A 4KNUA 4OM1H 4ZOAA 2C9RA 4MHHI 4TLUA 1OW0A 1RIVH 2IADA 4EI6B 3ISRA 5L0QB 4NKQB 1MRCH 1OGAE 5AL8A 1QUNA 3QJUB 3N43F 3DO3A 1DSFL 1YY9D 3RFRA 3ARYA 1EH9A 2WNXA 4EIBA 1KEGL 3NESA 2BDNH 3ULVE 1ETZB 1A14H 4WO4A 1KENL 3VWJC 5D5MF 5A2CA 2AABL 3GMQA 3WUZA 5AG9A 3DKHA 4XRCB 3D39A 1TIUA 3MODH 4UQ3B 1JNNL 1JRHL 2AITA 3TF7C 5BV7H 2XIIA 4FQIL 3W9DB 3GMNA 3OLDA 3V6FA 2WKGA 4NNPL 1MG2C 3QXDB 5MI0C 4MAUH 3ZHDA 1HINH 1M1XA 1XH3A 4JY6B 3ZSTA 3T3PF 3MZGB 1E6JH 2VKWA 4IRJD 4B9PA 4TV3A 2AEQL 1Q1JH 3T1FB 1JPTL 3IDGB 1F11B 1P6FA 5FFOA 5MERB 2ZX9A 3BI9X 1BZ7A 5I30L 5IHHA 4APXB 1U3HD 3EYOA 2VQ1A 3P4LA 4NRXB 3MLTA 5TDOB 4ZO8A 3TVMA 1OGTA 4YS4A 1A4JB 3UG3A 2F8IA 1UD5A 2VLMD 3DX9A 1CBVL 5IIEB 1OAZH 2GFBA 3DI3B 3GLEA 2EIZB 3A6CL 4LLVA 1BVNT 4NZTL 4GSDH 4I4WB 2VLRB 3L95B 5KG9B 4WUKL 4I18A 5KANG 2OTUB 4FXGB 1DZ0A 1BCIA 1DEDA 2P8PB 4KVPA 3WNJA 1KN4H 1D6EA 4ZX6A 5HHPA 2X3BA 4NI3A 4PGCA 1HQ4B 4FXKC 3K72B 4OGYH 1OIOA 2APXA 2FECI 2E5EA 2PP9A 1HKLH 1N0LB 2GKIA 3SGEI 5MEQB 1JNJA 1DUYA 2BXYA 2V9UA 3ELQA 5AG8A 2YBRA 4FS0A 4U6TA 2PYED 4I85A 2BM3A 4L1HA 4RFNB 5IF0A 4X5LA 3C6LB 3QIBD 4NSKA 3H56A 3II1A 3O2DH 4YHLL 2W0KA 4HEPA 4ZMLA 4NOBA 3O45A 5F6IC 2ENQA 5LXGH 2HB0A 4YK4B 4H40A 3LCYA 4ABVA 3LNEA 3CZNA 2P46B 3KYMA 3HHMA 2PO6D 1HZHL 1LP9A 4X4ZA 4X8JA 5FUZL 3WBDA 3ULUH 4OLWH 1T1WA 2YLHA 4OZFB 5J89A 4EUPA 1QSZA 1MCQA 2JWYA 2Z4QA 3P3SA 4KXZH 5T1KA 1FL3A 3DYMA 1I4FA 3MXWL 2X6BA 2IPUK 2BSTB 4RAVA 3X17A 2VXTH 2R2BB 1HEZA 3X14B 4C83B 2R39A 4AQ1B 4L9DA 1ZS8B 3HE6A 4KI1A 5EFIA 3EFDH 4OFQA 1SDDA 4ZFZB 3H6JA 5JYMA 4MVBD 4HMEA 3FQXA 4AGOA 3LPWA 2X89D 4HOXA 2YWZA 2DTMH 4U6XA 5E2TH 1S7QA 3NRFA 4HS6A 3VFVA 1XBDA 3MRLA 3LS4L 4J28A 1UJ3C 1DFBH 2HPOA 4M1DH 5FA3A 2EXWD 4XP5H 5AVYB 3X3FH 2J57A 4MMXA 1FV1A 4GY4A 2IG2L 1VFBA 4NKMA 5EEXA 4OGAC 2FQFA 1W72H 1OB1B 3G9AB 1IE5A 2OS7A 1MQ8A 5FX3A 3IDUA 5DGRA 1OAXH 2RALA 4NENA 4DK3A 3RURA 4WW2B 5F3BA 3D08A 3D5OF 3GSOA 3B7UX 5DCCA 4BM7A 1FJ1B 3CUPB 3O2WL 4ADGA 4FJZA 5E8DH 2R69A 4JKKA 3IJYA 1LHZA 25C8L 3P4NB 3U79A 3MACL 4W9EC 1BEYH 2FAUA 2FJHA 3WFHA 5D2NB 5LLIC 3IMVA 2OYKA 5J6SA 3CN4A 2DV6A 5DQDL 3VA6A 1VESA 4NCDA 5E51A 3QRFM 3AABA 3PQYA 1OCWL 1XAKA 1BFVH 3BFQG 3B34A 5DURB 3D4GA 2AQTA 4IRJB 4LEOA 4PJ9A 5DJDB 3L1OL 3PNWA 4NQSB 1JZ8A 1JWUB 4NWTH 5DD1H 1CXLA 3LKSB 4UBDD 3FB6B 4HYTB 1WFOA 1CGSH 2OTWA 4Z0XA 5E99L 3RY4A 3V4VL 5HYQA 3JYCA 1VFAB 2LQRA 2D4DA 5GQBA 1ZLSL 3IF1B 1IBGH 5AAWA 3AADB 4LKXB 3OKKA 2UWEB 4FNLL 3LXCA 4BFEA 3FFDB 4FG6D 1PCSA 1S7TB 5GGVL 2CBQA 3FRPB 3H85A 1MQKH 2IVFC 1EEYB 4C4UA 1FPTH 5C0CE 5JYLA 2B39A 5KS9B 1BMGA 1BXVA 4MXWL 2FHBA 4IU3A 4FQCL 1AHMA 4ILDA 3HNVL 3BP7B 2PCFA 3HC0A 2H3KA 4OBRA 1E5UI 2PYEB 1NCTA 4OCYH 4ECNA 4LLUA 3DV6B 4Y8DC 1A4AA 2Z8WC 4LSPH 3QIBB 2NY2D 2X53A 4BRJA 5GRVL 3ARQA 3IXTB 4JHWL 4NERA 2FX8L 4Z7IA 3O3DA 4I5BA 1YEDA 1AXIB 5F1NB 4IOSD 1TQCB 3VI4A 3NCJL 2HWZH 2PO6B 5IV2B 2A9AA 4GMSL 3V5KA 2IPTL 4KRPC 3V6ZA 2PCYA 1YN6A 3KPSE 5AFAA 2ZPKH 1J5IA 1MCJA 4M1GH 1D5IL 2HMIC 2WWMC 3GXFA 3UL4A 1DEEB 3UC0H 4NM8H 3UBGA 4ZFGH 3MRQB 4HH9B 5C3TA 3PWUA 4PRAB 2FB4H 1E9QA 2P5WE 2JB6A 1USQA 5JLZB 3GM8A 4LQ1A 4YDNA 1QHPA 2BZDA 2DMCA 5I1IH 4X8XA 3RZCC 1T1ZB 2V3DA 4Y16C 4HWBL 4NBYB 4WLCA 3TBWB 2BSSA 4YC2C 3EO0A 4OZFH 1FVCA 5T5FL 2JIXA 4LAQL 4OV5B 1G7HB 4O4YL 1AXTL 4EZLA 3I75B 3SPCA 2ZWZA 1A66A 4FXTA 2FYYA 1NCBH 2GIYA 1RY7B 2DQIH 5DZLA 1X7SA 3EG9B 3QDMD 4KKLD 3TT3H 3V5DA 4JDTL 1TDQA 3WMSA 5HDQL 1PDKA 4XAKE 5FGCB 2BY0A 3I9IA 2ADJA 4HHGA 3X1EA 4YHPB 1EMTL 2VDRB 4HSQA 3A21A 5DVOA 3QWQB 5E5RB 2ARJB 1WZ1L 3ERXA 3U1SH 2H8PB 1M9WA 4LARH 4WFED 4UANA 3MCYA 4BFBD 1D9KA 1F6AA 3E3QE 4G1MA 2K7QA 4QRAA 5DXWA 3PP3H 2DYRB 2G5BB 4OLXH 2R29A 2MCG1 5IQ7L 2Z0BA 1HI6A 2ADFL 3SZ6A 1NUDA 3BUBA 2FO4A 4XN8A 5F9WC 4QRRD 4KTDL 1ZLWH 4TNFA 3WIIH 2DQHH 4KMLB 1CTNA 4KY1L 4LSTL 4FFVC 5D7LB 5EWIH 1BLNA 1TKWA 3EH3B 3EJYC 1AVAA 5ACMA 1HSBB 4V1DD 3NFNA 1G7IB 1Q0EA 4QNPF 3WLWD 5I8KH 4EN3A 3LKRA 2BK8A 5I5JA 1MAML 5GIRA 4S2SB 4JK0D 2AK1H 5TF1L 3IDMA 2P5EA 4WUUA 1IGIL 3G6DL 2BP8A 1ZAGA 2GT9B 3WXVH 1S7SB 2FEEL 4XNUH 1BWWA 2ZWSA 5KTEL 3LXUX 4NCC1 2FX9L 1HYSD 1G0YR 1CD1A 1L3NA 5A3IC 3ZT6A 4PY8J 3DPBB 3T8VA 3U6RA 1M7DA 2XZCL 1J8KA 2EE0A 5BUGA 1LO5B 4QHNA 4YZWA 2KZBA 4NXKA 3GRWL 1W8OA 2OMNA 3VWKC 4PBWD 3O8XD 3TNMB 3GMPA 4NQVA 4OCSH 1XF3A 3NABL 2AKRA 1LP9F 3WJJC 1GAFL 1KC5L 1R6VA 3K0YA 4BJLA 4UM9D 2P45B 1EO5A 2IAND 3RWGA 2C7FA 3EGSB 2VLRE 3RVVC 1EJOH 1O7SA 4XVTH 2Y2YA 2H47C 4M56A 2OSYA 3RY5A 2NY2B 4XN9A 4K94C 2R2HA 1BZ8A 1Q72H 1T0NB 2C4FT 4PV1C 2DL2A 1MJ8H 5JPNA 1A7QH 4YDKH 5E0QA 2R8SL 2CO4A 2FX7H 1PZDA 5C0RL 1B0RA 1KLFB 1ZA3A 4JFYB 5KOVC 5LAPA 4JVUA 4S0SD 4J3UA 3OZ9L 4OW6A 1S9XA 3OR6B 2AQNA 3PAZA 1XF1A 1BIHA 2XN9D 4PCYA 1F90H 1JZ4A 1ZKAA 3E7JA 5J13C 3HS8A 1YEEH 2OMUA 3AAZA 1G7MA 4XWGH 4BQ8A 5GRVK 4LLQB 5T1DH 4DUVA 2CO2A 4PLNC 1COBA 5BO0D 1D6VH 5HYJA 3MVSA 4DPBX 1WGVA 2UZYA 2HUEA 1OAUH 3QJZA 3G6AA 2BWIA 4GW1B 2K1MA 3N9GH 3SPIA 4UTAL 3ECBB 2F15A 4IMLB 3ZHLA 3Q6FA 2WCGA 3OKEA 1I8UA 4QY8A 3OXSA 3JV6A 5J9PA 1WC7B 3CVCA 2IGFH 2OMZA 3NZ8A 4M43L 4AQ8C 4G1EB 3Q48A 3C5JB 2JXMB 3F5WA 4IBVA 3CH1A 5K9JH 3RVWD 1FIGH 1M3JA 1NINA 2WNKA 2WOBA 4ZSOE 5LAXA 3A6BH 4Y4FD 4WI2A 4Z7WE 2WBJC 4ONOA 4P0DA 3A3YB 3TZVA 1ORSA 5KBKA 1A1MA 1KPVB 3QUGA 1SLXA 3TVMC 2BHZA 1UVQA 3M17B 1WHPA 1J0IA 4K23L 4ZUVA 1U4EA 4MNHB 1YQ2A 2NY7L 3DIVA 1JGUH 3HAEB 4NLAA 5JOFA 3VI3A 4HJIA 5F7UA 4Z78B 1JHTA 1H8OA 4PGDA 5AOJA 2NY4B 3SYOA 4DJMA 1S7XA 4XVJH 5KVEE 4TNGA 1MIMH 2VDRH 5D2NE 5J11C 1JXFA 5MEPA 2HH0L 2CKBA 3U7YL 4E42A 3MODL 2P43B 4ZK8A 1KN2H 5CJOH 2NCMA 3MBED 1BA9A 4DETA 1F3JB 3NIDB 3ROOA 1FUNA 3QJTB 4KUZH 3GINA 3ETTA 1MCKA 4PGBA 4PRBB 1ZGLP 4Y8AA 3ZRFC 2BY1A 5FYKE 2RTTA 4XXDA 1OTTD 3L3GA 3WO4C 3LKNB 1DN0A 4AY0A 5D1ZC 5DO2C 2MOVA 1G1YA 5JW3H 4K0OA 2WLLB 4NDMB 1AKPA 3I6GA 4YEEA 2X7LB 3FTUA 1A9VA 5AW7B 3VI4F 3CFBB 3OR7A 1L9NA 4TULL 2VLME 1JV2B 3ARDC 3AC0A 2VW4A 5E6ID 3EFFB 2MWCA 1K3ZA 2GTZB 2AF2A 3ARWA 1HL8A 3HRZA 4LCCB 2D3NA 2IANB 5F93C 4KXDA 5AVZB 1J0JA 1J9SA 1ZHNA 1J5OH 2UWEE 3DX6A 2YXFA 2PPCA 2YD9A 2CA3A 3ARGA 4ZUUA 2BWDA 2NY6B 3MUGA 4XHJC 5FV1L 5GGRB 3HE6C 1ZCRA 2EO1A 2YZ8A 3DURA 1FC2D 4G3YL 4JJHA 3CMOH 3QCTL 3S5YA 3S2CA 3FUEA 5KS9E 3QPQC 5DQJA 3W11D 1REIA 1CF1A 4IKKA 3DOIA 1WWAX 1ZVSB 3SYQA 4TSBL 2EP6A 4JPWH 1E4XH 5LHDA 2W88A 3O0RL 2XY1A 3PAVA 4YPGA 3SCMD 3ARSA 2WIIB 4XPHH 4X5WA 1S9KC 2XN9B 2YFNA 2E6QA 4H8WH 4F92B 4P9HC 2I7OA 3P1VA 3O2DL 4ZUTA 1XF2B 3WKPA 3RB5A 5FW8A 5IUCA 2ZAGA 1FLRL 3MLUH 3ARRA 1A1NA 4DZ8B 3MFFB 1BM3H 1BVKB 1S5IH 2OYMA 4WKZA 1II4E 2BIQA 3KCWA 5D1XA 3VWJD 1RIHH 4M8UA 2V33A 1SFHA 5B1BB 3DRQA 2WWKO 3G5WA 2CDEB 3THML 3V4LA 4FTVD 5E0FA 4RH4A 2AK4D 5E5LA 2CHXA 4M61B 4HX1B 3DX8A 3FN9A 4NFCA 2DLHA 2V5SA 3D2UD 4OLUL 4P4RA 2Z8SA 3ABMB 1KBKA 2DIEA 4ODXB 3WUWG 3O4OB 2HVJB 5LGKA 2C4FU 3QB7C 1SM3L 5TH2A 3V0AC 5D7SL 3H1ZA 3PDOB 2ED7A 1ZT7A 4G43A 1DFBL 3LN9A 4Y4FB 4M1DL 4TTGA 4ZMOA 2YN3A 2X1WL 4XP5L 1YNTA 1RCYA 2XKSA 2K7PA 1NBVL 2YD8A 3OAYH 3QAZC 3N85L 4N0RA 1IGCH 2QGBA 4S1RL 4E5XB 4X7TB 1HXMB 1QACA 2LGNA 2XXMB 3FOMA 4IEFB 4HGWB 5FHBH 4Y9GA 5FGCE 3UZVA 1VGEH 1KCBA 4PJBA 5F7DA 1CFTB 3UAFA 3FB8B 4R90H 3BRFA 1N59B 4ALAC 3O3BB 5C7XH 4G7VH 2QPSA 2EDMA 2NUPB 4AMKH 1S78C 4XC3L 1A65A 3SQRA 2DS4A 4JLRB 2ZOUA 5E8DL 3IMBA 1BMWA 4ZX5A 5C0JA 2B1OA 2NQDA 3ZO9A 2ENPA 4K9JA 5EC1A 2V17H 4NQED 1DBML 2VLJA 5B38G 1QWHA 2YKKA 3CSYB 4Q2ZA 4NUGL 5D7LE 2I9LA 1DUZB 3MBEB 4NNXB 4FOMA 1A4KA 4HAKA 2WMPA 4TUUA 5CEZD 5I71C 1W6WA 2WC7A 1KACB 2R4RH 4FCAA 5HYIA 3ZTJG 3T0BA 2J55A 4PJGA 1U92A 3HAEH 2WAQA 1GGUA 1MCOH 4M5YH 4DTGH 3MRKA 4RFOH 4LCWB 3VG9B 4OU3A 2AGJH 1JF5A 3MFGB 1ZV2A 3UTTE 1FZOA 4XNDA 1X5IA 3UBFA 2JKJA 3UP1A 4KHTH 1M6OB 1URIA 4QOKD 5D8JH 5E8NB 1JWSB 1DQJA 8CGTA 2DEYX 3LYRA 3WKMH 3DETC 3OKLA 5E6IB 3RX9A 3ZE0F 5DJAA 1N6QH 4X42A 2X38A 3IJHB 4RA0C 3QUMB 1E8XA 4J23A 2V37A 5E94B 1C12B 5IW6B 5AB9A 2PPEA 2D0GA 1X5JA 1VEMA 5F9JB 1HXYA 2D8KA 4OJCA 4R8WL 1TETL 1V27A 4AZUA 3NIGB 4ODUB 3K6SA 1RJCA 4OB5H 4WENB 4GW4B 3MJ9L 1FIEA 1WA2X 3IB4A 2ZTBA 2HFEB 3LMJH 5AYTA 4WU7A 2NXZC 35C8L 3RWHA 1SNRA 1P7QD 2DDQH 4FQJL 4DO6A 5JW4M 4OGAD 5A2JH 2J8UB 3LEXB 4OI7A 5T5NF 1YEKH 4RMWA 2YPVL 4K4KA 2DQUH 3F01A 4AIXA 5DHDA 5EZIL 1WBXB 4G83A 1KGUA 3WIFA 1E4HA 4LCIL 1THCA 4MYWB 4ONFH 1U8QA 3U1QA 5I1GH 2VQTA 4WFHD 3ENEA 1IC0A 1YRKA 2E27H 1KIRB 4NBZB 2OW7A 2C1PB 2HWZL 2WXJA 1LO0H 2AJZB 3OGCA 4HKZA 4I77H 5KANI 2Z7YA 3C5SB 4HS3B 3VWJB 1KJ3H 1PLBA 4EAEA 2PP7A 2W8CA 3QXTA 3TPKA 1KJVA 1SXCA 5CILH 5GGSB 1E9OB 1D9KC 4JG0H 5I8CA 4KVCH 3TV3L 3JTSA 3HC4L 5J6GA 4FTVB 5DDHA 1SMAA 2NY5L 3DTXA 5MI0B 4Z7QB 5ICYA 2E75C 3EYFA 3EH1A 3D2UB 1X9UA 4RGOH 3HI6H 5F0MB 1N7MH 4DKTA 3L4UA 2XPYA 1T4KA 2A9NL 4BH7B 3BYYA 3FHAA 2DJUA 3SGDI 2WO4A 3GXTA 3VI3F 3SOBL 4FNTA 2GJZA 3MLWH 4U1IA 5JXAH 2P8LB 2QSCH 4RGMB 4WJ5A 4NCC2 2JSFA 2ZJSL 1BFOB 2MTPA 2AXFB 1R4XA 1OD7A 4ZFQA 1NCDH 4X7DC 3D85A 1KB5H 3BHBA 5GSRA 3MYZA 3CVIL 3MGTB 4ZMAT 5EN2A 3T4AC 4DKFL 5HHOD 2X4OB 3SBWC 3CN1A 2ZWYA 1WIUA 2AQ3A 1SXNA 4JPVL 1XIWA 2CZNA 3QULA 2B9AA 3TJPA 3KLHC 2BVOA 3APNA 2ADGA 3NSFA 1TZOA 4IOIA 3TNNA 1P4LA 4UTBH 2YD6A 4FXKB 3VXTB 4WFEE 1MNUL 1YMMB 3FB7A 2YUWA 3WIHL 1ORQA 4I2XE 4AEIH 4NQEB 4OLXL 3FQUB 5EOQH 1CT8B 3RIKA 4HAFA 1E43A 4FQXD 1K9TA 4GOSA 5FW7A 5JR1H 4R26H 5F70A 3QQ9C 1S7RB 1F0LA 3LZPA 2DQHL 3RG1C 3GSVA 5E2VH 1JI1A 2OZ4L 5F6IB 1SXAA 2FQDA 4X8CA 2I9TB 5FWRA 4DP9X 5JPNC 2W0PA 2CRMA 3J2PA 2WQRA 2FSEA 1PU0A 3F7YA 3DROA 3VG0H 4KRPD 1UB6B 1EWHA 3MQIA 3WS3A 4XOCA 2OP4H 2MSPA 3NIDE 3QBTB 2HMID 4XC1H 2WWMD 5KVEL 2ZNWA 2D3VA 3NT0A 3MJGX 4Y4HC 2VDQB 2YK1H 3MV01 4TLKA 5KSAA 2XG4B 4Z7VB 4HHWA 2HKFH 3SE4A 5I1EL 4G8GD 4PGJA 3KPLB 2FRGP 4F3FA 5LNGA 2UZXB 1O9VA 1UA3A 4X6CB 2HX9A 1CGTA 5CLZA 3OKYA 4NRYA 2DKUA 3D69B 3QRLA 4BDVA 1ZVYA 4QXTA 4GUPB 1KXVA 4A2HA 5TQ0L 3RZCD 4Y16D 4X5XA 2JI2A 1TO4A 4U0QB 2GCYB 2NSMA 1P4BH 1UJ3B 4OZGB 4KZEL 5CLYA 3O6FD 2VR3A 5FYKL 3B1UA 1BFSA 1IFHH 4UDUA 4ZO9A 2IANE 2IH9A 4XXCA 2GTQA 2O5XH 3PGCB 4WU5B 1SDYA 1WT5A 2VIRB 4FFYH 4UT6A 4D8PA 1BPLB 3IMTA 3E38A 4BZ2A 3SPVB 2BVYA 4R96A 1KGYE 4F7CB 3AVEA 3BAKA 4CJ0A 4NP4L 4BE5A 3QUMH 3ZTNL 2HVBA 4KJPC 3B5TA 4M1CC 4RRPA 1KUMA 2FWOB 4KTYA 5SWSD 4ZFOB 5IBTH 2GW5A 4F58L 5CBAA 4X0KA 2DJ4A 4A7QA 2FX7L 1ILSA 2OMVA 3GT6A 4OLYL 2EUWA 4J2XA 3MOBH 4KK6C 1NKRA 4XWOC 3EJJX 1A2YA 2ODHA 3TIDB 3TJEH 1U8KA 2BJMH 2XN9E 3HC2A 3TZVC 5LUMA 2VL5B 1AIFB 2E46A 4MA1B 2XQYA 5JQHC 2VT0A 2J4WH 1IAIM 2W59A 1AG6A 3O41B 1RK1B 4UM9B 3EJYD 3KPRD 2CHNA 5HHVL 4XWGL 4GKNB 4I3SH 2MOGA 3QWOA 4G80B 1NGZA 1SEBA 5T1DL 4PJBF 3N1GC 4Y2DA 1H6EA 3Q3GA 4DF9A 5ESQA 3QG6B 2LVEA 1D6VL 2GAZA 2DI7A 5I66B 2VITA 2EKJA 1I3VA 3TA3C 1IE4A 1DCEA 2CA4A 3PWVA 4F9LC 3C8KA 1P6WA 2OA9A 5DWUL 3P4MB 4IBLT 5IB1B 2X88A 2A9MH 4ZNCD 4ZMVA 3FU3A 3DVGA 2Q3XA 1OO2A 5C07B 1JTPA 5J6HA 1PD1A 4ZRGA 5A3ID 4TOYL 3BEWB 5HHOB 2XIBA 1MRDL 4ZQTA 2ISDA 3UBXB 1VF5C 2FH6A 4BZ1H 5JDJA 2XN0A 1RK0A 1NEPA 4M8QA 4KDVA 3QEQD 1M2OA 4PJGF 2WXOA 2FSDA 2DQCH 3VWKD 5DI8B 3DX2A 3ZO0A 2EDOA 1A6PA 5D7KD 4RISH 1FCCA 4K3DL 5EO1B 2Q8BH 2CSPA 1UZ8B 3RVVD 2Y2TA 2P49B 1WAAA 1A7RH 4AYSA 4PV9A 1GYUA 2VN7A 4I7ZC 3ZT5A 3NZHH 1EGJA 7CGTA 4YZFF 1INEH 1QNZL 2VDLL 3U36B 1EERB 1A6ZB 1RZQA 2QHRL 1G7JA 1DBJH 1DJHA 2W1NA 2A0LC 2J8OA 3B4NA 4NT6A 4UWQB 3RVXC 4FQ2H 1G6RB 4HJUA 4NHUB 2HT4D 2VXUL 4IS6B 3WU1A 1AGDB 2MCMA 3MCKA 3FO2A 4MKTA 1D5MB 1R46A 4KI5C 4WEMB 4URKA 2VB5A 3WENA 3QHFL 3PP3K 4F80A 5CJOL 4PJEA 4K07A 1I8IA 3MOAH 4JFHD 5DUPL 5H37G 1NGPL 4PB9H 3J8F7 5CEYB 2B1AL 4KUZL 1HU8A 1NC2B 1UQSB 4LKCA 2RB8A 2V4LA 5FOBA 3VSQA 5CEZH 4LCWE 5CGBA 4G8GB 4QR7A 3RGVA 2VH5L 3U2SB 2GG1A 5TGBA 4L8CA 1FDLL 2R59A 3RZCB 1TQVA 4OI8A 1SY6A 2QHLA 4Y16B 5EIIB 3E1F1 3F58H 4XHQA 4KHXL 4EI0A 3QQ4B 4YC2B 4DGIH 4KX9A 2HXAA 2YA1A 1J5OL 5I1JH 1C5CH 4F9PA 3S3PA 5FYLH 5HJ3A 2VDQH 2DWXA 1E5ZA 2X2IA 5INDB 4E9RA 4K3HA 5E1IA 4EVNA 3L3IB 1L0YA 2BP0A 3NIGE 3UAJC 3V0FA 5TE6H 4HA1A 3VFUB 1T0MA 1XVSA 3IDIB 1BPVA 2XWJA 4PJ7A 4OIIH 4G82A 4HUXA 2WBJD 4G9DA 3VAEA 5DJ2B 5CN2A 1YEIL 2EO9A 4JPWL 4ANWA 1T21A 3HN3A 1XGZA 5JXEA 5D4QA 5FUCE 3KVPA 4XPHL 5DD6A 3VH8A 1B6UA 4H0GA 1ROCA 3QK0A 5EU3A 1NDMA 3EO1A 5C7ZA 2O5ZL 5F9WB 3FJTA 5HYSA 4R7VA 1HE8A 4AI7A 1L7TL 1RZFL 2VYRE 1KLUA 2ESVD 1AH1A 1H5BA 1R9FA 1EHLL 3SHSA 2X28A 1KV3A 4OT1L 1Q0XH 4Z7NB 4DESA 4MNGA 4N2DA 1BQRA 3VE0A 1JHKH 2X9XA 3LTVA 1U36A 3S5LG 2J6WA 1PNCA 4JS7A 4FTVE 4TXVB 2HJKA 4NI6A 2Q20A 3WIAA 3N44B 4ES9A 4Z7QE 1NCIA 1UXMA 2FLRT 1YAIA 3B2VL 3GI9H 3GQFA 4MZRA 1EAPA 1FVDB 5HJBA 3BT2L 3ZE1B 2LAGB 4WEEA 2A1WH 4JFPA 3HLKA 2EH8H 3DVFA 2HTLC 2ZCKH 4OJFL 4JZNB 3KWTA 3TP4A 2R7EB 3QZWG 3OQ3B 3VFNA 3BCDA 2KL6A 3U0WH 4FHJA 3NA9H 1NGXA 5D1ZD 5DO2D 3VU1A 5GZNC 3KXFD 3L4TA 3VWKB 2OX5A 2EYTB 1AO7D 4CBZA 3EZJB 1FG2A 2JJSC 3ARDD 3P2TA 4PS7A 3SZKC 1DDTA 3QEHA 4TLTA 1RAMA 1DN2A 3WDHA 4K9EC 2DM2A 2D31B 3S8FB 5DJ0B 3IWUA 4MJIB 4PW4A 3OKDA 4TNWK 1MHHA 2W60A 4XHJD 4PLOB 4X4ME 4U6YB 5HVWA 3SKNA 1NCAH 5DJZA 5DJYA 5IJDC 4X4XA 3VD7A 2GTWB 1YMME 5T1LA 4AMKL 1YLBB 5C09B 1ADWA 1U8HB 1ADQA 3GSRB 3CVHA 1CDGA 4NQEE 4QUOA 2V5MA 5A16A 3GGWA 1TR7A 2W80C 3EYSH 5IQ9B 2IQ9H 5DK2A 4F2ME 5KBLA 4YSCA 5CEZE 1AE6L 4L05A 2DQEL 4NAQA 3QPKA 4I3GA 5C0AD 5J13B 2NNFA 4YSSA 4E68A 3WFCL 2ZUUA 1Z32X 3ABKB 1CZ8H 4FABL 1QUNB 3PUUA 4Y5XA 4PHZA 1CG9A 1R3JA 4PTUB 3WLBB 1QP1A 3VFGL 4YHYC 4HLEA 3WKQA 1G6RH 1FBIH 2G2NA 4XH2A 5D8JL 4ZAKC 1MH5A 5FYLE 3WKML 4M4PA 2H45A 3D39B 2NSXA 1G1CA 4OF5A 4JCMA 4U3HA 1C5DA 3LZRA 4Z7VE 1NUGA 1P53A 3C87A 1EHAA 1O7VA 3GMNB 4EBQL 3Q2NA 1CFSA 3WHXB 4X6CE 4AT6B 5B7FA 1XH3B 1XEUA 1QSFA 3ZYZA 2BVQA 5AZUA 1JGDA 3A67L 4Z3EA 3GNML 3IKKA 4YDZA 3F2LA 3AU1B 4AYID 4AYGA 3D48R 2Q7NA 4OZGE 4PCTA 1ACYH 1WBYA 1OT1A 4B5ZA 7PAZA 1SEQH 4OB5L 1VB9A 3HTLX 1YN7A 3HN8A 1JV5A 1N2RB 1D7DA 2WBJB 3I2CH 3LMJL 4M3KB 4MQ7A 1Q9OA 4O02A 2J25A 4PJDA 4KROC 2DQDL 4JPIA 1T1YA 3N1FC 3TVMB 4WNQB 2ZX7A 5LVEA 3DX9B 4U2YA 2XJKA 3HG1A 1DVXA 4LLVB 1KJ2A 2LLNA 5IB5B 3QQ3A 4GKSB 4I18B 4YBQC 3NJNA 1XIWC 3UEQA 1D6EB 4ONFL 3GLDA 1RSYA 1T0OA 1RULH 2JVUA 4J6IA 5AOMA 5HHPB 2ESVB 4U3XA 4GH7B 4ETQA 4PGCB 1YPZF 4LZKA 1CQKA 3MC0A 4OVVA 4HXBL 5I5RA 2ILLA 1G5AA 4TVPE 3WE6A 2YBRB 4I88A 1SN0A 4JRYA 1X7TA 1X7QB 4BCZA 2AEOA 2VRKA 3UPAA 4YHML 1VCAA 3LKQA 4FERA 4NSKB 4LLYA 1JRHI 4JM2C 5E24E 2PXYA 4IQHA 3MJ8A 3P3UA 2XNAB 1H15A 2Y1ZA 5LG1A 2Z7ZA 3BGFC 3O45B 1N7ML 3OWRA 1EBAA 2ITCA 5KVFH 1NMAH 2HA1A 5D1ZB 4DO4A 1OV8A 4LMQE 1CFMA 2AJXH 3KXFB 3MLWL 4X8JB 2VMEA 4EUPB 1AO7B 2Q3ZA 3ARDB 4YDIL 1NCDL 1X5XA 5C07E 2VZVA 5T1KB 4CUCA 2IEPA 3MLVL 1R3LA 1RKRA 2WD0A 3OX8B 2X12A 4RAVB 5E9AA 1Z6JT 1IBZA 5HHOE 4JHAH 1JVLA 5KSAC 1WLHA 5K59F 2D03H 2VXQH 3HE6B 5L2KA 5EFIB 3CFDA 4IDLA 4Z7UA 3SE4C 4CNIA 1YEJL 2G3ZA 3ATBA 5GRJL 3VMPA 3KBFA 3FQXB 5CIPA 5MHSD 2ZSWA 4HLJA 5B3NA 3M46A 1AGBA 4R6UA 1YEFH 1KXVC 4GAYA 3DMMA 3KJ4B 1A3RL 2NXZD 3P0VH 3OHMB 3TT1H 3VFVB 3MRLB 3TCTA 3WGUB 1EO8L 1L6ZA 1ODAA 3V0JA 5FA3B 5MEND 1NJ9A 3QJVB 1HXKA 1FV1B 3FO0L 4HUCA 5EOQL 5I0XA 1LE9B 5IP4A 3E8VA 3VX1A 5IR1B 2ALAA 3BUYA 2Q1EA 3FFCD 4TQ8A 5A1AA 4PN6A 1RZKC 4GI8A 4M6OH 4GG6A 2YBGA 3LAFA 4G7SB 4HIXH 4H0IA 1QLRB 4JFDA 4HUWB 4DP4X 2V6HA 1EQWA 4ZQKA 4NKOA 1GRWA 1HESA 2OMYA 3MLRL 3TH4T 4KKQA 1D5XA 3VJ6A 2HX8A 3EYUH 4JCLA 2P80A 4HCFA 4AYEC 1PIFA 3ZT7A 5G4OA 1A4CA 5EF0A 5GS0C 2YS4A 1LWRA 3IJYB 1KCRH 3G5YB 1VPOL 2UVFA 3OV6A 3TL5A 5FB8A 4AK2A 1D9KD 1AQKH 3B37A 4PRNA 5FGBC 1OOWA 4XC1L 3WJMA 2Z1KA 3BAWA 1EHKB 3QPXH 5KZCD 1E4KA 4LHUA 4JJ5A 1G1OA 4JFVA 2O6CA 2QMKA 4AX3A 4DVBA 5IFHH 4G6MH 1JBJA 4FEMA 5DK0B 5B1JC 1QI5A 1ZV5A 3PQYB 2DYPD 3DUSA 2DQFA 5CUSH 1J9RA 4F8NA 2XPZA 2ZOOA 1J87A 2WVVB 4RZKA 4F20A 1FLTX 3QT2A 4FLRA 3PNWB 3VU2A 1JYVA 5FCUH 4P23A 3HZMA 1PSKL 1AQDA 3FTGA 4KTGA 4WI8A 5CP3H 4UDTB 4QYOA 3QAZB 2VDKL 1AGCA 3B6SB 4FRWA 5CR8A 3LN4A 3D4ZA 1BM7A 3CDYA 4A2LA 1F8TH 3PL6A 2X40A 1MY5A 5A6MA 4GSXA 3GBDA 3D33A 2D9QB 3JV0A 5BZDA 1KBVA 3MRMA 4FI7A 4ZTOL 1AKJA 1BECA 5IBTL 1MCBA 1DBAL 5LJYH 1FFOA 4MBRA 1ZIAA 4N8CH 4D0DB 3TWCL 4JO2H 1Q9LB 4M6NL 3ZZLA 2C9QA 3FYEB 3PV6A 2PCFB 3HC0B 3WN5C 4AGLA 3IRZA 2EH7L 5HPMA 1E2VA 3PDDA 3II2A 5I71B 3BKJL 4P5KB 5KVFE 3WTXA 3ORJA 1TJIL 2G0KA 3NACL 2MHAA 1I8LA 2KYIA 4Z7NE 5DJCA 1V55B 4PP1C 4RMRA 5HGDA 1K5NA 3K71A 1IM3A 1S2EA 2AV1A 1WTGT 3FCTA 3MV7A 3V5KB 1OARH 2F18A 5LG6A 4B9FA 2OL3L 3VQLA 3POHA 1YN6B 3ZE1E 3R0NA 3S35L 2XN2A 1A6UH 3NVQA 1EPFA 4FCHA 4Y4HD 2G60L 5B4MC 4N8PA 4NO0D 3HG5A 4FLSA 3PU7A 2FH8A 3L7EA 3NSDA 3QUZA 5F89B 4HU2A 4XGZB 3L6FA 5J4MA 1T80A 1GMIA 4YDMA 1TTRA 1FI8C 3IPEA 3E6FA 3UJJL 1E9QB 4BZ1L 3IGFA 3RGVC 2A9BA 3NPSC 1BBDL 4D94A 4URTB 4G7QB 4CSZA 3LIZH 4ABQA 5D7KE 3RIFF 5DA0B 3FFOA 1MUJA 1N8OE 1YHPA 4FFZL 2N1TE 3JBG7 4QHUB 2NXZB 2JV6A 2YPLA 4MJIE 2K78A 2YA2A 3GYRA 2BSSB 3K5RA 1MHPL 4W68A 3EO0B 1FVCB 4PJHA 4EUPH 2VZ1A 5FYJD 4W9FC 1A7RL 1ZPLA 1B4JH 2VDPL 5LO7A 3ZKQD 2HLEB 3CSBA 5AWNL 2Y06H 4F9PC 3FFCB 1INEL 4M1CD 4KJPD 3V5DB 5C09E 4MD4A 1X5MA 1QZ1A 2IFGA 1SXBA 3K4AA 1J12A 2ADJB 3WAJA 3L54A 3TO4C 3TBVA 4KK6D 4XWOD 1ZANL 2CLZA 2K3HA 3MLYH 4A37A 4A55A 2Y7QA 4P2AA 1INQA 3BRGC 4NJ9L 2WZPA 1D9KB 4JFHE 1L7IL 1VADA 1QBLH 4QHMA 1Z9SA 4PJDF 1HI6B 3MA7A 3QJHA 5KZCB 1K8IB 3ZGIA 2RQEA 2XWDA 5FO7B 4UUJA 3P0YL 4P9HH 5CEZL 2BZCA 1Z1WA 1TKWB 3FHEA 3KLAA 2X4RA 2DYPB 5KYWB 1DBKH 3LQZA 4NGHL 4WTZG 4N4YB 1UXSA 3DTUB 2P5PA 5D70L 1H5BC 3DJRA 3LKRB 4M5SA 2RHEA 1JWMA 2R2EA 3TA3D 3HZKA 3N6YA 3D39E 2Y1AA 1WCBA 1MCLA 2P26A 3H3PL 1NGQH 3T09A 2Z31A 1CD0A 5L8LB 2BP8B 1MDTA 4IU2B 2OCJA 4WV1C 1TTAA 4QWWD 5G5DA 3NK4A 2R0KL 3ARVA 1TFPA 1YYMH 3FAWA 5D71H 5FYLL 3T4AB 1RUKH 1KIUA 4NJAH 5E6UB 5ABAA 4EDXB 1GGBL 3KGTA 4E9SA 5A6LA 1E8WA 3B3IB 4Y4KA 3NH7L 5EC2B 1E7VA 3U46B 3PWLA 1M7DB 4TNEA 3LXBA 1LO2L 5EORH 1NWOA 3GC3A 3KH4A 3O2VH 4QHNB 4X6FA 1BAGA 3LRSA 4NUMA 1UT2A 1OWRM 2CJTA 3GMPB 4NQVB 1HE7A 1XF3B 2AKRB 4DKEH 1I7UB 4UB0H 2CO1A 3APMA 3T2PA 2X6AA 2VM9A 4GP8B 4LGRB 3BT0A 1I9RH 2R0WL 3CZSA 3RWGB 5CJXA 2GBAA 3JZ7A 2IMNA 3CFCH 1CB4A 3SDXB 1TQSA 5FDWA 4GXVH 3W5MA 4XNZC 4QRQB 2ESVE 2FDBP 5DUBA 2VTFA 1E9PA 2VXSL 4Y7OC 2CDFA 3RVXD 1SJMA 1EUTA 4ALAH 4ZFOL 1BZOA 1NC4A 5JPNB 5I19H 2Z91A 3SQBB 2F9BT 4IGBD 1AGEA 1SLUA 2QT6A 1B0RB 5IM7B 1ZA3B 4C55A 1NL0L 4L3FA 2EUVA 3UYRL 4KI5D 4OD2B 1O0VA 5DFWH 2OR7A 4DW2H 1JFQL 2CUMA 2Q7AA 1XF4A 4NO0B 3TBSA 5I6KA 2WXNA 4ZYKA 2ZG3A 4TVPL 1ONQA 2EH8L 2O61B 1ZY9A 1RXLA 2WAHA 2OMUB 4F7TA 3AAZB 4CBPA 1CFNB 3FSAA 4LGSB 4PS4L 4GG6F 4HT1H 3QORA 2JJVA 2WXPA 4Y1AA 3F7VA 3U0WL 1FGNL 5TK4A 3FQWB 4QO1A 1JF1A 1LO4L 4R4FH 5HYJB 4W9DC 5C08A 2CIIA 1CGWA 2XHNA 4LQFH 2UZYB 5KAQF 2RD0A 2F54A 3G6AB 3POCA 2N0MA 2EO7A 1MFDH 3CD4A 2GBVA 4GRMA 2JFCA 3P30L 4DAGL 2DWSA 3JV6B 5J9PB 1P84K 3BDXA 4UV4H 2PWFA 2VQUA 2VZTA 3GIZH 3NZ8B 5CLXA 3UAJD 3PY9A 4M7JL 4I89A 1T89A 1EFQA 3F5WB 1AZNA 4PWHA 2J8HA 5L88L 2CQVA 4Z3GA 5LAXB 4B9ZA 4G7YH 1AZUA 2OJZL 5K9OA 3NSJA 2I85A 3BSGA 3TZVB 1ORSB 2CMRH 1IGJB 2IF7A 1MFCH 1LDPH 3MLSL 4PY7A 4HV8A 4HIPA 5SX4I 3G6JA 4BWUA 1F18A 4CC1A 2XICA 3NEEA 3UTSA 4U1SA 1U95B 1Y18B 4ZUVB 3UZQA 3RWIA 5LBGA 4KRLB 1NGYA 4PJXF 4KKAC 3C5ZA 3C2SA 1LGVA 4IRSA 5IVZA 3FSWA 5FKAB 1JHTB 2BY3A 2QTVA 4PGDB 2DB8A 4NQCA 3NAAH 1DSWA 1S7XB 3TA3B 3QDJA 3QXUA 4JO4L 4DVRL 1FN4B 3H0TA 2J88L 2QBWA 2WWOA 1GS8A 2CNYA 2F7RA 4E42B 1A6VL 3NFSH 1IFRA 4G8IA 3V79C 3PQYE 4HUUA 2HTLD 3ROOB 3H4FA 3TYGH 1LEIA 4M02A 3MRDB 4PGBB 3HN5A 5CEXA 1N64L 1WAPA 2PXYC 4K71C 5J1TC 4KVNH 3RU8L 3M1CA 4JDEA 3FCSA 4XXDB 3L3GB 2OK0H 3CAFA 2D7NA 4BHUI 3GJFH 3I6GB 4AJVA 4QPEA 1DQML 3B7SA 3OR7B 1KT2A 1SYSB 3BKML 2GJ6D 3KDMA 4QKTA 1DL7H 1H8SA 4NC1C 1ZHNB 3GO1H 2XUWA 3D12B 3DX6B 1NFIA 5CCGE 2XKNA 2ICEC 2ZF8A 1ED3A 2B8OT 3MUGB 1R3IL 4MRBA 3RWDA 1TXKA 3W39A 3DURB 3KYOA 3OKMA 3VFWA 3D4YA 3BLPX 5DQJB 2I24N 4M5ZH 4U1MB 4X5PA 1OCZB 5JNYB 3DMMC 5DTFA 3DC0A 3U9UB 4H26B 1U8CA 1RURL 3W9EA 4NN6C 4AEEA 4X5WB 3ZDYB 3MPCA 4LE8A 4PJHF 1QA9A 4WJKB 3AREA 4BELD 4XNAA 3NG5A 4DGWC 1KXTB 2B9BA 4F8TA 3HHSA 5EN3A 1U93A 5F1OB 3U6XS 3VI4E 4WI4A 2NR6C 5INCA 2Y3AA 4JUTA 4YE0A 1ZSDB 4XZUA 2AJXL 3LNIA 4BFKA 1R19A 3IE4A 3QFDA 4RX4D 4UINH 4ZAKD 3ZQ9A 1FYTD 2C34A 2BPBA 1D7FA 5HHNA 3DRQB 3GHBL 4F7PA 2IH1B 1FNFA 2RJMA 4GIOA 4JR9L 4DOHB 1E4KC 1URLA 3V95A 4JHAL 5L4FA 3FQTB 3ILQC 5AEAA 2VXQL 2ZKYA 1S9YA 4XAWH 1D5RA 5MHSE 1SMDA 3L45A 1NPNA 3RPKA 4FL4C 4KPHL 3MRGB 1IGMH 3ZE2B 5TH2B 4JL1A 4JKPL 2ZQKA 1ZT7B 4MSWA 5KYXA 4FFWC 4F37K 4P23C 1PNDA 4G43B 3VNYA 1EJ6A 4KROD 5EOCL 4XN4A 1J1PL 4F33A 1YNTB 3GK8L 3FFCE 3GLAA 4PJFB 3U7WH 2O93L 4YXLH 4Q9RH 5FYJH 4C57C 5E8OA 3SD5A 2CLVA 5GGQH 1FH5H 1L9MA 1UOWA 1JZHA 3BJLA 4YBLC 2WBWB 4JANA 4YBQD 5GJSH 2KMWA 1AR2A 1ZMYA 5C0BA 4ES8A 3HPLA 5DD0L 4K94L 1AZCA 5JIIA 2DWTA 3KS0H 4XP9H 3SDCC 5IJBC 5KOMC 1I1CA 3PWNB 1NCGA 3U7AA 5K9QG 2CGRL 3BAEH 3L9EA 4GKOA 4ZXBA 5J0BA 3D6GA 1IAIL 1QAWA 1BQHB 2ORBL 4RRPM 4MDIA 2VLJB 4PY8I 5KVGH 4Q2ZB 2W9EH 3QPXL 5C6TH 2PR9A 2ZXGA 2EADA 1U3ZA 4KXZI 3ZOAA 4JM2D 4LPCA 4G6ML 2X9ZA 4MDJB 5DUML 1CLZL 4KQ4H 5CUSL 1U92B 3IETB 2ZCZA 3HG3A 4NUQA 4PGZA 4TSAH 3T2NL 3MRKB 1FRGL 4A68A 3PV7A 4KO6A 2IPKA 2IIJA 5C92A 5K69A 5H4YA 2Z8RA 4ODWB 1BQLL 3B7YA 1MCFA 3FB5A 1YC7A 3OAZH 2XQBH 4ZMXA 5CNHA 4Z7OB 3UERA 2Y69B 4G11A 4GRWB 4E5XG 1YUHA 5CGMA 3OKLB 3VRIA 1ND0A 3MV9D 1MFMA 5ABDE 4EOWL 1I85C 4LK4A 3HRPA 4PJ5D 3DJTA 4JN1H 3ASNB 4KH9A 1FO0A 1F8TL 3IMSA 5EPMA 5DJXB 1WWWX 1QRND 1VIWA 2Y72A 4HIJB 4X98B 2XT1B 2EDWA 3L2LA 4KAQL 1PG7H 3VD1A 3K6SB 4NEHB 2JKWA 2VLKA 3IFPA 1T66D 4N9OB 4JFXA 3CXDL 5BO1H 4LOEA 1J1OL 4XTRD 2HG0A 2IDTA 5K9KB 1JDDA 2CR0A 3B7TA 1G9HA 4TPRH 1A6TA 1KCWA 3MOQA 1KCVH 5KJ7E 1PZ3A 4Z8FH 5KVDH 2YEVB 3WY2A 3GDBA 2KQNA 1FZMA 2E9WA 1X5GA 1H3PH 4Y9FA 1SYVA 5I1KL 2VN3A 1T5XA 2R0LH 2JB5L 1A7NL 3VXRD 4XN1A 3MLXH 1U8QB 3GSNB 4PRHD 3UZEA 1ES0A 5IKCB 4A7GA 3OHXC 4A7TA 1PEZA 4YHYB 4B3VA 2XZAH 4HKZB 4JX0A 5D2LF 4XNXH 3N50A 2Y23A 3ATEA 4LL1A 5CJQL 4ZAKB 4N6QA 5E00A 3L3DB 1KJVB 1I7TA 3FU5A 3BAJA 3JTSB 1UJTA 5DDHB 5IG7B 4UOW0 4F2EA 2CKNA 4J3OG 4KUCF 4XMTA 1PG7X 3EYFB 4EDWH 4PJAA 4AMWA 3MTRA 2ZXWB 2V3EA 3V52H 1OWWA 2F5AL 5BMFH 2DN7A 4TUKH 1XZ0A 1T4KB 3GRGA 4FZ8L 4YN3A 3PXHA 2AJSL 2UYLA 3DBXA 4FEIA 1DJWA 5IB2A 1AJ7H 1A5FL 3H7BA 4RBPH 2GJZB 4ELMB 4LIQH 1MVFA 2Y7OA 5B7EA 3BZ5A 4B27A 3QCUH 5K1VA 2PTVA 4G5AA 4WJ5B 5FYJE 4KROB 3NZUA 4P3DA 3GPEA 4RMQA 3MX0B 2ZOLA 1B4JL 4QGTA 4GG8A 1GYWA 3D85B 5GSRB 3N1PC 4YR6A 2LVCA 2AHIA 4EZJA 1IEBB 5I5MA 3CLEL 3CDCA 3I3EA 1VKXA 1XIWB 1HH9A 2P28B 5D96C 3FU0A 2ADGB 2E9JA 2UV3A 4HOWA 1P4LB 4P07A 3G08A 1YJDH 3FB7B 1OCCB 5FUOH 3H3BC 1A6AA 4L4JA 1JJUA 3KHQA 2XWZA 2YAEA 1ORQB 5EU5B 2BSBA 2WP3T 3MROA 1P1ZA 2XJLA 4DPCX 3PLYA 3QHZL 4M6MH 3PFQA 3PIQA 5CZVH 5I26A 4DGYL 5E95B 2FO8A 4O5LH 2PN5A 4P9HL 1KEMH 3BGFB 2HT3C 3GSVB 1AAJA 1CFVL 4PP1D 5BRQA 3U0PA 1S7WA 2CXKA 3PF2A 4PIBA 1I1FA 1M7XA 4F8OA 3H2PA 5F7HA 5HYEA 4HDIB 1YQVH 2OR9L 4LVOC 4Q9QH 3SKUD 5J12C 3DECA 5J3HD 2FSEB 3F7YB 4MGXA 4XB8A 5HD8C 4R3SB 4Q56A 2R69L 3WL9A 3IT8D 3CMGA 2N7BA 1HHIB 2EIKB 3IU3A 4WF7A 3BD3A 1T03L 3OVUB 3EHBC 1AY1H 3FCBA 2ZP0T 2F0CA 5B22A 4XNMA 5KSAB 3KPOB 1E4WL 4JQIH 1UD6A 1E2WA 3D7PA 2IGLA 3QO1A 4OD3H 3TTSA 3I02A 4XMKH 3FW6A 3QORC 5C0NC 2YJLA 4QXTB 4C58B 1A0QH 2ZOKA 3QJFA 4QYAA 1JS4A 2FHFA 4UOJA 3R19A 4WFFD 2JJWA 4O2FA 4OLEA 3PABA 4X7FC 4DKEL 5KVDE 1J5DA 2BH0A 1X5AA 4GRWH 4K9EH 3G9VA 1MRFL 1KELH 4D8PB 1VAHA 4R96B 1MW3A 3MRRB 1L9PA 2B4CL 4OZHF 4AVKA 4GXVL 1Q9KA 2QQNL 2FHCA 1OOAA 4FNSA 1CK0H 4TSCH 3S4SB 1T89C 3O3AB 3TO4D 3ULSA 3VXRB 2FT7A 5CBAB 4PRHB 4QRTA 4UQ2A 3CFEA 4OJYA 1L5GB 2RR3A 2AV7B 5I18L 1GMEA 4WWKC 3QHTC 2VLLB 4A7VA 5BW7C 3K6DA 4U6HB 3ZDYE 1U8KB 3F64A 3G7TA 2H5UA 3L5IA 4ANVA 1HSAA 4N6RB 1IC5L 4NO5A 1EXGA 4X6DF 4Y19A 5F7NC 4AGMA 1GZHA 3KS0J 3KGRA 4X99A 5E9DA 1VGKA 2MCPL 1U4FA 1WIOA 1C1EH 1BYNA 4WFGD 2VO8A 1V5JA 1QLEB 3QWOB 5ESVB 3HR5A 3QDHA 5GS1A 6FABL 2GSIA 1SEBB 4LIQE 3DSFL 5CZKA 5AYQA 2H26A 1H6FA 1IQDA 2EIMB 4HKXB 4PBVC 1TTBA 5ESQB 3WEBA 3GSNH 2GAZB 4KTEL 3S5ZA 4KJWC 3VFOA 2VITB 4ZD3L 3S88H 2AI0H 2CM5A 1MLCA 3BQUD 5EZLA 5FGSA 5EO0A 4NZFA 4GKZA 5GRWA 1UWGL 4WI9A 3L5JA 1PX8A 3PWVB 2FQGA 4N8VA 1ZA6A 5IHUH 1BF5A 1MFDL 2C7UB 5MP6H 1TTFA 3IJSA 3VXSD 2PCXA 5IEKB 1W72A 3BWUF 3C12A 3JWOC 3U83A 1H8NA 3ULVF 4BE6A 2BNRD 5BXFB 4NQTA 4UAHA 1T2JA 4AYFB 4F1ZA 3QUYA 4HJSA 3T2QA 2UX6A 3GIZL 3ZE2E 3RLSA 1NA8A 1NMCC 4ZDHB 3TCLA 1MVUB 2YUXA 2BOLA 1KCLA 1P4IL 3FT0A 1OAQH 4YHIA 3UTQA 4DP0X 1BJ8A 5C3LD 2N4IA 5HGAB 1SF5A 4OUUB 3N04A 2QDVA 1LEKA 3EJQA 3GXMA 4DQAA 3CDGA 2FIKB 4XBEH 4JB9H 4MTMA 3WN5B 4LLWA 1CE1H 1TZAA 2IDFA 2AJUH 4PLKC 1JERA 4PJBE 3VXPA 3H9HB 2A38A 5TE7L 1D7CA 4RMBA 3BZFB 5DC4B 4EI6A 5DUJA 2CUHA 3P77A 3VNZA 3KPPA 1G7JB 4NT6B 2J2ZA 2K4WA 4H1LH 1UHVA 2FECL 2WZ0A 3QJOA 3QARA 3ZDWA 1A9EB 2D0FA 2P48B 2VLJE 1WBZA 1XGTA 2WXRA 3I74A 3MCKB 5L9DL 4XRCA 1QLFA 4XX1E 4PIRF 1UOLA 3FMGL 1KYDA 5IHWA 2YARA 4PJEB 1BQSA 3W9DA 2J7LA 2R29L 4OLVH 3AREC 1PX4A 3PRZA 3I9GH 2D7QA 4LKCB 5FOBB 1AC6A 3UBXG 4AIZA 4LT7A 1J48A 3RGVB 1AC0A 3NPSB 1YYCA 4GKLA 4L8CB 1F11A 5BVJB 4Z7OE 2ZXQA 2BHYA 4GRWE 1ESOA 2YC1B 5DHXB 5I75B 3OAWA 2OCFD 4UV7H 3ZRSA 1CICA 4APXA 1JGVH 2YN5A 1A6WL 5TDOA 4NZDA 2WVSA 3MNVA 1ZLUH 1JNLL 2FLBT 4G5ZH 1U8PB 4P46A 2E3VA 3K0WA 1U30A 2EIZA 3S96B 3NJFA 5C3IA 4HPYH 1E5YA 4I4WA 5KG9A 4W9JC 4XT1C 4QHLA 2OTUA 4FXGA 4I0PC 3C6SA 3WD5H 4AKQA 1T6WA 2IFFH 4PJAF 2VRAA 3BZDA 4R2GC 4PJ7B 1MXDA 1JVKA 4YWGH 2H2PC 2KLTA 3KL3A 1MFEL 4HUXB 1M6UA 2WUBH 2AZAA 1N0LA 5MEQA 1OM3H 2QEJA 3C60C 3HFML 3FAXA 4XO8A 3VH8B 2O1AA 4N90D 4FKEA 4P59L 2GSMB 4XO3A 1IAKB 5DD6B 4UQCA 3AUVA 3V9CA 3KHOA 5EU3B 1NDMB 3EO1B 3HBZA 3RTQC 3HG1D 3V0EA 3K8LA 5HYSB 1TTUA 4CU7A 2YD1A 4XPBH 2OSXA 1RZKH 1HX0A 2X05A 2WLYA 3ABGA 1GKOA 3BMWA 1KLUB 1CDYA 4BRVA 4CMMB 1MWOA 4LCYA 4BWWA 1H5BB 1G9MC 4LCVA 1OTSC 2OXHA 3L8QA 4MNGB 4MMYA 3HNTL 3DYOA 3Q8FA 4RCAA 2XFXB 2HJKB 3NSYA 3KBHE 3P9LB 1GCFA 3ARFD 4MJ6B 4L2YA 3RBGA 3QS2A 3VXSB 1EAPB 2EEDA 1ASQA 2BSTA 1EEUA 3DO7B 2R2BA 1TVBA 3LN5A 3X14A 4C83A 2BNRB 4N0FB 2WZAA 4AQ1A 1ZOXA 3ASWA 2YKLH 3ZKSD 4P5TD 3MNMA 5E2JA 1GC1C 4LSVH 3VFNB 1QLEH 4ELME 4B9GA 1IILE 3KNBB 5ELIA 1NGXB 4CU6A 2FK9A 2GY7B 2F19L 1NLDH 2VZOA 4YSEA 4AL8C 1W80A 2CBMA 3Q44A 1FFPA 1CPUA 2EIDA 3CHOA 4J3WA 1FG2B 2H1XA 1IUZA 3QEHB 1UKSA 2QLVB 3AW5A 5CFAA 2E7LC 3PJNA 1TQTA 1I53A 1EEQA 1GPOL 2VL4A 4GQZA 2X1OA 3HS0C 3IS1X 1XGUA 3OKDB 4NO2A 2ZWKA 3SJVD 4PRDB 2W60B 5GGQL 2XXGA 4XNZB 2LLLA 3FS9A 2B1HL 3SKNB 4WNSA 5DJZB 2A77L 3QCVL 4GQRA 5DJYB 2HKAA 4X4XB 5CBEA 4WW2A 4Z3IA 2BFGA 2A4EA 3OSKA 1PAZA 3QFGA 4Z77A 5AB2A 2EEFA 2D7PA 2VN6A 3CVHB 3VVVA 4XCNB 3B3BA 2WVUA 2C3XA 2W91A 2Y07L 2WTOA 3BESR 5A16B 3GGWB 1JCKA 3BKCH 2PPAA 5DK2B 3HC3H 1TJMA 1QX1A 3RIAK 4QEGA 1OZUA 2B59A 4HKBA 2K6WA 4MCZA 3O6MH 3KG5A 2DM4A 4OGXH 1KFAH 1T2QL 4LPVA 5ISZD 1RZIA 3I50L 3NOIA 2NR6D 3EAKA 4IRJA 1RI8A 2CRIA 3S36L 4PJ8D 3K8MA 1PS3A 5AVVB 2APWA 3BH8A 4NQSA 4OFYD 2FL5A 4FKHA 4HWZB 3RY6A 4HU8A 2XQBL 3PHAA 4DKAA 4Q74A 3ULUF 5IJVB 3LKSA 3HFFA 5IGXH 1U3HA 1MH5B 4G6AC 2DQTH 3JQOB 4M93C 5AW4B 1ZXKA 3EUDA 4OF7A 3CXHK 2OI9C 1C5DB 3PPEA 1FVEB 4Y9CA 2CKBL 2COQA 2KZKA 3ILQD 3MJWA 1VFAA 4JY5H 3VD2A 1CFSB 4Z1PA 1B4RA 2LU7A 2BFVH 3BSZH 3MUHL 3DGDA 5L4JA 3MKKA 1NCWL 1QSFB 4P2RD 1JGDB 2UWEA 3DOSB 1H3VA 1KF9B 1SOKA 2Y2WA 2HFGH 3FFDA 4EEEA 1CI5A 4LU5H 3BP6B 3FRPA 3KCPA 3FUKA 3VGDA 1TZIB 5E6SB 4JUSA 1YN7B 1Y6NR 1JV5B 1OAJA 2VDML 3LS5H 1SY6H 1WS8A 2DWYA 4U1HA 2I25N 2HN7A 4JPIB 5AB1A 1T1YB 5EHFA 2XA8L 3VFMA 1KPRA 3FQRB 2AEPH 4MA8L 2ZCHH 1UACL 3F7QA 2PYEA 1KCVL 4AGQA 5JOPD 4OFDA 5DJ8B 3DV6A 3TASA 1CXFA 3HG1B 1EJFA 4IBWA 3GBML 3QIBA 3VA2C 3VXRE 4PRHE 3IXTA 2R0LL 2E9GA 3SDCD 4N2MA 1EIBA 4FNPA 1B6DA 5DEZA 4ETQB 1FNHA 4IKJA 1AS6A 2PO6A 3GMLB 4PJIA 4XNXL 5IV2A 4WHYH 5GS2H 1GGCL 5I6XC 3WE6B 3D3VA 2RBLA 2VGLM 4GI6A 4ZW6A 3RNKB 3P11L 2X4QA 1DEEA 2H2SC 3LKQB 4LLYB 3CBJB 4MJHA 1IIKA 4HH9A 1N0XH 2PXYB 2IDSA 2YLKA 4K71B 3GD1C 1H15B 4HQQH 1FSKB 4N0UB 1FNAA 1TNNA 5AD0B 3LH9A 1L3WA 3NUKA 3GHEL 5JLZA 2ITCB 4DGVL 1NLBH 4OF6A 4UT9H 1QI4A 3VFTA 4BQ9A 5EZJB 2UXVA 3MV7D 3CSGA 3U0TB 1RHHB 5EV7A 2O6EA 1CTMA 1MCSA 2VERN 3ZKNC 3TBWA 5J56B 4BUQA 1AGFB 1QASA 1MJUH 2YAPA 1E65A 1FAIH 4WY7L 4KMTH 1G4RA 2XI9A 2ICEB 3HI5L 4GB9A 3KWWB 4J6RH 3N06B 4K2UL 4PAZA 5L2KB 5JO5B 4Z7UB 4CNIB 1Z3GH 5DU7A 4B9JA 5CIPB 1WITA 3S37H 2WZ6A 1AGBB 5H35B 4AMXA 5CCKL 2A9CA 3A23A 3DMMB 3T77A 2WN3A 3K6IA 1WAAE 2ZKWA 3LHAA 2QPFA 3QIWA 2Q10A 1CVRA 3NTCH 1G94A 1NJ9B 4XN2A 4OLZL 4M6ML 3KEHA 1MFBH 3BUYB 5A43C 5CZVL 4HEPG 4D3CL 1AIZA 4O5LL 3UG5A 1INDL 2APTA 5DFVD 2XDHA 5TPWH 1JDAA 2K6ZA 4ZQKB 4EF3A 5HDRA 3Q13A 3HW7A 5CLTA 4XO4A 3VJ6B 1UOVA 3QNFA 5GRUH 4FQ1L 1HZLA 4MAZA 4Q9QL 4JM4L 3MU3A 3OPUA 4S2SA 1ADQH 3CVHH 2HRPL 4PJEE 5K59E 4PRNB 1G9NH 3MNDA 4K7PY 1GS6X 3MGOA 4XVUC 4PW9A 1S7SA 1ZHLA 4ICXA 3WJMB 5K9QI 4NZUL 3LRKA 4JJ5B 4FD0A 1GZHC 2ITEA 4ZOBA 4MD0B 4DVBB 2Y5QA 5C9KA 2D2CC 3S37X 1JZGA 5D6DA 4E9LA 1A02N 3UABA 1U8NA 3DPBA 4FL4B 2VR6A 4G2AA 3EDFA 1LO5A 5JIQA 4OD1L 2I60H 3FPYA 3MMEB 5HHXH 2KI6A 4P23B 4TUOB 4ANKA 4WEBH 3HZMB 1ACXA 3UMNA 1AQDB 2VE6B 5I1AA 5JIPA 4FYRA 4PR5A 3S3JA 4MZ3A 4X80H 3JV4A 1AGCB 1E8ZA 1IGFH 4K9EL 3SGKC 1XHHA 3LN4B 1NH6A 4HPHA 2G5UA 3EOAA 3IWVA 4XPFH 3RL1A 5ADOH 1F3RB 4YBLB 2ARWA 1WFMA 3QUYC 4WKXA 1DJGA 4PJ7E 2FBJH 1CK0L 1R3KA 4O51A 1N6VA 3MRMB 3U4BH 1T0NA 3QJXA 4HBCL 3SDCB 1FFOB 2JCWA 1E40A 3ZDXB 4IOSA 3WFDH 5D1QC 1EFXD 1KLFA 4LSRL 3ARZA 1HHGA 3OR6A 2DAVA 2DQMA 1MG3C 4WI0B 2BSRA 4YDLC 1AQ8A 3H9SD 4ZS6D 1BAFL 1KXQA 4I3RH 1NCHA 3FSVA 5GJTL 2E4TA 1G0XA 2HT3D 2PWHA 4HFWA 1JP5A 3EBGA 1WGOA 1V05A 4LLQA 2MHAB 1OLLA 5FAAA 4CMHC 5DJCB 3DGCR 4MNGE 4RNRA 5E08L 2B0SL 4I87A 3IGUA 5HGDB 1K5NB 1AZVA 4WW2F 3ZMEA 3K71B 4RAUA 2DLEA 3OJDB 1IQWL 3S88L 5JW5A 2IH3A 3FCTB 3MV7B 4YH6A 4XE5B