3F6OA

Crystal structure of arsr family transcriptional regulator, rha00566
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
MAQYPEQLNGIFQALADPTRRAVLGRLSRGPATVSELAKPFDMALPSFMKHIHFLEDSGWIRTHKQGRVRTCAIEKEPFTAVEAWLAEQQELWESRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ArsR family transcriptional regulator, RHA00566
rcsb
source organism Rhodococcus sp. rha1
molecule tags Transcription regulator
molecule keywords Probable transcriptional regulator, ArsR family protein
total genus 30
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12840 HTH_20 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f6oA00
2FBKA 4BHCA 2Z3YA 3LQQA 4P96A 1P2FA 4UVBA 1SAXA 4FHTA 3ABUA 2VN2A 5D8KB 3FXRA 2HKXA 2GZWA 2GIVA 1XSDA 2ZFWA 3BWGA 2W57A 1FZPB 1Z1DA 3ZMTA 1WSUA 2XAJA 1FNNA 1QPMA 2QQBA 3Q9SA 4O6JA 3KP5A 2KKOA 1BI3A 5LGUA 4CYDA 4YG2F 3BP8A 1S7OA 4A2UA 2R7DA 3FM3A 1Y0UA 4RS8A 4WWCA 4HX4A 4HF1A 1SFUA 5AIPA 5IT3A 2C6YA 5D5UB 2HQRA 2PI0A 1MKMA 4CGZA 3I0TA 3V7RA 5HLHA 5DCFA 2BBYA 4LG0B 2FNPA 5A2QK 1ZG1A 5HS7A 2CW0F 1GXQA 5DUIA 2BYVE 5HLIA 5L3BA 5H6QA 1TW2A 3Q5FA 1KQ0A 3TDUC 1ZH5A 3BJAA 3DKWA 1RNLA 2DK8A 1F1ZA 1H0MA 2OQGA 3R60A 3O2PE 3U2RA 2MC3A 2GXGA 1DP7P 4IRGA 4L0ZB 2JPBA 5ILUA 4UVAA 1U5TB 1IRFA 1G3YA 1S29A 4IJAA 1RUOA 1QZYA 1HKSA 3K1NA 3DP7A 1YIOA 4RB3C 1HSJA 2STWA 3PQJA 1XB4A 1NHAA 3L09A 3WTUC 3EYYA 3DFGA 2YU3A 3F8NA 1HKTA 4XRFA 2DK5A 1DPUA 4H0EA 1MDMB 1IUYA 4CXFA 3KZZA 5CVUA 4GGGA 2QUFA 4MGRA 5J8FA 3T8RA 1J75A 4XSXF 3J80Z 4L9NA 5ICGA 3GUDA 3RIRA 3VODA 1PP7U 4CDGA 3OV8A 2EA2A 5LGTA 2DQLA 2P8TA 2K7LA 3IKVA 2HTSA 1B6AA 5DCMB 1OYYA 1UHMA 3RPQA 5TJJA 2QYOA 1XCVA 2DFIA 1G4DA 3LQRA 4EJVA 2VT3A 4NQWA 4XLNF 2IT0A 3JSOA 4WCGA 2VOOA 1HBXG 4EM1A 2DW4A 3K2ZA 1FYKA 3C1DA 2ACJA 4WK8F 2EFOA 1TNTA 2VC0A 4IVNA 1ZREA 2HYGD 5E1WA 4HF2A 2D1HA 2L4AA 4A5NA 2Q2EA 1GVJA 2IP2A 1JXSA 1LDKB 4MHGA 4P9FA 3LAJA 4ESFA 4ENJA 5AONA 3SZTA 1UHWA 5FO5A 3IHUA 2O0YA 3F6VA 2PLYA 2A5YB 2KIFA 5EEGA 4G7ZF 4WXCA 4FX0A 2ZO4A 5LHHA 3E97A 3QU3A 5LRRA 1K79A 2DO7A 2RV8A 3ECOA 3GWZA 3VEPA 4EM0B 5E18F 3ZN1A 5DV5A 4MNUA 3N4MA 1FSEA 2EV0A 2PJPA 2CGPA 3MFKA 2GQQA 5HS9A 3E6MA 4KUMA 4E70A 1XD7A 2HFHA 1JGSA 1BM9A 2QVOA 1R1TA 3BDDA 1IRGA 4A6DA 4IPAA 3GLXA 1AOYA 1BI0A 2K27A 3M7GA 1ZN2A 2P7VB 3CUQA 4LK0F 3DV8A 5L3EA 3ERED 4OIRF 2M45A 4M9XA 3TO7A 4GYGA 3BY6A 2EK5A 3GFJA 1XGOA 3QP6A 2DTRA 1KYZA 4TV7A 1CF7A 4KIFA 1YLFA 3RKYA 1RUNA 1CF7B 3GFMA 1KQ9A 1W7PB 4G6QA 1Z91A 4WXDA 1RI7A 2E7WA 2R3SA 3IRQA 5HDGA 2PMHA 3WE3A 1SD7A 1TNSA 3F6OA 4HLYA 2DQRA 2ZXJA 1FLIA 4U0YA 3ECHA 2Z33A 3FMSA 2Y75A 3RYRA 2A07F 4A0YA 5IT9Z 4ETSA 1XMKA 1R00A 4GYIA 1V3FA 2E7XA 3CUQC 1FYMA 1U78A 3R0JA 2G7UA 1YW9A 4Q5SF 2ZNZA 2QQAA 2XAGA 3F22A 3PFIA 3GVAA 3WU0A 1C0WA 2IA2A 2KIUA 1DUXC 3TKYA 2B0LA 1SFEA 3WODF 1XGSA 2JSCA 4YIFA 3T0YA 1CGPA 2QLZA 3TO6A 3GYHX 4EVIA 2COMA 2K4JA 3JTHA 4U7BA 3ZPLA 2IA1A 1IF1A 1LEBA 1K7AA 5HLGA 2RQPA 1EH8A 2WWYA 2FRHA 1PUEE 4OINF 2XGXA 4JBAA 1TQPA 4AVPA 2QM3A 1ZLKA 2VONA 3TOAA 2M1BA 5K5QA 4I2OA 3NQOA 3H3ZA 2X4HA 5DCMA 4RAZA 1V4RA 2A68F 3F8MA 3HRTA 2QQ9A 4A6EA 4XSZF 4A0ZA 2XAFA 5JHUA 1BIAA 1I1SA 2CYYA 5D6FA 2Z99A 2VBZA 1LDDA 3ZMDA 5LEJA 3KEQA 2ZCWA 2IVMA 1BC7C 1IN6A 5LRSA 5ERIA 4EM2A 2A3SA 4S04A 3P9KA 2KRFA 2FF4A 4Q4ZF 4HAMA 1O3TA 2ZJ2A 3KP3A 3CO6C 2R7FA 4I02A 2UWMA 4IRIA 5IT9K 4KN4X 4L5IA 4YFNF 3WGHA 3GXOA 3V7SA 2EB7A 2DT5A 1PDNC 2RKHA 3RKWA 3EDPA 5HS8A 2L4MA 1XSXA 1U6GA 4IRHA 2EFPA 1O7LA 3RI4A 2O8XA 4KIBA 2A69F 4LLLA 2IJLA 4R1HA 3R6SA 1E2XA 4PZJA 4OIQF 3KE2A 3FXUA 2V1XA 1SD5A 5ILVA 4EV0A 1XDSA 2STTA 4BNCA 5CVIA 4Y17A 4LJZF 1XDUA 4HQMA 4A5MA 5DEQA 1FOKA 2HEOA 5BQTA 4ZH4F 3F8FA 3NRVA 4RB0A 3VB2A 2KJCA 4EGZA 1WWXA 2MH9A 5HOOA 4UV8A 2P7CB 2NNYA 3E6BA 3JTGA 2W24A 4MQ9F 2FBIA 1BI1A 5DYMA 4KIGA 3EQLF 3QRFF 4KMFA 5LGNA 4UV9A 2OZUA 1Q1HA 3HYIA 1MD0A 5F6FA 2OD5A 1YW7A 4OOIA 3O6BB 1YW8A 3BJ6A 4JK1X 4HZFA 1JHFA 4I7HA 4LD5A 1KU3A 3B73A 3OOPA 5BPIA 2A6EF 5J8CA 4KN7X 2CSOA 1MJAA 1S8NA 2VBWA 5LHIA 1BN5A 1FYLA 3WTXC 4HBLA 1LDJA 3E6DA 3KLOA 3V7CA 1D8KA 2FOKA 2GA1A 2IA0A 1R22A 2XAHA 1S6LA 2NYXA 4XBFA 2DLLA 2FNAA 2PEXA 2QBYB 3QAHA 5D5WB 2W85A 3DPTA 3U9GA 3BOQA 2IW5A 5FB2A 4M71A 5DD4A 2YPRA 2XROA 6PAXA 2Z5UA 1HW5A 2VC1A 2D45A 3MEXA 1G3TA 4HA8A 2RGVA 1XGMA 3E5XA 2OU2A 2X0LA 4K2EA 1AWCA 2P5KA 2EFQA 3IRRA 1F4KA 5FFZA 4HQEA 5K1YA 1STZA 4IF4A 4OIPF 2FEZA 3E5QA 4ZYGA 4I0BA 3I64A 2XUBA 4CHUA 1I1GA 4ENKA 3WG9A 1TW3A 4QLCU 3HOTA 1O3RA 1IZ1A 1I27A 1LB2A 1QZZA 2F5FA 4LB6B 3V8LA 4PDKA 5CVVA 1YO5C 1HW1A 1USTA 1ZGAA 2ZMEB 1BC8C 1R7JA 3M9AA 5L3GA 4HLXA 1XSVA 2M30A 1U2WA 2BEOA 1XMAA 1FBUA 5JFRA 1J5YA 1B59A 2H6CA 1MZBA 2PG4A 1KYWA 5FLXK 3RDIA 1D3YA 1IXRC 1XCBA 4RGRA 3HOSA 4LB5A 5ILSA 1J7KA 5HDNA 1FC3A 1OPCA 4UHTA 3NEUA 1T6SA 5CYVA 4AWXB 1F5TA 4RB1A 4Q47A 5HVQC 4LG0A 3WTVC 2P5LC 1DDNA 3SQNA 5BMZA 4I09A 2L3DA 3G73A 2LKPA 4RB2C 2VT2A 3FZVA 5L3CA 2XHKA 3CLOA 2IPQX 2EA4A 4EJWA 3CUQB 2VE8A 2GA2A 2RNJA 2ESHA 4MTDA 1Z9CA 4LK1F 5AIQA 3HHGA 2QENA 2OAZA 1EH6A 1GXPA 3RPUA 4HX7A 5JI6A 4LLNA 3MCZA 1B1BA 1YG2A 1QQIA 5L3FA 4R79A 4G9YA 1RIOH 2EV5A 3HRSA 4ZZLA 5DUKA 1FT9A 3K0LA 1R5GA 4PGHA 4EJOA 2L02A 1HSTA 4Y15A 3E5UA 3AAFA 4I01A 3BZ6A 4GO1A 5H6RA 5LEKA 4G7OF 3EETA 1T2KA 1J0RA 3J81K 4KNYA 3CO7C 2BGCA 2EFNA 1BI2A 1J9IA 4OIOF 2WV0A 1YTYA 3ROUA 1HQCA 2HQNA 5KVRA 1R58A 3I4PA 2FE3A 2V1DA 4LFUA 3WTYC 4ZYDA 2DPUA 1K78B 5D5XB 2KIMA 3SXYA 3WTZA 1ZLJA 2CWEA 5ICCA 2XASA 2PQ8A 4UNOA 5A2QZ 2OQRA 4NB5A 3QPTA 5CVRA 3ISPA 1SMYF 2H6BA 3JAMZ 2NRAC 3VOEA 4HF0A 2MD5A 4WX9A 3IWZA 2XKPA 2RDPA 2EWNA 4EQQA 3HTSB 3HHHA 3ULQB 4KDPA 2YR2A 4BH9A 1VTNC 4L9TA 3Q9VA 1P4WA 2EFWA 2O6GE 4M9SA 4M9ZA 2YSRA 1PP8F 1WRJA 1B9NA 1J59A 1F9NA 5TRDA 1B4AA 4U7DA 3L7WA 3MZYA 4Z2YA 4EJTA 1X3UA 2FU4A 2HDCA 2V6CA 3HTUA 3ZMUA 2MLGA 3I53A 2RN7A 2DAOA 4O5VA 2ESNA 3WGGA 2PMUA 3CDHA 2Q8KA 2H94A 5ICFA 1UCRA 4CO8A 1JHHA 1K6OA 1H9TA 1G3WA 4HDUA 4ESJA 2HTJA 2WTEA 3ZMVA 3B02A 1REPC 2AS5F 4MQVA 3GFIA 2A61A 2HWVA 5E8GA 3FF5A 2HKOA 2JT1A 3LFKA 3I59B 5K5OA 1IXCA 1QO0D 1UB9A 4LMYA 3J81Z 4QWQA 2AXLA 3FHZA 1WI9A 5BPDA 3FM5A 1A04A 1IN8A 1ZRFA 4IHSA 3W6JB 2FQ3A 1R23A 1UFMA 3DF8A 4ZYHA 4KICA 1L3LA 3KETA 1FWZA 2QZ8A 4S05A 3WU1B 5E17F 1ZARA 4L9VA 2E1CA 4EMSA 2OA4A 2UZKA 3ABTA 4ENNA 2VBYA 2W84A 4BQAA 3VFZA 4IXAA 4BAYA 3F72A 3RKXA 3COAC 2M5WA 5LBQA 4U0VA 2KJBA 3HIFA 3QP5A 3DXJF 3PQKA 3GFLA 1ZYRF 3IC7A 4KA4A 2J5OA 4L18B 1HXDA 2Q0OA 2GWRA 3D5LA 2NAZA 2ETHA 5L3DA 1G6NA 4AIJA 1LEAA 1T0FA 2V79A 1BOAA 2MBFA 1KA8A 5JVTA 2OZ6A 2LF7A 4M74A 4HX8A 2NS0A 5D6EA 5E8IA 3WTWC 4R8HA 1FP2A 2XIGA 1R36A 3HRMA 3JAMK 1ZG5A 1SMTA 1YS6A 1O3QA 3L2CA 3N97A 4N0BA 4P5OA 2HGCA 1B9MA 3CJNA 2LF8A 1J2XA 4UUVA 2TDXA 3BROA 5FD5A 4YFKF 4EJUA 1FY7A 3F21A 4YIIA 3MAJA 4AIHA 1IXSB 2VXZA 2FMLA 1HKQA 3RJPA 2NNNA 2ZBKA 2Z9OA 1G3SA 3QPHA 4PCQA 3KP7A 1T38A 2P6TA 4FX4A 4M72A 2QWWA 2DI3A 4FT8A 3D0SA 5F1RA 3K1MA 1YS7A 2O03A 3KEOA 4ZYEA 3LA7A 1T98A 4CICA 2ISZA 5D5VB 5ICEA 5CJ9A 3GW2A 1U8RA 1K78A 1ULYA 5CLSA 1RZ4A 3LA3A 4BHBA 2VBXA 3H3UA 3QU6A 3ML6A 5DDGA 3KZYA 3M1EA 3LWFA 3J80K 3KCCA 2P6SA 3BPXA 3F3XA 4Q48A 4P55A 1MGTA 5D4RA 1FBQA 1MJBA 3K1PA 1QGPA 2O3FA 4OMZA 3KP6A 2XAQA 3L00A 2PN6A 2K86A 2JZYA 4L9JA 5J6XA 1U5TC 2FBHA 1R1VA 3HSRA 1IW7F 2YX7A 1SFXA 3I71A 1IAWA 2HS5A 2Y0MA 4KYWA 5D8LB 3V4GA 4WF2A 1KGSA 4RGUA 2BE5F 2QBYA 3BPVA 2J5PA 4DNCA 1BBYA 3FMRA 3I58A 1E17A 2D1VA 3GF2A 4UXNA 2LNBA 2FA5A 1IN7A 1TTYA 3HSFA 5BOXA 4HDVA 2IRFG 4MTEA 4YFXF 1OYWA 1KU2A 1OKRA 4I0AA 4M73A 4G7HF 4JQFA 5FLXZ 4HV5A 1OMIA 3W6KB 2HR3A 3KLNA 1BIBA 1U3EM 1BJAA 1Z6RA 2F5DA 1I5ZA 4KT5C 3G3ZA 4P9UA 3GX4X 2LDUA 2MLKA 1ON2A 1MDMA 4RAYA 3FWEA 3ZMSA 1FX7A 1Z05A 2MH2A 3ZP5A 2RVCA 4M6XA 5FGMA 5F64A 2CG4A 4G6DA 4BHPA 3TOBA 5ED4A 3REOA 4A12A 1D5VA 4LGWA 3TQNA 1O57A 3EYIA 2V1UA 3SFZA 2BV6A 4CZZA 1U5TA 3GEZA 1HW2A 3V8KA 1W7PD 2EJRA 4EGYA 1USSA 3BJOA 1KQ8A 2PFBA 2MA3A 3C18A 1OYIA 3E6CC 2P5VA 1TBXA 3C3WA 4HOBA 3EUHA 2L54A 5LLQA 4BYYA 2RC4A 2HYFA 3FXQA 4KMUX 2L01A 5JR3A 1YQAA 2ADUA 2P4WA 1R1UA 3DQVC 5DD8A 1KU7A 1S7AA 4ON0A 2JRTA 3TO9A 1O3SA 3ZN0A 3GO5A 3K69A 2K02A 1TQIA 1KU9A 1LJ9A 1W5TA 1P4XA 1W5SA 2ZNYA 3TDZC 4LLGF 4F7ZA 3KFWX 1TQMA 5HDKA 2YX4A 1SD4A 4BXUA 3DEUA 2G7HA 3SZPA 2DPDA 1GHCA 2D2WA 1WKMA 3K9TA 2ZKZA 3GZ6A 1Z7UA 2UXXA 1W7PA 2FSWA 4PGGA 2F5CA 4O3MA 4RGSA 4GCVA 2G9WA 4WXHA 4UVCA 4A0XA 3H92A 2ISYA 4OMYA 4XLPF 2HZTA 4GXOA 3DPLC 1ZGJA 1EH7A 3MQ0A 3T5XA 3I54A 2F5EA 1Z6TA 2A6HF 3RTRA 3KP4A 2XV4S 3R0AA 2OBPA 2FMYA 2H27A 3ZMZA 4HV6A 3V8JA 3J7AO 1XGNA 3FMQA 1ZRCA 4KFCA 3SHFA 4L5JA 4B09A 3T1BA 2CQKA 3S2WA 1ONVA 1JE8A 3U1DA 2JTVA 1L0OC 3L9FA 3RYPA 1FPQA 5FD6A 2CO5A 4U88A 4G8XA 2GXBA 4U0WA 4NHJA 1LQ1A 4I98B 5E1XA 1ODDA 3KP2A 1XN7A 2HOEA 3R61A 1D8JA 3P9CA 3C7JA 3F23A 2LSOA 2E1NA 4B8XA 4ASNA 3T8TA 3WE2A 2PBIA 2EV6A 2DBBA 3JSPA 4N9IA 1S3JA 2ELHA 4Y13A 3E3VA 1WQ2A 1P92A 4G94A 3LSTA 1QNTA 3WTTC 1ZHFA 3I5UA 3HRUA 4AIKA 1ZRDA 5FFXA 2Y48A 1ON1A 3IWFA 3M8FA 1H9GA 1DPRA 2H09A 3WGIA 3HUGA 5KK1A 1FBSA 1ZG3A 3O3KA 4MEYF 2O61A 4RGXA 5BS6A 3I59A 1EV7A 1FSHA 5E1ZB 3HSEA 4DQ2A 5H20A 1IN4A 3IL2A 1LNWA 2CFXA 3WTSC 4ESBA 1O7FA 4L0YB 5EEHA 2W25A 5D4SA 1I6XA 1OR7A 3P9IA 4ZZDA 3MZHA 3GZ5A 1T39A 2K4BA 3LAPA 1P4AA 4N9HA 1FP1D 3MWMA 1TLHB 1P6RA 2VE9A 5K5RA 2VODA 4ENMA 3CTAA 3IKTA 2XKOA 2GAUA 2UXNA 4MEXF 2V9VA 2JPCA 3F8CA 4M6YA 5LHGA 3JW4A 2ZMEA 1MJ9A 1SD6A 1YYVA 3R4KA 2VOPA 3CUOA 3P7NA 2F2EA 4HW0A 1LVAA 2WC2A 3FX3A 4HYEA 3TGNA 3ELKA 1R5HA 2M8EA 1YFHA 4IHTA 1W4MA 5CVJA 1ZAOA 3ZQ7A 2FXAA 1QBJA 3F8BA 3QOPA 1IN5A 2DU9A 2XRNA 4D0PA 3LA2A 4AD9A 4OU0A 2M87A 5E20A 3M8EA 2XVCA
chains in the Genus database with same CATH superfamily
4IHWA 2OF7A 2DMNA 3QPSA 4A3CJ 3LFUA 3JRFA 1HBXG 2FBKA 4BHCA 1WVRA 2Z3YA 1Z3YA 3LQQA 4CCLA 4P96A 1P2FA 3K4MA 2CUEA 5HLTA 4UVBA 2BVLA 1JI8A 1SAXA 3K4NA 4FHTA 3ABUA 2VN2A 4BQNA 4XOTA 3HOXJ 1QVUA 2BVMA 3H0GJ 4QPOA 5D8KB 3BQZA 3FXRA 2HKXA 2GZWA 2GIVA 2HI3A 3LSIA 1Z0XA 4XKBA 1XSDA 2LH9A 2ZFWA 3BWGA 2EZHA 2W57A 3PSIA 2ELKA 1FZPB 5K7ZA 1DU6A 1Z1DA 3ZMTA 3FXJA 4BDYA 1WSUA 4JOMA 2XAJA 2KMUA 1DP3A 1WJBA 1FNNA 1QPMA 2QQBA 3Q9SA 2DA2A 3IH2A 3KP5A 1GV2A 4O6JA 2KKOA 1BI3A 1IDYA 3LMMA 4BDZA 3AL0C 5LGUA 4CYDA 2ZC2A 3QYEA 4YG2F 5F08A 3BP8A 1LVKA 2P81A 4QSHA 3CZ6A 1S7OA 2A05A 2CW8A 4A2UA 2R7DA 3FM3A 2LK2A 1Y0UA 4RS8A 4EEFG 4XKVA 4WWCA 4HX4A 2AO9A 4HF1A 1SFUA 5AIPA 5IT3A 2EBIA 2C6YA 5D5UB 2K5CA 4BE1A 4IO9F 4D7MA 2HQRA 2PI0A 4A3EJ 1PJRA 1MKMA 2MC4A 3TP0A 3OYLA 1FJLA 2CMPA 4CGZA 3I0TA 1WZ2A 2YS9A 3V7RA 5HLHA 4PSWA 5DCFA 3PO3J 3BZCA 3K4JA 2BBYA 4LG0B 2FNPA 5A2QK 1ZG1A 1LPQA 5HS7A 1DGWY 3CCSI 2CW0F 1GXQA 2CRGA 5DUIA 2BYVE 5HLIA 5L3BA 1OR7C 5H6QA 3MD2A 2V4JC 1TW2A 2ECBA 3Q5FA 5JLWA 1KQ0A 1GUUA 3TDUC 4D1QA 1ZH5A 3BJAA 3DKWA 1RNLA 2DK8A 1F1ZA 2IGOA 3CF5F 1H0MA 2PJRB 3DU6A 1QZEA 2OQGA 3NWTA 3R60A 4BJTA 2KRCA 3BTCA 3DPUA 1EKEA 3BR2A 5GAHJ 1BL0A 3O2PE 2Y9YA 3I4MJ 4IQ4A 3ZXSA 4BBRJ 3S16J 3U2RA 2MC3A 2MG4A 1WJEA 4XN0A 2GXGA 3DBHB 1DP7P 2CH0A 2DA4A 3B6AA 4IRGA 5J3LA 3H9GA 4GDFA 4L0ZB 2JPBA 5ILUA 4UVAA 1U5TB 4DW6A 1IRFA 1G3YA 4CCKA 1S29A 4IJAA 1RUOA 4BUPA 1IV6A 4YIRX 1SEUA 4DOZA 5LFAA 3S15J 1QPIA 1QZYA 3MKZA 4N4NB 1HKSA 3K1NA 3IUOA 3DP7A 1YIOA 2XB0X 4RB3C 1HF0A 1HSJA 2STWA 1IUFA 3PQJA 1XB4A 1NHAA 3L09A 3G1OA 1MBGA 3WTUC 4B47A 3EYYA 5GAGJ 3HBLA 2HXIA 2DMQA 3DFGA 3F8NA 2YU3A 2LLKA 1HKTA 3HOVJ 3HKZA 2M9HA 2R7XA 4XRFA 1PYVA 3OYEA 2DK5A 2HXOA 4XQFA 1DPUA 2KZVA 3G4SI 4H0EA 1MDMB 5J4VA 1IUYA 4CXFA 3L2UA 4DJAA 3KZZA 5CVUA 4GGGA 2K85A 4XN3A 2QUFA 1XPXA 4MGRA 2PX9A 5J8FA 3E0JB 3T8RA 1TWCJ 3AG2H 3QPLA 1J75A 4XSXF 3J80Z 4L9NA 5ICGA 3DBLB 3GUDA 3RIRA 3VODA 5J40A 1PP7U 4CDGA 3OV8A 2EA2A 5LGTA 5GTHC 2DQLA 2P8TA 2K7LA 3ZQQA 1E3OC 2GM4A 4IKFA 3IKVA 3CJTB 1T33A 2HTSA 3AG4H 1WFXA 1B6AA 5DCMB 1OYYA 2JVHA 4A3KJ 1UHMA 1WPKA 3RPQA 4CCJA 5IP6A 4C3HJ 5TJJA 2QYOA 5J47A 2LKXA 1Y6IA 1XCVA 2DFIA 1I6HJ 2V26A 1MIJA 3DKXA 4HSRA 1G4DA 3LQRA 4EJVA 2VT3A 4II3A 2LY9A 4NQWA 4XLNF 5E3OA 2IT0A 3JSOA 2QCOA 4XLEA 4WCGA 2NOGA 4NC6A 2X1EA 2DW4A 3K2ZA 4OAZA 3Q0VA 2DJIA 4LIVA 4EM1A 2Y9ZA 2JA6J 1FYKA 3C1DA 1S5LC 2ACJA 4PFPA 4DBQA 4WK8F 1QVTA 2EFOA 1VQ4I 1TNTA 2VC0A 4IVNA 3OYIA 3GTMJ 1ZREA 2HYGD 5E1WA 4HF2A 2D1HA 5FLMJ 2L4AA 1HDDC 1QHHD 4A5NA 2Q2EA 1GVJA 2FX0A 2GBYA 4CYCB 2IP2A 3CCYA 2VQCA 1JXSA 1A35A 1N77A 1GLNA 1LDKB 1X3ZB 4MHGA 2M7AA 4P9FA 3LAJA 1AKHB 4ESFA 4ENJA 4IOCF 5AONA 1VQ5I 3SZTA 1UHWA 5FO5A 3IHUA 2O0YA 3F6VA 2PLYA 2A5YB 3CMAI 4BJ6C 1IV8A 2H1KA 5LD2C 2KIFA 4XKWA 5EEGA 4G7ZF 4WXCA 4V2FA 4FX0A 2ZO4A 5LHHA 1MW7A 2EZIA 3OYDA 3E97A 4Z6YA 2K9QA 2Q1ZB 3QU3A 3RPUD 3L2VA 4HG2A 5LRRA 1VNDA 1K79A 2DO7A 2RV8A 3PIOF 2CFOA 1ZTRA 3ECOA 3GWZA 3VEPA 3CCLI 3GTOJ 1X1CA 3FBNB 4EM0B 3FDYA 3ZN1A 5E18F 4JYKA 5DV5A 4P1WA 4MNUA 4F52A 3N4MA 5C44J 4M3GA 1FSEA 3I55I 2EV0A 2PJPA 2CGPA 3MFKA 2GQQA 5HS9A 3E6MA 4M6VA 1LKXA 4KUMA 2AXTC 3S32A 4E70A 1HA8A 1XD7A 2HFHA 1JGSA 3G1MA 1BM9A 2QVOA 4F93B 1JUPA 1R1TA 2V9KA 3BDDA 2EIMH 3MKLA 1YRNA 2ME0A 5M5WJ 3H3VK 1IRGA 1WJAA 1FTTA 5EG0B 4BXXJ 4A6DA 4IPAA 3K6GA 3GLXA 3AFHA 4I99C 1AOYA 1BI0A 3G2BA 1HCRA 2K27A 3M7GA 2K40A 1VI0A 1ZN2A 2P7VB 3CUQA 4LK0F 3DV8A 5L3EA 3ERED 4OIRF 1X1BA 2MSYA 1ERDA 2M45A 3KX2A 4M9XA 3BG7A 2E2HJ 5EZHA 3RKQA 1D1CA 2W4SA 1N25A 3TO7A 4GYGA 3BY6A 1YX5A 2EK5A 2KQRA 3GFJA 1XGOA 2ZMEC 2JVGA 3QP6A 2DTRA 2EILH 1KYZA 2V7FA 4TV7A 1CF7A 4KIFA 1YLFA 3RKYA 2OUMA 3GLLA 2VB6A 3CCJI 1RUNA 1CF7B 3GFMA 1KQ9A 4XLCA 1W7PB 1MMNA 4G6QA 1Z91A 1B72A 4WXDA 2KT0A 1RI7A 2E7WA 1W1WE 3S2HJ 4RBOA 4A93J 1GVDA 2R3SA 4IZZA 1FOXA 3IRQA 3SFIA 1LFPA 1SVMA 2PMHA 5HDGA 1SD7A 3WE3A 1TNSA 2FD5A 4BS9A 3F6OA 4HLYA 2DQRA 2LMDA 2ZXJA 4XM3A 1FLIA 4LG3A 2LYCA 4U0YA 2R5ZB 1VQPI 3ECHA 2Z33A 1A5JA 1OCTC 4JX5A 4Y52J 3FMSA 2KHMA 2Y75A 2HVQA 3RYRA 2A07F 4A0YA 5IT9Z 3J7YJ 4QPQA 2ZSHB 4ETSA 1XMKA 1R00A 4GYIA 1V3FA 2E7XA 3CUQC 1RRJA 1FYMA 1U78A 3EUKL 3R0JA 1GDTA 1TT5B 1I3AA 2G7UA 4FASD 1YW9A 2IAIA 4Q5SF 2ZNZA 2QQAA 1VZ0A 2XAGA 3F22A 3PFIA 1MBHA 1Q1VA 1POGA 2QSGX 3GVAA 3WU0A 1C0WA 2IA2A 3JRDA 1JKPC 2KIUA 1DUXC 2VUMJ 4NC8A 3TKYA 1VQ8I 2B0LA 1YJ9I 2V9PA 1SFEA 2DODA 2HPMA 3WODF 2ZFUA 3EUHC 5HNFA 1F36A 3MKYB 1XGSA 2JSCA 1ETYA 4YIFA 5M3MJ 1Y1WJ 1W0TA 3T0YA 3GTQJ 3PL8A 1CGPA 2DT7B 1BR1A 2QLZA 5E3LA 3TO6A 5IYDJ 3L2QA 3GYHX 1D5YA 1X19A 4EVIA 2COMA 2K4JA 3OIOA 2X51A 3JTHA 3K10A 5EG0A 3HOZJ 3HEFA 1MSFC 3DWLE 4U7BA 3ZPLA 1B72B 2IA1A 2OTLI 1IF1A 1LEBA 1MMGA 2X85A 1P7IA 1K7AA 2A6TA 5HLGA 2RQPA 1EH8A 2TRTA 2WWYA 2FRHA 1PUEE 1YITI 2XGXA 4OINF 2QF7A 2FQ4A 4JBAA 1BW6A 1TQPA 4AVPA 2OC6A 2QM3A 2R7OA 3ASNH 2L9SA 1ZLKA 3RQIA 2VONA 1QU3A 5EYRA 3TOAA 2PJRA 2IXSA 5C4JJ 4PUSA 2M1BA 5K5QA 2X48A 4I2OA 3BTIA 3K2AA 2JJ7A 1U9OA 3NQOA 1R5ID 1YX3A 2LFBA 3H3ZA 3K7AJ 2N8GA 2X4HA 4ZC3A 3H1CA 3S3OA 1D0YA 5DCMA 2QSFX 4RAZA 1T08B 3AG3H 4AYBA 1B8IB 1V4RA 3IH4A 2A68F 3TP3A 1Z7LA 4DGWB 3OYNA 3FIWA 2JQ7A 4QTRA 1MBFA 2QQ8A 3F8MA 2R0QC 3D5SC 2ICWG 3HRTA 2QQ9A 1RC9A 4A6EA 5KCMA 4XSZF 4A0ZA 2XAFA 4BL0B 4A3FJ 1NG6A 3S1QJ 5JHUA 1BIAA 1I1SA 2VIXA 4V2GA 2CYYA 5D6FA 2Z99A 4S0HB 1BR4A 1BOBA 2VBZA 4M3FA 1LDDA 2DA1A 2DJNA 3ZMDA 1R4MB 4XR6A 5LEJA 3H0DA 3KEQA 2ZCWA 2E36A 2F6CA 2IVMA 2VXDA 1BC7C 2LTPA 2X1CA 3GCMA 1JJ8C 1IN6A 5LRSA 1MNMC 2IS6A 5ERIA 2VKHA 3O8HA 1JKRC 1P7JA 1RKWA 5JVGF 2ZXIA 3FBIB 4EM2A 1XC5A 2WY7Q 2A3SA 4B44A 3GBGA 4EATA 4S04A 3P9KA 2KRFA 2Z2SB 3SYTA 2FF4A 4Q4ZF 4HAMA 1O3TA 2ZJ2A 5F0CA 3KP3A 3CO6C 2R7FA 1T95A 4I02A 2UWMA 3OYBA 4IRIA 5IT9K 3KIOA 2I5UA 4KN4X 4L5IA 4YFNF 3WGHA 3GXOA 3V7SA 2EB7A 4HRIA 2DT5A 1PDNC 4CSWA 3W2AA 2LVSA 2RKHA 2EINH 2X1DA 1AU7A 4E7SA 4CCOA 3L2RA 2CS3A 2R7UA 3RKWA 5FKOA 2LBFB 3HC7A 3EDPA 3RZDJ 3KYLA 5HS8A 1G8XA 3IP4B 3BZKA 2L4MA 4DYQA 4Y7NJ 1XS9A 1XSXA 4HEA2 1U6GA 1JT0A 4IRHA 2EFPA 3OMYA 2Q2EB 1O7LA 3RI4A 2VQGA 2UV1A 3MZ8A 3I56I 2O8XA 1JTYA 2E2IJ 4KIBA 2A69F 3C2HA 3VDXA 4LLLA 1Y39A 3FXLA 2IJLA 4R1HA 2QGUA 1E2XA 4XL9A 4PZJA 3R6SA 4OIQF 3KE2A 3FXUA 2V1XA 1SD5A 4BU2A 5ILVA 3G71I 3LSJA 3FISA 4EV0A 3CC7I 1XDSA 2STTA 3BG6A 5M5YJ 4BNCA 1EA3A 5CVIA 2CQQA 4Y17A 3CC4I 2I10A 4LJZF 1XDUA 4HQMA 4A5MA 2F4IA 5DEQA 1FOKA 4A69C 2HEOA 3ZQIA 5F27A 1CQTA 5BQTA 3DBRB 4ZH4F 5KAFC 3H35A 2MFZA 2LR8A 3CLQA 3F8FA 2E34A 3NRVA 4RB0A 2EZKA 2KJCA 3VB2A 4EGZA 3JRCA 1WWXA 1V5GA 2EH3A 2MH9A 5IYBJ 5HOOA 4UV8A 2P7CB 2NNYA 2VQLA 3E6BA 3JTGA 2W24A 1WGXA 4MQ9F 1RR8C 2FBIA 4E4HA 1BI1A 5DYMA 4KIGA 3EQLF 3QRFF 3PUBA 4KMFA 5LGNA 5HNHA 2KIQA 4UV9A 4XMYA 2OZUA 4A3DJ 3BTJA 1Q1HA 1X58A 3HYIA 1MD0A 5F6FA 2XF6A 2OD5A 1YW7A 4OOIA 3O6BB 1YW8A 3BJ6A 3A0BC 3OL3A 4JK1X 2R92J 4HZFA 4RA2A 3ZR8X 1JHFA 2BXZA 4I7HA 1AKHA 3GZNB 5GTIC 2ZJQF 4LD5A 1KU3A 3B73A 3OOPA 5BPIA 3K70C 2A6EF 4IOAF 5J8CA 4KN7X 2CSOA 5IPAA 3TBIA 1MJAA 1S8NA 2VBWA 2L9RA 2WB1A 5LHIA 4A3BJ 1BN5A 1FYLA 1IC8A 2XF5A 3WTXC 4HBLA 4UUSB 1LDJA 3E6DA 1WJFA 3KLOA 3RCOA 3V7CA 4MIMA 2LG4A 1D8KA 2FOKA 2GA1A 2IA0A 1VQKI 2ID6A 1R22A 2K9SA 2XAHA 4E7LA 3LL7A 1PUFA 2YU9J 4JP0A 3S8PA 1NTCA 1S6LA 2NYXA 4XBFA 4LOCA 2CUFA 2DLLA 3M1CA 4BY1J 2FNAA 2PEXA 3QAHA 1UHSA 2LBFA 2QBYB 4XICA 2HDDA 5D5WB 2WA0A 2W85A 2GOXB 1MBJA 4A3MJ 3DPTA 3U9GA 3BOQA 2IW5A 5J1RA 5FB2A 3HZJA 4ABZA 2DFEA 4M71A 5DD4A 2YPRA 2XROA 6PAXA 2Z5UA 1HW5A 2VJ4A 4I76A 2VC1A 1V5FA 2JA5J 3BR1A 3BR5A 2D45A 2DDAA 4U87A 4D5FA 1YHQI 3MEXA 1G3TA 4HA8A 3SEZA 1U9NA 3EPZA 1LFUP 2WV1A 4PJ0C 2RGVA 1JGGA 1XGMA 3K4BA 5GPAA 4CCMA 3E5XA 2OU2A 2X0LA 2OCEA 4K2EA 1AWCA 3LSKA 2P5KA 5B5EC 5GPCA 2EFQA 3IRRA 3DLLF 5FFZA 1F4KA 3UNGC 5EDNA 4HQEA 3TEDA 5K1YA 2VPLA 1STZA 4IF4A 3JREA 2KPMA 2R7VA 4OIPF 2FEZA 3E5QA 4ZYGA 4I0BA 3I64A 2QA4I 3OYHA 2XUBA 3HJEA 1Z21A 2DYRH 4QIWN 3OYFA 1IGNA 2CQNA 4DYRA 4CHUA 1I1GA 4ENKA 2RAEA 1TT0A 2DOEA 2KDOA 2IS2A 1NH3A 2Y30A 5F0HA 3WG9A 1D0ZA 2OJED 1A31A 1N78A 1TW3A 3Q3SA 4QLCU 3HOTA 1U0JA 1K4SA 1O3RA 1IZ1A 1I27A 2TCTA 2BHZA 5EZGA 2R5ZA 1LB2A 1QZZA 2F5FA 4LB6B 3V8LA 2O9LA 3S14J 4PDKA 3HKZN 5CVVA 1ETOA 3AG1H 1OFCX 1YO5C 1HW1A 1E3HA 1USTA 1ZGAA 2ZMEB 4CA0A 2R93J 4ZJZA 1BC8C 2VKVA 1R7JA 3M9AA 2WB1N 5L3GA 1ETVA 4HLXA 1XSVA 2M30A 1U2WA 2BEOA 4PJJA 3VPRA 4IX7A 1MBKA 2MW8A 1ZR2A 1XMAA 1FBUA 5JFRA 1J5YA 1FEXA 1X2MA 2XGEA 2ZSIB 1B59A 4NC7A 4FETA 2H6CA 1MZBA 2PG4A 1KYWA 5B66C 3S1NJ 2E1MB 2B63J 2CQXA 5FLXK 3RDIA 3BC8A 3OR2C 1D3YA 1IXRC 3RSNA 2ECCA 1XCBA 4RGRA 3IAS2 4LIUA 3SDGA 3WHBA 3M3YJ 3H5RA 3HOSA 4LB5A 3ABKH 5ILSA 4B3XA 2DMUA 2DFHA 3IH3A 1J7KA 5HDNA 1FC3A 1OPCA 4UHTA 3NEUA 2L7KA 1T6SA 3LNQA 5CYVA 4AWXB 1F5TA 3C2BA 4AIDA 4RB1A 4Q47A 5IOZA 5HVQC 4LG0A 4RDUA 3WU2C 1M1EB 1LFBA 3WTVC 5E3MA 2BZTA 1K83J 2HYJA 2P5LC 1DDNA 4C3IJ 3NWSA 1IJWC 5TGTA 3SQNA 2DN0A 5BMZA 1YRNB 2MD0A 4BQQA 5IOYA 1LE8B 2BY1A 4C2UA 4I09A 2L3DA 3G73A 2BOLA 2JRMA 2LKPA 4RB2C 2L7ZA 4B48A 3GTJJ 4HSTA 2VT2A 3JCUC 2RREA 3FZVA 3CP2A 5CQEA 1ZELA 2XHKA 5L3CA 4BE0A 2BY0A 3CLOA 2IPQX 3S17J 3BR3A 2VLAA 1QA6A 2EA4A 4EJWA 3CUQB 2VE8A 2RNJA 2GA2A 2IGNA 3CMYA 2E19A 2ESHA 3MVPA 2WAFA 4MTDA 2E5ZA 5EGOB 1Z9CA 2CQ7A 3EUAA 5FROA 4LK1F 5AIQA 3HHGA 2QENA 1ITYA 2OAZA 3PM1A 1EH6A 1X3WB 1GXPA 3RPUA 3OYGA 4HX7A 5JI6A 1A36A 2DXIA 2BY3A 2M4KA 3CCMI 4LLNA 2DYSH 3MCZA 2DMTA 4BJ5C 1B1BA 1YG2A 3S93A 4C2MJ 4HNTA 1TP4A 2LRDA 2L2OA 1QQIA 5L3FA 4R79A 2WADA 1D0XA 3TMOA 5B1AH 4G9YA 1RIOH 1QHGA 2EV5A 2K3PA 3HRSA 1R6RA 4ZZLA 5DUKA 1FT9A 3K0LA 1R5GA 4PGHA 1FMVA 4DBRA 3HUGB 2R7QA 4EJOA 2L02A 1HSTA 2Y2ZA 3E5UA 3PNTA 4Y15A 3AAFA 1JKQC 4I01A 1ACIA 2HVRA 3BZ6A 4GO1A 5H6RA 3S3MA 5LEKA 2M2EA 5KAIC 1IRXA 3V42A 4G7OF 3EETA 3CQZJ 2XPWA 2IEKA 1T2KA 1J0RA 4FE4A 3J81K 2MABA 9ANTA 4KNYA 3CO7C 2BGCA 1VQ6I 2EFNA 1BI2A 3ZCOA 4B1RA 3SJMA 1IG7A 3BG3A 4OAYA 3CCEI 1X4PA 3BQYA 1J9IA 1Y0NA 3VSLA 5HODA 4OIOF 1I3QJ 3S1MJ 2DFFA 2WV0A 2WY8Q 1YTYA 2IS1A 3ROUA 3L2WA 1HQCA 2HQNA 2MGQA 5KVRA 2BHYA 1R58A 4L5EA 4BKXA 1B8IA 3I4PA 2FE3A 3FKIJ 4BQOA 2V1DA 2QKMB 4LFUA 3WTYC 4ZYDA 2DPUA 1K78B 5D5XB 2KIMA 5C3EJ 1X1AA 3SXYA 3DLAA 3WTZA 1ZLJA 2VQHA 2CV1A 2XSDC 2CWEA 1OJLA 5ICCA 2XASA 2PQ8A 1OCOH 4UNOA 5A2QZ 2OQRA 4NB5A 3QPTA 4CZCA 1PVEA 3U21A 5FKLA 2X9DA 4D7NA 2DA7A 5CVRA 3GTPJ 3ISPA 2R7WA 1SMYF 1MH4A 1X1PA 2H6BA 3JAMZ 3OS0A 2NRAC 4CH7A 3K4LA 1WJ5A 3VOEA 1OCPA 4FE7A 4HF0A 2MD5A 4WX9A 4XK4A 3IWZA 3QYFA 2V6EA 2XKPA 2RDPA 2EWNA 4UUTA 3ZQLA 4EQQA 4PJNA 4RAFA 3HTSB 3HHHA 3PNVA 3ULQB 3BTLA 5K7FA 4KDPA 1UAAA 3ZOBA 2H1LA 2YR2A 3VYUB 2CU7A 2Y69H 2E1MC 5FKNA 4BH9A 3ZRGA 1VTNC 1WCMJ 2P0WA 2VKDA 4L9TA 2KL4A 3Q9VA 1P4WA 4B4CA 3FHNA 2EFWA 2O6GE 1WJDA 4M9SA 3BCBA 3N05A 4M9ZA 2YSRA 2QKLB 2VPRA 1PP8F 1RPWA 1T8IA 1WRJA 1B9NA 4ZYAA 2D5VA 2KP6A 1P9QC 4KJZA 1O4XA 1J59A 4Y4RA 1F9NA 5TRDA 4AUXA 1B4AA 3HM5A 4U7DA 3L7WA 3MZYA 4Z2YA 2BXYA 4EJTA 3KYCB 1TWHJ 1X3UA 1MNDA 2FU4A 2HDCA 2V6CA 3HTUA 3X2QH 1TL8A 2EZLA 2WAEA 5F0FA 3HPHA 3ZMUA 2ZJPF 2MLGA 1NG7A 3MN2A 3QOEA 2ME6A 3MKWB 2HOSA 2K3FA 3I53A 1U8BA 1I50J 2O7OA 2RN7A 4F55A 1OCZH 2DAOA 4O5VA 2CJJA 3A2KA 5M5XJ 1HLVA 2JA7J 1KONA 5FRMA 3K70D 2ESNA 3FK7A 3WGGA 2PMUA 3CDHA 4RLQA 2CW7A 2M0MA 1AA7A 2Q8KA 2H94A 5IYCJ 3HGGA 5ICFA 1UCRA 4CO8A 1JHHA 1K6OA 2M4GA 1H9TA 4M3DA 5FRNA 4RM3A 1G3WA 2W82A 4XLAA 4HDUA 3ASOH 4ESJA 2HTJA 3HOWJ 2WTEA 2EIKH 1Z3XA 4XKCA 3ZMVA 3B02A 3P5JA 5C4XJ 1A6IA 1TZLA 4PFOA 1REPC 2AS5F 1HOMA 4MQVA 3GFIA 4JX6A 4BEHB 4J01A 3AKZA 2A61A 2HWVA 5E8GA 3FF5A 3VYTB 2HKOA 2JT1A 3LFKA 3I59B 3PFYA 4M3BA 2WAQA 4Y33A 5B3SH 4XRSG 4RM2A 5K5OA 1W36D 3OSFA 1D1BA 1IXCA 4MLOA 1QO0D 1BA5A 1UB9A 4LMYA 1ENHA 2M8GX 3J81Z 1DQUA 4QWQA 2AXLA 3FHZA 2L7MP 1WI9A 2KLOA 5BPDA 4GRIA 2NXNB 3DKYA 3FM5A 3BR0A 1A04A 2DOFA 1IN8A 1ZRFA 3CCUI 4IHSA 2FQ3A 1R23A 3W6JB 3DF8A 1UFMA 4BGDA 3LSPA 4A3GJ 3A01A 4FQGA 3AL0B 4ZYHA 4KICA 1L3LA 3KETA 1FWZA 2QZ8A 4S05A 5DM6F 3WU1B 3ABMH 2QEXI 2HOAA 2JUGA 4KT6A 5E17F 1N75A 1YJNI 1ZARA 4L9VA 1MBEA 2E1CA 4EMSA 2AHQA 3PIPF 2OA4A 2UZKA 1ZR4A 3KEYA 3ABTA 5BNGA 1Z67A 4ENNA 4LITA 3FXKA 2VBYA 2W84A 3L1PA 5KHDA 4BQAA 3VFZA 1S9HA 3S2DJ 4PJMA 2JUCA 4IXAA 3TW6A 4XRSA 1IRZA 4BAYA 1G59A 3F72A 2VL8A 5DM7F 2JSPA 3RKXA 3COAC 2XSJC 3A03A 2M5WA 5LBQA 2Y0SA 4U0VA 2KJBA 3HIFA 3QP5A 5EEAA 3GMEA 3DXJF 3CDLA 1APLC 2B7EA 3PQKA 3GFLA 1ZYRF 3Q0WA 1VQNI 3IC7A 3KPHA 4KA4A 1RKTA 2J5OA 2LOOA 4X6AJ 4N4OB 4A3LJ 2IBDA 1DGRM 4L18B 2KDZA 4IHXA 1WJCA 1HXDA 2Q0OA 1W0UA 2VOOA 2GWRA 4YELA 3D5RC 3D5LA 1Y8RB 2O5RA 2RNGA 3F0CA 3W2VA 2DOAA 3H5NA 3QWLA 1RESA 2NAZA 4AC0A 2GXAA 4F3QA 2XGDA 2ETHA 4DZPA 5L3DA 1G6NA 4AIJA 1LEAA 1T0FA 1W5CC 2V79A 4IEJA 1BOAA 2MBFA 1KA8A 4MFDA 5JVTA 2OZ6A 3VYRB 1WI3A 2LF7A 4M74A 2KISA 4HX8A 2NS0A 5D6EA 5E8IA 3WTWC 3ZQHA 2FOWA 1YE9A 4R8HA 3Q0UA 1FP2A 2XIGA 4KITB 1R36A 2E5NA 3HRMA 3JAMK 1ZG5A 1ETQA 1Y1VJ 1SMTA 4II2A 3M07A 1Z77A 1YS6A 4XLHA 1O3QA 3L2CA 2DA6A 3N97A 3TW7A 4N0BA 3W2WA 4P5OA 3QQAA 2HGCA 1B9MA 2NS7A 4XORA 3LOCA 4RMNA 3CJNA 2LF8A 4G12A 2HZDA 1J2XA 4UUVA 1SFOJ 2TDXA 3BROA 3NAUA 5FKKA 2OV7A 5FD5A 4YFKF 4EJUA 4PK4A 1FY7A 3F21A 4YIIA 3MAJA 4E7IA 2ELJA 4AIHA 1IXSB 2VXZA 3PUFA 2FMLA 1HKQA 4YRVA 1ZKGA 3RJPA 4XOPA 2HDWA 2NNNA 2R7RA 1FTZA 2ZBKA 2Z9OA 1T0FC 1G3SA 5E79C 3QPHA 4PCQA 3KP7A 4ITVA 2HQAA 2AQFA 2H8RA 2PMZN 2CV0A 1T38A 4Y3OA 1IO2A 2P6TA 2NVXJ 4FX4A 4M72A 3J7AY 2QWWA 4BY7J 2DI3A 4FT8A 3D0SA 5F1RA 2OPTA 3K1MA 1YS7A 1SVOA 2O03A 3KEOA 3OSGA 4ZYEA 3LA7A 1T98A 4CICA 2ISZA 5D5VB 5M3FJ 1UG0A 5ICEA 1BR2A 4C30A 5CJ9A 4AVZA 1ZQ3P 3CP8A 3GW2A 3LSGA 2LD5A 1U8RA 1K78A 3OIPA 1ULYA 3C2GA 1ETWA 5CLSA 1RZ4A 4DZJA 3BLYA 4BXFA 3LA3A 1T56A 3H3UA 1FIAA 2VBXA 1FOWA 4BHBA 3QU6A 3JRGA 1TWGJ 3ML6A 1A6QA 1H8AC 3A1YA 3CCRI 1LUJB 5DDGA 3KZYA 3M1EA 2L9NA 1RR7A 3LWFA 2AQEA 4G6TB 3J80K 3U1KA 2R7TA 3KCCA 2P6SA 3BPXA 3F3XA 1JT6A 2EQRA 4IHYA 5B1BH 2ID3A 4Q48A 2WBMA 4P55A 2IGMA 5EGOA 2FJ1A 1MGTA 2WAQN 1MMDA 2BW3A 2E2JJ 5D4RA 1FBQA 3H9JA 3ZQFA 2X6XA 1MJBA 2K9LA 3K1PA 1MMAA 1QGPA 2O3FA 1HC8A 2JMWA 2VI6A 4OMZA 2LP0A 2I8DA 3D1NI 4NBQA 1MSEC 3KP6A 5CQGA 1OCCH 2XAQA 3L00A 1V54H 2PN6A 2K86A 3FXOA 2JZYA 2QSHX 4ZTJA 4XLFA 2OCCH 4L9JA 3OS1A 4JX4A 3OWTA 3GTKJ 4BBSJ 1JTXA 4X0GA 5J6XA 1U5TC 4YEJA 2FBHA 1G2HA 1R1VA 3HSRA 1IW7F 4ANJA 2YX7A 2X6YA 1SFXA 5F04A 2ZXWH 3CJRB 2XRLA 3ABLH 1WH5A 5E3NA 3I71A 4DIQA 1IAWA 2HS5A 1OQYA 2Y0MA 3JRAA 2E60A 4KYWA 3SZGA 5D8LB 2DA3A 5CPRB 3V4GA 3DTEA 1KGSA 4WF2A 1X1DA 4RGUA 2BE5F 3IAM2 3BPVA 2QBYA 3SEQA 2J5PA 4DNCA 1BBYA 3FMRA 3IV5A 2GOMA 3I58A 1D1AA 1I39A 4BACA 1E17A 2D1VA 3GF2A 4UXNA 2LNBA 2F48A 2FA5A 3E1SA 1IN7A 1TTYA 3HSFA 1FMWA 2F4OB 5BOXA 1EF4A 1W36C 4HDVA 2IRFG 4MTEA 1VQOI 4YFXF 2VJ5A 2CUJA 1X2NA 2R5YA 1OYWA 1KU2A 1OKRA 4I0AA 4M73A 4G7HF 5IP7J 3DTIA 3PNYA 4JQFA 5FLXZ 5J4YA 4HV5A 4E7HA 5GP9A 2XF7A 1OMIA 5H2FC 3M8JA 4HNVA 3W6KB 2HR3A 3KLNA 1VF9A 1BIBA 1XMXA 1WHUA 1BJAA 4M3EA 4UB6C 4C9YA 1U3EM 1Z6RA 2F5DA 1I5ZA 4KT5C 2GLOA 3G3ZA 4P9UA 1J09A 3GX4X 2M0CA 4BEHA 4OWRB 2E71A 2LDUA 2F4MB 2MLKA 1JJ6C 1ON2A 2EIJH 4ZDPA 1MDMA 1K6YA 4UB8C 4RAYA 3FWEA 3ZMSA 1FX7A 1Z05A 1BW5A 2MH2A 4RAGA 3ZP5A 2RVCA 4M6XA 3E7LA 5FGMA 3A02A 5TISC 1SFKA 2CG4A 2JN6A 5F64A 3J7ZI 4G6DA 1ORKA 3ERMA 3QODA 4BHPA 3TOBA 5ED4A 2PMZA 4E6KG 3REOA 3LSHA 4NDLA 1UG2A 4A12A 2M3AA 5IY5H 1D5VA 2NVYJ 4LGWA 1UZCA 4A3IJ 2R4GA 3TQNA 4CYCA 1O57A 3EYIA 2V1UA 1PUFB 2LREA 3SFZA 4D9JA 2BV6A 4CZZA 1U5TA 1K4TA 3GEZA 3CF2A 5DTDA 1HW2A 3V8KA 1W7PD 2EJRA 4EGYA 1USSA 2COBA 3HPGA 3WHCA 2LY2A 5J1UA 3BJOA 1NK2P 3ZGKA 1KQ8A 3A01B 1OLTA 2PFBA 2MA3A 3C18A 2DDBA 1OYIA 3E6CC 1H89C 2P5VA 2YUSA 3HXLA 3TL4X 1TBXA 5K7HA 4XIDA 2XC7A 3K4KA 2OTJI 3C3WA 4IHVA 4HOBA 1UELB 2DMPA 1JUSA 3M4OJ 2HNHA 2K9MA 3BCAA 3EUHA 1DU0A 2L54A 5LLQA 4BYYA 2RC4A 2HYFA 3FXQA 4HNUA 4KMUX 2KFDA 2L01A 5JR3A 1R71A 3K4CA 3OR1C 2XGCA 3VWBA 1YQAA 2ADUA 3S1RJ 2L5QA 3KYDB 2P4WA 1R1UA 3DQVC 5DD8A 1KU7A 1S7AA 3OOUA 1AHDP 3DCFA 2NVQJ 2VJIA 1YJWI 1Y56A 4FTHA 4ON0A 2JRTA 3HB9A 3HOUJ 4XONA 3OL4A 3TO9A 1O3SA 3ZN0A 1TWAJ 3GO5A 4XNFA 1VFCA 3K69A 3HL2A 2K02A 2RQQA 1TQIA 3MMYB 4X1EA 1KU9A 2DA5A 1LJ9A 4XRMA 1W5TA 1P4XA 1W5SA 2ZNYA 3TDZC 2LC2A 4LLGF 2VASA 3UR3C 4F7ZA 3KFWX 1TQMA 2EPFA 2DT6A 5HDKA 2YX4A 3LSRA 5FJ8J 4E7JA 1SD4A 2GIZA 3CCQI 1K61A 1SVLA 2XPUA 3A0HC 4GFBA 2G0EA 4BXUA 4IL6C 3DEUA 5IP9J 4CUGA 4J00A 2G7HA 3FXMA 3SZPA 3RQ4A 2DPDA 1GHCA 2D2WA 1WKMA 1R49A 2HVSA 3K9TA 1R4NB 3OYAA 2ZKZA 3GZ6A 3H5AA 4KISA 1Z7UA 3VSKA 4HPQA 2UXXA 1SC7A 1W7PA 3VYSB 2R7ZJ 2FSWA 3H36A 4PGGA 4J19A 2F5CA 3HOYJ 4O3MA 4RGSA 4GCVA 1V5EA 2G9WA 4WXHA 4UVCA 1UJ8A 4A0XA 3H92A 1MMSA 3OYJA 2ISYA 2NVUB 3JRIA 4OMYA 4XLPF 2HZTA 4GXOA 2W1OA 3DPLC 3I3LA 3O8GA 2Z1DA 1TWFJ 1R9TJ 1ZGJA 2LKSA 3G6EI 5FLVA 1EH7A 1E3PA 3MQ0A 3W3CA 2LY1A 1JKOC 1VQMI 3T5XA 3DEEA 2W00A 1FOYA 4C2TA 2ZB9A 3I54A 3BG5A 3I4NJ 3OS2A 4FCYA 1ZK8A 2F5EA 2O8KA 1Z6TA 2A6HF 2VJJA 3CESA 3KP4A 2H8WA 2K9NA 2XV4S 3R0AA 3RTRA 4ZTFA 2M7BA 4NQWB 1Y8QB 2OBPA 2FMYA 1LE8A 2H27A 4RLFA 3ZMZA 4HV6A 3OYMA 3V8JA 3J7AO 2E1OA 1XGNA 3FMQA 4UY8I 1ZRCA 2JK3A 3JRBA 4KFCA 2JA8J 1YOVB 3SHFA 2MYSA 3ZQGA 1ETXA 4L5JA 3W6VA 1S7EA 4NNJA 4B09A 1ETKA 3QYBA 3T1BA 2JA2A 2CQKA 3S2WA 1ONVA 1JE8A 4W1UA 5EF6A 3U1DA 2Y0SN 2JTVA 3OYKA 1L0OC 3L9FA 2KZGA 3RYPA 1FPQA 5FD6A 2R7SA 2CO5A 4U88A 2IS4A 4G8XA 4W97A 2GXBA 5JLXA 4U0WA 4NHJA 1VQ9I 3CDIA 1LQ1A 4I98B 5E1XA 1S72I 1ODDA 3KP2A 1XN7A 3PO2J 1OCRH 2F5VA 2HOEA 2ZXHA 3R61A 1HDPA 2L7FP 2HU9A 1IDZA 1D8JA 3P9CA 1SANA 2XDVA 3S3NA 1VQLI 3C7JA 3F23A 1JUMA 1XG1A 4F92B 2LSOA 5DS9A 1BJZA 2DCEA 2E1NA 3CMMA 4ASNA 4B8XA 3T8TA 3ZQCA 3WE2A 1UMQA 2PBIA 3B6CA 4F91B 4MO7A 2EV6A 5GADJ 1TC3C 2DBBA 3JSPA 1MH3A 4N9IA 5F1JA 3PJRA 1S3JA 2ELHA 4Y13A 2UUZA 3E3VA 4PJLA 4BE2A 3HDDA 4IQJA 1WQ2A 1P92A 4G94A 2CV2A 3LSTA 1QNTA 3I9V2 3WTTC 5GAEJ 1ZHFA 2BY2A 3I5UA 3HRUA 3ESWB 3FKJA 2VKEA 4AIKA 1ZGWA 4E7KA 1H88C 1ZRDA 5FFXA 2Y48A 1ON1A 3IWFA 4B3AA 4E7ZA 3M8FA 1WH7A 1EJ9A 2A5WA 1H9GA 1E0EA 1DPRA 4NUBA 2HPIA 2H09A 3WGIA 3HUGA 5KK1A 1FBSA 1ZG3A 3O3KA 4MEYF 2O61A 3KZIC 4RGXA 1FIPA 2Y31A 5BS6A 3DU5A 3I59A 3GTLJ 1EV7A 1FSHA 5E1ZB 3JRHA 3HSEA 4H4KC 3CCVI 4DQ2A 2NVTJ 5H20A 3CC2I 1IN4A 3JR9A 3CMEI 3IL2A 1LNWA 2CFXA 4C3JJ 1MNEA 3PSFA 3A4CA 2E35A 3WTSC 4ESBA 1GV5A 1O7FA 1F43A 4DYCA 3OIQA 3DTKA 2FUG2 5EEHA 4L0YB 2W25A 3BR6A 5D4SA 5EJCA 1I6XA 1OR7A 4AYBN 2X6OA 4MFEA 3F9KA 3P9IA 2BW3B 4ZZDA 4FISA 3MZHA 3GZ5A 1T39A 2K4BA 2X6WA 3LAPA 1P4AA 4N9HA 1FP1D 3MWMA 1TLHB 1P6RA 1SAUA 3G1LA 5JHFA 1KZHA 3HG9A 2L0KA 2VE9A 5K5RA 1OISA 1RETA 3NARA 2VODA 4ENMA 2XB5A 3SDBA 2KRHA 3CTAA 2L9VA 3IKTA 2CUZA 2XKOA 1XX5A 2W48A 5KNLA 2GAUA 2UXNA 2V1NA 4B43A 3DEWA 5CKTA 2M34A 2R5YB 2V9VA 4MEXF 2JPCA 3F8CA 4M6YA 5LHGA 3JW4A 2ZJRF 2ZMEA 1MJ9A 1SD6A 1YYVA 3FK6A 4A3JJ 5J1YA 1VQ7I 3R4KA 4CCNA 2HOTA 2VOPA 1V55H 2JWTA 3CUOA 3P7NA 2F2EA 3H9QA 4I6ZA 3RZOJ 1YIJI 2NS8A 4HW0A 3BG9A 1GT0C 1NK3P 1LVAA 2WC2A 3FX3A 1YI2I 4HYEA 3TGNA 3ELKA 4V19K 1R5HA 1X4OA 2M8EA 1YFHA 4IHTA 2HQ5A 1W4MA 2XPVA 5CVJA 3GTGJ 1ZAOA 3ZQ7A 4PSXA 3WG7H 3HGYA 2FXAA 2W7NA 1QBJA 3OY9A 3F8BA 1QRYA 2IGKA 2XAUA 3QOPA 1IN5A 3CJQB 2DU9A 4AU7A 3BT9A 2XRNA 4ZDLA 3CD6I 4D0PA 4UUSA 1XTAA 3UKGA 2DTZA 3LSMA 3LA2A 2Z16A 3ONQA 5FKMA 4OU0A 4AD9A 3OYCA 2M87A 2NOJB 2B9SA 5E20A 4D5CA 3M8EA 2XVCA 4AM3A 4ZDOA
chains in the Genus database with same CATH topology
2FBKA 4BHCA 2Z3YA 3LQQA 4P96A 1P2FA 4UVBA 1SAXA 4FHTA 3ABUA 2VN2A 5D8KB 3FXRA 2HKXA 2GZWA 2GIVA 1XSDA 2ZFWA 3BWGA 2W57A 1FZPB 1Z1DA 3ZMTA 1WSUA 2XAJA 1FNNA 1QPMA 2QQBA 3Q9SA 4O6JA 3KP5A 2KKOA 1BI3A 5LGUA 4CYDA 4YG2F 3BP8A 1S7OA 4A2UA 2R7DA 3FM3A 1Y0UA 4RS8A 4WWCA 4HX4A 4HF1A 1SFUA 5AIPA 5IT3A 2C6YA 5D5UB 2HQRA 2PI0A 1MKMA 4CGZA 3I0TA 3V7RA 5HLHA 5DCFA 2BBYA 4LG0B 2FNPA 5A2QK 1ZG1A 5HS7A 2CW0F 1GXQA 5DUIA 2BYVE 5HLIA 5L3BA 5H6QA 1TW2A 3Q5FA 1KQ0A 3TDUC 1ZH5A 3BJAA 3DKWA 1RNLA 2DK8A 1F1ZA 1H0MA 2OQGA 3R60A 3O2PE 3U2RA 2MC3A 2GXGA 1DP7P 4IRGA 4L0ZB 2JPBA 5ILUA 4UVAA 1U5TB 1IRFA 1G3YA 1S29A 4IJAA 1RUOA 1QZYA 1HKSA 3K1NA 3DP7A 1YIOA 4RB3C 1HSJA 2STWA 3PQJA 1XB4A 1NHAA 3L09A 3WTUC 3EYYA 3DFGA 2YU3A 3F8NA 1HKTA 4XRFA 2DK5A 1DPUA 4H0EA 1MDMB 1IUYA 4CXFA 3KZZA 5CVUA 4GGGA 2QUFA 4MGRA 5J8FA 3T8RA 1J75A 4XSXF 3J80Z 4L9NA 5ICGA 3GUDA 3RIRA 3VODA 1PP7U 4CDGA 3OV8A 2EA2A 5LGTA 2DQLA 2P8TA 2K7LA 3IKVA 2HTSA 1B6AA 5DCMB 1OYYA 1UHMA 3RPQA 5TJJA 2QYOA 1XCVA 2DFIA 1G4DA 3LQRA 4EJVA 2VT3A 4NQWA 4XLNF 2IT0A 3JSOA 4WCGA 2VOOA 1HBXG 4EM1A 2DW4A 3K2ZA 1FYKA 3C1DA 2ACJA 4WK8F 2EFOA 1TNTA 2VC0A 4IVNA 1ZREA 2HYGD 5E1WA 4HF2A 2D1HA 2L4AA 4A5NA 2Q2EA 1GVJA 2IP2A 1JXSA 1LDKB 4MHGA 4P9FA 3LAJA 4ESFA 4ENJA 5AONA 3SZTA 1UHWA 5FO5A 3IHUA 2O0YA 3F6VA 2PLYA 2A5YB 2KIFA 5EEGA 4G7ZF 4WXCA 4FX0A 2ZO4A 5LHHA 3E97A 3QU3A 5LRRA 1K79A 2DO7A 2RV8A 3ECOA 3GWZA 3VEPA 4EM0B 5E18F 3ZN1A 5DV5A 4MNUA 3N4MA 1FSEA 2EV0A 2PJPA 2CGPA 3MFKA 2GQQA 5HS9A 3E6MA 4KUMA 4E70A 1XD7A 2HFHA 1JGSA 1BM9A 2QVOA 1R1TA 3BDDA 1IRGA 4A6DA 4IPAA 3GLXA 1AOYA 1BI0A 2K27A 3M7GA 1ZN2A 2P7VB 3CUQA 4LK0F 3DV8A 5L3EA 3ERED 4OIRF 2M45A 4M9XA 3TO7A 4GYGA 3BY6A 2EK5A 3GFJA 1XGOA 3QP6A 2DTRA 1KYZA 4TV7A 1CF7A 4KIFA 1YLFA 3RKYA 1RUNA 1CF7B 3GFMA 1KQ9A 1W7PB 4G6QA 1Z91A 4WXDA 1RI7A 2E7WA 2R3SA 3IRQA 5HDGA 2PMHA 3WE3A 1SD7A 1TNSA 3F6OA 4HLYA 2DQRA 2ZXJA 1FLIA 4U0YA 3ECHA 2Z33A 3FMSA 2Y75A 3RYRA 2A07F 4A0YA 5IT9Z 4ETSA 1XMKA 1R00A 4GYIA 1V3FA 2E7XA 3CUQC 1FYMA 1U78A 3R0JA 2G7UA 1YW9A 4Q5SF 2ZNZA 2QQAA 2XAGA 3F22A 3PFIA 3GVAA 3WU0A 1C0WA 2IA2A 2KIUA 1DUXC 3TKYA 2B0LA 1SFEA 3WODF 1XGSA 2JSCA 4YIFA 3T0YA 1CGPA 2QLZA 3TO6A 3GYHX 4EVIA 2COMA 2K4JA 3JTHA 4U7BA 3ZPLA 2IA1A 1IF1A 1LEBA 1K7AA 5HLGA 2RQPA 1EH8A 2WWYA 2FRHA 1PUEE 4OINF 2XGXA 4JBAA 1TQPA 4AVPA 2QM3A 1ZLKA 2VONA 3TOAA 2M1BA 5K5QA 4I2OA 3NQOA 3H3ZA 2X4HA 5DCMA 4RAZA 1V4RA 2A68F 3F8MA 3HRTA 2QQ9A 4A6EA 4XSZF 4A0ZA 2XAFA 5JHUA 1BIAA 1I1SA 2CYYA 5D6FA 2Z99A 2VBZA 1LDDA 3ZMDA 5LEJA 3KEQA 2ZCWA 2IVMA 1BC7C 1IN6A 5LRSA 5ERIA 4EM2A 2A3SA 4S04A 3P9KA 2KRFA 2FF4A 4Q4ZF 4HAMA 1O3TA 2ZJ2A 3KP3A 3CO6C 2R7FA 4I02A 2UWMA 4IRIA 5IT9K 4KN4X 4L5IA 4YFNF 3WGHA 3GXOA 3V7SA 2EB7A 2DT5A 1PDNC 2RKHA 3RKWA 3EDPA 5HS8A 2L4MA 1XSXA 1U6GA 4IRHA 2EFPA 1O7LA 3RI4A 2O8XA 4KIBA 2A69F 4LLLA 2IJLA 4R1HA 3R6SA 1E2XA 4PZJA 4OIQF 3KE2A 3FXUA 2V1XA 1SD5A 5ILVA 4EV0A 1XDSA 2STTA 4BNCA 5CVIA 4Y17A 4LJZF 1XDUA 4HQMA 4A5MA 5DEQA 1FOKA 2HEOA 5BQTA 4ZH4F 3F8FA 3NRVA 4RB0A 3VB2A 2KJCA 4EGZA 1WWXA 2MH9A 5HOOA 4UV8A 2P7CB 2NNYA 3E6BA 3JTGA 2W24A 4MQ9F 2FBIA 1BI1A 5DYMA 4KIGA 3EQLF 3QRFF 4KMFA 5LGNA 4UV9A 2OZUA 1Q1HA 3HYIA 1MD0A 5F6FA 2OD5A 1YW7A 4OOIA 3O6BB 1YW8A 3BJ6A 4JK1X 4HZFA 1JHFA 4I7HA 4LD5A 1KU3A 3B73A 3OOPA 5BPIA 2A6EF 5J8CA 4KN7X 2CSOA 1MJAA 1S8NA 2VBWA 5LHIA 1BN5A 1FYLA 3WTXC 4HBLA 1LDJA 3E6DA 3KLOA 3V7CA 1D8KA 2FOKA 2GA1A 2IA0A 1R22A 2XAHA 1S6LA 2NYXA 4XBFA 2DLLA 2FNAA 2PEXA 2QBYB 3QAHA 5D5WB 2W85A 3DPTA 3U9GA 3BOQA 2IW5A 5FB2A 4M71A 5DD4A 2YPRA 2XROA 6PAXA 2Z5UA 1HW5A 2VC1A 2D45A 3MEXA 1G3TA 4HA8A 2RGVA 1XGMA 3E5XA 2OU2A 2X0LA 4K2EA 1AWCA 2P5KA 2EFQA 3IRRA 1F4KA 5FFZA 4HQEA 5K1YA 1STZA 4IF4A 4OIPF 2FEZA 3E5QA 4ZYGA 4I0BA 3I64A 2XUBA 4CHUA 1I1GA 4ENKA 3WG9A 1TW3A 4QLCU 3HOTA 1O3RA 1IZ1A 1I27A 1LB2A 1QZZA 2F5FA 4LB6B 3V8LA 4PDKA 5CVVA 1YO5C 1HW1A 1USTA 1ZGAA 2ZMEB 1BC8C 1R7JA 3M9AA 5L3GA 4HLXA 1XSVA 2M30A 1U2WA 2BEOA 1XMAA 1FBUA 5JFRA 1J5YA 1B59A 2H6CA 1MZBA 2PG4A 1KYWA 5FLXK 3RDIA 1D3YA 1IXRC 1XCBA 4RGRA 3HOSA 4LB5A 5ILSA 1J7KA 5HDNA 1FC3A 1OPCA 4UHTA 3NEUA 1T6SA 5CYVA 4AWXB 1F5TA 4RB1A 4Q47A 5HVQC 4LG0A 3WTVC 2P5LC 1DDNA 3SQNA 5BMZA 4I09A 2L3DA 3G73A 2LKPA 4RB2C 2VT2A 3FZVA 5L3CA 2XHKA 3CLOA 2IPQX 2EA4A 4EJWA 3CUQB 2VE8A 2GA2A 2RNJA 2ESHA 4MTDA 1Z9CA 4LK1F 5AIQA 3HHGA 2QENA 2OAZA 1EH6A 1GXPA 3RPUA 4HX7A 5JI6A 4LLNA 3MCZA 1B1BA 1YG2A 1QQIA 5L3FA 4R79A 4G9YA 1RIOH 2EV5A 3HRSA 4ZZLA 5DUKA 1FT9A 3K0LA 1R5GA 4PGHA 4EJOA 2L02A 1HSTA 4Y15A 3E5UA 3AAFA 4I01A 3BZ6A 4GO1A 5H6RA 5LEKA 4G7OF 3EETA 1T2KA 1J0RA 3J81K 4KNYA 3CO7C 2BGCA 2EFNA 1BI2A 1J9IA 4OIOF 2WV0A 1YTYA 3ROUA 1HQCA 2HQNA 5KVRA 1R58A 3I4PA 2FE3A 2V1DA 4LFUA 3WTYC 4ZYDA 2DPUA 1K78B 5D5XB 2KIMA 3SXYA 3WTZA 1ZLJA 2CWEA 5ICCA 2XASA 2PQ8A 4UNOA 5A2QZ 2OQRA 4NB5A 3QPTA 5CVRA 3ISPA 1SMYF 2H6BA 3JAMZ 2NRAC 3VOEA 4HF0A 2MD5A 4WX9A 3IWZA 2XKPA 2RDPA 2EWNA 4EQQA 3HTSB 3HHHA 3ULQB 4KDPA 2YR2A 4BH9A 1VTNC 4L9TA 3Q9VA 1P4WA 2EFWA 2O6GE 4M9SA 4M9ZA 2YSRA 1PP8F 1WRJA 1B9NA 1J59A 1F9NA 5TRDA 1B4AA 4U7DA 3L7WA 3MZYA 4Z2YA 4EJTA 1X3UA 2FU4A 2HDCA 2V6CA 3HTUA 3ZMUA 2MLGA 3I53A 2RN7A 2DAOA 4O5VA 2ESNA 3WGGA 2PMUA 3CDHA 2Q8KA 2H94A 5ICFA 1UCRA 4CO8A 1JHHA 1K6OA 1H9TA 1G3WA 4HDUA 4ESJA 2HTJA 2WTEA 3ZMVA 3B02A 1REPC 2AS5F 4MQVA 3GFIA 2A61A 2HWVA 5E8GA 3FF5A 2HKOA 2JT1A 3LFKA 3I59B 5K5OA 1IXCA 1QO0D 1UB9A 4LMYA 3J81Z 4QWQA 2AXLA 3FHZA 1WI9A 5BPDA 3FM5A 1A04A 1IN8A 1ZRFA 4IHSA 3W6JB 2FQ3A 1R23A 1UFMA 3DF8A 4ZYHA 4KICA 1L3LA 3KETA 1FWZA 2QZ8A 4S05A 3WU1B 5E17F 1ZARA 4L9VA 2E1CA 4EMSA 2OA4A 2UZKA 3ABTA 4ENNA 2VBYA 2W84A 4BQAA 3VFZA 4IXAA 4BAYA 3F72A 3RKXA 3COAC 2M5WA 5LBQA 4U0VA 2KJBA 3HIFA 3QP5A 3DXJF 3PQKA 3GFLA 1ZYRF 3IC7A 4KA4A 2J5OA 4L18B 1HXDA 2Q0OA 2GWRA 3D5LA 2NAZA 2ETHA 5L3DA 1G6NA 4AIJA 1LEAA 1T0FA 2V79A 1BOAA 2MBFA 1KA8A 5JVTA 2OZ6A 2LF7A 4M74A 4HX8A 2NS0A 5D6EA 5E8IA 3WTWC 4R8HA 1FP2A 2XIGA 1R36A 3HRMA 3JAMK 1ZG5A 1SMTA 1YS6A 1O3QA 3L2CA 3N97A 4N0BA 4P5OA 2HGCA 1B9MA 3CJNA 2LF8A 1J2XA 4UUVA 2TDXA 3BROA 5FD5A 4YFKF 4EJUA 1FY7A 3F21A 4YIIA 3MAJA 4AIHA 1IXSB 2VXZA 2FMLA 1HKQA 3RJPA 2NNNA 2ZBKA 2Z9OA 1G3SA 3QPHA 4PCQA 3KP7A 1T38A 2P6TA 4FX4A 4M72A 2QWWA 2DI3A 4FT8A 3D0SA 5F1RA 3K1MA 1YS7A 2O03A 3KEOA 4ZYEA 3LA7A 1T98A 4CICA 2ISZA 5D5VB 5ICEA 5CJ9A 3GW2A 1U8RA 1K78A 1ULYA 5CLSA 1RZ4A 3LA3A 4BHBA 2VBXA 3H3UA 3QU6A 3ML6A 5DDGA 3KZYA 3M1EA 3LWFA 3J80K 3KCCA 2P6SA 3BPXA 3F3XA 4Q48A 4P55A 1MGTA 5D4RA 1FBQA 1MJBA 3K1PA 1QGPA 2O3FA 4OMZA 3KP6A 2XAQA 3L00A 2PN6A 2K86A 2JZYA 4L9JA 5J6XA 1U5TC 2FBHA 1R1VA 3HSRA 1IW7F 2YX7A 1SFXA 3I71A 1IAWA 2HS5A 2Y0MA 4KYWA 5D8LB 3V4GA 4WF2A 1KGSA 4RGUA 2BE5F 2QBYA 3BPVA 2J5PA 4DNCA 1BBYA 3FMRA 3I58A 1E17A 2D1VA 3GF2A 4UXNA 2LNBA 2FA5A 1IN7A 1TTYA 3HSFA 5BOXA 4HDVA 2IRFG 4MTEA 4YFXF 1OYWA 1KU2A 1OKRA 4I0AA 4M73A 4G7HF 4JQFA 5FLXZ 4HV5A 1OMIA 3W6KB 2HR3A 3KLNA 1BIBA 1U3EM 1BJAA 1Z6RA 2F5DA 1I5ZA 4KT5C 3G3ZA 4P9UA 3GX4X 2LDUA 2MLKA 1ON2A 1MDMA 4RAYA 3FWEA 3ZMSA 1FX7A 1Z05A 2MH2A 3ZP5A 2RVCA 4M6XA 5FGMA 5F64A 2CG4A 4G6DA 4BHPA 3TOBA 5ED4A 3REOA 4A12A 1D5VA 4LGWA 3TQNA 1O57A 3EYIA 2V1UA 3SFZA 2BV6A 4CZZA 1U5TA 3GEZA 1HW2A 3V8KA 1W7PD 2EJRA 4EGYA 1USSA 3BJOA 1KQ8A 2PFBA 2MA3A 3C18A 1OYIA 3E6CC 2P5VA 1TBXA 3C3WA 4HOBA 3EUHA 2L54A 5LLQA 4BYYA 2RC4A 2HYFA 3FXQA 4KMUX 2L01A 5JR3A 1YQAA 2ADUA 2P4WA 1R1UA 3DQVC 5DD8A 1KU7A 1S7AA 4ON0A 2JRTA 3TO9A 1O3SA 3ZN0A 3GO5A 3K69A 2K02A 1TQIA 1KU9A 1LJ9A 1W5TA 1P4XA 1W5SA 2ZNYA 3TDZC 4LLGF 4F7ZA 3KFWX 1TQMA 5HDKA 2YX4A 1SD4A 4BXUA 3DEUA 2G7HA 3SZPA 2DPDA 1GHCA 2D2WA 1WKMA 3K9TA 2ZKZA 3GZ6A 1Z7UA 2UXXA 1W7PA 2FSWA 4PGGA 2F5CA 4O3MA 4RGSA 4GCVA 2G9WA 4WXHA 4UVCA 4A0XA 3H92A 2ISYA 4OMYA 4XLPF 2HZTA 4GXOA 3DPLC 1ZGJA 1EH7A 3MQ0A 3T5XA 3I54A 2F5EA 1Z6TA 2A6HF 3RTRA 3KP4A 2XV4S 3R0AA 2OBPA 2FMYA 2H27A 3ZMZA 4HV6A 3V8JA 3J7AO 1XGNA 3FMQA 1ZRCA 4KFCA 3SHFA 4L5JA 4B09A 3T1BA 2CQKA 3S2WA 1ONVA 1JE8A 3U1DA 2JTVA 1L0OC 3L9FA 3RYPA 1FPQA 5FD6A 2CO5A 4U88A 4G8XA 2GXBA 4U0WA 4NHJA 1LQ1A 4I98B 5E1XA 1ODDA 3KP2A 1XN7A 2HOEA 3R61A 1D8JA 3P9CA 3C7JA 3F23A 2LSOA 2E1NA 4B8XA 4ASNA 3T8TA 3WE2A 2PBIA 2EV6A 2DBBA 3JSPA 4N9IA 1S3JA 2ELHA 4Y13A 3E3VA 1WQ2A 1P92A 4G94A 3LSTA 1QNTA 3WTTC 1ZHFA 3I5UA 3HRUA 4AIKA 1ZRDA 5FFXA 2Y48A 1ON1A 3IWFA 3M8FA 1H9GA 1DPRA 2H09A 3WGIA 3HUGA 5KK1A 1FBSA 1ZG3A 3O3KA 4MEYF 2O61A 4RGXA 5BS6A 3I59A 1EV7A 1FSHA 5E1ZB 3HSEA 4DQ2A 5H20A 1IN4A 3IL2A 1LNWA 2CFXA 3WTSC 4ESBA 1O7FA 4L0YB 5EEHA 2W25A 5D4SA 1I6XA 1OR7A 3P9IA 4ZZDA 3MZHA 3GZ5A 1T39A 2K4BA 3LAPA 1P4AA 4N9HA 1FP1D 3MWMA 1TLHB 1P6RA 2VE9A 5K5RA 2VODA 4ENMA 3CTAA 3IKTA 2XKOA 2GAUA 2UXNA 4MEXF 2V9VA 2JPCA 3F8CA 4M6YA 5LHGA 3JW4A 2ZMEA 1MJ9A 1SD6A 1YYVA 3R4KA 2VOPA 3CUOA 3P7NA 2F2EA 4HW0A 1LVAA 2WC2A 3FX3A 4HYEA 3TGNA 3ELKA 1R5HA 2M8EA 1YFHA 4IHTA 1W4MA 5CVJA 1ZAOA 3ZQ7A 2FXAA 1QBJA 3F8BA 3QOPA 1IN5A 2DU9A 2XRNA 4D0PA 3LA2A 4AD9A 4OU0A 2M87A 5E20A 3M8EA 2XVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBK A;  4BHC A;  2Z3Y A;  3LQQ A;  4P96 A;  1P2F A;  4UVB A;  1SAX A;  4FHT A;  3ABU A;  2VN2 A;  5D8K B;  3FXR A;  2HKX A;  2GZW A;  2GIV A;  1XSD A;  2ZFW A;  3BWG A;  2W57 A;  1FZP B;  1Z1D A;  3ZMT A;  1WSU A;  2XAJ A;  1FNN A;  1QPM A;  2QQB A;  3Q9S A;  4O6J A;  3KP5 A;  2KKO A;  1BI3 A;  5LGU A;  4CYD A;  4YG2 F;  3BP8 A;  1S7O A;  4A2U A;  2R7D A;  3FM3 A;  1Y0U A;  4RS8 A;  4WWC A;  4HX4 A;  4HF1 A;  1SFU A;  5AIP A;  5IT3 A;  2C6Y A;  5D5U B;  2HQR A;  2PI0 A;  1MKM A;  4CGZ A;  3I0T A;  3V7R A;  5HLH A;  5DCF A;  2BBY A;  4LG0 B;  2FNP A;  5A2Q K;  1ZG1 A;  5HS7 A;  2CW0 F;  1GXQ A;  5DUI A;  2BYV E;  5HLI A;  5L3B A;  5H6Q A;  1TW2 A;  3Q5F A;  1KQ0 A;  3TDU C;  1ZH5 A;  3BJA A;  3DKW A;  1RNL A;  2DK8 A;  1F1Z A;  1H0M A;  2OQG A;  3R60 A;  3O2P E;  3U2R A;  2MC3 A;  2GXG A;  1DP7 P;  4IRG A;  4L0Z B;  2JPB A;  5ILU A;  4UVA A;  1U5T B;  1IRF A;  1G3Y A;  1S29 A;  4IJA A;  1RUO A;  1QZY A;  1HKS A;  3K1N A;  3DP7 A;  1YIO A;  4RB3 C;  1HSJ A;  2STW A;  3PQJ A;  1XB4 A;  1NHA A;  3L09 A;  3WTU C;  3EYY A;  3DFG A;  2YU3 A;  3F8N A;  1HKT A;  4XRF A;  2DK5 A;  1DPU A;  4H0E A;  1MDM B;  1IUY A;  4CXF A;  3KZZ A;  5CVU A;  4GGG A;  2QUF A;  4MGR A;  5J8F A;  3T8R A;  1J75 A;  4XSX F;  3J80 Z;  4L9N A;  5ICG A;  3GUD A;  3RIR A;  3VOD A;  1PP7 U;  4CDG A;  3OV8 A;  2EA2 A;  5LGT A;  2DQL A;  2P8T A;  2K7L A;  3IKV A;  2HTS A;  1B6A A;  5DCM B;  1OYY A;  1UHM A;  3RPQ A;  5TJJ A;  2QYO A;  1XCV A;  2DFI A;  1G4D A;  3LQR A;  4EJV A;  2VT3 A;  4NQW A;  4XLN F;  2IT0 A;  3JSO A;  4WCG A;  2VOO A;  1HBX G;  4EM1 A;  2DW4 A;  3K2Z A;  1FYK A;  3C1D A;  2ACJ A;  4WK8 F;  2EFO A;  1TNT A;  2VC0 A;  4IVN A;  1ZRE A;  2HYG D;  5E1W A;  4HF2 A;  2D1H A;  2L4A A;  4A5N A;  2Q2E A;  1GVJ A;  2IP2 A;  1JXS A;  1LDK B;  4MHG A;  4P9F A;  3LAJ A;  4ESF A;  4ENJ A;  5AON A;  3SZT A;  1UHW A;  5FO5 A;  3IHU A;  2O0Y A;  3F6V A;  2PLY A;  2A5Y B;  2KIF A;  5EEG A;  4G7Z F;  4WXC A;  4FX0 A;  2ZO4 A;  5LHH A;  3E97 A;  3QU3 A;  5LRR A;  1K79 A;  2DO7 A;  2RV8 A;  3ECO A;  3GWZ A;  3VEP A;  4EM0 B;  5E18 F;  3ZN1 A;  5DV5 A;  4MNU A;  3N4M A;  1FSE A;  2EV0 A;  2PJP A;  2CGP A;  3MFK A;  2GQQ A;  5HS9 A;  3E6M A;  4KUM A;  4E70 A;  1XD7 A;  2HFH A;  1JGS A;  1BM9 A;  2QVO A;  1R1T A;  3BDD A;  1IRG A;  4A6D A;  4IPA A;  3GLX A;  1AOY A;  1BI0 A;  2K27 A;  3M7G A;  1ZN2 A;  2P7V B;  3CUQ A;  4LK0 F;  3DV8 A;  5L3E A;  3ERE D;  4OIR F;  2M45 A;  4M9X A;  3TO7 A;  4GYG A;  3BY6 A;  2EK5 A;  3GFJ A;  1XGO A;  3QP6 A;  2DTR A;  1KYZ A;  4TV7 A;  1CF7 A;  4KIF A;  1YLF A;  3RKY A;  1RUN A;  1CF7 B;  3GFM A;  1KQ9 A;  1W7P B;  4G6Q A;  1Z91 A;  4WXD A;  1RI7 A;  2E7W A;  2R3S A;  3IRQ A;  5HDG A;  2PMH A;  3WE3 A;  1SD7 A;  1TNS A;  3F6O A;  4HLY A;  2DQR A;  2ZXJ A;  1FLI A;  4U0Y A;  3ECH A;  2Z33 A;  3FMS A;  2Y75 A;  3RYR A;  2A07 F;  4A0Y A;  5IT9 Z;  4ETS A;  1XMK A;  1R00 A;  4GYI A;  1V3F A;  2E7X A;  3CUQ C;  1FYM A;  1U78 A;  3R0J A;  2G7U A;  1YW9 A;  4Q5S F;  2ZNZ A;  2QQA A;  2XAG A;  3F22 A;  3PFI A;  3GVA A;  3WU0 A;  1C0W A;  2IA2 A;  2KIU A;  1DUX C;  3TKY A;  2B0L A;  1SFE A;  3WOD F;  1XGS A;  2JSC A;  4YIF A;  3T0Y A;  1CGP A;  2QLZ A;  3TO6 A;  3GYH X;  4EVI A;  2COM A;  2K4J A;  3JTH A;  4U7B A;  3ZPL A;  2IA1 A;  1IF1 A;  1LEB A;  1K7A A;  5HLG A;  2RQP A;  1EH8 A;  2WWY A;  2FRH A;  1PUE E;  4OIN F;  2XGX A;  4JBA A;  1TQP A;  4AVP A;  2QM3 A;  1ZLK A;  2VON A;  3TOA A;  2M1B A;  5K5Q A;  4I2O A;  3NQO A;  3H3Z A;  2X4H A;  5DCM A;  4RAZ A;  1V4R A;  2A68 F;  3F8M A;  3HRT A;  2QQ9 A;  4A6E A;  4XSZ F;  4A0Z A;  2XAF A;  5JHU A;  1BIA A;  1I1S A;  2CYY A;  5D6F A;  2Z99 A;  2VBZ A;  1LDD A;  3ZMD A;  5LEJ A;  3KEQ A;  2ZCW A;  2IVM A;  1BC7 C;  1IN6 A;  5LRS A;  5ERI A;  4EM2 A;  2A3S A;  4S04 A;  3P9K A;  2KRF A;  2FF4 A;  4Q4Z F;  4HAM A;  1O3T A;  2ZJ2 A;  3KP3 A;  3CO6 C;  2R7F A;  4I02 A;  2UWM A;  4IRI A;  5IT9 K;  4KN4 X;  4L5I A;  4YFN F;  3WGH A;  3GXO A;  3V7S A;  2EB7 A;  2DT5 A;  1PDN C;  2RKH A;  3RKW A;  3EDP A;  5HS8 A;  2L4M A;  1XSX A;  1U6G A;  4IRH A;  2EFP A;  1O7L A;  3RI4 A;  2O8X A;  4KIB A;  2A69 F;  4LLL A;  2IJL A;  4R1H A;  3R6S A;  1E2X A;  4PZJ A;  4OIQ F;  3KE2 A;  3FXU A;  2V1X A;  1SD5 A;  5ILV A;  4EV0 A;  1XDS A;  2STT A;  4BNC A;  5CVI A;  4Y17 A;  4LJZ F;  1XDU A;  4HQM A;  4A5M A;  5DEQ A;  1FOK A;  2HEO A;  5BQT A;  4ZH4 F;  3F8F A;  3NRV A;  4RB0 A;  3VB2 A;  2KJC A;  4EGZ A;  1WWX A;  2MH9 A;  5HOO A;  4UV8 A;  2P7C B;  2NNY A;  3E6B A;  3JTG A;  2W24 A;  4MQ9 F;  2FBI A;  1BI1 A;  5DYM A;  4KIG A;  3EQL F;  3QRF F;  4KMF A;  5LGN A;  4UV9 A;  2OZU A;  1Q1H A;  3HYI A;  1MD0 A;  5F6F A;  2OD5 A;  1YW7 A;  4OOI A;  3O6B B;  1YW8 A;  3BJ6 A;  4JK1 X;  4HZF A;  1JHF A;  4I7H A;  4LD5 A;  1KU3 A;  3B73 A;  3OOP A;  5BPI A;  2A6E F;  5J8C A;  4KN7 X;  2CSO A;  1MJA A;  1S8N A;  2VBW A;  5LHI A;  1BN5 A;  1FYL A;  3WTX C;  4HBL A;  1LDJ A;  3E6D A;  3KLO A;  3V7C A;  1D8K A;  2FOK A;  2GA1 A;  2IA0 A;  1R22 A;  2XAH A;  1S6L A;  2NYX A;  4XBF A;  2DLL A;  2FNA A;  2PEX A;  2QBY B;  3QAH A;  5D5W B;  2W85 A;  3DPT A;  3U9G A;  3BOQ A;  2IW5 A;  5FB2 A;  4M71 A;  5DD4 A;  2YPR A;  2XRO A;  6PAX A;  2Z5U A;  1HW5 A;  2VC1 A;  2D45 A;  3MEX A;  1G3T A;  4HA8 A;  2RGV A;  1XGM A;  3E5X A;  2OU2 A;  2X0L A;  4K2E A;  1AWC A;  2P5K A;  2EFQ A;  3IRR A;  1F4K A;  5FFZ A;  4HQE A;  5K1Y A;  1STZ A;  4IF4 A;  4OIP F;  2FEZ A;  3E5Q A;  4ZYG A;  4I0B A;  3I64 A;  2XUB A;  4CHU A;  1I1G A;  4ENK A;  3WG9 A;  1TW3 A;  4QLC U;  3HOT A;  1O3R A;  1IZ1 A;  1I27 A;  1LB2 A;  1QZZ A;  2F5F A;  4LB6 B;  3V8L A;  4PDK A;  5CVV A;  1YO5 C;  1HW1 A;  1UST A;  1ZGA A;  2ZME B;  1BC8 C;  1R7J A;  3M9A A;  5L3G A;  4HLX A;  1XSV A;  2M30 A;  1U2W A;  2BEO A;  1XMA A;  1FBU A;  5JFR A;  1J5Y A;  1B59 A;  2H6C A;  1MZB A;  2PG4 A;  1KYW A;  5FLX K;  3RDI A;  1D3Y A;  1IXR C;  1XCB A;  4RGR A;  3HOS A;  4LB5 A;  5ILS A;  1J7K A;  5HDN A;  1FC3 A;  1OPC A;  4UHT A;  3NEU A;  1T6S A;  5CYV A;  4AWX B;  1F5T A;  4RB1 A;  4Q47 A;  5HVQ C;  4LG0 A;  3WTV C;  2P5L C;  1DDN A;  3SQN A;  5BMZ A;  4I09 A;  2L3D A;  3G73 A;  2LKP A;  4RB2 C;  2VT2 A;  3FZV A;  5L3C A;  2XHK A;  3CLO A;  2IPQ X;  2EA4 A;  4EJW A;  3CUQ B;  2VE8 A;  2GA2 A;  2RNJ A;  2ESH A;  4MTD A;  1Z9C A;  4LK1 F;  5AIQ A;  3HHG A;  2QEN A;  2OAZ A;  1EH6 A;  1GXP A;  3RPU A;  4HX7 A;  5JI6 A;  4LLN A;  3MCZ A;  1B1B A;  1YG2 A;  1QQI A;  5L3F A;  4R79 A;  4G9Y A;  1RIO H;  2EV5 A;  3HRS A;  4ZZL A;  5DUK A;  1FT9 A;  3K0L A;  1R5G A;  4PGH A;  4EJO A;  2L02 A;  1HST A;  4Y15 A;  3E5U A;  3AAF A;  4I01 A;  3BZ6 A;  4GO1 A;  5H6R A;  5LEK A;  4G7O F;  3EET A;  1T2K A;  1J0R A;  3J81 K;  4KNY A;  3CO7 C;  2BGC A;  2EFN A;  1BI2 A;  1J9I A;  4OIO F;  2WV0 A;  1YTY A;  3ROU A;  1HQC A;  2HQN A;  5KVR A;  1R58 A;  3I4P A;  2FE3 A;  2V1D A;  4LFU A;  3WTY C;  4ZYD A;  2DPU A;  1K78 B;  5D5X B;  2KIM A;  3SXY A;  3WTZ A;  1ZLJ A;  2CWE A;  5ICC A;  2XAS A;  2PQ8 A;  4UNO A;  5A2Q Z;  2OQR A;  4NB5 A;  3QPT A;  5CVR A;  3ISP A;  1SMY F;  2H6B A;  3JAM Z;  2NRA C;  3VOE A;  4HF0 A;  2MD5 A;  4WX9 A;  3IWZ A;  2XKP A;  2RDP A;  2EWN A;  4EQQ A;  3HTS B;  3HHH A;  3ULQ B;  4KDP A;  2YR2 A;  4BH9 A;  1VTN C;  4L9T A;  3Q9V A;  1P4W A;  2EFW A;  2O6G E;  4M9S A;  4M9Z A;  2YSR A;  1PP8 F;  1WRJ A;  1B9N A;  1J59 A;  1F9N A;  5TRD A;  1B4A A;  4U7D A;  3L7W A;  3MZY A;  4Z2Y A;  4EJT A;  1X3U A;  2FU4 A;  2HDC A;  2V6C A;  3HTU A;  3ZMU A;  2MLG A;  3I53 A;  2RN7 A;  2DAO A;  4O5V A;  2ESN A;  3WGG A;  2PMU A;  3CDH A;  2Q8K A;  2H94 A;  5ICF A;  1UCR A;  4CO8 A;  1JHH A;  1K6O A;  1H9T A;  1G3W A;  4HDU A;  4ESJ A;  2HTJ A;  2WTE A;  3ZMV A;  3B02 A;  1REP C;  2AS5 F;  4MQV A;  3GFI A;  2A61 A;  2HWV A;  5E8G A;  3FF5 A;  2HKO A;  2JT1 A;  3LFK A;  3I59 B;  5K5O A;  1IXC A;  1QO0 D;  1UB9 A;  4LMY A;  3J81 Z;  4QWQ A;  2AXL A;  3FHZ A;  1WI9 A;  5BPD A;  3FM5 A;  1A04 A;  1IN8 A;  1ZRF A;  4IHS A;  3W6J B;  2FQ3 A;  1R23 A;  1UFM A;  3DF8 A;  4ZYH A;  4KIC A;  1L3L A;  3KET A;  1FWZ A;  2QZ8 A;  4S05 A;  3WU1 B;  5E17 F;  1ZAR A;  4L9V A;  2E1C A;  4EMS A;  2OA4 A;  2UZK A;  3ABT A;  4ENN A;  2VBY A;  2W84 A;  4BQA A;  3VFZ A;  4IXA A;  4BAY A;  3F72 A;  3RKX A;  3COA C;  2M5W A;  5LBQ A;  4U0V A;  2KJB A;  3HIF A;  3QP5 A;  3DXJ F;  3PQK A;  3GFL A;  1ZYR F;  3IC7 A;  4KA4 A;  2J5O A;  4L18 B;  1HXD A;  2Q0O A;  2GWR A;  3D5L A;  2NAZ A;  2ETH A;  5L3D A;  1G6N A;  4AIJ A;  1LEA A;  1T0F A;  2V79 A;  1BOA A;  2MBF A;  1KA8 A;  5JVT A;  2OZ6 A;  2LF7 A;  4M74 A;  4HX8 A;  2NS0 A;  5D6E A;  5E8I A;  3WTW C;  4R8H A;  1FP2 A;  2XIG A;  1R36 A;  3HRM A;  3JAM K;  1ZG5 A;  1SMT A;  1YS6 A;  1O3Q A;  3L2C A;  3N97 A;  4N0B A;  4P5O A;  2HGC A;  1B9M A;  3CJN A;  2LF8 A;  1J2X A;  4UUV A;  2TDX A;  3BRO A;  5FD5 A;  4YFK F;  4EJU A;  1FY7 A;  3F21 A;  4YII A;  3MAJ A;  4AIH A;  1IXS B;  2VXZ A;  2FML A;  1HKQ A;  3RJP A;  2NNN A;  2ZBK A;  2Z9O A;  1G3S A;  3QPH A;  4PCQ A;  3KP7 A;  1T38 A;  2P6T A;  4FX4 A;  4M72 A;  2QWW A;  2DI3 A;  4FT8 A;  3D0S A;  5F1R A;  3K1M A;  1YS7 A;  2O03 A;  3KEO A;  4ZYE A;  3LA7 A;  1T98 A;  4CIC A;  2ISZ A;  5D5V B;  5ICE A;  5CJ9 A;  3GW2 A;  1U8R A;  1K78 A;  1ULY A;  5CLS A;  1RZ4 A;  3LA3 A;  4BHB A;  2VBX A;  3H3U A;  3QU6 A;  3ML6 A;  5DDG A;  3KZY A;  3M1E A;  3LWF A;  3J80 K;  3KCC A;  2P6S A;  3BPX A;  3F3X A;  4Q48 A;  4P55 A;  1MGT A;  5D4R A;  1FBQ A;  1MJB A;  3K1P A;  1QGP A;  2O3F A;  4OMZ A;  3KP6 A;  2XAQ A;  3L00 A;  2PN6 A;  2K86 A;  2JZY A;  4L9J A;  5J6X A;  1U5T C;  2FBH A;  1R1V A;  3HSR A;  1IW7 F;  2YX7 A;  1SFX A;  3I71 A;  1IAW A;  2HS5 A;  2Y0M A;  4KYW A;  5D8L B;  3V4G A;  4WF2 A;  1KGS A;  4RGU A;  2BE5 F;  2QBY A;  3BPV A;  2J5P A;  4DNC A;  1BBY A;  3FMR A;  3I58 A;  1E17 A;  2D1V A;  3GF2 A;  4UXN A;  2LNB A;  2FA5 A;  1IN7 A;  1TTY A;  3HSF A;  5BOX A;  4HDV A;  2IRF G;  4MTE A;  4YFX F;  1OYW A;  1KU2 A;  1OKR A;  4I0A A;  4M73 A;  4G7H F;  4JQF A;  5FLX Z;  4HV5 A;  1OMI A;  3W6K B;  2HR3 A;  3KLN A;  1BIB A;  1U3E M;  1BJA A;  1Z6R A;  2F5D A;  1I5Z A;  4KT5 C;  3G3Z A;  4P9U A;  3GX4 X;  2LDU A;  2MLK A;  1ON2 A;  1MDM A;  4RAY A;  3FWE A;  3ZMS A;  1FX7 A;  1Z05 A;  2MH2 A;  3ZP5 A;  2RVC A;  4M6X A;  5FGM A;  5F64 A;  2CG4 A;  4G6D A;  4BHP A;  3TOB A;  5ED4 A;  3REO A;  4A12 A;  1D5V A;  4LGW A;  3TQN A;  1O57 A;  3EYI A;  2V1U A;  3SFZ A;  2BV6 A;  4CZZ A;  1U5T A;  3GEZ A;  1HW2 A;  3V8K A;  1W7P D;  2EJR A;  4EGY A;  1USS A;  3BJO A;  1KQ8 A;  2PFB A;  2MA3 A;  3C18 A;  1OYI A;  3E6C C;  2P5V A;  1TBX A;  3C3W A;  4HOB A;  3EUH A;  2L54 A;  5LLQ A;  4BYY A;  2RC4 A;  2HYF A;  3FXQ A;  4KMU X;  2L01 A;  5JR3 A;  1YQA A;  2ADU A;  2P4W A;  1R1U A;  3DQV C;  5DD8 A;  1KU7 A;  1S7A A;  4ON0 A;  2JRT A;  3TO9 A;  1O3S A;  3ZN0 A;  3GO5 A;  3K69 A;  2K02 A;  1TQI A;  1KU9 A;  1LJ9 A;  1W5T A;  1P4X A;  1W5S A;  2ZNY A;  3TDZ C;  4LLG F;  4F7Z A;  3KFW X;  1TQM A;  5HDK A;  2YX4 A;  1SD4 A;  4BXU A;  3DEU A;  2G7H A;  3SZP A;  2DPD A;  1GHC A;  2D2W A;  1WKM A;  3K9T A;  2ZKZ A;  3GZ6 A;  1Z7U A;  2UXX A;  1W7P A;  2FSW A;  4PGG A;  2F5C A;  4O3M A;  4RGS A;  4GCV A;  2G9W A;  4WXH A;  4UVC A;  4A0X A;  3H92 A;  2ISY A;  4OMY A;  4XLP F;  2HZT A;  4GXO A;  3DPL C;  1ZGJ A;  1EH7 A;  3MQ0 A;  3T5X A;  3I54 A;  2F5E A;  1Z6T A;  2A6H F;  3RTR A;  3KP4 A;  2XV4 S;  3R0A A;  2OBP A;  2FMY A;  2H27 A;  3ZMZ A;  4HV6 A;  3V8J A;  3J7A O;  1XGN A;  3FMQ A;  1ZRC A;  4KFC A;  3SHF A;  4L5J A;  4B09 A;  3T1B A;  2CQK A;  3S2W A;  1ONV A;  1JE8 A;  3U1D A;  2JTV A;  1L0O C;  3L9F A;  3RYP A;  1FPQ A;  5FD6 A;  2CO5 A;  4U88 A;  4G8X A;  2GXB A;  4U0W A;  4NHJ A;  1LQ1 A;  4I98 B;  5E1X A;  1ODD A;  3KP2 A;  1XN7 A;  2HOE A;  3R61 A;  1D8J A;  3P9C A;  3C7J A;  3F23 A;  2LSO A;  2E1N A;  4B8X A;  4ASN A;  3T8T A;  3WE2 A;  2PBI A;  2EV6 A;  2DBB A;  3JSP A;  4N9I A;  1S3J A;  2ELH A;  4Y13 A;  3E3V A;  1WQ2 A;  1P92 A;  4G94 A;  3LST A;  1QNT A;  3WTT C;  1ZHF A;  3I5U A;  3HRU A;  4AIK A;  1ZRD A;  5FFX A;  2Y48 A;  1ON1 A;  3IWF A;  3M8F A;  1H9G A;  1DPR A;  2H09 A;  3WGI A;  3HUG A;  5KK1 A;  1FBS A;  1ZG3 A;  3O3K A;  4MEY F;  2O61 A;  4RGX A;  5BS6 A;  3I59 A;  1EV7 A;  1FSH A;  5E1Z B;  3HSE A;  4DQ2 A;  5H20 A;  1IN4 A;  3IL2 A;  1LNW A;  2CFX A;  3WTS C;  4ESB A;  1O7F A;  4L0Y B;  5EEH A;  2W25 A;  5D4S A;  1I6X A;  1OR7 A;  3P9I A;  4ZZD A;  3MZH A;  3GZ5 A;  1T39 A;  2K4B A;  3LAP A;  1P4A A;  4N9H A;  1FP1 D;  3MWM A;  1TLH B;  1P6R A;  2VE9 A;  5K5R A;  2VOD A;  4ENM A;  3CTA A;  3IKT A;  2XKO A;  2GAU A;  2UXN A;  4MEX F;  2V9V A;  2JPC A;  3F8C A;  4M6Y A;  5LHG A;  3JW4 A;  2ZME A;  1MJ9 A;  1SD6 A;  1YYV A;  3R4K A;  2VOP A;  3CUO A;  3P7N A;  2F2E A;  4HW0 A;  1LVA A;  2WC2 A;  3FX3 A;  4HYE A;  3TGN A;  3ELK A;  1R5H A;  2M8E A;  1YFH A;  4IHT A;  1W4M A;  5CVJ A;  1ZAO A;  3ZQ7 A;  2FXA A;  1QBJ A;  3F8B A;  3QOP A;  1IN5 A;  2DU9 A;  2XRN A;  4D0P A;  3LA2 A;  4AD9 A;  4OU0 A;  2M87 A;  5E20 A;  3M8E A;  2XVC A; 
#chains in the Genus database with same CATH topology
 4IHW A;  2OF7 A;  2DMN A;  3QPS A;  4A3C J;  3LFU A;  3JRF A;  1HBX G;  2FBK A;  4BHC A;  1WVR A;  2Z3Y A;  1Z3Y A;  3LQQ A;  4CCL A;  4P96 A;  1P2F A;  3K4M A;  2CUE A;  5HLT A;  4UVB A;  2BVL A;  1JI8 A;  1SAX A;  3K4N A;  4FHT A;  3ABU A;  2VN2 A;  4BQN A;  4XOT A;  3HOX J;  1QVU A;  2BVM A;  3H0G J;  4QPO A;  5D8K B;  3BQZ A;  3FXR A;  2HKX A;  2GZW A;  2GIV A;  2HI3 A;  3LSI A;  1Z0X A;  4XKB A;  1XSD A;  2LH9 A;  2ZFW A;  3BWG A;  2EZH A;  2W57 A;  3PSI A;  2ELK A;  1FZP B;  5K7Z A;  1DU6 A;  1Z1D A;  3ZMT A;  3FXJ A;  4BDY A;  1WSU A;  4JOM A;  2XAJ A;  2KMU A;  1DP3 A;  1WJB A;  1FNN A;  1QPM A;  2QQB A;  3Q9S A;  2DA2 A;  3IH2 A;  3KP5 A;  1GV2 A;  4O6J A;  2KKO A;  1BI3 A;  1IDY A;  3LMM A;  4BDZ A;  3AL0 C;  5LGU A;  4CYD A;  2ZC2 A;  3QYE A;  4YG2 F;  5F08 A;  3BP8 A;  1LVK A;  2P81 A;  4QSH A;  3CZ6 A;  1S7O A;  2A05 A;  2CW8 A;  4A2U A;  2R7D A;  3FM3 A;  2LK2 A;  1Y0U A;  4RS8 A;  4EEF G;  4XKV A;  4WWC A;  4HX4 A;  2AO9 A;  4HF1 A;  1SFU A;  5AIP A;  5IT3 A;  2EBI A;  2C6Y A;  5D5U B;  2K5C A;  4BE1 A;  4IO9 F;  4D7M A;  2HQR A;  2PI0 A;  4A3E J;  1PJR A;  1MKM A;  2MC4 A;  3TP0 A;  3OYL A;  1FJL A;  2CMP A;  4CGZ A;  3I0T A;  1WZ2 A;  2YS9 A;  3V7R A;  5HLH A;  4PSW A;  5DCF A;  3PO3 J;  3BZC A;  3K4J A;  2BBY A;  4LG0 B;  2FNP A;  5A2Q K;  1ZG1 A;  1LPQ A;  5HS7 A;  1DGW Y;  3CCS I;  2CW0 F;  1GXQ A;  2CRG A;  5DUI A;  2BYV E;  5HLI A;  5L3B A;  1OR7 C;  5H6Q A;  3MD2 A;  2V4J C;  1TW2 A;  2ECB A;  3Q5F A;  5JLW A;  1KQ0 A;  1GUU A;  3TDU C;  4D1Q A;  1ZH5 A;  3BJA A;  3DKW A;  1RNL A;  2DK8 A;  1F1Z A;  2IGO A;  3CF5 F;  1H0M A;  2PJR B;  3DU6 A;  1QZE A;  2OQG A;  3NWT A;  3R60 A;  4BJT A;  2KRC A;  3BTC A;  3DPU A;  1EKE A;  3BR2 A;  5GAH J;  1BL0 A;  3O2P E;  2Y9Y A;  3I4M J;  4IQ4 A;  3ZXS A;  4BBR J;  3S16 J;  3U2R A;  2MC3 A;  2MG4 A;  1WJE A;  4XN0 A;  2GXG A;  3DBH B;  1DP7 P;  2CH0 A;  2DA4 A;  3B6A A;  4IRG A;  5J3L A;  3H9G A;  4GDF A;  4L0Z B;  2JPB A;  5ILU A;  4UVA A;  1U5T B;  4DW6 A;  1IRF A;  1G3Y A;  4CCK A;  1S29 A;  4IJA A;  1RUO A;  4BUP A;  1IV6 A;  4YIR X;  1SEU A;  4DOZ A;  5LFA A;  3S15 J;  1QPI A;  1QZY A;  3MKZ A;  4N4N B;  1HKS A;  3K1N A;  3IUO A;  3DP7 A;  1YIO A;  2XB0 X;  4RB3 C;  1HF0 A;  1HSJ A;  2STW A;  1IUF A;  3PQJ A;  1XB4 A;  1NHA A;  3L09 A;  3G1O A;  1MBG A;  3WTU C;  4B47 A;  3EYY A;  5GAG J;  3HBL A;  2HXI A;  2DMQ A;  3DFG A;  3F8N A;  2YU3 A;  2LLK A;  1HKT A;  3HOV J;  3HKZ A;  2M9H A;  2R7X A;  4XRF A;  1PYV A;  3OYE A;  2DK5 A;  2HXO A;  4XQF A;  1DPU A;  2KZV A;  3G4S I;  4H0E A;  1MDM B;  5J4V A;  1IUY A;  4CXF A;  3L2U A;  4DJA A;  3KZZ A;  5CVU A;  4GGG A;  2K85 A;  4XN3 A;  2QUF A;  1XPX A;  4MGR A;  2PX9 A;  5J8F A;  3E0J B;  3T8R A;  1TWC J;  3AG2 H;  3QPL A;  1J75 A;  4XSX F;  3J80 Z;  4L9N A;  5ICG A;  3DBL B;  3GUD A;  3RIR A;  3VOD A;  5J40 A;  1PP7 U;  4CDG A;  3OV8 A;  2EA2 A;  5LGT A;  5GTH C;  2DQL A;  2P8T A;  2K7L A;  3ZQQ A;  1E3O C;  2GM4 A;  4IKF A;  3IKV A;  3CJT B;  1T33 A;  2HTS A;  3AG4 H;  1WFX A;  1B6A A;  5DCM B;  1OYY A;  2JVH A;  4A3K J;  1UHM A;  1WPK A;  3RPQ A;  4CCJ A;  5IP6 A;  4C3H J;  5TJJ A;  2QYO A;  5J47 A;  2LKX A;  1Y6I A;  1XCV A;  2DFI A;  1I6H J;  2V26 A;  1MIJ A;  3DKX A;  4HSR A;  1G4D A;  3LQR A;  4EJV A;  2VT3 A;  4II3 A;  2LY9 A;  4NQW A;  4XLN F;  5E3O A;  2IT0 A;  3JSO A;  2QCO A;  4XLE A;  4WCG A;  2NOG A;  4NC6 A;  2X1E A;  2DW4 A;  3K2Z A;  4OAZ A;  3Q0V A;  2DJI A;  4LIV A;  4EM1 A;  2Y9Z A;  2JA6 J;  1FYK A;  3C1D A;  1S5L C;  2ACJ A;  4PFP A;  4DBQ A;  4WK8 F;  1QVT A;  2EFO A;  1VQ4 I;  1TNT A;  2VC0 A;  4IVN A;  3OYI A;  3GTM J;  1ZRE A;  2HYG D;  5E1W A;  4HF2 A;  2D1H A;  5FLM J;  2L4A A;  1HDD C;  1QHH D;  4A5N A;  2Q2E A;  1GVJ A;  2FX0 A;  2GBY A;  4CYC B;  2IP2 A;  3CCY A;  2VQC A;  1JXS A;  1A35 A;  1N77 A;  1GLN A;  1LDK B;  1X3Z B;  4MHG A;  2M7A A;  4P9F A;  3LAJ A;  1AKH B;  4ESF A;  4ENJ A;  4IOC F;  5AON A;  1VQ5 I;  3SZT A;  1UHW A;  5FO5 A;  3IHU A;  2O0Y A;  3F6V A;  2PLY A;  2A5Y B;  3CMA I;  4BJ6 C;  1IV8 A;  2H1K A;  5LD2 C;  2KIF A;  4XKW A;  5EEG A;  4G7Z F;  4WXC A;  4V2F A;  4FX0 A;  2ZO4 A;  5LHH A;  1MW7 A;  2EZI A;  3OYD A;  3E97 A;  4Z6Y A;  2K9Q A;  2Q1Z B;  3QU3 A;  3RPU D;  3L2V A;  4HG2 A;  5LRR A;  1VND A;  1K79 A;  2DO7 A;  2RV8 A;  3PIO F;  2CFO A;  1ZTR A;  3ECO A;  3GWZ A;  3VEP A;  3CCL I;  3GTO J;  1X1C A;  3FBN B;  4EM0 B;  3FDY A;  3ZN1 A;  5E18 F;  4JYK A;  5DV5 A;  4P1W A;  4MNU A;  4F52 A;  3N4M A;  5C44 J;  4M3G A;  1FSE A;  3I55 I;  2EV0 A;  2PJP A;  2CGP A;  3MFK A;  2GQQ A;  5HS9 A;  3E6M A;  4M6V A;  1LKX A;  4KUM A;  2AXT C;  3S32 A;  4E70 A;  1HA8 A;  1XD7 A;  2HFH A;  1JGS A;  3G1M A;  1BM9 A;  2QVO A;  4F93 B;  1JUP A;  1R1T A;  2V9K A;  3BDD A;  2EIM H;  3MKL A;  1YRN A;  2ME0 A;  5M5W J;  3H3V K;  1IRG A;  1WJA A;  1FTT A;  5EG0 B;  4BXX J;  4A6D A;  4IPA A;  3K6G A;  3GLX A;  3AFH A;  4I99 C;  1AOY A;  1BI0 A;  3G2B A;  1HCR A;  2K27 A;  3M7G A;  2K40 A;  1VI0 A;  1ZN2 A;  2P7V B;  3CUQ A;  4LK0 F;  3DV8 A;  5L3E A;  3ERE D;  4OIR F;  1X1B A;  2MSY A;  1ERD A;  2M45 A;  3KX2 A;  4M9X A;  3BG7 A;  2E2H J;  5EZH A;  3RKQ A;  1D1C A;  2W4S A;  1N25 A;  3TO7 A;  4GYG A;  3BY6 A;  1YX5 A;  2EK5 A;  2KQR A;  3GFJ A;  1XGO A;  2ZME C;  2JVG A;  3QP6 A;  2DTR A;  2EIL H;  1KYZ A;  2V7F A;  4TV7 A;  1CF7 A;  4KIF A;  1YLF A;  3RKY A;  2OUM A;  3GLL A;  2VB6 A;  3CCJ I;  1RUN A;  1CF7 B;  3GFM A;  1KQ9 A;  4XLC A;  1W7P B;  1MMN A;  4G6Q A;  1Z91 A;  1B72 A;  4WXD A;  2KT0 A;  1RI7 A;  2E7W A;  1W1W E;  3S2H J;  4RBO A;  4A93 J;  1GVD A;  2R3S A;  4IZZ A;  1FOX A;  3IRQ A;  3SFI A;  1LFP A;  1SVM A;  2PMH A;  5HDG A;  1SD7 A;  3WE3 A;  1TNS A;  2FD5 A;  4BS9 A;  3F6O A;  4HLY A;  2DQR A;  2LMD A;  2ZXJ A;  4XM3 A;  1FLI A;  4LG3 A;  2LYC A;  4U0Y A;  2R5Z B;  1VQP I;  3ECH A;  2Z33 A;  1A5J A;  1OCT C;  4JX5 A;  4Y52 J;  3FMS A;  2KHM A;  2Y75 A;  2HVQ A;  3RYR A;  2A07 F;  4A0Y A;  5IT9 Z;  3J7Y J;  4QPQ A;  2ZSH B;  4ETS A;  1XMK A;  1R00 A;  4GYI A;  1V3F A;  2E7X A;  3CUQ C;  1RRJ A;  1FYM A;  1U78 A;  3EUK L;  3R0J A;  1GDT A;  1TT5 B;  1I3A A;  2G7U A;  4FAS D;  1YW9 A;  2IAI A;  4Q5S F;  2ZNZ A;  2QQA A;  1VZ0 A;  2XAG A;  3F22 A;  3PFI A;  1MBH A;  1Q1V A;  1POG A;  2QSG X;  3GVA A;  3WU0 A;  1C0W A;  2IA2 A;  3JRD A;  1JKP C;  2KIU A;  1DUX C;  2VUM J;  4NC8 A;  3TKY A;  1VQ8 I;  2B0L A;  1YJ9 I;  2V9P A;  1SFE A;  2DOD A;  2HPM A;  3WOD F;  2ZFU A;  3EUH C;  5HNF A;  1F36 A;  3MKY B;  1XGS A;  2JSC A;  1ETY A;  4YIF A;  5M3M J;  1Y1W J;  1W0T A;  3T0Y A;  3GTQ J;  3PL8 A;  1CGP A;  2DT7 B;  1BR1 A;  2QLZ A;  5E3L A;  3TO6 A;  5IYD J;  3L2Q A;  3GYH X;  1D5Y A;  1X19 A;  4EVI A;  2COM A;  2K4J A;  3OIO A;  2X51 A;  3JTH A;  3K10 A;  5EG0 A;  3HOZ J;  3HEF A;  1MSF C;  3DWL E;  4U7B A;  3ZPL A;  1B72 B;  2IA1 A;  2OTL I;  1IF1 A;  1LEB A;  1MMG A;  2X85 A;  1P7I A;  1K7A A;  2A6T A;  5HLG A;  2RQP A;  1EH8 A;  2TRT A;  2WWY A;  2FRH A;  1PUE E;  1YIT I;  2XGX A;  4OIN F;  2QF7 A;  2FQ4 A;  4JBA A;  1BW6 A;  1TQP A;  4AVP A;  2OC6 A;  2QM3 A;  2R7O A;  3ASN H;  2L9S A;  1ZLK A;  3RQI A;  2VON A;  1QU3 A;  5EYR A;  3TOA A;  2PJR A;  2IXS A;  5C4J J;  4PUS A;  2M1B A;  5K5Q A;  2X48 A;  4I2O A;  3BTI A;  3K2A A;  2JJ7 A;  1U9O A;  3NQO A;  1R5I D;  1YX3 A;  2LFB A;  3H3Z A;  3K7A J;  2N8G A;  2X4H A;  4ZC3 A;  3H1C A;  3S3O A;  1D0Y A;  5DCM A;  2QSF X;  4RAZ A;  1T08 B;  3AG3 H;  4AYB A;  1B8I B;  1V4R A;  3IH4 A;  2A68 F;  3TP3 A;  1Z7L A;  4DGW B;  3OYN A;  3FIW A;  2JQ7 A;  4QTR A;  1MBF A;  2QQ8 A;  3F8M A;  2R0Q C;  3D5S C;  2ICW G;  3HRT A;  2QQ9 A;  1RC9 A;  4A6E A;  5KCM A;  4XSZ F;  4A0Z A;  2XAF A;  4BL0 B;  4A3F J;  1NG6 A;  3S1Q J;  5JHU A;  1BIA A;  1I1S A;  2VIX A;  4V2G A;  2CYY A;  5D6F A;  2Z99 A;  4S0H B;  1BR4 A;  1BOB A;  2VBZ A;  4M3F A;  1LDD A;  2DA1 A;  2DJN A;  3ZMD A;  1R4M B;  4XR6 A;  5LEJ A;  3H0D A;  3KEQ A;  2ZCW A;  2E36 A;  2F6C A;  2IVM A;  2VXD A;  1BC7 C;  2LTP A;  2X1C A;  3GCM A;  1JJ8 C;  1IN6 A;  5LRS A;  1MNM C;  2IS6 A;  5ERI A;  2VKH A;  3O8H A;  1JKR C;  1P7J A;  1RKW A;  5JVG F;  2ZXI A;  3FBI B;  4EM2 A;  1XC5 A;  2WY7 Q;  2A3S A;  4B44 A;  3GBG A;  4EAT A;  4S04 A;  3P9K A;  2KRF A;  2Z2S B;  3SYT A;  2FF4 A;  4Q4Z F;  4HAM A;  1O3T A;  2ZJ2 A;  5F0C A;  3KP3 A;  3CO6 C;  2R7F A;  1T95 A;  4I02 A;  2UWM A;  3OYB A;  4IRI A;  5IT9 K;  3KIO A;  2I5U A;  4KN4 X;  4L5I A;  4YFN F;  3WGH A;  3GXO A;  3V7S A;  2EB7 A;  4HRI A;  2DT5 A;  1PDN C;  4CSW A;  3W2A A;  2LVS A;  2RKH A;  2EIN H;  2X1D A;  1AU7 A;  4E7S A;  4CCO A;  3L2R A;  2CS3 A;  2R7U A;  3RKW A;  5FKO A;  2LBF B;  3HC7 A;  3EDP A;  3RZD J;  3KYL A;  5HS8 A;  1G8X A;  3IP4 B;  3BZK A;  2L4M A;  4DYQ A;  4Y7N J;  1XS9 A;  1XSX A;  4HEA 2;  1U6G A;  1JT0 A;  4IRH A;  2EFP A;  3OMY A;  2Q2E B;  1O7L A;  3RI4 A;  2VQG A;  2UV1 A;  3MZ8 A;  3I56 I;  2O8X A;  1JTY A;  2E2I J;  4KIB A;  2A69 F;  3C2H A;  3VDX A;  4LLL A;  1Y39 A;  3FXL A;  2IJL A;  4R1H A;  2QGU A;  1E2X A;  4XL9 A;  4PZJ A;  3R6S A;  4OIQ F;  3KE2 A;  3FXU A;  2V1X A;  1SD5 A;  4BU2 A;  5ILV A;  3G71 I;  3LSJ A;  3FIS A;  4EV0 A;  3CC7 I;  1XDS A;  2STT A;  3BG6 A;  5M5Y J;  4BNC A;  1EA3 A;  5CVI A;  2CQQ A;  4Y17 A;  3CC4 I;  2I10 A;  4LJZ F;  1XDU A;  4HQM A;  4A5M A;  2F4I A;  5DEQ A;  1FOK A;  4A69 C;  2HEO A;  3ZQI A;  5F27 A;  1CQT A;  5BQT A;  3DBR B;  4ZH4 F;  5KAF C;  3H35 A;  2MFZ A;  2LR8 A;  3CLQ A;  3F8F A;  2E34 A;  3NRV A;  4RB0 A;  2EZK A;  2KJC A;  3VB2 A;  4EGZ A;  3JRC A;  1WWX A;  1V5G A;  2EH3 A;  2MH9 A;  5IYB J;  5HOO A;  4UV8 A;  2P7C B;  2NNY A;  2VQL A;  3E6B A;  3JTG A;  2W24 A;  1WGX A;  4MQ9 F;  1RR8 C;  2FBI A;  4E4H A;  1BI1 A;  5DYM A;  4KIG A;  3EQL F;  3QRF F;  3PUB A;  4KMF A;  5LGN A;  5HNH A;  2KIQ A;  4UV9 A;  4XMY A;  2OZU A;  4A3D J;  3BTJ A;  1Q1H A;  1X58 A;  3HYI A;  1MD0 A;  5F6F A;  2XF6 A;  2OD5 A;  1YW7 A;  4OOI A;  3O6B B;  1YW8 A;  3BJ6 A;  3A0B C;  3OL3 A;  4JK1 X;  2R92 J;  4HZF A;  4RA2 A;  3ZR8 X;  1JHF A;  2BXZ A;  4I7H A;  1AKH A;  3GZN B;  5GTI C;  2ZJQ F;  4LD5 A;  1KU3 A;  3B73 A;  3OOP A;  5BPI A;  3K70 C;  2A6E F;  4IOA F;  5J8C A;  4KN7 X;  2CSO A;  5IPA A;  3TBI A;  1MJA A;  1S8N A;  2VBW A;  2L9R A;  2WB1 A;  5LHI A;  4A3B J;  1BN5 A;  1FYL A;  1IC8 A;  2XF5 A;  3WTX C;  4HBL A;  4UUS B;  1LDJ A;  3E6D A;  1WJF A;  3KLO A;  3RCO A;  3V7C A;  4MIM A;  2LG4 A;  1D8K A;  2FOK A;  2GA1 A;  2IA0 A;  1VQK I;  2ID6 A;  1R22 A;  2K9S A;  2XAH A;  4E7L A;  3LL7 A;  1PUF A;  2YU9 J;  4JP0 A;  3S8P A;  1NTC A;  1S6L A;  2NYX A;  4XBF A;  4LOC A;  2CUF A;  2DLL A;  3M1C A;  4BY1 J;  2FNA A;  2PEX A;  3QAH A;  1UHS A;  2LBF A;  2QBY B;  4XIC A;  2HDD A;  5D5W B;  2WA0 A;  2W85 A;  2GOX B;  1MBJ A;  4A3M J;  3DPT A;  3U9G A;  3BOQ A;  2IW5 A;  5J1R A;  5FB2 A;  3HZJ A;  4ABZ A;  2DFE A;  4M71 A;  5DD4 A;  2YPR A;  2XRO A;  6PAX A;  2Z5U A;  1HW5 A;  2VJ4 A;  4I76 A;  2VC1 A;  1V5F A;  2JA5 J;  3BR1 A;  3BR5 A;  2D45 A;  2DDA A;  4U87 A;  4D5F A;  1YHQ I;  3MEX A;  1G3T A;  4HA8 A;  3SEZ A;  1U9N A;  3EPZ A;  1LFU P;  2WV1 A;  4PJ0 C;  2RGV A;  1JGG A;  1XGM A;  3K4B A;  5GPA A;  4CCM A;  3E5X A;  2OU2 A;  2X0L A;  2OCE A;  4K2E A;  1AWC A;  3LSK A;  2P5K A;  5B5E C;  5GPC A;  2EFQ A;  3IRR A;  3DLL F;  5FFZ A;  1F4K A;  3UNG C;  5EDN A;  4HQE A;  3TED A;  5K1Y A;  2VPL A;  1STZ A;  4IF4 A;  3JRE A;  2KPM A;  2R7V A;  4OIP F;  2FEZ A;  3E5Q A;  4ZYG A;  4I0B A;  3I64 A;  2QA4 I;  3OYH A;  2XUB A;  3HJE A;  1Z21 A;  2DYR H;  4QIW N;  3OYF A;  1IGN A;  2CQN A;  4DYR A;  4CHU A;  1I1G A;  4ENK A;  2RAE A;  1TT0 A;  2DOE A;  2KDO A;  2IS2 A;  1NH3 A;  2Y30 A;  5F0H A;  3WG9 A;  1D0Z A;  2OJE D;  1A31 A;  1N78 A;  1TW3 A;  3Q3S A;  4QLC U;  3HOT A;  1U0J A;  1K4S A;  1O3R A;  1IZ1 A;  1I27 A;  2TCT A;  2BHZ A;  5EZG A;  2R5Z A;  1LB2 A;  1QZZ A;  2F5F A;  4LB6 B;  3V8L A;  2O9L A;  3S14 J;  4PDK A;  3HKZ N;  5CVV A;  1ETO A;  3AG1 H;  1OFC X;  1YO5 C;  1HW1 A;  1E3H A;  1UST A;  1ZGA A;  2ZME B;  4CA0 A;  2R93 J;  4ZJZ A;  1BC8 C;  2VKV A;  1R7J A;  3M9A A;  2WB1 N;  5L3G A;  1ETV A;  4HLX A;  1XSV A;  2M30 A;  1U2W A;  2BEO A;  4PJJ A;  3VPR A;  4IX7 A;  1MBK A;  2MW8 A;  1ZR2 A;  1XMA A;  1FBU A;  5JFR A;  1J5Y A;  1FEX A;  1X2M A;  2XGE A;  2ZSI B;  1B59 A;  4NC7 A;  4FET A;  2H6C A;  1MZB A;  2PG4 A;  1KYW A;  5B66 C;  3S1N J;  2E1M B;  2B63 J;  2CQX A;  5FLX K;  3RDI A;  3BC8 A;  3OR2 C;  1D3Y A;  1IXR C;  3RSN A;  2ECC A;  1XCB A;  4RGR A;  3IAS 2;  4LIU A;  3SDG A;  3WHB A;  3M3Y J;  3H5R A;  3HOS A;  4LB5 A;  3ABK H;  5ILS A;  4B3X A;  2DMU A;  2DFH A;  3IH3 A;  1J7K A;  5HDN A;  1FC3 A;  1OPC A;  4UHT A;  3NEU A;  2L7K A;  1T6S A;  3LNQ A;  5CYV A;  4AWX B;  1F5T A;  3C2B A;  4AID A;  4RB1 A;  4Q47 A;  5IOZ A;  5HVQ C;  4LG0 A;  4RDU A;  3WU2 C;  1M1E B;  1LFB A;  3WTV C;  5E3M A;  2BZT A;  1K83 J;  2HYJ A;  2P5L C;  1DDN A;  4C3I J;  3NWS A;  1IJW C;  5TGT A;  3SQN A;  2DN0 A;  5BMZ A;  1YRN B;  2MD0 A;  4BQQ A;  5IOY A;  1LE8 B;  2BY1 A;  4C2U A;  4I09 A;  2L3D A;  3G73 A;  2BOL A;  2JRM A;  2LKP A;  4RB2 C;  2L7Z A;  4B48 A;  3GTJ J;  4HST A;  2VT2 A;  3JCU C;  2RRE A;  3FZV A;  3CP2 A;  5CQE A;  1ZEL A;  2XHK A;  5L3C A;  4BE0 A;  2BY0 A;  3CLO A;  2IPQ X;  3S17 J;  3BR3 A;  2VLA A;  1QA6 A;  2EA4 A;  4EJW A;  3CUQ B;  2VE8 A;  2RNJ A;  2GA2 A;  2IGN A;  3CMY A;  2E19 A;  2ESH A;  3MVP A;  2WAF A;  4MTD A;  2E5Z A;  5EGO B;  1Z9C A;  2CQ7 A;  3EUA A;  5FRO A;  4LK1 F;  5AIQ A;  3HHG A;  2QEN A;  1ITY A;  2OAZ A;  3PM1 A;  1EH6 A;  1X3W B;  1GXP A;  3RPU A;  3OYG A;  4HX7 A;  5JI6 A;  1A36 A;  2DXI A;  2BY3 A;  2M4K A;  3CCM I;  4LLN A;  2DYS H;  3MCZ A;  2DMT A;  4BJ5 C;  1B1B A;  1YG2 A;  3S93 A;  4C2M J;  4HNT A;  1TP4 A;  2LRD A;  2L2O A;  1QQI A;  5L3F A;  4R79 A;  2WAD A;  1D0X A;  3TMO A;  5B1A H;  4G9Y A;  1RIO H;  1QHG A;  2EV5 A;  2K3P A;  3HRS A;  1R6R A;  4ZZL A;  5DUK A;  1FT9 A;  3K0L A;  1R5G A;  4PGH A;  1FMV A;  4DBR A;  3HUG B;  2R7Q A;  4EJO A;  2L02 A;  1HST A;  2Y2Z A;  3E5U A;  3PNT A;  4Y15 A;  3AAF A;  1JKQ C;  4I01 A;  1ACI A;  2HVR A;  3BZ6 A;  4GO1 A;  5H6R A;  3S3M A;  5LEK A;  2M2E A;  5KAI C;  1IRX A;  3V42 A;  4G7O F;  3EET A;  3CQZ J;  2XPW A;  2IEK A;  1T2K A;  1J0R A;  4FE4 A;  3J81 K;  2MAB A;  9ANT A;  4KNY A;  3CO7 C;  2BGC A;  1VQ6 I;  2EFN A;  1BI2 A;  3ZCO A;  4B1R A;  3SJM A;  1IG7 A;  3BG3 A;  4OAY A;  3CCE I;  1X4P A;  3BQY A;  1J9I A;  1Y0N A;  3VSL A;  5HOD A;  4OIO F;  1I3Q J;  3S1M J;  2DFF A;  2WV0 A;  2WY8 Q;  1YTY A;  2IS1 A;  3ROU A;  3L2W A;  1HQC A;  2HQN A;  2MGQ A;  5KVR A;  2BHY A;  1R58 A;  4L5E A;  4BKX A;  1B8I A;  3I4P A;  2FE3 A;  3FKI J;  4BQO A;  2V1D A;  2QKM B;  4LFU A;  3WTY C;  4ZYD A;  2DPU A;  1K78 B;  5D5X B;  2KIM A;  5C3E J;  1X1A A;  3SXY A;  3DLA A;  3WTZ A;  1ZLJ A;  2VQH A;  2CV1 A;  2XSD C;  2CWE A;  1OJL A;  5ICC A;  2XAS A;  2PQ8 A;  1OCO H;  4UNO A;  5A2Q Z;  2OQR A;  4NB5 A;  3QPT A;  4CZC A;  1PVE A;  3U21 A;  5FKL A;  2X9D A;  4D7N A;  2DA7 A;  5CVR A;  3GTP J;  3ISP A;  2R7W A;  1SMY F;  1MH4 A;  1X1P A;  2H6B A;  3JAM Z;  3OS0 A;  2NRA C;  4CH7 A;  3K4L A;  1WJ5 A;  3VOE A;  1OCP A;  4FE7 A;  4HF0 A;  2MD5 A;  4WX9 A;  4XK4 A;  3IWZ A;  3QYF A;  2V6E A;  2XKP A;  2RDP A;  2EWN A;  4UUT A;  3ZQL A;  4EQQ A;  4PJN A;  4RAF A;  3HTS B;  3HHH A;  3PNV A;  3ULQ B;  3BTL A;  5K7F A;  4KDP A;  1UAA A;  3ZOB A;  2H1L A;  2YR2 A;  3VYU B;  2CU7 A;  2Y69 H;  2E1M C;  5FKN A;  4BH9 A;  3ZRG A;  1VTN C;  1WCM J;  2P0W A;  2VKD A;  4L9T A;  2KL4 A;  3Q9V A;  1P4W A;  4B4C A;  3FHN A;  2EFW A;  2O6G E;  1WJD A;  4M9S A;  3BCB A;  3N05 A;  4M9Z A;  2YSR A;  2QKL B;  2VPR A;  1PP8 F;  1RPW A;  1T8I A;  1WRJ A;  1B9N A;  4ZYA A;  2D5V A;  2KP6 A;  1P9Q C;  4KJZ A;  1O4X A;  1J59 A;  4Y4R A;  1F9N A;  5TRD A;  4AUX A;  1B4A A;  3HM5 A;  4U7D A;  3L7W A;  3MZY A;  4Z2Y A;  2BXY A;  4EJT A;  3KYC B;  1TWH J;  1X3U A;  1MND A;  2FU4 A;  2HDC A;  2V6C A;  3HTU A;  3X2Q H;  1TL8 A;  2EZL A;  2WAE A;  5F0F A;  3HPH A;  3ZMU A;  2ZJP F;  2MLG A;  1NG7 A;  3MN2 A;  3QOE A;  2ME6 A;  3MKW B;  2HOS A;  2K3F A;  3I53 A;  1U8B A;  1I50 J;  2O7O A;  2RN7 A;  4F55 A;  1OCZ H;  2DAO A;  4O5V A;  2CJJ A;  3A2K A;  5M5X J;  1HLV A;  2JA7 J;  1KON A;  5FRM A;  3K70 D;  2ESN A;  3FK7 A;  3WGG A;  2PMU A;  3CDH A;  4RLQ A;  2CW7 A;  2M0M A;  1AA7 A;  2Q8K A;  2H94 A;  5IYC J;  3HGG A;  5ICF A;  1UCR A;  4CO8 A;  1JHH A;  1K6O A;  2M4G A;  1H9T A;  4M3D A;  5FRN A;  4RM3 A;  1G3W A;  2W82 A;  4XLA A;  4HDU A;  3ASO H;  4ESJ A;  2HTJ A;  3HOW J;  2WTE A;  2EIK H;  1Z3X A;  4XKC A;  3ZMV A;  3B02 A;  3P5J A;  5C4X J;  1A6I A;  1TZL A;  4PFO A;  1REP C;  2AS5 F;  1HOM A;  4MQV A;  3GFI A;  4JX6 A;  4BEH B;  4J01 A;  3AKZ A;  2A61 A;  2HWV A;  5E8G A;  3FF5 A;  3VYT B;  2HKO A;  2JT1 A;  3LFK A;  3I59 B;  3PFY A;  4M3B A;  2WAQ A;  4Y33 A;  5B3S H;  4XRS G;  4RM2 A;  5K5O A;  1W36 D;  3OSF A;  1D1B A;  1IXC A;  4MLO A;  1QO0 D;  1BA5 A;  1UB9 A;  4LMY A;  1ENH A;  2M8G X;  3J81 Z;  1DQU A;  4QWQ A;  2AXL A;  3FHZ A;  2L7M P;  1WI9 A;  2KLO A;  5BPD A;  4GRI A;  2NXN B;  3DKY A;  3FM5 A;  3BR0 A;  1A04 A;  2DOF A;  1IN8 A;  1ZRF A;  3CCU I;  4IHS A;  2FQ3 A;  1R23 A;  3W6J B;  3DF8 A;  1UFM A;  4BGD A;  3LSP A;  4A3G J;  3A01 A;  4FQG A;  3AL0 B;  4ZYH A;  4KIC A;  1L3L A;  3KET A;  1FWZ A;  2QZ8 A;  4S05 A;  5DM6 F;  3WU1 B;  3ABM H;  2QEX I;  2HOA A;  2JUG A;  4KT6 A;  5E17 F;  1N75 A;  1YJN I;  1ZAR A;  4L9V A;  1MBE A;  2E1C A;  4EMS A;  2AHQ A;  3PIP F;  2OA4 A;  2UZK A;  1ZR4 A;  3KEY A;  3ABT A;  5BNG A;  1Z67 A;  4ENN A;  4LIT A;  3FXK A;  2VBY A;  2W84 A;  3L1P A;  5KHD A;  4BQA A;  3VFZ A;  1S9H A;  3S2D J;  4PJM A;  2JUC A;  4IXA A;  3TW6 A;  4XRS A;  1IRZ A;  4BAY A;  1G59 A;  3F72 A;  2VL8 A;  5DM7 F;  2JSP A;  3RKX A;  3COA C;  2XSJ C;  3A03 A;  2M5W A;  5LBQ A;  2Y0S A;  4U0V A;  2KJB A;  3HIF A;  3QP5 A;  5EEA A;  3GME A;  3DXJ F;  3CDL A;  1APL C;  2B7E A;  3PQK A;  3GFL A;  1ZYR F;  3Q0W A;  1VQN I;  3IC7 A;  3KPH A;  4KA4 A;  1RKT A;  2J5O A;  2LOO A;  4X6A J;  4N4O B;  4A3L J;  2IBD A;  1DGR M;  4L18 B;  2KDZ A;  4IHX A;  1WJC A;  1HXD A;  2Q0O A;  1W0U A;  2VOO A;  2GWR A;  4YEL A;  3D5R C;  3D5L A;  1Y8R B;  2O5R A;  2RNG A;  3F0C A;  3W2V A;  2DOA A;  3H5N A;  3QWL A;  1RES A;  2NAZ A;  4AC0 A;  2GXA A;  4F3Q A;  2XGD A;  2ETH A;  4DZP A;  5L3D A;  1G6N A;  4AIJ A;  1LEA A;  1T0F A;  1W5C C;  2V79 A;  4IEJ A;  1BOA A;  2MBF A;  1KA8 A;  4MFD A;  5JVT A;  2OZ6 A;  3VYR B;  1WI3 A;  2LF7 A;  4M74 A;  2KIS A;  4HX8 A;  2NS0 A;  5D6E A;  5E8I A;  3WTW C;  3ZQH A;  2FOW A;  1YE9 A;  4R8H A;  3Q0U A;  1FP2 A;  2XIG A;  4KIT B;  1R36 A;  2E5N A;  3HRM A;  3JAM K;  1ZG5 A;  1ETQ A;  1Y1V J;  1SMT A;  4II2 A;  3M07 A;  1Z77 A;  1YS6 A;  4XLH A;  1O3Q A;  3L2C A;  2DA6 A;  3N97 A;  3TW7 A;  4N0B A;  3W2W A;  4P5O A;  3QQA A;  2HGC A;  1B9M A;  2NS7 A;  4XOR A;  3LOC A;  4RMN A;  3CJN A;  2LF8 A;  4G12 A;  2HZD A;  1J2X A;  4UUV A;  1SFO J;  2TDX A;  3BRO A;  3NAU A;  5FKK A;  2OV7 A;  5FD5 A;  4YFK F;  4EJU A;  4PK4 A;  1FY7 A;  3F21 A;  4YII A;  3MAJ A;  4E7I A;  2ELJ A;  4AIH A;  1IXS B;  2VXZ A;  3PUF A;  2FML A;  1HKQ A;  4YRV A;  1ZKG A;  3RJP A;  4XOP A;  2HDW A;  2NNN A;  2R7R A;  1FTZ A;  2ZBK A;  2Z9O A;  1T0F C;  1G3S A;  5E79 C;  3QPH A;  4PCQ A;  3KP7 A;  4ITV A;  2HQA A;  2AQF A;  2H8R A;  2PMZ N;  2CV0 A;  1T38 A;  4Y3O A;  1IO2 A;  2P6T A;  2NVX J;  4FX4 A;  4M72 A;  3J7A Y;  2QWW A;  4BY7 J;  2DI3 A;  4FT8 A;  3D0S A;  5F1R A;  2OPT A;  3K1M A;  1YS7 A;  1SVO A;  2O03 A;  3KEO A;  3OSG A;  4ZYE A;  3LA7 A;  1T98 A;  4CIC A;  2ISZ A;  5D5V B;  5M3F J;  1UG0 A;  5ICE A;  1BR2 A;  4C30 A;  5CJ9 A;  4AVZ A;  1ZQ3 P;  3CP8 A;  3GW2 A;  3LSG A;  2LD5 A;  1U8R A;  1K78 A;  3OIP A;  1ULY A;  3C2G A;  1ETW A;  5CLS A;  1RZ4 A;  4DZJ A;  3BLY A;  4BXF A;  3LA3 A;  1T56 A;  3H3U A;  1FIA A;  2VBX A;  1FOW A;  4BHB A;  3QU6 A;  3JRG A;  1TWG J;  3ML6 A;  1A6Q A;  1H8A C;  3A1Y A;  3CCR I;  1LUJ B;  5DDG A;  3KZY A;  3M1E A;  2L9N A;  1RR7 A;  3LWF A;  2AQE A;  4G6T B;  3J80 K;  3U1K A;  2R7T A;  3KCC A;  2P6S A;  3BPX A;  3F3X A;  1JT6 A;  2EQR A;  4IHY A;  5B1B H;  2ID3 A;  4Q48 A;  2WBM A;  4P55 A;  2IGM A;  5EGO A;  2FJ1 A;  1MGT A;  2WAQ N;  1MMD A;  2BW3 A;  2E2J J;  5D4R A;  1FBQ A;  3H9J A;  3ZQF A;  2X6X A;  1MJB A;  2K9L A;  3K1P A;  1MMA A;  1QGP A;  2O3F A;  1HC8 A;  2JMW A;  2VI6 A;  4OMZ A;  2LP0 A;  2I8D A;  3D1N I;  4NBQ A;  1MSE C;  3KP6 A;  5CQG A;  1OCC H;  2XAQ A;  3L00 A;  1V54 H;  2PN6 A;  2K86 A;  3FXO A;  2JZY A;  2QSH X;  4ZTJ A;  4XLF A;  2OCC H;  4L9J A;  3OS1 A;  4JX4 A;  3OWT A;  3GTK J;  4BBS J;  1JTX A;  4X0G A;  5J6X A;  1U5T C;  4YEJ A;  2FBH A;  1G2H A;  1R1V A;  3HSR A;  1IW7 F;  4ANJ A;  2YX7 A;  2X6Y A;  1SFX A;  5F04 A;  2ZXW H;  3CJR B;  2XRL A;  3ABL H;  1WH5 A;  5E3N A;  3I71 A;  4DIQ A;  1IAW A;  2HS5 A;  1OQY A;  2Y0M A;  3JRA A;  2E60 A;  4KYW A;  3SZG A;  5D8L B;  2DA3 A;  5CPR B;  3V4G A;  3DTE A;  1KGS A;  4WF2 A;  1X1D A;  4RGU A;  2BE5 F;  3IAM 2;  3BPV A;  2QBY A;  3SEQ A;  2J5P A;  4DNC A;  1BBY A;  3FMR A;  3IV5 A;  2GOM A;  3I58 A;  1D1A A;  1I39 A;  4BAC A;  1E17 A;  2D1V A;  3GF2 A;  4UXN A;  2LNB A;  2F48 A;  2FA5 A;  3E1S A;  1IN7 A;  1TTY A;  3HSF A;  1FMW A;  2F4O B;  5BOX A;  1EF4 A;  1W36 C;  4HDV A;  2IRF G;  4MTE A;  1VQO I;  4YFX F;  2VJ5 A;  2CUJ A;  1X2N A;  2R5Y A;  1OYW A;  1KU2 A;  1OKR A;  4I0A A;  4M73 A;  4G7H F;  5IP7 J;  3DTI A;  3PNY A;  4JQF A;  5FLX Z;  5J4Y A;  4HV5 A;  4E7H A;  5GP9 A;  2XF7 A;  1OMI A;  5H2F C;  3M8J A;  4HNV A;  3W6K B;  2HR3 A;  3KLN A;  1VF9 A;  1BIB A;  1XMX A;  1WHU A;  1BJA A;  4M3E A;  4UB6 C;  4C9Y A;  1U3E M;  1Z6R A;  2F5D A;  1I5Z A;  4KT5 C;  2GLO A;  3G3Z A;  4P9U A;  1J09 A;  3GX4 X;  2M0C A;  4BEH A;  4OWR B;  2E71 A;  2LDU A;  2F4M B;  2MLK A;  1JJ6 C;  1ON2 A;  2EIJ H;  4ZDP A;  1MDM A;  1K6Y A;  4UB8 C;  4RAY A;  3FWE A;  3ZMS A;  1FX7 A;  1Z05 A;  1BW5 A;  2MH2 A;  4RAG A;  3ZP5 A;  2RVC A;  4M6X A;  3E7L A;  5FGM A;  3A02 A;  5TIS C;  1SFK A;  2CG4 A;  2JN6 A;  5F64 A;  3J7Z I;  4G6D A;  1ORK A;  3ERM A;  3QOD A;  4BHP A;  3TOB A;  5ED4 A;  2PMZ A;  4E6K G;  3REO A;  3LSH A;  4NDL A;  1UG2 A;  4A12 A;  2M3A A;  5IY5 H;  1D5V A;  2NVY J;  4LGW A;  1UZC A;  4A3I J;  2R4G A;  3TQN A;  4CYC A;  1O57 A;  3EYI A;  2V1U A;  1PUF B;  2LRE A;  3SFZ A;  4D9J A;  2BV6 A;  4CZZ A;  1U5T A;  1K4T A;  3GEZ A;  3CF2 A;  5DTD A;  1HW2 A;  3V8K A;  1W7P D;  2EJR A;  4EGY A;  1USS A;  2COB A;  3HPG A;  3WHC A;  2LY2 A;  5J1U A;  3BJO A;  1NK2 P;  3ZGK A;  1KQ8 A;  3A01 B;  1OLT A;  2PFB A;  2MA3 A;  3C18 A;  2DDB A;  1OYI A;  3E6C C;  1H89 C;  2P5V A;  2YUS A;  3HXL A;  3TL4 X;  1TBX A;  5K7H A;  4XID A;  2XC7 A;  3K4K A;  2OTJ I;  3C3W A;  4IHV A;  4HOB A;  1UEL B;  2DMP A;  1JUS A;  3M4O J;  2HNH A;  2K9M A;  3BCA A;  3EUH A;  1DU0 A;  2L54 A;  5LLQ A;  4BYY A;  2RC4 A;  2HYF A;  3FXQ A;  4HNU A;  4KMU X;  2KFD A;  2L01 A;  5JR3 A;  1R71 A;  3K4C A;  3OR1 C;  2XGC A;  3VWB A;  1YQA A;  2ADU A;  3S1R J;  2L5Q A;  3KYD B;  2P4W A;  1R1U A;  3DQV C;  5DD8 A;  1KU7 A;  1S7A A;  3OOU A;  1AHD P;  3DCF A;  2NVQ J;  2VJI A;  1YJW I;  1Y56 A;  4FTH A;  4ON0 A;  2JRT A;  3HB9 A;  3HOU J;  4XON A;  3OL4 A;  3TO9 A;  1O3S A;  3ZN0 A;  1TWA J;  3GO5 A;  4XNF A;  1VFC A;  3K69 A;  3HL2 A;  2K02 A;  2RQQ A;  1TQI A;  3MMY B;  4X1E A;  1KU9 A;  2DA5 A;  1LJ9 A;  4XRM A;  1W5T A;  1P4X A;  1W5S A;  2ZNY A;  3TDZ C;  2LC2 A;  4LLG F;  2VAS A;  3UR3 C;  4F7Z A;  3KFW X;  1TQM A;  2EPF A;  2DT6 A;  5HDK A;  2YX4 A;  3LSR A;  5FJ8 J;  4E7J A;  1SD4 A;  2GIZ A;  3CCQ I;  1K61 A;  1SVL A;  2XPU A;  3A0H C;  4GFB A;  2G0E A;  4BXU A;  4IL6 C;  3DEU A;  5IP9 J;  4CUG A;  4J00 A;  2G7H A;  3FXM A;  3SZP A;  3RQ4 A;  2DPD A;  1GHC A;  2D2W A;  1WKM A;  1R49 A;  2HVS A;  3K9T A;  1R4N B;  3OYA A;  2ZKZ A;  3GZ6 A;  3H5A A;  4KIS A;  1Z7U A;  3VSK A;  4HPQ A;  2UXX A;  1SC7 A;  1W7P A;  3VYS B;  2R7Z J;  2FSW A;  3H36 A;  4PGG A;  4J19 A;  2F5C A;  3HOY J;  4O3M A;  4RGS A;  4GCV A;  1V5E A;  2G9W A;  4WXH A;  4UVC A;  1UJ8 A;  4A0X A;  3H92 A;  1MMS A;  3OYJ A;  2ISY A;  2NVU B;  3JRI A;  4OMY A;  4XLP F;  2HZT A;  4GXO A;  2W1O A;  3DPL C;  3I3L A;  3O8G A;  2Z1D A;  1TWF J;  1R9T J;  1ZGJ A;  2LKS A;  3G6E I;  5FLV A;  1EH7 A;  1E3P A;  3MQ0 A;  3W3C A;  2LY1 A;  1JKO C;  1VQM I;  3T5X A;  3DEE A;  2W00 A;  1FOY A;  4C2T A;  2ZB9 A;  3I54 A;  3BG5 A;  3I4N J;  3OS2 A;  4FCY A;  1ZK8 A;  2F5E A;  2O8K A;  1Z6T A;  2A6H F;  2VJJ A;  3CES A;  3KP4 A;  2H8W A;  2K9N A;  2XV4 S;  3R0A A;  3RTR A;  4ZTF A;  2M7B A;  4NQW B;  1Y8Q B;  2OBP A;  2FMY A;  1LE8 A;  2H27 A;  4RLF A;  3ZMZ A;  4HV6 A;  3OYM A;  3V8J A;  3J7A O;  2E1O A;  1XGN A;  3FMQ A;  4UY8 I;  1ZRC A;  2JK3 A;  3JRB A;  4KFC A;  2JA8 J;  1YOV B;  3SHF A;  2MYS A;  3ZQG A;  1ETX A;  4L5J A;  3W6V A;  1S7E A;  4NNJ A;  4B09 A;  1ETK A;  3QYB A;  3T1B A;  2JA2 A;  2CQK A;  3S2W A;  1ONV A;  1JE8 A;  4W1U A;  5EF6 A;  3U1D A;  2Y0S N;  2JTV A;  3OYK A;  1L0O C;  3L9F A;  2KZG A;  3RYP A;  1FPQ A;  5FD6 A;  2R7S A;  2CO5 A;  4U88 A;  2IS4 A;  4G8X A;  4W97 A;  2GXB A;  5JLX A;  4U0W A;  4NHJ A;  1VQ9 I;  3CDI A;  1LQ1 A;  4I98 B;  5E1X A;  1S72 I;  1ODD A;  3KP2 A;  1XN7 A;  3PO2 J;  1OCR H;  2F5V A;  2HOE A;  2ZXH A;  3R61 A;  1HDP A;  2L7F P;  2HU9 A;  1IDZ A;  1D8J A;  3P9C A;  1SAN A;  2XDV A;  3S3N A;  1VQL I;  3C7J A;  3F23 A;  1JUM A;  1XG1 A;  4F92 B;  2LSO A;  5DS9 A;  1BJZ A;  2DCE A;  2E1N A;  3CMM A;  4ASN A;  4B8X A;  3T8T A;  3ZQC A;  3WE2 A;  1UMQ A;  2PBI A;  3B6C A;  4F91 B;  4MO7 A;  2EV6 A;  5GAD J;  1TC3 C;  2DBB A;  3JSP A;  1MH3 A;  4N9I A;  5F1J A;  3PJR A;  1S3J A;  2ELH A;  4Y13 A;  2UUZ A;  3E3V A;  4PJL A;  4BE2 A;  3HDD A;  4IQJ A;  1WQ2 A;  1P92 A;  4G94 A;  2CV2 A;  3LST A;  1QNT A;  3I9V 2;  3WTT C;  5GAE J;  1ZHF A;  2BY2 A;  3I5U A;  3HRU A;  3ESW B;  3FKJ A;  2VKE A;  4AIK A;  1ZGW A;  4E7K A;  1H88 C;  1ZRD A;  5FFX A;  2Y48 A;  1ON1 A;  3IWF A;  4B3A A;  4E7Z A;  3M8F A;  1WH7 A;  1EJ9 A;  2A5W A;  1H9G A;  1E0E A;  1DPR A;  4NUB A;  2HPI A;  2H09 A;  3WGI A;  3HUG A;  5KK1 A;  1FBS A;  1ZG3 A;  3O3K A;  4MEY F;  2O61 A;  3KZI C;  4RGX A;  1FIP A;  2Y31 A;  5BS6 A;  3DU5 A;  3I59 A;  3GTL J;  1EV7 A;  1FSH A;  5E1Z B;  3JRH A;  3HSE A;  4H4K C;  3CCV I;  4DQ2 A;  2NVT J;  5H20 A;  3CC2 I;  1IN4 A;  3JR9 A;  3CME I;  3IL2 A;  1LNW A;  2CFX A;  4C3J J;  1MNE A;  3PSF A;  3A4C A;  2E35 A;  3WTS C;  4ESB A;  1GV5 A;  1O7F A;  1F43 A;  4DYC A;  3OIQ A;  3DTK A;  2FUG 2;  5EEH A;  4L0Y B;  2W25 A;  3BR6 A;  5D4S A;  5EJC A;  1I6X A;  1OR7 A;  4AYB N;  2X6O A;  4MFE A;  3F9K A;  3P9I A;  2BW3 B;  4ZZD A;  4FIS A;  3MZH A;  3GZ5 A;  1T39 A;  2K4B A;  2X6W A;  3LAP A;  1P4A A;  4N9H A;  1FP1 D;  3MWM A;  1TLH B;  1P6R A;  1SAU A;  3G1L A;  5JHF A;  1KZH A;  3HG9 A;  2L0K A;  2VE9 A;  5K5R A;  1OIS A;  1RET A;  3NAR A;  2VOD A;  4ENM A;  2XB5 A;  3SDB A;  2KRH A;  3CTA A;  2L9V A;  3IKT A;  2CUZ A;  2XKO A;  1XX5 A;  2W48 A;  5KNL A;  2GAU A;  2UXN A;  2V1N A;  4B43 A;  3DEW A;  5CKT A;  2M34 A;  2R5Y B;  2V9V A;  4MEX F;  2JPC A;  3F8C A;  4M6Y A;  5LHG A;  3JW4 A;  2ZJR F;  2ZME A;  1MJ9 A;  1SD6 A;  1YYV A;  3FK6 A;  4A3J J;  5J1Y A;  1VQ7 I;  3R4K A;  4CCN A;  2HOT A;  2VOP A;  1V55 H;  2JWT A;  3CUO A;  3P7N A;  2F2E A;  3H9Q A;  4I6Z A;  3RZO J;  1YIJ I;  2NS8 A;  4HW0 A;  3BG9 A;  1GT0 C;  1NK3 P;  1LVA A;  2WC2 A;  3FX3 A;  1YI2 I;  4HYE A;  3TGN A;  3ELK A;  4V19 K;  1R5H A;  1X4O A;  2M8E A;  1YFH A;  4IHT A;  2HQ5 A;  1W4M A;  2XPV A;  5CVJ A;  3GTG J;  1ZAO A;  3ZQ7 A;  4PSX A;  3WG7 H;  3HGY A;  2FXA A;  2W7N A;  1QBJ A;  3OY9 A;  3F8B A;  1QRY A;  2IGK A;  2XAU A;  3QOP A;  1IN5 A;  3CJQ B;  2DU9 A;  4AU7 A;  3BT9 A;  2XRN A;  4ZDL A;  3CD6 I;  4D0P A;  4UUS A;  1XTA A;  3UKG A;  2DTZ A;  3LSM A;  3LA2 A;  2Z16 A;  3ONQ A;  5FKM A;  4OU0 A;  4AD9 A;  3OYC A;  2M87 A;  2NOJ B;  2B9S A;  5E20 A;  4D5C A;  3M8E A;  2XVC A;  4AM3 A;  4ZDO A; 
#chains in the Genus database with same CATH homology
 2FBK A;  4BHC A;  2Z3Y A;  3LQQ A;  4P96 A;  1P2F A;  4UVB A;  1SAX A;  4FHT A;  3ABU A;  2VN2 A;  5D8K B;  3FXR A;  2HKX A;  2GZW A;  2GIV A;  1XSD A;  2ZFW A;  3BWG A;  2W57 A;  1FZP B;  1Z1D A;  3ZMT A;  1WSU A;  2XAJ A;  1FNN A;  1QPM A;  2QQB A;  3Q9S A;  4O6J A;  3KP5 A;  2KKO A;  1BI3 A;  5LGU A;  4CYD A;  4YG2 F;  3BP8 A;  1S7O A;  4A2U A;  2R7D A;  3FM3 A;  1Y0U A;  4RS8 A;  4WWC A;  4HX4 A;  4HF1 A;  1SFU A;  5AIP A;  5IT3 A;  2C6Y A;  5D5U B;  2HQR A;  2PI0 A;  1MKM A;  4CGZ A;  3I0T A;  3V7R A;  5HLH A;  5DCF A;  2BBY A;  4LG0 B;  2FNP A;  5A2Q K;  1ZG1 A;  5HS7 A;  2CW0 F;  1GXQ A;  5DUI A;  2BYV E;  5HLI A;  5L3B A;  5H6Q A;  1TW2 A;  3Q5F A;  1KQ0 A;  3TDU C;  1ZH5 A;  3BJA A;  3DKW A;  1RNL A;  2DK8 A;  1F1Z A;  1H0M A;  2OQG A;  3R60 A;  3O2P E;  3U2R A;  2MC3 A;  2GXG A;  1DP7 P;  4IRG A;  4L0Z B;  2JPB A;  5ILU A;  4UVA A;  1U5T B;  1IRF A;  1G3Y A;  1S29 A;  4IJA A;  1RUO A;  1QZY A;  1HKS A;  3K1N A;  3DP7 A;  1YIO A;  4RB3 C;  1HSJ A;  2STW A;  3PQJ A;  1XB4 A;  1NHA A;  3L09 A;  3WTU C;  3EYY A;  3DFG A;  2YU3 A;  3F8N A;  1HKT A;  4XRF A;  2DK5 A;  1DPU A;  4H0E A;  1MDM B;  1IUY A;  4CXF A;  3KZZ A;  5CVU A;  4GGG A;  2QUF A;  4MGR A;  5J8F A;  3T8R A;  1J75 A;  4XSX F;  3J80 Z;  4L9N A;  5ICG A;  3GUD A;  3RIR A;  3VOD A;  1PP7 U;  4CDG A;  3OV8 A;  2EA2 A;  5LGT A;  2DQL A;  2P8T A;  2K7L A;  3IKV A;  2HTS A;  1B6A A;  5DCM B;  1OYY A;  1UHM A;  3RPQ A;  5TJJ A;  2QYO A;  1XCV A;  2DFI A;  1G4D A;  3LQR A;  4EJV A;  2VT3 A;  4NQW A;  4XLN F;  2IT0 A;  3JSO A;  4WCG A;  2VOO A;  1HBX G;  4EM1 A;  2DW4 A;  3K2Z A;  1FYK A;  3C1D A;  2ACJ A;  4WK8 F;  2EFO A;  1TNT A;  2VC0 A;  4IVN A;  1ZRE A;  2HYG D;  5E1W A;  4HF2 A;  2D1H A;  2L4A A;  4A5N A;  2Q2E A;  1GVJ A;  2IP2 A;  1JXS A;  1LDK B;  4MHG A;  4P9F A;  3LAJ A;  4ESF A;  4ENJ A;  5AON A;  3SZT A;  1UHW A;  5FO5 A;  3IHU A;  2O0Y A;  3F6V A;  2PLY A;  2A5Y B;  2KIF A;  5EEG A;  4G7Z F;  4WXC A;  4FX0 A;  2ZO4 A;  5LHH A;  3E97 A;  3QU3 A;  5LRR A;  1K79 A;  2DO7 A;  2RV8 A;  3ECO A;  3GWZ A;  3VEP A;  4EM0 B;  5E18 F;  3ZN1 A;  5DV5 A;  4MNU A;  3N4M A;  1FSE A;  2EV0 A;  2PJP A;  2CGP A;  3MFK A;  2GQQ A;  5HS9 A;  3E6M A;  4KUM A;  4E70 A;  1XD7 A;  2HFH A;  1JGS A;  1BM9 A;  2QVO A;  1R1T A;  3BDD A;  1IRG A;  4A6D A;  4IPA A;  3GLX A;  1AOY A;  1BI0 A;  2K27 A;  3M7G A;  1ZN2 A;  2P7V B;  3CUQ A;  4LK0 F;  3DV8 A;  5L3E A;  3ERE D;  4OIR F;  2M45 A;  4M9X A;  3TO7 A;  4GYG A;  3BY6 A;  2EK5 A;  3GFJ A;  1XGO A;  3QP6 A;  2DTR A;  1KYZ A;  4TV7 A;  1CF7 A;  4KIF A;  1YLF A;  3RKY A;  1RUN A;  1CF7 B;  3GFM A;  1KQ9 A;  1W7P B;  4G6Q A;  1Z91 A;  4WXD A;  1RI7 A;  2E7W A;  2R3S A;  3IRQ A;  5HDG A;  2PMH A;  3WE3 A;  1SD7 A;  1TNS A;  3F6O A;  4HLY A;  2DQR A;  2ZXJ A;  1FLI A;  4U0Y A;  3ECH A;  2Z33 A;  3FMS A;  2Y75 A;  3RYR A;  2A07 F;  4A0Y A;  5IT9 Z;  4ETS A;  1XMK A;  1R00 A;  4GYI A;  1V3F A;  2E7X A;  3CUQ C;  1FYM A;  1U78 A;  3R0J A;  2G7U A;  1YW9 A;  4Q5S F;  2ZNZ A;  2QQA A;  2XAG A;  3F22 A;  3PFI A;  3GVA A;  3WU0 A;  1C0W A;  2IA2 A;  2KIU A;  1DUX C;  3TKY A;  2B0L A;  1SFE A;  3WOD F;  1XGS A;  2JSC A;  4YIF A;  3T0Y A;  1CGP A;  2QLZ A;  3TO6 A;  3GYH X;  4EVI A;  2COM A;  2K4J A;  3JTH A;  4U7B A;  3ZPL A;  2IA1 A;  1IF1 A;  1LEB A;  1K7A A;  5HLG A;  2RQP A;  1EH8 A;  2WWY A;  2FRH A;  1PUE E;  4OIN F;  2XGX A;  4JBA A;  1TQP A;  4AVP A;  2QM3 A;  1ZLK A;  2VON A;  3TOA A;  2M1B A;  5K5Q A;  4I2O A;  3NQO A;  3H3Z A;  2X4H A;  5DCM A;  4RAZ A;  1V4R A;  2A68 F;  3F8M A;  3HRT A;  2QQ9 A;  4A6E A;  4XSZ F;  4A0Z A;  2XAF A;  5JHU A;  1BIA A;  1I1S A;  2CYY A;  5D6F A;  2Z99 A;  2VBZ A;  1LDD A;  3ZMD A;  5LEJ A;  3KEQ A;  2ZCW A;  2IVM A;  1BC7 C;  1IN6 A;  5LRS A;  5ERI A;  4EM2 A;  2A3S A;  4S04 A;  3P9K A;  2KRF A;  2FF4 A;  4Q4Z F;  4HAM A;  1O3T A;  2ZJ2 A;  3KP3 A;  3CO6 C;  2R7F A;  4I02 A;  2UWM A;  4IRI A;  5IT9 K;  4KN4 X;  4L5I A;  4YFN F;  3WGH A;  3GXO A;  3V7S A;  2EB7 A;  2DT5 A;  1PDN C;  2RKH A;  3RKW A;  3EDP A;  5HS8 A;  2L4M A;  1XSX A;  1U6G A;  4IRH A;  2EFP A;  1O7L A;  3RI4 A;  2O8X A;  4KIB A;  2A69 F;  4LLL A;  2IJL A;  4R1H A;  3R6S A;  1E2X A;  4PZJ A;  4OIQ F;  3KE2 A;  3FXU A;  2V1X A;  1SD5 A;  5ILV A;  4EV0 A;  1XDS A;  2STT A;  4BNC A;  5CVI A;  4Y17 A;  4LJZ F;  1XDU A;  4HQM A;  4A5M A;  5DEQ A;  1FOK A;  2HEO A;  5BQT A;  4ZH4 F;  3F8F A;  3NRV A;  4RB0 A;  3VB2 A;  2KJC A;  4EGZ A;  1WWX A;  2MH9 A;  5HOO A;  4UV8 A;  2P7C B;  2NNY A;  3E6B A;  3JTG A;  2W24 A;  4MQ9 F;  2FBI A;  1BI1 A;  5DYM A;  4KIG A;  3EQL F;  3QRF F;  4KMF A;  5LGN A;  4UV9 A;  2OZU A;  1Q1H A;  3HYI A;  1MD0 A;  5F6F A;  2OD5 A;  1YW7 A;  4OOI A;  3O6B B;  1YW8 A;  3BJ6 A;  4JK1 X;  4HZF A;  1JHF A;  4I7H A;  4LD5 A;  1KU3 A;  3B73 A;  3OOP A;  5BPI A;  2A6E F;  5J8C A;  4KN7 X;  2CSO A;  1MJA A;  1S8N A;  2VBW A;  5LHI A;  1BN5 A;  1FYL A;  3WTX C;  4HBL A;  1LDJ A;  3E6D A;  3KLO A;  3V7C A;  1D8K A;  2FOK A;  2GA1 A;  2IA0 A;  1R22 A;  2XAH A;  1S6L A;  2NYX A;  4XBF A;  2DLL A;  2FNA A;  2PEX A;  2QBY B;  3QAH A;  5D5W B;  2W85 A;  3DPT A;  3U9G A;  3BOQ A;  2IW5 A;  5FB2 A;  4M71 A;  5DD4 A;  2YPR A;  2XRO A;  6PAX A;  2Z5U A;  1HW5 A;  2VC1 A;  2D45 A;  3MEX A;  1G3T A;  4HA8 A;  2RGV A;  1XGM A;  3E5X A;  2OU2 A;  2X0L A;  4K2E A;  1AWC A;  2P5K A;  2EFQ A;  3IRR A;  1F4K A;  5FFZ A;  4HQE A;  5K1Y A;  1STZ A;  4IF4 A;  4OIP F;  2FEZ A;  3E5Q A;  4ZYG A;  4I0B A;  3I64 A;  2XUB A;  4CHU A;  1I1G A;  4ENK A;  3WG9 A;  1TW3 A;  4QLC U;  3HOT A;  1O3R A;  1IZ1 A;  1I27 A;  1LB2 A;  1QZZ A;  2F5F A;  4LB6 B;  3V8L A;  4PDK A;  5CVV A;  1YO5 C;  1HW1 A;  1UST A;  1ZGA A;  2ZME B;  1BC8 C;  1R7J A;  3M9A A;  5L3G A;  4HLX A;  1XSV A;  2M30 A;  1U2W A;  2BEO A;  1XMA A;  1FBU A;  5JFR A;  1J5Y A;  1B59 A;  2H6C A;  1MZB A;  2PG4 A;  1KYW A;  5FLX K;  3RDI A;  1D3Y A;  1IXR C;  1XCB A;  4RGR A;  3HOS A;  4LB5 A;  5ILS A;  1J7K A;  5HDN A;  1FC3 A;  1OPC A;  4UHT A;  3NEU A;  1T6S A;  5CYV A;  4AWX B;  1F5T A;  4RB1 A;  4Q47 A;  5HVQ C;  4LG0 A;  3WTV C;  2P5L C;  1DDN A;  3SQN A;  5BMZ A;  4I09 A;  2L3D A;  3G73 A;  2LKP A;  4RB2 C;  2VT2 A;  3FZV A;  5L3C A;  2XHK A;  3CLO A;  2IPQ X;  2EA4 A;  4EJW A;  3CUQ B;  2VE8 A;  2GA2 A;  2RNJ A;  2ESH A;  4MTD A;  1Z9C A;  4LK1 F;  5AIQ A;  3HHG A;  2QEN A;  2OAZ A;  1EH6 A;  1GXP A;  3RPU A;  4HX7 A;  5JI6 A;  4LLN A;  3MCZ A;  1B1B A;  1YG2 A;  1QQI A;  5L3F A;  4R79 A;  4G9Y A;  1RIO H;  2EV5 A;  3HRS A;  4ZZL A;  5DUK A;  1FT9 A;  3K0L A;  1R5G A;  4PGH A;  4EJO A;  2L02 A;  1HST A;  4Y15 A;  3E5U A;  3AAF A;  4I01 A;  3BZ6 A;  4GO1 A;  5H6R A;  5LEK A;  4G7O F;  3EET A;  1T2K A;  1J0R A;  3J81 K;  4KNY A;  3CO7 C;  2BGC A;  2EFN A;  1BI2 A;  1J9I A;  4OIO F;  2WV0 A;  1YTY A;  3ROU A;  1HQC A;  2HQN A;  5KVR A;  1R58 A;  3I4P A;  2FE3 A;  2V1D A;  4LFU A;  3WTY C;  4ZYD A;  2DPU A;  1K78 B;  5D5X B;  2KIM A;  3SXY A;  3WTZ A;  1ZLJ A;  2CWE A;  5ICC A;  2XAS A;  2PQ8 A;  4UNO A;  5A2Q Z;  2OQR A;  4NB5 A;  3QPT A;  5CVR A;  3ISP A;  1SMY F;  2H6B A;  3JAM Z;  2NRA C;  3VOE A;  4HF0 A;  2MD5 A;  4WX9 A;  3IWZ A;  2XKP A;  2RDP A;  2EWN A;  4EQQ A;  3HTS B;  3HHH A;  3ULQ B;  4KDP A;  2YR2 A;  4BH9 A;  1VTN C;  4L9T A;  3Q9V A;  1P4W A;  2EFW A;  2O6G E;  4M9S A;  4M9Z A;  2YSR A;  1PP8 F;  1WRJ A;  1B9N A;  1J59 A;  1F9N A;  5TRD A;  1B4A A;  4U7D A;  3L7W A;  3MZY A;  4Z2Y A;  4EJT A;  1X3U A;  2FU4 A;  2HDC A;  2V6C A;  3HTU A;  3ZMU A;  2MLG A;  3I53 A;  2RN7 A;  2DAO A;  4O5V A;  2ESN A;  3WGG A;  2PMU A;  3CDH A;  2Q8K A;  2H94 A;  5ICF A;  1UCR A;  4CO8 A;  1JHH A;  1K6O A;  1H9T A;  1G3W A;  4HDU A;  4ESJ A;  2HTJ A;  2WTE A;  3ZMV A;  3B02 A;  1REP C;  2AS5 F;  4MQV A;  3GFI A;  2A61 A;  2HWV A;  5E8G A;  3FF5 A;  2HKO A;  2JT1 A;  3LFK A;  3I59 B;  5K5O A;  1IXC A;  1QO0 D;  1UB9 A;  4LMY A;  3J81 Z;  4QWQ A;  2AXL A;  3FHZ A;  1WI9 A;  5BPD A;  3FM5 A;  1A04 A;  1IN8 A;  1ZRF A;  4IHS A;  3W6J B;  2FQ3 A;  1R23 A;  1UFM A;  3DF8 A;  4ZYH A;  4KIC A;  1L3L A;  3KET A;  1FWZ A;  2QZ8 A;  4S05 A;  3WU1 B;  5E17 F;  1ZAR A;  4L9V A;  2E1C A;  4EMS A;  2OA4 A;  2UZK A;  3ABT A;  4ENN A;  2VBY A;  2W84 A;  4BQA A;  3VFZ A;  4IXA A;  4BAY A;  3F72 A;  3RKX A;  3COA C;  2M5W A;  5LBQ A;  4U0V A;  2KJB A;  3HIF A;  3QP5 A;  3DXJ F;  3PQK A;  3GFL A;  1ZYR F;  3IC7 A;  4KA4 A;  2J5O A;  4L18 B;  1HXD A;  2Q0O A;  2GWR A;  3D5L A;  2NAZ A;  2ETH A;  5L3D A;  1G6N A;  4AIJ A;  1LEA A;  1T0F A;  2V79 A;  1BOA A;  2MBF A;  1KA8 A;  5JVT A;  2OZ6 A;  2LF7 A;  4M74 A;  4HX8 A;  2NS0 A;  5D6E A;  5E8I A;  3WTW C;  4R8H A;  1FP2 A;  2XIG A;  1R36 A;  3HRM A;  3JAM K;  1ZG5 A;  1SMT A;  1YS6 A;  1O3Q A;  3L2C A;  3N97 A;  4N0B A;  4P5O A;  2HGC A;  1B9M A;  3CJN A;  2LF8 A;  1J2X A;  4UUV A;  2TDX A;  3BRO A;  5FD5 A;  4YFK F;  4EJU A;  1FY7 A;  3F21 A;  4YII A;  3MAJ A;  4AIH A;  1IXS B;  2VXZ A;  2FML A;  1HKQ A;  3RJP A;  2NNN A;  2ZBK A;  2Z9O A;  1G3S A;  3QPH A;  4PCQ A;  3KP7 A;  1T38 A;  2P6T A;  4FX4 A;  4M72 A;  2QWW A;  2DI3 A;  4FT8 A;  3D0S A;  5F1R A;  3K1M A;  1YS7 A;  2O03 A;  3KEO A;  4ZYE A;  3LA7 A;  1T98 A;  4CIC A;  2ISZ A;  5D5V B;  5ICE A;  5CJ9 A;  3GW2 A;  1U8R A;  1K78 A;  1ULY A;  5CLS A;  1RZ4 A;  3LA3 A;  4BHB A;  2VBX A;  3H3U A;  3QU6 A;  3ML6 A;  5DDG A;  3KZY A;  3M1E A;  3LWF A;  3J80 K;  3KCC A;  2P6S A;  3BPX A;  3F3X A;  4Q48 A;  4P55 A;  1MGT A;  5D4R A;  1FBQ A;  1MJB A;  3K1P A;  1QGP A;  2O3F A;  4OMZ A;  3KP6 A;  2XAQ A;  3L00 A;  2PN6 A;  2K86 A;  2JZY A;  4L9J A;  5J6X A;  1U5T C;  2FBH A;  1R1V A;  3HSR A;  1IW7 F;  2YX7 A;  1SFX A;  3I71 A;  1IAW A;  2HS5 A;  2Y0M A;  4KYW A;  5D8L B;  3V4G A;  4WF2 A;  1KGS A;  4RGU A;  2BE5 F;  2QBY A;  3BPV A;  2J5P A;  4DNC A;  1BBY A;  3FMR A;  3I58 A;  1E17 A;  2D1V A;  3GF2 A;  4UXN A;  2LNB A;  2FA5 A;  1IN7 A;  1TTY A;  3HSF A;  5BOX A;  4HDV A;  2IRF G;  4MTE A;  4YFX F;  1OYW A;  1KU2 A;  1OKR A;  4I0A A;  4M73 A;  4G7H F;  4JQF A;  5FLX Z;  4HV5 A;  1OMI A;  3W6K B;  2HR3 A;  3KLN A;  1BIB A;  1U3E M;  1BJA A;  1Z6R A;  2F5D A;  1I5Z A;  4KT5 C;  3G3Z A;  4P9U A;  3GX4 X;  2LDU A;  2MLK A;  1ON2 A;  1MDM A;  4RAY A;  3FWE A;  3ZMS A;  1FX7 A;  1Z05 A;  2MH2 A;  3ZP5 A;  2RVC A;  4M6X A;  5FGM A;  5F64 A;  2CG4 A;  4G6D A;  4BHP A;  3TOB A;  5ED4 A;  3REO A;  4A12 A;  1D5V A;  4LGW A;  3TQN A;  1O57 A;  3EYI A;  2V1U A;  3SFZ A;  2BV6 A;  4CZZ A;  1U5T A;  3GEZ A;  1HW2 A;  3V8K A;  1W7P D;  2EJR A;  4EGY A;  1USS A;  3BJO A;  1KQ8 A;  2PFB A;  2MA3 A;  3C18 A;  1OYI A;  3E6C C;  2P5V A;  1TBX A;  3C3W A;  4HOB A;  3EUH A;  2L54 A;  5LLQ A;  4BYY A;  2RC4 A;  2HYF A;  3FXQ A;  4KMU X;  2L01 A;  5JR3 A;  1YQA A;  2ADU A;  2P4W A;  1R1U A;  3DQV C;  5DD8 A;  1KU7 A;  1S7A A;  4ON0 A;  2JRT A;  3TO9 A;  1O3S A;  3ZN0 A;  3GO5 A;  3K69 A;  2K02 A;  1TQI A;  1KU9 A;  1LJ9 A;  1W5T A;  1P4X A;  1W5S A;  2ZNY A;  3TDZ C;  4LLG F;  4F7Z A;  3KFW X;  1TQM A;  5HDK A;  2YX4 A;  1SD4 A;  4BXU A;  3DEU A;  2G7H A;  3SZP A;  2DPD A;  1GHC A;  2D2W A;  1WKM A;  3K9T A;  2ZKZ A;  3GZ6 A;  1Z7U A;  2UXX A;  1W7P A;  2FSW A;  4PGG A;  2F5C A;  4O3M A;  4RGS A;  4GCV A;  2G9W A;  4WXH A;  4UVC A;  4A0X A;  3H92 A;  2ISY A;  4OMY A;  4XLP F;  2HZT A;  4GXO A;  3DPL C;  1ZGJ A;  1EH7 A;  3MQ0 A;  3T5X A;  3I54 A;  2F5E A;  1Z6T A;  2A6H F;  3RTR A;  3KP4 A;  2XV4 S;  3R0A A;  2OBP A;  2FMY A;  2H27 A;  3ZMZ A;  4HV6 A;  3V8J A;  3J7A O;  1XGN A;  3FMQ A;  1ZRC A;  4KFC A;  3SHF A;  4L5J A;  4B09 A;  3T1B A;  2CQK A;  3S2W A;  1ONV A;  1JE8 A;  3U1D A;  2JTV A;  1L0O C;  3L9F A;  3RYP A;  1FPQ A;  5FD6 A;  2CO5 A;  4U88 A;  4G8X A;  2GXB A;  4U0W A;  4NHJ A;  1LQ1 A;  4I98 B;  5E1X A;  1ODD A;  3KP2 A;  1XN7 A;  2HOE A;  3R61 A;  1D8J A;  3P9C A;  3C7J A;  3F23 A;  2LSO A;  2E1N A;  4B8X A;  4ASN A;  3T8T A;  3WE2 A;  2PBI A;  2EV6 A;  2DBB A;  3JSP A;  4N9I A;  1S3J A;  2ELH A;  4Y13 A;  3E3V A;  1WQ2 A;  1P92 A;  4G94 A;  3LST A;  1QNT A;  3WTT C;  1ZHF A;  3I5U A;  3HRU A;  4AIK A;  1ZRD A;  5FFX A;  2Y48 A;  1ON1 A;  3IWF A;  3M8F A;  1H9G A;  1DPR A;  2H09 A;  3WGI A;  3HUG A;  5KK1 A;  1FBS A;  1ZG3 A;  3O3K A;  4MEY F;  2O61 A;  4RGX A;  5BS6 A;  3I59 A;  1EV7 A;  1FSH A;  5E1Z B;  3HSE A;  4DQ2 A;  5H20 A;  1IN4 A;  3IL2 A;  1LNW A;  2CFX A;  3WTS C;  4ESB A;  1O7F A;  4L0Y B;  5EEH A;  2W25 A;  5D4S A;  1I6X A;  1OR7 A;  3P9I A;  4ZZD A;  3MZH A;  3GZ5 A;  1T39 A;  2K4B A;  3LAP A;  1P4A A;  4N9H A;  1FP1 D;  3MWM A;  1TLH B;  1P6R A;  2VE9 A;  5K5R A;  2VOD A;  4ENM A;  3CTA A;  3IKT A;  2XKO A;  2GAU A;  2UXN A;  4MEX F;  2V9V A;  2JPC A;  3F8C A;  4M6Y A;  5LHG A;  3JW4 A;  2ZME A;  1MJ9 A;  1SD6 A;  1YYV A;  3R4K A;  2VOP A;  3CUO A;  3P7N A;  2F2E A;  4HW0 A;  1LVA A;  2WC2 A;  3FX3 A;  4HYE A;  3TGN A;  3ELK A;  1R5H A;  2M8E A;  1YFH A;  4IHT A;  1W4M A;  5CVJ A;  1ZAO A;  3ZQ7 A;  2FXA A;  1QBJ A;  3F8B A;  3QOP A;  1IN5 A;  2DU9 A;  2XRN A;  4D0P A;  3LA2 A;  4AD9 A;  4OU0 A;  2M87 A;  5E20 A;  3M8E A;  2XVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...