3F6OA

Crystal structure of arsr family transcriptional regulator, rha00566
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
MAQYPEQLNGIFQALADPTRRAVLGRLSRGPATVSELAKPFDMALPSFMKHIHFLEDSGWIRTHKQGRVRTCAIEKEPFTAVEAWLAEQQELWESRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable transcriptional regulator, ArsR family protein
publication title Crystal structure of ArsR family transcriptional regulator, RHA00566
rcsb
source organism Rhodococcus sp. rha1
molecule tags Transcription regulator
total genus 30
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12840 HTH_20 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f6oA00
2P8TA 3R0AA 4HYEA 4KYWA 1J5YA 3TO7A 3RPUA 3VODA 1QNTA 3D0SA 4GXOA 4EJUA 4PDKA 1G4DA 2ZJ2A 2W57A 1IF1A 4RB2C 3TDZC 3GXOA 4ESBA 3ZMDA 3F8MA 2FMYA 3LA7A 1FZPB 2M1BA 4CO8A 3I59B 5JI6A 4NB5A 2IPQX 3F8FA 2WC2A 1QQIA 3MEXA 3TO9A 3F21A 4ZH4F 1K78B 1TQMA 4KDPA 5HLGA 3R6SA 5D4SA 2XROA 2Z33A 3FM5A 2RGVA 4RAYA 5FLXZ 1K79A 4M71A 1MZBA 1YO5C 2HQNA 3WTYC 1MD0A 1HW2A 2VOPA 3CO7C 3DEUA 1O7LA 1X3UA 4RGSA 1ZH5A 1FT9A 4WX9A 2M8EA 3L00A 5A2QK 1MJAA 3EYIA 1TLHB 1QO0D 1PDNC 3HIFA 5K1YA 2BE5F 4HX4A 2QQ9A 4U0WA 3IC7A 4EJVA 1O3RA 2WV0A 1XDUA 5F6FA 2Q0OA 3GX4X 5CVIA 4ASNA 1HW1A 1LEBA 1HW5A 4DQ2A 4A5NA 3GZ6A 2DK8A 5D5UB 3ULQB 1WQ2A 3T0YA 1FWZA 1T38A 4GYGA 1DUXC 2L01A 4WK8F 2LDUA 3HHHA 2XAHA 5CYVA 1B4AA 2DQLA 2FNAA 1VTNC 5DEQA 2P4WA 3M8EA 3JSPA 3BPXA 2RV8A 2FBIA 2MBFA 1IN5A 1YW8A 2D2WA 5EEGA 1REPC 1YW7A 2PJPA 3LA3A 4G6QA 2M45A 3Q5FA 2DPDA 1MDMB 2H6BA 4XBFA 1ZN2A 2ELHA 3R0JA 1T6SA 4KIFA 4Q48A 3C7JA 2FEZA 4LK0F 4AVPA 1TBXA 5D6EA 1B59A 4FHTA 2VBYA 1G3WA 3R4KA 4HW0A 1R00A 3O2PE 1LVAA 1E2XA 2IP2A 4OIQF 2NRAC 3FM3A 3E5XA 4WXHA 4MTDA 2OZ6A 1S8NA 1T2KA 1S6LA 2VBZA 3REOA 1KU7A 3KETA 1B9NA 3F8BA 2PMHA 3B73A 3RIRA 2HKOA 3OOPA 2FQ3A 1KU3A 2L3DA 3T1BA 4EJWA 4QLCU 1FP2A 3HRMA 2P5VA 4IVNA 1Z9CA 1FOKA 5J6XA 1O57A 4TV7A 4I7HA 1P6RA 3NRVA 1TW3A 2M30A 2PEXA 5H20A 2OQRA 1ZLKA 5D6FA 1EH6A 4MEYF 5HDGA 4YG2F 4L9JA 1SAXA 1S29A 4RB0A 4S04A 3M8FA 1IRGA 1IN7A 1WI9A 5L3CA 2NYXA 4I2OA 1U5TC 1BOAA 3BY6A 1J0RA 3HOTA 4R79A 3ML6A 1IXRC 4RS8A 4I01A 3WGGA 4MEXF 4UHTA 4Y15A 1ZRDA 1OYYA 3CUQC 1R1TA 1LNWA 3HSEA 4BHCA 5E1WA 1STZA 2O61A 5CVUA 2VT3A 1IW7F 3HTUA 4HV5A 1EH8A 4LMYA 3DPLC 5HDKA 3T8RA 4I98B 5IT3A 1WSUA 4ZYGA 1J2XA 4KICA 2EK5A 5LEKA 2HEOA 1U2WA 3GUDA 2CSOA 3ZMTA 5D5WB 2ZXJA 3TOBA 3TGNA 3FMRA 4IRHA 1L0OC 3H3UA 2VONA 1IN6A 2A5YB 4KMFA 2R3SA 5CVJA 4XLNF 4ESJA 3QRFF 1ZYRF 3K1PA 3V7CA 3U1DA 3R61A 2STTA 3SHFA 3BWGA 1UHMA 2QQBA 3MZHA 1LDKB 2E1CA 1Z91A 3MAJA 2E7WA 5DV5A 1BI1A 4CGZA 1QZYA 4LJZF 4WWCA 1OKRA 3VEPA 2QENA 3E97A 3KEQA 2EV0A 3FHZA 1DDNA 2HTSA 1BIAA 1D3YA 1YLFA 4CYDA 3L2CA 4JQFA 3I4PA 1MJBA 5LGNA 3JAMK 4EJTA 3L9FA 1XCVA 5HS8A 2EFWA 4EGZA 4G8XA 4U7DA 3JTGA 1DPUA 3KCCA 1YYVA 3QP6A 4L9TA 1HSJA 2JT1A 2BYVE 2EFOA 2FRHA 2JPBA 4HF1A 2W85A 2YPRA 4YFNF 1DPRA 2Z5UA 5E17F 3LAJA 4ENMA 2QBYA 3LA2A 1W7PA 4M73A 3KFWX 2CG4A 4LB5A 3K9TA 5F1RA 2CQKA 4A0XA 5HS9A 1P4WA 1T98A 2TDXA 3VOEA 3M1EA 4KN4X 4LLLA 3EETA 2L4AA 3F6VA 4EMSA 4L0YB 1ZG1A 2GA1A 2P7VB 3WTWC 2IA0A 5ICCA 3M7GA 5AIPA 1FLIA 3JW4A 4L0ZB 3K69A 2MLKA 5F64A 3HHGA 2VBXA 1BI0A 2V79A 4M74A 2H27A 4A0YA 3CLOA 3WTTC 3J80K 2L54A 2Z99A 2IJLA 3RYPA 4O6JA 5FD5A 3GYHX 4BAYA 3KP7A 5LRRA 5L3GA 1BC8C 1TQPA 3I59A 1HKQA 4M9SA 1UFMA 2MH9A 4GO1A 2A3SA 4AWXB 1SD7A 2XAJA 5K5QA 4H0EA 1K78A 3FZVA 2FA5A 4HDVA 3KZZA 4LG0B 1KU2A 2KIUA 3IL2A 4Y17A 2EV5A 3KLOA 4HQMA 3RYRA 3H92A 2RDPA 2RQPA 3DP7A 3IRRA 2K27A 2STWA 2QVOA 3HSRA 3GO5A 3J81K 2FXAA 1W7PD 4EM0B 4GYIA 5HVQC 2HQRA 1TTYA 2DK5A 4HV6A 2HZTA 4PZJA 3KZYA 4F7ZA 2QUFA 4UNOA 4BHBA 4E70A 1FBUA 2CGPA 1AOYA 2KRFA 4G7OF 1USSA 1RUNA 1A04A 1XB4A 1ONVA 1S7AA 4P55A 1K7AA 5DCFA 3TO6A 4KIGA 4OIRF 2OU2A 3F72A 3IWZA 4AIKA 2HWVA 3GFIA 5D8LB 1BN5A 5TJJA 1EH7A 3GWZA 3ZMVA 2DW4A 1GVJA 1IRFA 5D8KB 3FXQA 3TDUC 1WRJA 2FMLA 3F6OA 2D1VA 4O5VA 4EM1A 2VBWA 3DXJF 5L3EA 4L9NA 1ZAOA 4ENNA 3CO6C 1U5TB 4LD5A 3GW2A 2DI3A 3GF2A 2YR2A 4BNCA 3U9GA 3TKYA 4G7ZF 3ZN1A 2XIGA 4IXAA 4A12A 3F8CA 5ILSA 2IT0A 4BHPA 2GXBA 3CUQB 3FMSA 3PQKA 2G7HA 4RB3C 1MDMA 3LAPA 1IXCA 5ICEA 1OMIA 1BI3A 3DV8A 3QPHA 3FX3A 5FLXK 4R1HA 4O3MA 2PMUA 3KP2A 3WGHA 1WKMA 3GZ5A 2LNBA 1FY7A 4CDGA 5D5XB 2GQQA 1XGOA 5HLIA 1F9NA 1MGTA 4HLYA 3IKTA 4LK1F 3ELKA 4CXFA 3FMQA 4A2UA 5ILUA 1FBSA 5HOOA 3ISPA 1ON2A 1ZREA 4OU0A 5CJ9A 3SZTA 3DPTA 2Y75A 3W6JB 3E5QA 3LFKA 4IRGA 1OPCA 3ZMUA 3E6BA 4IHTA 1BI2A 4YFXF 5JFRA 2J5OA 2VC0A 3WU1B 1YW9A 4I0BA 5LHHA 5FO5A 2M5WA 2R7DA 3V8KA 2A69F 1FP1D 1YG2A 2HTJA 3C3WA 1P2FA 3EDPA 2QWWA 1FBQA 3IRQA 4AD9A 3V4GA 3MFKA 3BJOA 3RKYA 2ZO4A 3L7WA 3QAHA 3P7NA 1ZARA 4M6XA 2HYGD 5DCMB 2ZNYA 3I5UA 4RGUA 5DD4A 5CVVA 2DTRA 4HDUA 4RGRA 2FU4A 2VXZA 1RI7A 3ZMZA 2J5PA 1S7OA 4EQQA 3T8TA 2F5CA 4L18B 3BP8A 5E18F 1LDJA 1BJAA 3DKWA 2EV6A 4LGWA 3RKXA 3QOPA 1UB9A 1R1VA 2OQGA 2XAQA 3HYIA 2RVCA 1FSHA 3WTVC 4MTEA 2WWYA 2VC1A 1XSVA 1R5GA 3KEOA 3AAFA 5J8FA 1ZLJA 2K86A 2DPUA 2XAGA 1JHHA 2EFQA 3I71A 1J59A 2QYOA 2MC3A 4I09A 5LHIA 5LHGA 1FSEA 1IN8A 3K1MA 1KYWA 2ZCWA 5FD6A 2XRNA 1BM9A 4YFKF 3IKVA 2JPCA 3TOAA 2LSOA 2XHKA 2W25A 3R60A 2CW0F 1XSXA 1TNTA 5IT9Z 1IUYA 2W24A 3EYYA 5J8CA 1I1SA 1CGPA 4Z2YA 3WE3A 3K0LA 4KA4A 3HOSA 1FYKA 3E6DA 1YQAA 1KQ0A 3BDDA 1SMTA 4U0YA 3ZPLA 3E6CC 1ZGJA 5H6RA 2B0LA 4QWQA 2LF7A 4A6DA 5L3BA 1CF7B 1LEAA 3MQ0A 4U0VA 1UCRA 1IZ1A 2YX7A 3RI4A 4MHGA 3U2RA 3VB2A 1PUEE 2VT2A 3ZP5A 2P5LC 3BJAA 4WF2A 1GXQA 5D4RA 4M9XA 1JGSA 1O7FA 4MGRA 3FXRA 1H0MA 1IN4A 4IJAA 4ENKA 4ZZLA 1J75A 2HKXA 3F8NA 3BJ6A 2P6TA 4HF2A 2E7XA 3M9AA 4GGGA 1XMAA 2OBPA 1EV7A 2G7UA 1Z6TA 2NNNA 1R7JA 1Z6RA 4RB1A 1KQ9A 1R23A 4FT8A 1FYLA 3Q9SA 4MQ9F 4KNYA 1ULYA 2ZMEB 2A61A 3ZN0A 2H94A 3SFZA 5E8GA 4GCVA 4OMZA 2MH2A 4WCGA 1FNNA 1H9GA 2V1DA 2EFPA 2F5FA 1TNSA 2EA4A 2BEOA 2PQ8A 5LLQA 2ETHA 2XVCA 2EWNA 4BXUA 1SD5A 2Z3YA 2MA3A 1LDDA 3OV8A 4PCQA 2PN6A 5LGUA 3KLNA 1ZGAA 1KA8A 4IRIA 1G3YA 1Y0UA 1QZZA 1P4AA 2XGXA 4NHJA 2NS0A 4OIOF 1OR7A 2O0YA 1R58A 2PI0A 5LBQA 4G6DA 4HLXA 5L3FA 2IA2A 4IF4A 2O3FA 4L5JA 2BBYA 3ROUA 5BS6A 3V7SA 1SD4A 4LLGF 1XSDA 3O3KA 4LG0A 4KN7X 4EV0A 1YS6A 1Q1HA 1OYIA 2ESNA 1YS7A 3GLXA 4LFUA 5LRSA 2CWEA 2COMA 2KJCA 5AIQA 1XCBA 5ED4A 1V4RA 2CYYA 3GVAA 4B8XA 3F22A 1XD7A 3ERED 5BMZA 3LQRA 3CJNA 2ZKZA 2HS5A 3V7RA 4HOBA 3BROA 4EGYA 1D8KA 2XKOA 4D0PA 2FF4A 2QQAA 3LQQA 2MLGA 4ZYHA 5E8IA 1XGSA 3CUOA 5BPDA 1MKMA 3IHUA 5LEJA 3HRSA 2QM3A 3WTSC 4UUVA 1KU9A 3NQOA 4Q47A 2L02A 4A0ZA 1IXSB 4B09A 1YIOA 2K4BA 4L5IA 2FBKA 3BOQA 1JXSA 3SXYA 2QZ8A 2ZBKA 4ZYDA 4KMUX 3H3ZA 3HSFA 3PFIA 2HFHA 1QPMA 1W4MA 2KIFA 4OINF 2Y0MA 5DDGA 2HGCA 4P9UA 2V1UA 2DU9A 4G94A 5BOXA 3E6MA 1K6OA 2M87A 5HS7A 3QU6A 1Z1DA 3WTXC 1U5TA 2IA1A 2BGCA 5DUKA 4Q4ZF 1JHFA 1I1GA 4OMYA 2VODA 5A2QZ 1LQ1A 4JK1X 2PFBA 2RN7A 5CLSA 4EM2A 1PP7U 3CUQA 2PG4A 1SFEA 5LGTA 4YIIA 2CFXA 1QBJA 4NQWA 3MWMA 2EFNA 4PGHA 1C0WA 2A6HF 2UXNA 2FBHA 2XUBA 4UVCA 3VFZA 4HF0A 2MD5A 3WE2A 4EVIA 2P7CB 1J7KA 4Y13A 4UV8A 2EJRA 4ESFA 4RGXA 2DFIA 3N4MA 4XLPF 3B02A 4IHSA 1ZRFA 4XRFA 5KK1A 2K4JA 4HQEA 4KT5C 1SFXA 5E20A 5BQTA 1D8JA 3JTHA 3ABUA 2IW5A 1RUOA 4Q5SF 3T5XA 2GXGA 3I58A 4UXNA 1I5ZA 2Z9OA 1ZRCA 1XGNA 3E5UA 2BV6A 2OZUA 2DQRA 5CVRA 2KJBA 2F2EA 1SD6A 1O3TA 2OAZA 4M72A 5ERIA 2YSRA 1BBYA 2KIMA 3FXUA 5E1XA 1XN7A 3KE2A 2GZWA 3KP4A 2NAZA 5H6QA 4S05A 1Z05A 1W5SA 2H09A 4P96A 3N97A 3SQNA 3ZQ7A 5DYMA 5DCMA 3JSOA 1FX7A 1FPQA 3TQNA 2FE3A 2DAOA 2HR3A 4MQVA 1XGMA 2ZFWA 1U78A 4A5MA 1FYMA 2IVMA 2L4MA 1ZHFA 2JSCA 4WXDA 3W6KB 1AWCA 3QPTA 4MNUA 1KYZA 4CZZA 1B1BA 2P6SA 1USTA 4M6YA 3WU0A 3COAC 1BC7C 2VOOA 4XSZF 3IWFA 3I54A 1LJ9A 1RZ4A 3QP5A 3I53A 3WTZA 3HUGA 5ILVA 4RAZA 5BPIA 2A68F 5TRDA 3MZYA 3RKWA 3F23A 2ACJA 4DNCA 2KKOA 4LB6B 3K2ZA 2EA2A 1YTYA 1I6XA 4UV9A 2AS5F 5HDNA 4OIPF 4IPAA 1CF7A 3C18A 1GHCA 2YX4A 4ETSA 4U7BA 1R5HA 1R22A 4KUMA 2R7FA 3LSTA 5HLHA 3J7AO 2Q8KA 2PLYA 3EQLF 5E1ZB 3FF5A 2RC4A 2ISZA 2ADUA 1QGPA 1IAWA 2V1XA 2GA2A 4HX7A 2F5EA 1G3SA 3CDHA 4AIJA 2WTEA 3BPVA 3V8LA 2V9VA 1SFUA 1S3JA 3FWEA 3PQJA 1MJ9A 2VE8A 5ICGA 3HRTA 3V8JA 2UXXA 3WGIA 5KVRA 1U6GA 2F5DA 3E3VA 2G9WA 2RNJA 2XKPA 5K5RA 1YFHA 1D5VA 1BIBA 3S2WA 3WODF 1DP7P 2ZMEA 3EUHA 2CO5A 1OYWA 1L3LA 3RDIA 1HQCA 1FC3A 4UVBA 5DUIA 3GEZA 1B6AA 3K1NA 3WTUC 4BQAA 4ON0A 2QLZA 4G7HF 2K02A 1HXDA 2PBIA 1HKTA 2GIVA 2HOEA 3BZ6A 2UZKA 1ZG3A 5AONA 4BH9A 2XV4S 1G6NA 5FFZA 1TW2A 4P9FA 1F1ZA 4A6EA 3SZPA 3RJPA 5ICFA 2YU3A 3ECHA 4R8HA 4FX4A 5DD8A 2O6GE 4AIHA 1ODDA 2E1NA 4I0AA 3JAMZ 4PGGA 2DT5A 1H9TA 2H6CA 6PAXA 1LB2A 2FOKA 1TQIA 4HAMA 3P9CA 5FB2A 5IT9K 5EEHA 4N9HA 5K5OA 1B9MA 1R36A 2X4HA 1ZG5A 1XMKA 1R1UA 4KIBA 1PP8F 3RPQA 3GFJA 2FNPA 3QU3A 1O3SA 1GXPA 1J9IA 4P5OA 3GFMA 2DLLA 3LWFA 3GFLA 3KP6A 1V3FA 2OA4A 3KP5A 2JRTA 2X0LA 2A6EF 2VN2A 2LKPA 3DFGA 1T39A 4LLNA 4I02A 2JTVA 3D5LA 3P9KA 1KGSA 2P5KA 1P92A 1U3EM 4L9VA 4ENJA 2NNYA 1Z7UA 3ABTA 4OOIA 1HKSA 2GWRA 1UHWA 4XSXF 4HX8A 4JBAA 4HBLA 3MCZA 4N0BA 5FFXA 3G3ZA 2HDCA 3DQVC 4EJOA 3J80Z 3I64A 4FX0A 1HSTA 5D5VB 1U8RA 2XASA 1G3TA 4G9YA 3F3XA 4WXCA 3RTRA 1WWXA 2DO7A 3ECOA 2FSWA 2D45A 5JHUA 1F4KA 4CHUA 1E17A 3DF8A 1RNLA 2VE9A 1JE8A 1ON1A 4M9ZA 1RIOH 3ZMSA 2D1HA 1SMYF 2EB7A 1NHAA 1O3QA 2W84A 1P4XA 2C6YA 2Y48A 2ISYA 2RKHA 3Q9VA 3HTSB 2GAUA 3J81Z 3L09A 2IRFG 1F5TA 4HZFA 3CTAA 3G73A 5JR3A 3I0TA 1HBXG 2OD5A 2V6CA 3WG9A 4K2EA 2AXLA 1XDSA 1I27A 2Q2EA 3C1DA 4CICA 3HRUA 3O6BB 2ESHA 3KP3A 2XAFA 4N9IA 4KFCA 3P9IA 2ZNZA 4ZYEA 2UWMA 4BYYA 1T0FA 2LF8A 4YIFA 4ZZDA 2A07F 2QBYB 3NEUA 1W7PB 2K7LA 5L3DA 4U88A 2DBBA 1W5TA 2O03A 2HYFA 5JVTA 2O8XA 1KQ8A 5FGMA 4UVAA 4HA8A 2JZYA
chains in the Genus database with same CATH superfamily
2P8TA 3KYDB 5GPAA 2AO9A 2F6CA 1VQ6I 3R0AA 4HYEA 4KYWA 1J5YA 3TO7A 4X6AJ 2HZDA 2E35A 3U21A 1E3OC 3RPUA 2JQ7A 3VODA 1QNTA 3UKGA 3D0SA 1ITYA 4JX5A 3FK6A 4GXOA 3HKZA 4EJUA 4PDKA 2CQ7A 4BDZA 1G4DA 2M3AA 3QWLA 2OCCH 3OS0A 1D1CA 3OOUA 2ME6A 2ZJ2A 2W57A 4M3GA 1IF1A 1VQ7I 2NXNB 4RB2C 3TDZC 3GXOA 4ESBA 3M3YJ 3OYHA 3ZMDA 4V19K 3F8MA 1X1CA 2FMYA 3LA7A 3FBIB 3L1PA 1Y39A 1FZPB 3PNVA 3OR2C 2M1BA 4CO8A 2RREA 2UUZA 1FOXA 3I59B 1J09A 5JI6A 4NB5A 4JX4A 2IPQX 4FE4A 3JRIA 2JVHA 4DYRA 1WPKA 3F8FA 2WC2A 1QQIA 3MEXA 3TO9A 1MBJA 3BLYA 3MKLA 4RM2A 3F21A 4CZCA 3GLLA 4ZH4F 5C3EJ 1K78B 1W36D 5FKLA 1TQMA 4XN0A 5EF6A 3CCSI 3BG9A 4KDPA 5HLGA 3R6SA 4BE2A 5D4SA 4CH7A 2XROA 2Z33A 1QPIA 2QSFX 3FM5A 3JR9A 3ONQA 2HDWA 2RGVA 4RAYA 3CMYA 5FLXZ 1K79A 1ZR4A 2IGOA 3OYJA 3KZIC 4M71A 1MZBA 1YO5C 1FIAA 5M5WJ 2HQNA 3WTYC 4AVZA 1MD0A 1HW2A 2VOPA 4XOTA 4CCNA 1FIPA 3IAS2 1FEXA 3CO7C 3DEUA 1O7LA 1X3UA 4RGSA 1ZH5A 3CESA 3MD2A 2VIXA 1FT9A 1LFBA 2Y2ZA 4WX9A 1EF4A 2M8EA 1SAUA 1K6YA 3L00A 4EATA 5A2QK 5EDNA 3IH4A 1R71A 2OC6A 1MJAA 3EYIA 3CZ6A 2M7BA 2EIJH 5GAEJ 2PMZA 3C2BA 3SZGA 1TLHB 1H88C 1QO0D 4NC7A 1PDNC 3HIFA 5HNFA 5K1YA 2BE5F 4HX4A 2QQ9A 5E79C 1X1BA 4U0WA 1X1AA 3CJQB 4F55A 3IC7A 1DGRM 3LFUA 2K40A 4M3BA 3CMMA 4EJVA 3CMAI 5IY5H 4XICA 1O3RA 2WV0A 1XDUA 2R7ZJ 3O8GA 5F6FA 2Q0OA 3OR1C 3GX4X 1T8IA 2H8WA 3G1MA 2KL4A 3UR3C 2RQQA 5DTDA 4FETA 1N75A 1OCTC 1YIJI 2L0KA 5CVIA 4ASNA 1HW1A 4IQJA 1VFCA 5F04A 1SVOA 2JA8J 3BTJA 1LEBA 1HW5A 4B43A 4FISA 4DQ2A 4CCJA 1AHDP 3WHCA 4C3JJ 5J1YA 1LUJB 4A5NA 3GZ6A 2DK8A 2JWTA 1QVTA 5D5UB 3ULQB 2F4OB 1WQ2A 2NOJB 1YHQI 3T0YA 2X6WA 3OIQA 1FWZA 1T38A 4DW6A 3CCEI 4GYGA 1DUXC 2L01A 4WK8F 3BG5A 2LDUA 3BG3A 2XAHA 3HHHA 5CYVA 1B4AA 2LY9A 2QKLB 3OYLA 1OR7C 2DQLA 2FNAA 2M34A 3BTIA 3BR5A 5DEQA 2ZSIB 1VTNC 2KIQA 2P4WA 3M8EA 3JSPA 3LSKA 2XPVA 4MFEA 3A2KA 2KHMA 1U9NA 4YELA 1WJDA 3ABKH 3BPXA 2RV8A 2AQEA 2FBIA 1Z3XA 1P7IA 2MBFA 1IN5A 4CCMA 2WAQN 3QPLA 5B1AH 1YW8A 4M3EA 3FXKA 4XIDA 3LSJA 2E2HJ 2D2WA 3AG4H 3OYNA 1AA7A 5EEGA 3ZOBA 4BY1J 2WB1A 2AHQA 1REPC 1X4PA 1YW7A 5J40A 2PJPA 4A3EJ 3ZQCA 3LA3A 4G6QA 1UJ8A 2M45A 3Q5FA 5IOZA 2DPDA 1MDMB 2H6BA 4XBFA 1ZN2A 2ELHA 2K9MA 2D5VA 3FKJA 3R0JA 3L2QA 1FTTA 1T6SA 3CQZJ 4KIFA 4Q48A 3C7JA 5EEAA 3CMEI 2NVTJ 2FEZA 2OPTA 4LK0F 2NVUB 2V6EA 4AVPA 3W6VA 3PFYA 1TBXA 3HPHA 2F48A 4KJZA 1QHHD 5D6EA 1B59A 4FHTA 2XF6A 3S8PA 2VBYA 1Y8QB 4XRMA 1G3WA 1SFOJ 2WY8Q 3R4KA 2QF7A 4HW0A 5HLTA 1R00A 2MYSA 1WJBA 1U9OA 3O2PE 1LVAA 2GLOA 2DMQA 2DMNA 1GV5A 1E2XA 2IP2A 4AC0A 5CKTA 4DYCA 4OIQF 1GDTA 2NRAC 1MSEC 2IEKA 3G1LA 3M07A 4F92B 3FM3A 3E5XA 4WXHA 4MTDA 4RAFA 2VLAA 2OZ6A 3ERMA 4BBSJ 1S8NA 1T2KA 4D7MA 1S6LA 5KHDA 1MBKA 2VBZA 1MMDA 3REOA 1KU7A 3CC4I 3KETA 1B9NA 3F8BA 3DU5A 2PMHA 3B73A 3RIRA 4S0HB 2L2OA 1B72B 2HKOA 2R92J 3OOPA 1IRZA 2FQ3A 5KNLA 1KU3A 3CCYA 2L3DA 3T1BA 4EJWA 4QLCU 2ZJPF 1RR7A 2RAEA 1T33A 3I56I 1FP2A 3HRMA 2P5VA 4IVNA 1Z9CA 1FOKA 5J6XA 5EG0B 5LD2C 4BE0A 3E0JB 3HEFA 2M2EA 1O57A 2L9NA 4TV7A 1ZKGA 3BCBA 4I7HA 1P6RA 1JTXA 4RBOA 2HPIA 3NRVA 1TW3A 2M30A 2PEXA 3BTCA 5DS9A 5H20A 2OQRA 1ZLKA 4XM3A 5D6FA 1EH6A 2MC4A 4MEYF 5HDGA 4YG2F 3K70D 4L9JA 1SAXA 3K10A 1S29A 4RB0A 4S04A 3KYCB 2DMUA 3M8FA 1IRGA 1IN7A 2F4IA 2X9DA 4BUPA 1WI9A 5L3CA 2DT7B 2NYXA 4I2OA 5FKMA 1GV2A 3L2RA 1U5TC 1BOAA 2X51A 3TL4X 3BY6A 1J0RA 3HOTA 2B7EA 4R79A 3FDYA 3ML6A 1HOMA 1IXRC 4RS8A 4I01A 2EZLA 3WGGA 4MEXF 1LVKA 3MVPA 2QQ8A 1UZCA 3A01B 1ZGWA 4UHTA 4Y15A 1ZRDA 2A05A 2BVLA 2E1MB 2M0MA 1HA8A 1WI3A 1TWHJ 1OYYA 3PUFA 3CUQC 1VF9A 3DLLF 3H9JA 1R1TA 1LNWA 3HSEA 4D7NA 4BHCA 5E1WA 1STZA 2O61A 5CVUA 2CQNA 2VT3A 3P5JA 2FOWA 1IW7F 3HTUA 4HV5A 1EH8A 4LMYA 5FKKA 4ZJZA 4A93J 3DPLC 5HDKA 2VJJA 3GBGA 2VUMJ 3T8RA 3ASNH 4I98B 5IT3A 1WSUA 3WU2C 3CF5F 5HODA 1T08B 2H8RA 4ZYGA 2B9SA 2XGEA 3C2HA 5HNHA 1J2XA 1K4TA 2DMPA 4KICA 4XLHA 2EK5A 5LEKA 2KRCA 1YX3A 3Q0UA 2HEOA 1U2WA 1WHUA 1NG7A 3GUDA 2CSOA 3ZMTA 5D5WB 2ZXJA 3WG7H 5DM6F 3DU6A 2R7VA 3H5RA 3TOBA 4BEHA 3TGNA 2M4GA 3FMRA 3OYKA 1MMGA 3PL8A 2VKEA 2JN6A 4IRHA 1DU0A 2VL8A 1L0OC 3H3UA 2KMUA 3S1MJ 2VONA 5JLXA 1IN6A 5M5YJ 1JT6A 2A5YB 2R3SA 2DMTA 2EQRA 5CVJA 4XLNF 4KMFA 1IDZA 5EZHA 3VPRA 4ESJA 5E3OA 3QRFF 1ZYRF 3K1PA 2R7WA 3GTKJ 3V7CA 3BQZA 3H5AA 4E7LA 3U1DA 5EGOB 3R61A 2R7OA 1LE8B 3IH3A 2STTA 3SHFA 1LFPA 2IGKA 3BWGA 3K4NA 3QODA 1UHMA 3BR2A 2QQBA 3MZHA 1LDKB 1DGWY 1ORKA 3VYRB 4PJJA 2MW8A 1JJ8C 2E1CA 2BW3A 1FOYA 1Z91A 3MAJA 3NAUA 1JKQC 4QTRA 1AKHA 3HOUJ 2E7WA 5DV5A 1IUFA 1BI1A 4E6KG 4CGZA 1QZYA 4LJZF 4WWCA 3HBLA 1VI0A 2R5YA 1OKRA 4ZTJA 3VEPA 1BJZA 1OCPA 2K9SA 2QENA 1TT0A 3E97A 2R5ZA 1MSFC 3KEQA 2EV0A 3I9V2 3FHZA 2LMDA 1DDNA 2HTSA 1BIAA 5C44J 1D3YA 1R5ID 3HGGA 2LVSA 1YLFA 4CYDA 1VQ4I 1LPQA 3L2CA 2L7FP 2XF7A 2ZXHA 4JQFA 3I4PA 4UUSB 4OAYA 1MJBA 5LGNA 3DBHB 2DA6A 3JAMK 1OCZH 5J3LA 4EJTA 3L9FA 1XCVA 5HS8A 2EFWA 3J7YJ 4EGZA 5IOYA 4G8XA 3HOYJ 1WVRA 4U7DA 2IAIA 3OYMA 2COBA 3JTGA 2WAQA 3HC7A 1DPUA 3WHBA 3KCCA 2L9RA 2HVSA 1YYVA 3QP6A 2BY0A 4DJAA 3D5RC 3L2WA 4L9TA 1PUFA 1HSJA 2L9SA 2JT1A 4RLQA 4OAZA 2BYVE 2EFOA 2LBFB 2FRHA 4RM3A 2JPBA 2XPWA 3MKWB 4HF1A 1JKPC 2W85A 2CUFA 2YPRA 4YFNF 1DPRA 2Z5UA 5F08A 5E17F 3LAJA 2O7OA 2BY3A 4ENMA 4CA0A 3W3CA 2W00A 4XQFA 2QBYA 3LA2A 1W7PA 4M73A 3KFWX 2CG4A 4BJ6C 4RDUA 1MBHA 4XORA 4XRSA 5E3MA 1H89C 3HG9A 3HXLA 2WB1N 4LB5A 3K9TA 5F1RA 2CQKA 2CV0A 4A0XA 5HS9A 2V7FA 1UMQA 4IQ4A 1P4WA 1T98A 2TDXA 3VOEA 4HNUA 1O4XA 4D9JA 3M1EA 4N4OB 4KN4X 4LLLA 2KISA 3S1RJ 1BL0A 4NDLA 3EETA 2L4AA 3F6VA 4EMSA 4L0YB 2LOOA 1ZG1A 2IS2A 2GA1A 2P7VB 3BZKA 5BNGA 1S72I 3FXOA 3WTWC 2IA0A 5ICCA 3M7GA 5AIPA 1FLIA 2IGMA 2MABA 2VKHA 3JW4A 4L0ZB 3K69A 1TP4A 3K4JA 3ZQHA 2KT0A 2MLKA 5F64A 1A36A 1IRXA 3HHGA 3CC2I 4ZC3A 2VBXA 2IS6A 1A6IA 1BI0A 2V79A 4M74A 2H27A 2ZXWH 2CU7A 3OIOA 2NVQJ 4A0YA 3CLOA 3WTTC 2MGQA 3J80K 2QSGX 2L54A 2Z99A 2EINH 2IJLA 1ACIA 3RYPA 3G6EI 4O6JA 5FD5A 2M8GX 3SFIA 3GYHX 4AYBN 4BAYA 3KP7A 3EUAA 5LRRA 5L3GA 4E7IA 1UG2A 1FJLA 1BC8C 1TT5B 1TQPA 3I59A 3VYSB 1HKQA 4BKXA 1JUSA 4M9SA 3OY9A 2H1KA 4XR6A 2CH0A 1UFMA 2CUJA 1QA6A 2KFDA 4UUTA 3L2UA 2MH9A 4GO1A 2A3SA 4AWXB 1SD7A 2XAJA 5K5QA 4H0EA 2R7QA 1VZ0A 2QGUA 3G2BA 1K78A 2W48A 3OIPA 3FZVA 2FA5A 4HDVA 3AL0C 4A3DJ 3KZZA 1RPWA 4LG0B 1KU2A 2KIUA 3IL2A 4Y17A 1Z7LA 2JA6J 2P0WA 2EV5A 3KLOA 4HQMA 3TW6A 1QU3A 4E7KA 3RYRA 3H92A 5C4XJ 2RDPA 1OLTA 3CCMI 2RQPA 4NNJA 4ZTFA 3DP7A 1NG6A 2XSDC 3GTOJ 4JYKA 3IRRA 4A3FJ 5M5XJ 2K27A 2STWA 2QVOA 3HSRA 4B47A 4DZPA 3GO5A 3J81K 1FTZA 2FXAA 1W7PD 4DZJA 4EM0B 4GYIA 5HVQC 2HQRA 1W1WE 1WJFA 1MBEA 2E71A 3EPZA 1TTYA 3K4MA 1XG1A 2DK5A 4HV6A 2HZTA 4PZJA 3KZYA 4F7ZA 1IGNA 2QUFA 4XRSG 2ZMEC 5B66C 4UNOA 3EUHC 4BHBA 4E70A 1VQKI 1FBUA 4ZDOA 2CGPA 1AOYA 4A3LJ 3I55I 3KYLA 2KRFA 5FROA 3TBIA 4G7OF 1USSA 1RUNA 1A04A 3Q0WA 2OUMA 1XB4A 1RETA 4B3AA 4C2UA 5K7FA 4JP0A 4DOZA 1ONVA 1S7AA 4P55A 4F3QA 4QPOA 5E3NA 3Q0VA 1K7AA 5DCFA 3TO6A 4KIGA 4OIRF 4BQOA 2OU2A 3F72A 3IWZA 4AIKA 2LKXA 3PSIA 2HWVA 1P9QC 3AG1H 3OMYA 3K4LA 1F36A 2ECBA 3GFIA 1LFUP 1YE9A 4KITB 1RKWA 1TL8A 4A3MJ 2X6OA 5D8LB 1BN5A 5TJJA 1YRNB 1EH7A 3GWZA 4DIQA 3ZMVA 2DW4A 2YUSA 2ME0A 1GVJA 1IRFA 4YEJA 2R7RA 5D8KB 3FXQA 1VQMI 2IS4A 4Y4RA 3TDUC 1WRJA 2ZSHB 2IGNA 4H4KC 3H9GA 2FMLA 4FASD 1MNDA 2LP0A 3F6OA 4XOPA 3PJRA 3DBRB 4FTHA 2D1VA 1W0UA 2E36A 4O5VA 2NS8A 2VBWA 4EM1A 1K4SA 1RESA 2K9NA 3DXJF 5L3EA 2VI6A 4L9NA 2H1LA 5B1BH 3TW7A 1ZAOA 2ELKA 2JVGA 3CO6C 4ENNA 3S1QJ 1U5TB 1XTAA 1ETKA 4LD5A 4IX7A 1D0XA 3PO2J 2GXAA 5IYDJ 3GW2A 1SEUA 3CJTB 3S17J 1D1BA 2DI3A 3GF2A 2YR2A 4BNCA 2ELJA 1TWFJ 4JOMA 2CQXA 3RCOA 3U9GA 3TKYA 4G7ZF 2HQ5A 2NVYJ 2XIGA 3ZN1A 3W2AA 3TMOA 3K4KA 1A5JA 4IXAA 4A12A 3F8CA 4V2FA 5ILSA 2IT0A 3H3VK 2R7TA 2GOXB 4BHPA 4BGDA 2GXBA 3CUQB 3FMSA 2Z16A 3PQKA 4J01A 2G7HA 4RB3C 1MDMA 1PJRA 4NUBA 3LSGA 2TCTA 4NQWB 3LAPA 1IXCA 3RSNA 5ICEA 1OMIA 3A1YA 3JRGA 1BI3A 3S3NA 3DV8A 3QPHA 1G2HA 3FX3A 5EYRA 5FLXK 3HL2A 4BJTA 4R1HA 3TEDA 2MSYA 2L7ZA 4O3MA 2HXIA 5K7HA 1NK2P 2PMUA 1QHGA 3KP2A 2K9QA 1VQ9I 3DWLE 3WGHA 1WKMA 4LIVA 3Q3SA 3GZ5A 2LNBA 1FY7A 1OCRH 2CMPA 4YIRX 2WBMA 4PFOA 2F5VA 4BU2A 4CDGA 2EZHA 5D5XB 2NS7A 1XC5A 2GQQA 3LSPA 3HDDA 1MMNA 1XGOA 5HLIA 1F9NA 1MGTA 4HLYA 3IKTA 4LK1F 3ELKA 4CXFA 2KZVA 1V54H 3O8HA 1R4MB 3VWBA 3FMQA 4A2UA 5ILUA 2X6YA 4CSWA 1B72A 1FBSA 2Y9ZA 3BR3A 5HOOA 4XNFA 4LITA 2ZXIA 3ISPA 1ON2A 2XDVA 2OJED 1D5YA 1ZREA 4OU0A 5CJ9A 2V26A 5F0CA 3SZTA 1S5LC 3DPTA 5J1UA 2Y75A 3D5SC 3W6JB 2XSJC 3E5QA 1M1EB 3LFKA 4IRGA 3S32A 1OPCA 3ZMUA 5EG0A 1WH5A 3E6BA 4IHTA 1BI2A 2VQLA 1Y1WJ 1YOVB 3PNTA 4YFXF 5JFRA 3PSFA 2J5OA 2CUZA 2FX0A 2VC0A 2O8KA 3WU1B 1YW9A 4I0BA 2EIKH 5LHHA 5FO5A 2XRLA 2M5WA 5B5EC 2DDBA 2R7DA 3CD6I 4PJMA 3S15J 3V8KA 2A69F 1FP1D 2DOEA 4CUGA 4XKVA 2NOGA 4IHVA 1YG2A 2HTJA 5H2FC 1Z77A 3C3WA 1P2FA 3EDPA 2XB5A 2QWWA 3CP8A 1FBQA 3CCJI 3IRQA 4AD9A 1JI8A 1XPXA 3V4GA 4F93B 3MFKA 3BJOA 4IHXA 3ASOH 3VYUB 3RKYA 2ZO4A 3L7WA 3QAHA 3P7NA 1ZARA 4HSRA 3A01A 4M6XA 3JRDA 2HYGD 5DCMB 1W36C 2ZNYA 3F9KA 2OTLI 4AYBA 3FKIJ 3I5UA 3GTJJ 2LY2A 4IHYA 4RGUA 5DD4A 4D5FA 5CVVA 2DTRA 4HDUA 2DA4A 4RGRA 2FU4A 2VXZA 1RI7A 3ZMZA 4CYCB 2VKVA 2J5PA 1RKTA 1S7OA 4EQQA 2BHYA 3T8TA 4XKBA 2F5CA 1V5FA 4L18B 3BP8A 5E18F 1LDJA 3AFHA 3I4MJ 1BJAA 3GTLJ 2K3PA 3DKWA 2EV6A 1XS9A 4LGWA 3RKXA 3IP4B 3QOPA 1UB9A 1R1VA 2OQGA 2XAQA 3IUOA 3CCUI 3HYIA 4Y3OA 2RVCA 1BW6A 1FSHA 3WTVC 2MD0A 3BR6A 4PUSA 4PSWA 2YS9A 2V9PA 4BQQA 1HC8A 2E2IJ 4MTEA 2DA3A 3W2WA 1MMSA 2WWYA 2VC1A 3OS1A 1XSVA 1ETQA 1R5GA 2L7KA 3HJEA 3KEOA 1YX5A 4W97A 5J8FA 3AAFA 1ZLJA 2K86A 2DPUA 2XAGA 1ETOA 2B63J 2KQRA 1JHHA 2EFQA 3I71A 4PJ0C 5GTIC 1J59A 4N4NB 2QYOA 2BXZA 2MC3A 4I09A 1IC8A 5LHIA 1X19A 5LHGA 1FSEA 2BVMA 1IN8A 3JRAA 3K1MA 1KYWA 2F4MB 4NC8A 2DJIA 1ZR2A 4BXXJ 2ZCWA 3G1OA 5FD6A 2XRNA 1RC9A 1BM9A 4YFKF 2IXSA 3IKVA 3S1NJ 5GPCA 3EUKL 2LR8A 2JPCA 3TOAA 2LSOA 2XHKA 3LSIA 2W25A 3R60A 3HUGB 4RLFA 4IO9F 2CW0F 4B4CA 1JJ6C 1FOWA 5EGOA 3LNQA 4RAGA 2LD5A 1LE8A 2VPRA 2OTJI 1QRYA 1XSXA 4X0GA 1TNTA 5IT9Z 4FCYA 1IUYA 2W24A 3EYYA 5J8CA 1WCMJ 1I1SA 1CGPA 3K4CA 4Z2YA 3WE3A 2PJRB 3K0LA 5F0FA 5J4YA 5IYCJ 4KA4A 3HOSA 1FYKA 3E6DA 4A3BJ 1S9HA 2VASA 1YQAA 1KQ0A 2LK2A 3BDDA 1SMTA 4U0YA 3CLQA 1N77A 3ZPLA 3E6CC 1ZGJA 5H6RA 2B0LA 5K7ZA 4QWQA 2LF7A 2DDAA 3AG3H 3HB9A 4A6DA 3K2AA 2E19A 5L3BA 3L2VA 3M4OJ 1CF7B 1LEAA 3MQ0A 4U0VA 1UCRA 3RQIA 3ZQGA 4BBRJ 3J7ZI 3OYDA 1JGGA 5FRNA 1IZ1A 2YX7A 1T95A 1HF0A 3RI4A 3HOWJ 2E34A 4MHGA 3U2RA 3VB2A 1PUEE 3A0HC 2VT2A 3ZP5A 1HCRA 2P5LC 3BJAA 3CDLA 3W2VA 4WF2A 1GXQA 4DGWB 3S3OA 3FIWA 2IS1A 2BZTA 2KRHA 1JUPA 5D4RA 4M9XA 3OYAA 2HPMA 1JGSA 1O7FA 4MGRA 2OV7A 1WGXA 3FXRA 1ERDA 4UUSA 2EH3A 3AL0B 1H0MA 1HLVA 1X2NA 1IN4A 4IJAA 4ENKA 4AM3A 3RZDJ 4ZZLA 4E7ZA 1J75A 2HKXA 3F8NA 2DJNA 3BJ6A 2P6TA 4HF2A 2E7XA 1K83J 3CCQI 3H9QA 3FXMA 2LKSA 2JJ7A 3M9AA 2DCEA 4GGGA 1XMAA 2LBFA 2Q1ZB 1MBFA 2WAEA 2OBPA 2Y69H 1EV7A 2G7UA 1MH3A 3MKZA 1Z6TA 2MFZA 2NNNA 2KLOA 1R7JA 3PUBA 4C3IJ 1Z6RA 4CCKA 4RB1A 2W4SA 1KQ9A 1R23A 4FT8A 1FYLA 3DTEA 4AIDA 1V55H 3Q9SA 1UELB 4MQ9F 4U87A 2O9LA 4KNYA 3OWTA 1ULYA 2ZMEB 3VSKA 2A61A 3ZN0A 2CW7A 2H94A 4BQNA 1Z3YA 3SFZA 1Z67A 5E8GA 1JTYA 5GAHJ 3BT9A 1TWCJ 2X1DA 3DLAA 4GCVA 3E7LA 4OMZA 2MH2A 1W5CC 2Z1DA 3KEYA 4ITVA 4WCGA 4C2TA 4XK4A 1FNNA 1H9GA 2V1DA 1E3PA 2R0QC 3E1SA 5J47A 2EFPA 3KX2A 2W1OA 1FMVA 2F5FA 2JSPA 4EEFG 1R49A 1TNSA 2EA4A 4IZZA 2E60A 1OJLA 2BEOA 2PQ8A 5LLQA 1GT0C 2ID6A 2ETHA 2XVCA 4IOAF 2EWNA 2EZIA 1BOBA 4BXUA 2RNGA 1SD5A 1ETWA 3S3MA 2Z3YA 2VB6A 1X3ZB 1LDDA 2MA3A 3OV8A 2PN6A 4PCQA 5LGUA 5IP7J 2R4GA 1EKEA 4Y33A 2K85A 3KLNA 1ZGAA 2KZGA 3JCUC 1GVDA 1KA8A 2QSHX 4IRIA 1YJWI 3K70C 4A69C 3K4BA 4KT6A 1G3YA 1Y0UA 1QZZA 1P4AA 2XGXA 3CDIA 4NHJA 2NS0A 4OIOF 1OR7A 4NC6A 2AXTC 1MH4A 4F52A 2M4KA 4IL6C 1K61A 3ZGKA 2O0YA 1R58A 2L7MP 1B8IB 3TP3A 1MNMC 1WJ5A 3SEQA 1UHSA 2JUGA 2PX9A 2PI0A 5DM7F 5LBQA 4G6DA 4HLXA 1A31A 5L3FA 3A03A 2A6TA 2IA2A 4IF4A 2EIMH 5IP6A 3MMYB 2O3FA 4L5JA 3LOCA 2BBYA 3ROUA 5BS6A 3V7SA 1SD4A 2X1CA 4Y7NJ 4G6TB 4LLGF 1XSDA 3O3KA 4LG0A 9ANTA 1MNEA 1VNDA 4KN7X 3V42A 4EV0A 1TZLA 1YS6A 1Q1HA 1OYIA 2ESNA 1YS7A 3GLXA 4BACA 1I39A 4LFUA 5GP9A 5TGTA 2KPMA 5LRSA 3A4CA 2JMWA 2JRMA 2YU9J 2CWEA 4I76A 2COMA 2I5UA 2KJCA 5AIQA 1TWAJ 2XPUA 1XCBA 1I3AA 5ED4A 1XX5A 1V4RA 3ZXSA 2CYYA 3GVAA 4B8XA 3F22A 1BR4A 1WJEA 1XD7A 2GIZA 2ICWG 3FXLA 3NWTA 3ERED 5BMZA 4A3GJ 3LQRA 3CJNA 2VJ4A 2ZKZA 2HS5A 3V7RA 4PJNA 2Z2SB 4HOBA 2EZKA 2UV1A 3BROA 1SVLA 4EGYA 1D8KA 1VQOI 2XKOA 4D0PA 5FLMJ 5EJCA 2W7NA 2FF4A 4BL0B 3SJMA 4MIMA 4RMNA 4MLOA 4D5CA 2QQAA 3LQQA 2MLGA 1I3QJ 4HSTA 4ZYHA 5E8IA 4E7JA 1XGSA 4HNTA 1A6QA 2WY7Q 2R93J 3CUOA 2LFBA 4IEJA 5BPDA 3DKXA 1MKMA 4BS9A 1Q1VA 3IHUA 1JKRC 2XGCA 1D0YA 5LEJA 3HRSA 2JUCA 2QM3A 3WTSC 4UUVA 4PFPA 1KU9A 2HU9A 2X85A 4C9YA 4BDYA 2LREA 3ZQLA 2VQCA 1APLC 1NH3A 2BHZA 3NQOA 2K9LA 2GOMA 3S93A 4Q47A 2L02A 5IYBJ 4ZYAA 4A0ZA 1IXSB 4B09A 5FRMA 1YIOA 2K4BA 3ESWB 4L5IA 2FBKA 1YRNA 3BOQA 2CW8A 1JXSA 3SXYA 3OYBA 2QZ8A 2ZBKA 4ZYDA 1U8BA 3HZJA 4KMUX 3H3ZA 3HSFA 3PFIA 4V2GA 2HFHA 1QPMA 1W4MA 2KIFA 4OINF 2Y0MA 5DDGA 2HGCA 4P9UA 1VQ8I 3J7AY 2DA5A 1IJWC 1MBGA 1V5EA 3FK7A 2V1UA 2DU9A 4G94A 5JHFA 3B6CA 5BOXA 3E6MA 1K6OA 2M87A 3OYEA 3JRFA 5JVGF 5HS7A 3QU6A 1JUMA 1YJ9I 3NWSA 1Z1DA 3WTXC 1DP3A 1U5TA 2IA1A 1N25A 2XAUA 1Y0NA 2BGCA 5F27A 1JKOC 5DUKA 1OFCX 3ABLH 4Q4ZF 1JHFA 1I1GA 1Y8RB 2Y9YA 4OMYA 1I50J 2VODA 1KONA 1CQTA 2LG4A 2WV1A 5A2QZ 1LQ1A 4JK1X 2DYSH 3CCLI 4II3A 3S2DJ 2PFBA 2QA4I 2RN7A 1ZTRA 5CLSA 4EM2A 1PP7U 3CUQA 2PG4A 2Q2EB 1SFEA 2FJ1A 2M9HA 3ZQIA 1RR8C 5LGTA 3FHNA 4E7SA 3JREA 3VYTB 4YIIA 4B48A 2CFXA 1QBJA 4NQWA 4HNVA 3MWMA 1WFXA 2EFNA 4PGHA 1C0WA 1ZK8A 1WJAA 2A6HF 2UXNA 4W1UA 2FBHA 3BR1A 2XUBA 2DFHA 4UVCA 1W0TA 3VFZA 2CFOA 3QYBA 2BOLA 4HF0A 5F1JA 2MD5A 3WE2A 4EVIA 2P7CB 4GRIA 1J7KA 4Y13A 1R4NB 3DCFA 4UV8A 2EJRA 2FUG2 3CF2A 4ESFA 3GZNB 2DFIA 4RGXA 3N4MA 4XLPF 1X58A 2P81A 3M8JA 3B02A 2CQQA 1X2MA 3DEEA 1NTCA 1GLNA 2LC2A 1ZRFA 4IHSA 4XRFA 5KK1A 2JA5J 2K4JA 2L9VA 4M6VA 4HQEA 2CRGA 4KT5C 1SFXA 4I6ZA 4XKWA 5E20A 5BQTA 3LSHA 4MO7A 2WADA 1D8JA 1IG7A 5GTHC 4AUXA 2R7XA 3JTHA 3ABUA 2IW5A 2EBIA 2K3FA 1RUOA 4Q5SF 3T5XA 2GXGA 3I58A 4UXNA 1UG0A 1I5ZA 1AU7A 2Z9OA 1ZRCA 2HOSA 4J19A 1XGNA 3E5UA 2BV6A 3HOZJ 5KAFC 2FQ4A 1X4OA 5LFAA 2OZUA 3DTIA 4IOCF 4BXFA 4D1QA 3G71I 1OISA 2DQRA 5CVRA 3S16J 1A35A 2KJBA 4BE1A 2F2EA 1SD6A 4M3FA 1O3TA 2OF7A 2OAZA 4M72A 3CCVI 5ERIA 1IO2A 2E2JJ 4XKCA 2ZB9A 3RPUD 2O5RA 3OS2A 1D0ZA 4IKFA 2BY1A 2YSRA 3S2HJ 1Y1VJ 1T56A 2BXYA 2KIMA 1BBYA 3FXUA 1R6RA 1EA3A 4I99C 5E1XA 1XN7A 3KE2A 2GZWA 5FJ8J 3KP4A 4XLAA 3QPSA 2NAZA 5H6QA 3HM5A 2DA1A 1BA5A 4S05A 2V4JC 2JK3A 3DEWA 4E7HA 3HGYA 1Z05A 3QQAA 1W5SA 1KZHA 2H09A 4P96A 3HOXJ 1D1AA 3SQNA 3ZQ7A 3N97A 1NK3P 2M7AA 1Y6IA 5DYMA 5DCMA 3CP2A 4Z6YA 1ZQ3P 3OYGA 3JSOA 1FX7A 4B1RA 3OSGA 1FPQA 3TQNA 2FE3A 2Y0SN 2DAOA 4CYCA 2VQGA 2HQAA 4PK4A 2HR3A 4MQVA 2BY2A 3PIOF 3SEZA 1XGMA 2ZFWA 2HYJA 2LY1A 3JRCA 1U78A 4A5MA 5B3SH 4DBQA 1FYMA 4A3JJ 4OWRB 2IVMA 2L4MA 1ZHFA 4G12A 3CC7I 2JSCA 4WXDA 1Z21A 3K7AJ 3UNGC 3W6KB 1AWCA 3VDXA 4CCOA 3QPTA 4LG3A 3GCMA 1ZELA 4MNUA 1KYZA 5FKNA 4CZZA 3AKZA 1OQYA 1B1BA 4B44A 2P6SA 2EPFA 5CQEA 1USTA 2IBDA 4XMYA 4E4HA 2MG4A 2FD5A 3PM1A 3H5NA 4M6YA 3WU0A 4UB6C 4BJ5C 3COAC 3GTQJ 3DKYA 5GADJ 1BC7C 2VOOA 3M1CA 4XSZF 3IWFA 4QSHA 1LKXA 3I54A 4ZDPA 1LJ9A 1YJNI 1RZ4A 4QIWN 3QP5A 4IHWA 3I53A 5IPAA 2E5NA 5IP9J 1IDYA 1ETXA 3WTZA 3HUGA 5ILVA 3SYTA 4RAZA 5BPIA 2A68F 5TRDA 3MZYA 2X48A 1VQ5I 3RKWA 3BZCA 3F23A 3BQYA 3IH2A 2ACJA 2AQFA 2HI3A 4XONA 4DNCA 2E1OA 2DTZA 3SDGA 2KKOA 4LB6B 3K2ZA 2PJRA 4Y52J 2XF5A 2EA2A 1YTYA 3A0BC 1I6XA 4UV9A 2AS5F 4JX6A 1T0FC 2E5ZA 3CJRB 5HDNA 5TISC 2XGDA 4LOCA 4OIPF 3PIPF 3HOVJ 4IPAA 1UAAA 4NBQA 2LRDA 3AG2H 1CF7A 3C18A 2CV1A 1GHCA 2KDZA 3H36A 2YX4A 4LIUA 3GTMJ 4ETSA 1HDDC 2W82A 4U7BA 4C2MJ 1R5HA 1R22A 4KUMA 2R7FA 3FBNB 3LSTA 5HLHA 3J7AO 3OL4A 2Q8KA 2GM4A 2PLYA 3EQLF 5E1ZB 1WH7A 3FF5A 4FQGA 4ABZA 2RC4A 2ISZA 1ETYA 2ADUA 4AU7A 1QGPA 3SDBA 1IAWA 2V1XA 2GA2A 4HX7A 2F5EA 1G3SA 3CDHA 4AIJA 2HDDA 4HPQA 2WTEA 3BPVA 3V8LA 2V9VA 1SFUA 1S3JA 3FWEA 1FMWA 3PQJA 1MJ9A 2VE8A 3H35A 2DFEA 5ICGA 2LH9A 3HRTA 4HG2A 3FISA 3V8JA 2UXXA 4HEA2 3WGIA 5KVRA 3C2GA 3FXJA 1U6GA 2F5DA 3E3VA 1R9TJ 2LYCA 1PYVA 2G9WA 2RNJA 2XKPA 3G4SI 5K5RA 1YFHA 1D5VA 1BIBA 3BCAA 1ETVA 3S2WA 3WODF 1DP7P 3HKZN 2ZMEA 3EUHA 2V9KA 2CO5A 1OYWA 1L3LA 1I6HJ 3OSFA 3RDIA 2HVQA 1OCCH 1HQCA 4BY7J 4DYQA 1BR2A 1FC3A 2ECCA 1PVEA 4UVBA 1EJ9A 2LTPA 4CCLA 5DUIA 3GEZA 1B6AA 3K1NA 3WTUC 4BQAA 4ON0A 2QLZA 5FLVA 1BR1A 2JA2A 5CQGA 2R7UA 4G7HF 1WZ2A 2K02A 1HXDA 3LMMA 3S14J 1X1DA 2X1EA 2PBIA 1HKTA 2GIVA 2HOEA 3TP0A 3BZ6A 2UZKA 1P7JA 4RA2A 1ZG3A 3NARA 5AONA 4BH9A 3OL3A 2XV4S 1TC3C 1G6NA 5FFZA 1TW2A 2K5CA 5E3LA 2ID3A 4P9FA 2DA7A 3RZOJ 1F1ZA 4A6EA 5FKOA 3RJPA 2M0CA 3SZPA 3JRBA 5ICFA 4HRIA 2YU3A 3ECHA 3MN2A 4FE7A 4R8HA 4FX4A 2VQHA 5DD8A 3JRHA 2O6GE 1SC7A 4AIHA 3BC8A 2DN0A 5M3MJ 4A3KJ 1ODDA 2E1NA 3IV5A 4I0AA 4XLEA 3ZQFA 3JAMZ 4PGGA 1IV8A 3QOEA 4PSXA 2DT5A 1QZEA 2H6CA 2OCEA 1H9TA 4UB8C 2QEXI 3IAM2 6PAXA 2Y30A 1TWGJ 1LB2A 2DXIA 2FOKA 1TQIA 4HAMA 2KDOA 3N05A 3H1CA 3P9CA 5FB2A 5IT9K 2DOAA 5EEHA 4C3HJ 4N9HA 5K5OA 1B9MA 1R36A 2X4HA 1ZG5A 1B8IA 1XMKA 2ZJQF 1R1UA 2VJIA 4KIBA 1PP8F 3QYFA 3RPQA 4YRVA 2DYRH 3GFJA 2FNPA 2G0EA 3QU3A 2I8DA 1O3SA 1GXPA 1J9IA 3I3LA 1IV6A 4P5OA 3GFMA 1VQLI 3H0DA 2DLLA 2PMZN 2WAFA 1SVMA 3LWFA 5CPRB 1DU6A 3GFLA 3KP6A 1S7EA 3LSRA 1V3FA 4A3CJ 2OA4A 3KP5A 4MFDA 4XL9A 2CUEA 2JRTA 3K6GA 2X0LA 4GDFA 2A6EF 2VN2A 3U1KA 2LKPA 2HXOA 3DFGA 1T39A 4LLNA 2HNHA 4I02A 2JTVA 3D5LA 1F43A 2A5WA 3OYIA 3P9KA 1VQNI 1KGSA 2P5KA 1P92A 1E0EA 1MW7A 4M3DA 1RRJA 3DBLB 1U3EM 3OYCA 4L9VA 2Y0SA 4QPQA 4ENJA 2NNYA 1Z7UA 2V1NA 4B3XA 3ABTA 4OOIA 3ZR8X 3DTKA 1HKSA 2N8GA 2LLKA 2ZJRF 2L5QA 2GWRA 1UHWA 3HPGA 4BEHB 4XSXF 4HX8A 4JBAA 1G8XA 2WA0A 3B6AA 1YI2I 1QVUA 4HBLA 3LL7A 3MCZA 4N0BA 5FFXA 2DODA 4F91B 3G3ZA 1DQUA 2HDCA 3DQVC 4EJOA 3ZQQA 5EZGA 3J80Z 3I64A 3CCRI 4FX0A 2HOTA 1HSTA 2CV2A 1ENHA 1HDPA 5D5VB 1Y56A 2KP6A 1U8RA 2XASA 1G3TA 2VPLA 3KIOA 4UY8I 1BW5A 3OYFA 3MZ8A 4G9YA 4KISA 4ZDLA 3GTGJ 2GBYA 3F3XA 2BW3B 4WXCA 3RTRA 3BG7A 5J1RA 1WWXA 2DO7A 1N78A 1AKHB 3ECOA 2FSWA 4GFBA 1MIJA 2D45A 3BR0A 5JHUA 1U0JA 4XLFA 1F4KA 4CHUA 1E17A 3DF8A 1RNLA 2VE9A 1WJCA 2I10A 1JE8A 1ON1A 4M9ZA 2NVXJ 1E3HA 1RIOH 2R5YB 3ZMSA 2D1HA 5F0HA 1X3WB 1SMYF 2R5ZB 2DT6A 3F0CA 2EB7A 1NHAA 3D1NI 2VKDA 1O3QA 2W84A 1P4XA 2XB0X 2C6YA 2Y48A 2ISYA 2E1MC 2RKHA 3Q9VA 3ZCOA 4XN3A 1G59A 3HTSB 3GTPJ 1X1PA 2VXDA 1YITI 2GAUA 3J81Z 3L09A 4X1EA 1Z0XA 3GMEA 2VJ5A 2ZFUA 3A02A 2IRFG 2JA7J 2CJJA 1F5TA 3RQ4A 4XLCA 4HZFA 3PNYA 4ANJA 2EILH 3BTLA 1GUUA 1SANA 3CTAA 2HVRA 3G73A 1POGA 2CS3A 4L5EA 5JR3A 3VSLA 2HOAA 3I0TA 1HBXG 2OD5A 2V6CA 1SFKA 4C30A 1V5GA 3WG9A 4K2EA 2AXLA 4II2A 4A3IJ 1JT0A 1OCOH 5GAGJ 1XMXA 1XDSA 2QCOA 1I27A 2ZC2A 2Q2EA 3C1DA 4CICA 4DBRA 1PUFB 1MMAA 1VQPI 3HRUA 3O6BB 2X6XA 2ESHA 3KP3A 3MKYB 2DFFA 2XAFA 5KCMA 3ZRGA 4N9IA 5M3FJ 1H8AC 5KAIC 3H0GJ 5C4JJ 4KFCA 3ABMH 5J4VA 5JLWA 3I4NJ 3P9IA 2ZNZA 2R7SA 4ZYEA 2UWMA 4BYYA 4J00A 2TRTA 2Y31A 1T0FA 2DOFA 2LF8A 4YIFA 4ZZDA 2A07F 4P1WA 2QBYB 3LSMA 3NEUA 1W7PB 3X2QH 2K7LA 4PJLA 4U88A 5L3DA 2DBBA 1W5TA 2DA2A 2O03A 3DPUA 2HYFA 3BG6A 5JVTA 2O8XA 1KQ8A 5FGMA 3PO3J 3KPHA 4UVAA 2XC7A 3RKQA 4HA8A 3QYEA 2QKMB 2JZYA
chains in the Genus database with same CATH topology
2P8TA 3R0AA 4HYEA 4KYWA 1J5YA 3TO7A 3RPUA 3VODA 1QNTA 3D0SA 4GXOA 4EJUA 4PDKA 1G4DA 2ZJ2A 2W57A 1IF1A 4RB2C 3TDZC 3GXOA 4ESBA 3ZMDA 3F8MA 2FMYA 3LA7A 1FZPB 2M1BA 4CO8A 3I59B 5JI6A 4NB5A 2IPQX 3F8FA 2WC2A 1QQIA 3MEXA 3TO9A 3F21A 4ZH4F 1K78B 1TQMA 4KDPA 5HLGA 3R6SA 5D4SA 2XROA 2Z33A 3FM5A 2RGVA 4RAYA 5FLXZ 1K79A 4M71A 1MZBA 1YO5C 2HQNA 3WTYC 1MD0A 1HW2A 2VOPA 3CO7C 3DEUA 1O7LA 1X3UA 4RGSA 1ZH5A 1FT9A 4WX9A 2M8EA 3L00A 5A2QK 1MJAA 3EYIA 1TLHB 1QO0D 1PDNC 3HIFA 5K1YA 2BE5F 4HX4A 2QQ9A 4U0WA 3IC7A 4EJVA 1O3RA 2WV0A 1XDUA 5F6FA 2Q0OA 3GX4X 5CVIA 4ASNA 1HW1A 1LEBA 1HW5A 4DQ2A 4A5NA 3GZ6A 2DK8A 5D5UB 3ULQB 1WQ2A 3T0YA 1FWZA 1T38A 4GYGA 1DUXC 2L01A 4WK8F 2LDUA 3HHHA 2XAHA 5CYVA 1B4AA 2DQLA 2FNAA 1VTNC 5DEQA 2P4WA 3M8EA 3JSPA 3BPXA 2RV8A 2FBIA 2MBFA 1IN5A 1YW8A 2D2WA 5EEGA 1REPC 1YW7A 2PJPA 3LA3A 4G6QA 2M45A 3Q5FA 2DPDA 1MDMB 2H6BA 4XBFA 1ZN2A 2ELHA 3R0JA 1T6SA 4KIFA 4Q48A 3C7JA 2FEZA 4LK0F 4AVPA 1TBXA 5D6EA 1B59A 4FHTA 2VBYA 1G3WA 3R4KA 4HW0A 1R00A 3O2PE 1LVAA 1E2XA 2IP2A 4OIQF 2NRAC 3FM3A 3E5XA 4WXHA 4MTDA 2OZ6A 1S8NA 1T2KA 1S6LA 2VBZA 3REOA 1KU7A 3KETA 1B9NA 3F8BA 2PMHA 3B73A 3RIRA 2HKOA 3OOPA 2FQ3A 1KU3A 2L3DA 3T1BA 4EJWA 4QLCU 1FP2A 3HRMA 2P5VA 4IVNA 1Z9CA 1FOKA 5J6XA 1O57A 4TV7A 4I7HA 1P6RA 3NRVA 1TW3A 2M30A 2PEXA 5H20A 2OQRA 1ZLKA 5D6FA 1EH6A 4MEYF 5HDGA 4YG2F 4L9JA 1SAXA 1S29A 4RB0A 4S04A 3M8FA 1IRGA 1IN7A 1WI9A 5L3CA 2NYXA 4I2OA 1U5TC 1BOAA 3BY6A 1J0RA 3HOTA 4R79A 3ML6A 1IXRC 4RS8A 4I01A 3WGGA 4MEXF 4UHTA 4Y15A 1ZRDA 1OYYA 3CUQC 1R1TA 1LNWA 3HSEA 4BHCA 5E1WA 1STZA 2O61A 5CVUA 2VT3A 1IW7F 3HTUA 4HV5A 1EH8A 4LMYA 3DPLC 5HDKA 3T8RA 4I98B 5IT3A 1WSUA 4ZYGA 1J2XA 4KICA 2EK5A 5LEKA 2HEOA 1U2WA 3GUDA 2CSOA 3ZMTA 5D5WB 2ZXJA 3TOBA 3TGNA 3FMRA 4IRHA 1L0OC 3H3UA 2VONA 1IN6A 2A5YB 4KMFA 2R3SA 5CVJA 4XLNF 4ESJA 3QRFF 1ZYRF 3K1PA 3V7CA 3U1DA 3R61A 2STTA 3SHFA 3BWGA 1UHMA 2QQBA 3MZHA 1LDKB 2E1CA 1Z91A 3MAJA 2E7WA 5DV5A 1BI1A 4CGZA 1QZYA 4LJZF 4WWCA 1OKRA 3VEPA 2QENA 3E97A 3KEQA 2EV0A 3FHZA 1DDNA 2HTSA 1BIAA 1D3YA 1YLFA 4CYDA 3L2CA 4JQFA 3I4PA 1MJBA 5LGNA 3JAMK 4EJTA 3L9FA 1XCVA 5HS8A 2EFWA 4EGZA 4G8XA 4U7DA 3JTGA 1DPUA 3KCCA 1YYVA 3QP6A 4L9TA 1HSJA 2JT1A 2BYVE 2EFOA 2FRHA 2JPBA 4HF1A 2W85A 2YPRA 4YFNF 1DPRA 2Z5UA 5E17F 3LAJA 4ENMA 2QBYA 3LA2A 1W7PA 4M73A 3KFWX 2CG4A 4LB5A 3K9TA 5F1RA 2CQKA 4A0XA 5HS9A 1P4WA 1T98A 2TDXA 3VOEA 3M1EA 4KN4X 4LLLA 3EETA 2L4AA 3F6VA 4EMSA 4L0YB 1ZG1A 2GA1A 2P7VB 3WTWC 2IA0A 5ICCA 3M7GA 5AIPA 1FLIA 3JW4A 4L0ZB 3K69A 2MLKA 5F64A 3HHGA 2VBXA 1BI0A 2V79A 4M74A 2H27A 4A0YA 3CLOA 3WTTC 3J80K 2L54A 2Z99A 2IJLA 3RYPA 4O6JA 5FD5A 3GYHX 4BAYA 3KP7A 5LRRA 5L3GA 1BC8C 1TQPA 3I59A 1HKQA 4M9SA 1UFMA 2MH9A 4GO1A 2A3SA 4AWXB 1SD7A 2XAJA 5K5QA 4H0EA 1K78A 3FZVA 2FA5A 4HDVA 3KZZA 4LG0B 1KU2A 2KIUA 3IL2A 4Y17A 2EV5A 3KLOA 4HQMA 3RYRA 3H92A 2RDPA 2RQPA 3DP7A 3IRRA 2K27A 2STWA 2QVOA 3HSRA 3GO5A 3J81K 2FXAA 1W7PD 4EM0B 4GYIA 5HVQC 2HQRA 1TTYA 2DK5A 4HV6A 2HZTA 4PZJA 3KZYA 4F7ZA 2QUFA 4UNOA 4BHBA 4E70A 1FBUA 2CGPA 1AOYA 2KRFA 4G7OF 1USSA 1RUNA 1A04A 1XB4A 1ONVA 1S7AA 4P55A 1K7AA 5DCFA 3TO6A 4KIGA 4OIRF 2OU2A 3F72A 3IWZA 4AIKA 2HWVA 3GFIA 5D8LB 1BN5A 5TJJA 1EH7A 3GWZA 3ZMVA 2DW4A 1GVJA 1IRFA 5D8KB 3FXQA 3TDUC 1WRJA 2FMLA 3F6OA 2D1VA 4O5VA 4EM1A 2VBWA 3DXJF 5L3EA 4L9NA 1ZAOA 4ENNA 3CO6C 1U5TB 4LD5A 3GW2A 2DI3A 3GF2A 2YR2A 4BNCA 3U9GA 3TKYA 4G7ZF 3ZN1A 2XIGA 4IXAA 4A12A 3F8CA 5ILSA 2IT0A 4BHPA 2GXBA 3CUQB 3FMSA 3PQKA 2G7HA 4RB3C 1MDMA 3LAPA 1IXCA 5ICEA 1OMIA 1BI3A 3DV8A 3QPHA 3FX3A 5FLXK 4R1HA 4O3MA 2PMUA 3KP2A 3WGHA 1WKMA 3GZ5A 2LNBA 1FY7A 4CDGA 5D5XB 2GQQA 1XGOA 5HLIA 1F9NA 1MGTA 4HLYA 3IKTA 4LK1F 3ELKA 4CXFA 3FMQA 4A2UA 5ILUA 1FBSA 5HOOA 3ISPA 1ON2A 1ZREA 4OU0A 5CJ9A 3SZTA 3DPTA 2Y75A 3W6JB 3E5QA 3LFKA 4IRGA 1OPCA 3ZMUA 3E6BA 4IHTA 1BI2A 4YFXF 5JFRA 2J5OA 2VC0A 3WU1B 1YW9A 4I0BA 5LHHA 5FO5A 2M5WA 2R7DA 3V8KA 2A69F 1FP1D 1YG2A 2HTJA 3C3WA 1P2FA 3EDPA 2QWWA 1FBQA 3IRQA 4AD9A 3V4GA 3MFKA 3BJOA 3RKYA 2ZO4A 3L7WA 3QAHA 3P7NA 1ZARA 4M6XA 2HYGD 5DCMB 2ZNYA 3I5UA 4RGUA 5DD4A 5CVVA 2DTRA 4HDUA 4RGRA 2FU4A 2VXZA 1RI7A 3ZMZA 2J5PA 1S7OA 4EQQA 3T8TA 2F5CA 4L18B 3BP8A 5E18F 1LDJA 1BJAA 3DKWA 2EV6A 4LGWA 3RKXA 3QOPA 1UB9A 1R1VA 2OQGA 2XAQA 3HYIA 2RVCA 1FSHA 3WTVC 4MTEA 2WWYA 2VC1A 1XSVA 1R5GA 3KEOA 3AAFA 5J8FA 1ZLJA 2K86A 2DPUA 2XAGA 1JHHA 2EFQA 3I71A 1J59A 2QYOA 2MC3A 4I09A 5LHIA 5LHGA 1FSEA 1IN8A 3K1MA 1KYWA 2ZCWA 5FD6A 2XRNA 1BM9A 4YFKF 3IKVA 2JPCA 3TOAA 2LSOA 2XHKA 2W25A 3R60A 2CW0F 1XSXA 1TNTA 5IT9Z 1IUYA 2W24A 3EYYA 5J8CA 1I1SA 1CGPA 4Z2YA 3WE3A 3K0LA 4KA4A 3HOSA 1FYKA 3E6DA 1YQAA 1KQ0A 3BDDA 1SMTA 4U0YA 3ZPLA 3E6CC 1ZGJA 5H6RA 2B0LA 4QWQA 2LF7A 4A6DA 5L3BA 1CF7B 1LEAA 3MQ0A 4U0VA 1UCRA 1IZ1A 2YX7A 3RI4A 4MHGA 3U2RA 3VB2A 1PUEE 2VT2A 3ZP5A 2P5LC 3BJAA 4WF2A 1GXQA 5D4RA 4M9XA 1JGSA 1O7FA 4MGRA 3FXRA 1H0MA 1IN4A 4IJAA 4ENKA 4ZZLA 1J75A 2HKXA 3F8NA 3BJ6A 2P6TA 4HF2A 2E7XA 3M9AA 4GGGA 1XMAA 2OBPA 1EV7A 2G7UA 1Z6TA 2NNNA 1R7JA 1Z6RA 4RB1A 1KQ9A 1R23A 4FT8A 1FYLA 3Q9SA 4MQ9F 4KNYA 1ULYA 2ZMEB 2A61A 3ZN0A 2H94A 3SFZA 5E8GA 4GCVA 4OMZA 2MH2A 4WCGA 1FNNA 1H9GA 2V1DA 2EFPA 2F5FA 1TNSA 2EA4A 2BEOA 2PQ8A 5LLQA 2ETHA 2XVCA 2EWNA 4BXUA 1SD5A 2Z3YA 2MA3A 1LDDA 3OV8A 4PCQA 2PN6A 5LGUA 3KLNA 1ZGAA 1KA8A 4IRIA 1G3YA 1Y0UA 1QZZA 1P4AA 2XGXA 4NHJA 2NS0A 4OIOF 1OR7A 2O0YA 1R58A 2PI0A 5LBQA 4G6DA 4HLXA 5L3FA 2IA2A 4IF4A 2O3FA 4L5JA 2BBYA 3ROUA 5BS6A 3V7SA 1SD4A 4LLGF 1XSDA 3O3KA 4LG0A 4KN7X 4EV0A 1YS6A 1Q1HA 1OYIA 2ESNA 1YS7A 3GLXA 4LFUA 5LRSA 2CWEA 2COMA 2KJCA 5AIQA 1XCBA 5ED4A 1V4RA 2CYYA 3GVAA 4B8XA 3F22A 1XD7A 3ERED 5BMZA 3LQRA 3CJNA 2ZKZA 2HS5A 3V7RA 4HOBA 3BROA 4EGYA 1D8KA 2XKOA 4D0PA 2FF4A 2QQAA 3LQQA 2MLGA 4ZYHA 5E8IA 1XGSA 3CUOA 5BPDA 1MKMA 3IHUA 5LEJA 3HRSA 2QM3A 3WTSC 4UUVA 1KU9A 3NQOA 4Q47A 2L02A 4A0ZA 1IXSB 4B09A 1YIOA 2K4BA 4L5IA 2FBKA 3BOQA 1JXSA 3SXYA 2QZ8A 2ZBKA 4ZYDA 4KMUX 3H3ZA 3HSFA 3PFIA 2HFHA 1QPMA 1W4MA 2KIFA 4OINF 2Y0MA 5DDGA 2HGCA 4P9UA 2V1UA 2DU9A 4G94A 5BOXA 3E6MA 1K6OA 2M87A 5HS7A 3QU6A 1Z1DA 3WTXC 1U5TA 2IA1A 2BGCA 5DUKA 4Q4ZF 1JHFA 1I1GA 4OMYA 2VODA 5A2QZ 1LQ1A 4JK1X 2PFBA 2RN7A 5CLSA 4EM2A 1PP7U 3CUQA 2PG4A 1SFEA 5LGTA 4YIIA 2CFXA 1QBJA 4NQWA 3MWMA 2EFNA 4PGHA 1C0WA 2A6HF 2UXNA 2FBHA 2XUBA 4UVCA 3VFZA 4HF0A 2MD5A 3WE2A 4EVIA 2P7CB 1J7KA 4Y13A 4UV8A 2EJRA 4ESFA 4RGXA 2DFIA 3N4MA 4XLPF 3B02A 4IHSA 1ZRFA 4XRFA 5KK1A 2K4JA 4HQEA 4KT5C 1SFXA 5E20A 5BQTA 1D8JA 3JTHA 3ABUA 2IW5A 1RUOA 4Q5SF 3T5XA 2GXGA 3I58A 4UXNA 1I5ZA 2Z9OA 1ZRCA 1XGNA 3E5UA 2BV6A 2OZUA 2DQRA 5CVRA 2KJBA 2F2EA 1SD6A 1O3TA 2OAZA 4M72A 5ERIA 2YSRA 1BBYA 2KIMA 3FXUA 5E1XA 1XN7A 3KE2A 2GZWA 3KP4A 2NAZA 5H6QA 4S05A 1Z05A 1W5SA 2H09A 4P96A 3N97A 3SQNA 3ZQ7A 5DYMA 5DCMA 3JSOA 1FX7A 1FPQA 3TQNA 2FE3A 2DAOA 2HR3A 4MQVA 1XGMA 2ZFWA 1U78A 4A5MA 1FYMA 2IVMA 2L4MA 1ZHFA 2JSCA 4WXDA 3W6KB 1AWCA 3QPTA 4MNUA 1KYZA 4CZZA 1B1BA 2P6SA 1USTA 4M6YA 3WU0A 3COAC 1BC7C 2VOOA 4XSZF 3IWFA 3I54A 1LJ9A 1RZ4A 3QP5A 3I53A 3WTZA 3HUGA 5ILVA 4RAZA 5BPIA 2A68F 5TRDA 3MZYA 3RKWA 3F23A 2ACJA 4DNCA 2KKOA 4LB6B 3K2ZA 2EA2A 1YTYA 1I6XA 4UV9A 2AS5F 5HDNA 4OIPF 4IPAA 1CF7A 3C18A 1GHCA 2YX4A 4ETSA 4U7BA 1R5HA 1R22A 4KUMA 2R7FA 3LSTA 5HLHA 3J7AO 2Q8KA 2PLYA 3EQLF 5E1ZB 3FF5A 2RC4A 2ISZA 2ADUA 1QGPA 1IAWA 2V1XA 2GA2A 4HX7A 2F5EA 1G3SA 3CDHA 4AIJA 2WTEA 3BPVA 3V8LA 2V9VA 1SFUA 1S3JA 3FWEA 3PQJA 1MJ9A 2VE8A 5ICGA 3HRTA 3V8JA 2UXXA 3WGIA 5KVRA 1U6GA 2F5DA 3E3VA 2G9WA 2RNJA 2XKPA 5K5RA 1YFHA 1D5VA 1BIBA 3S2WA 3WODF 1DP7P 2ZMEA 3EUHA 2CO5A 1OYWA 1L3LA 3RDIA 1HQCA 1FC3A 4UVBA 5DUIA 3GEZA 1B6AA 3K1NA 3WTUC 4BQAA 4ON0A 2QLZA 4G7HF 2K02A 1HXDA 2PBIA 1HKTA 2GIVA 2HOEA 3BZ6A 2UZKA 1ZG3A 5AONA 4BH9A 2XV4S 1G6NA 5FFZA 1TW2A 4P9FA 1F1ZA 4A6EA 3SZPA 3RJPA 5ICFA 2YU3A 3ECHA 4R8HA 4FX4A 5DD8A 2O6GE 4AIHA 1ODDA 2E1NA 4I0AA 3JAMZ 4PGGA 2DT5A 1H9TA 2H6CA 6PAXA 1LB2A 2FOKA 1TQIA 4HAMA 3P9CA 5FB2A 5IT9K 5EEHA 4N9HA 5K5OA 1B9MA 1R36A 2X4HA 1ZG5A 1XMKA 1R1UA 4KIBA 1PP8F 3RPQA 3GFJA 2FNPA 3QU3A 1O3SA 1GXPA 1J9IA 4P5OA 3GFMA 2DLLA 3LWFA 3GFLA 3KP6A 1V3FA 2OA4A 3KP5A 2JRTA 2X0LA 2A6EF 2VN2A 2LKPA 3DFGA 1T39A 4LLNA 4I02A 2JTVA 3D5LA 3P9KA 1KGSA 2P5KA 1P92A 1U3EM 4L9VA 4ENJA 2NNYA 1Z7UA 3ABTA 4OOIA 1HKSA 2GWRA 1UHWA 4XSXF 4HX8A 4JBAA 4HBLA 3MCZA 4N0BA 5FFXA 3G3ZA 2HDCA 3DQVC 4EJOA 3J80Z 3I64A 4FX0A 1HSTA 5D5VB 1U8RA 2XASA 1G3TA 4G9YA 3F3XA 4WXCA 3RTRA 1WWXA 2DO7A 3ECOA 2FSWA 2D45A 5JHUA 1F4KA 4CHUA 1E17A 3DF8A 1RNLA 2VE9A 1JE8A 1ON1A 4M9ZA 1RIOH 3ZMSA 2D1HA 1SMYF 2EB7A 1NHAA 1O3QA 2W84A 1P4XA 2C6YA 2Y48A 2ISYA 2RKHA 3Q9VA 3HTSB 2GAUA 3J81Z 3L09A 2IRFG 1F5TA 4HZFA 3CTAA 3G73A 5JR3A 3I0TA 1HBXG 2OD5A 2V6CA 3WG9A 4K2EA 2AXLA 1XDSA 1I27A 2Q2EA 3C1DA 4CICA 3HRUA 3O6BB 2ESHA 3KP3A 2XAFA 4N9IA 4KFCA 3P9IA 2ZNZA 4ZYEA 2UWMA 4BYYA 1T0FA 2LF8A 4YIFA 4ZZDA 2A07F 2QBYB 3NEUA 1W7PB 2K7LA 5L3DA 4U88A 2DBBA 1W5TA 2O03A 2HYFA 5JVTA 2O8XA 1KQ8A 5FGMA 4UVAA 4HA8A 2JZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P8T A;  3R0A A;  4HYE A;  4KYW A;  1J5Y A;  3TO7 A;  3RPU A;  3VOD A;  1QNT A;  3D0S A;  4GXO A;  4EJU A;  4PDK A;  1G4D A;  2ZJ2 A;  2W57 A;  1IF1 A;  4RB2 C;  3TDZ C;  3GXO A;  4ESB A;  3ZMD A;  3F8M A;  2FMY A;  3LA7 A;  1FZP B;  2M1B A;  4CO8 A;  3I59 B;  5JI6 A;  4NB5 A;  2IPQ X;  3F8F A;  2WC2 A;  1QQI A;  3MEX A;  3TO9 A;  3F21 A;  4ZH4 F;  1K78 B;  1TQM A;  4KDP A;  5HLG A;  3R6S A;  5D4S A;  2XRO A;  2Z33 A;  3FM5 A;  2RGV A;  4RAY A;  5FLX Z;  1K79 A;  4M71 A;  1MZB A;  1YO5 C;  2HQN A;  3WTY C;  1MD0 A;  1HW2 A;  2VOP A;  3CO7 C;  3DEU A;  1O7L A;  1X3U A;  4RGS A;  1ZH5 A;  1FT9 A;  4WX9 A;  2M8E A;  3L00 A;  5A2Q K;  1MJA A;  3EYI A;  1TLH B;  1QO0 D;  1PDN C;  3HIF A;  5K1Y A;  2BE5 F;  4HX4 A;  2QQ9 A;  4U0W A;  3IC7 A;  4EJV A;  1O3R A;  2WV0 A;  1XDU A;  5F6F A;  2Q0O A;  3GX4 X;  5CVI A;  4ASN A;  1HW1 A;  1LEB A;  1HW5 A;  4DQ2 A;  4A5N A;  3GZ6 A;  2DK8 A;  5D5U B;  3ULQ B;  1WQ2 A;  3T0Y A;  1FWZ A;  1T38 A;  4GYG A;  1DUX C;  2L01 A;  4WK8 F;  2LDU A;  3HHH A;  2XAH A;  5CYV A;  1B4A A;  2DQL A;  2FNA A;  1VTN C;  5DEQ A;  2P4W A;  3M8E A;  3JSP A;  3BPX A;  2RV8 A;  2FBI A;  2MBF A;  1IN5 A;  1YW8 A;  2D2W A;  5EEG A;  1REP C;  1YW7 A;  2PJP A;  3LA3 A;  4G6Q A;  2M45 A;  3Q5F A;  2DPD A;  1MDM B;  2H6B A;  4XBF A;  1ZN2 A;  2ELH A;  3R0J A;  1T6S A;  4KIF A;  4Q48 A;  3C7J A;  2FEZ A;  4LK0 F;  4AVP A;  1TBX A;  5D6E A;  1B59 A;  4FHT A;  2VBY A;  1G3W A;  3R4K A;  4HW0 A;  1R00 A;  3O2P E;  1LVA A;  1E2X A;  2IP2 A;  4OIQ F;  2NRA C;  3FM3 A;  3E5X A;  4WXH A;  4MTD A;  2OZ6 A;  1S8N A;  1T2K A;  1S6L A;  2VBZ A;  3REO A;  1KU7 A;  3KET A;  1B9N A;  3F8B A;  2PMH A;  3B73 A;  3RIR A;  2HKO A;  3OOP A;  2FQ3 A;  1KU3 A;  2L3D A;  3T1B A;  4EJW A;  4QLC U;  1FP2 A;  3HRM A;  2P5V A;  4IVN A;  1Z9C A;  1FOK A;  5J6X A;  1O57 A;  4TV7 A;  4I7H A;  1P6R A;  3NRV A;  1TW3 A;  2M30 A;  2PEX A;  5H20 A;  2OQR A;  1ZLK A;  5D6F A;  1EH6 A;  4MEY F;  5HDG A;  4YG2 F;  4L9J A;  1SAX A;  1S29 A;  4RB0 A;  4S04 A;  3M8F A;  1IRG A;  1IN7 A;  1WI9 A;  5L3C A;  2NYX A;  4I2O A;  1U5T C;  1BOA A;  3BY6 A;  1J0R A;  3HOT A;  4R79 A;  3ML6 A;  1IXR C;  4RS8 A;  4I01 A;  3WGG A;  4MEX F;  4UHT A;  4Y15 A;  1ZRD A;  1OYY A;  3CUQ C;  1R1T A;  1LNW A;  3HSE A;  4BHC A;  5E1W A;  1STZ A;  2O61 A;  5CVU A;  2VT3 A;  1IW7 F;  3HTU A;  4HV5 A;  1EH8 A;  4LMY A;  3DPL C;  5HDK A;  3T8R A;  4I98 B;  5IT3 A;  1WSU A;  4ZYG A;  1J2X A;  4KIC A;  2EK5 A;  5LEK A;  2HEO A;  1U2W A;  3GUD A;  2CSO A;  3ZMT A;  5D5W B;  2ZXJ A;  3TOB A;  3TGN A;  3FMR A;  4IRH A;  1L0O C;  3H3U A;  2VON A;  1IN6 A;  2A5Y B;  4KMF A;  2R3S A;  5CVJ A;  4XLN F;  4ESJ A;  3QRF F;  1ZYR F;  3K1P A;  3V7C A;  3U1D A;  3R61 A;  2STT A;  3SHF A;  3BWG A;  1UHM A;  2QQB A;  3MZH A;  1LDK B;  2E1C A;  1Z91 A;  3MAJ A;  2E7W A;  5DV5 A;  1BI1 A;  4CGZ A;  1QZY A;  4LJZ F;  4WWC A;  1OKR A;  3VEP A;  2QEN A;  3E97 A;  3KEQ A;  2EV0 A;  3FHZ A;  1DDN A;  2HTS A;  1BIA A;  1D3Y A;  1YLF A;  4CYD A;  3L2C A;  4JQF A;  3I4P A;  1MJB A;  5LGN A;  3JAM K;  4EJT A;  3L9F A;  1XCV A;  5HS8 A;  2EFW A;  4EGZ A;  4G8X A;  4U7D A;  3JTG A;  1DPU A;  3KCC A;  1YYV A;  3QP6 A;  4L9T A;  1HSJ A;  2JT1 A;  2BYV E;  2EFO A;  2FRH A;  2JPB A;  4HF1 A;  2W85 A;  2YPR A;  4YFN F;  1DPR A;  2Z5U A;  5E17 F;  3LAJ A;  4ENM A;  2QBY A;  3LA2 A;  1W7P A;  4M73 A;  3KFW X;  2CG4 A;  4LB5 A;  3K9T A;  5F1R A;  2CQK A;  4A0X A;  5HS9 A;  1P4W A;  1T98 A;  2TDX A;  3VOE A;  3M1E A;  4KN4 X;  4LLL A;  3EET A;  2L4A A;  3F6V A;  4EMS A;  4L0Y B;  1ZG1 A;  2GA1 A;  2P7V B;  3WTW C;  2IA0 A;  5ICC A;  3M7G A;  5AIP A;  1FLI A;  3JW4 A;  4L0Z B;  3K69 A;  2MLK A;  5F64 A;  3HHG A;  2VBX A;  1BI0 A;  2V79 A;  4M74 A;  2H27 A;  4A0Y A;  3CLO A;  3WTT C;  3J80 K;  2L54 A;  2Z99 A;  2IJL A;  3RYP A;  4O6J A;  5FD5 A;  3GYH X;  4BAY A;  3KP7 A;  5LRR A;  5L3G A;  1BC8 C;  1TQP A;  3I59 A;  1HKQ A;  4M9S A;  1UFM A;  2MH9 A;  4GO1 A;  2A3S A;  4AWX B;  1SD7 A;  2XAJ A;  5K5Q A;  4H0E A;  1K78 A;  3FZV A;  2FA5 A;  4HDV A;  3KZZ A;  4LG0 B;  1KU2 A;  2KIU A;  3IL2 A;  4Y17 A;  2EV5 A;  3KLO A;  4HQM A;  3RYR A;  3H92 A;  2RDP A;  2RQP A;  3DP7 A;  3IRR A;  2K27 A;  2STW A;  2QVO A;  3HSR A;  3GO5 A;  3J81 K;  2FXA A;  1W7P D;  4EM0 B;  4GYI A;  5HVQ C;  2HQR A;  1TTY A;  2DK5 A;  4HV6 A;  2HZT A;  4PZJ A;  3KZY A;  4F7Z A;  2QUF A;  4UNO A;  4BHB A;  4E70 A;  1FBU A;  2CGP A;  1AOY A;  2KRF A;  4G7O F;  1USS A;  1RUN A;  1A04 A;  1XB4 A;  1ONV A;  1S7A A;  4P55 A;  1K7A A;  5DCF A;  3TO6 A;  4KIG A;  4OIR F;  2OU2 A;  3F72 A;  3IWZ A;  4AIK A;  2HWV A;  3GFI A;  5D8L B;  1BN5 A;  5TJJ A;  1EH7 A;  3GWZ A;  3ZMV A;  2DW4 A;  1GVJ A;  1IRF A;  5D8K B;  3FXQ A;  3TDU C;  1WRJ A;  2FML A;  3F6O A;  2D1V A;  4O5V A;  4EM1 A;  2VBW A;  3DXJ F;  5L3E A;  4L9N A;  1ZAO A;  4ENN A;  3CO6 C;  1U5T B;  4LD5 A;  3GW2 A;  2DI3 A;  3GF2 A;  2YR2 A;  4BNC A;  3U9G A;  3TKY A;  4G7Z F;  3ZN1 A;  2XIG A;  4IXA A;  4A12 A;  3F8C A;  5ILS A;  2IT0 A;  4BHP A;  2GXB A;  3CUQ B;  3FMS A;  3PQK A;  2G7H A;  4RB3 C;  1MDM A;  3LAP A;  1IXC A;  5ICE A;  1OMI A;  1BI3 A;  3DV8 A;  3QPH A;  3FX3 A;  5FLX K;  4R1H A;  4O3M A;  2PMU A;  3KP2 A;  3WGH A;  1WKM A;  3GZ5 A;  2LNB A;  1FY7 A;  4CDG A;  5D5X B;  2GQQ A;  1XGO A;  5HLI A;  1F9N A;  1MGT A;  4HLY A;  3IKT A;  4LK1 F;  3ELK A;  4CXF A;  3FMQ A;  4A2U A;  5ILU A;  1FBS A;  5HOO A;  3ISP A;  1ON2 A;  1ZRE A;  4OU0 A;  5CJ9 A;  3SZT A;  3DPT A;  2Y75 A;  3W6J B;  3E5Q A;  3LFK A;  4IRG A;  1OPC A;  3ZMU A;  3E6B A;  4IHT A;  1BI2 A;  4YFX F;  5JFR A;  2J5O A;  2VC0 A;  3WU1 B;  1YW9 A;  4I0B A;  5LHH A;  5FO5 A;  2M5W A;  2R7D A;  3V8K A;  2A69 F;  1FP1 D;  1YG2 A;  2HTJ A;  3C3W A;  1P2F A;  3EDP A;  2QWW A;  1FBQ A;  3IRQ A;  4AD9 A;  3V4G A;  3MFK A;  3BJO A;  3RKY A;  2ZO4 A;  3L7W A;  3QAH A;  3P7N A;  1ZAR A;  4M6X A;  2HYG D;  5DCM B;  2ZNY A;  3I5U A;  4RGU A;  5DD4 A;  5CVV A;  2DTR A;  4HDU A;  4RGR A;  2FU4 A;  2VXZ A;  1RI7 A;  3ZMZ A;  2J5P A;  1S7O A;  4EQQ A;  3T8T A;  2F5C A;  4L18 B;  3BP8 A;  5E18 F;  1LDJ A;  1BJA A;  3DKW A;  2EV6 A;  4LGW A;  3RKX A;  3QOP A;  1UB9 A;  1R1V A;  2OQG A;  2XAQ A;  3HYI A;  2RVC A;  1FSH A;  3WTV C;  4MTE A;  2WWY A;  2VC1 A;  1XSV A;  1R5G A;  3KEO A;  3AAF A;  5J8F A;  1ZLJ A;  2K86 A;  2DPU A;  2XAG A;  1JHH A;  2EFQ A;  3I71 A;  1J59 A;  2QYO A;  2MC3 A;  4I09 A;  5LHI A;  5LHG A;  1FSE A;  1IN8 A;  3K1M A;  1KYW A;  2ZCW A;  5FD6 A;  2XRN A;  1BM9 A;  4YFK F;  3IKV A;  2JPC A;  3TOA A;  2LSO A;  2XHK A;  2W25 A;  3R60 A;  2CW0 F;  1XSX A;  1TNT A;  5IT9 Z;  1IUY A;  2W24 A;  3EYY A;  5J8C A;  1I1S A;  1CGP A;  4Z2Y A;  3WE3 A;  3K0L A;  4KA4 A;  3HOS A;  1FYK A;  3E6D A;  1YQA A;  1KQ0 A;  3BDD A;  1SMT A;  4U0Y A;  3ZPL A;  3E6C C;  1ZGJ A;  5H6R A;  2B0L A;  4QWQ A;  2LF7 A;  4A6D A;  5L3B A;  1CF7 B;  1LEA A;  3MQ0 A;  4U0V A;  1UCR A;  1IZ1 A;  2YX7 A;  3RI4 A;  4MHG A;  3U2R A;  3VB2 A;  1PUE E;  2VT2 A;  3ZP5 A;  2P5L C;  3BJA A;  4WF2 A;  1GXQ A;  5D4R A;  4M9X A;  1JGS A;  1O7F A;  4MGR A;  3FXR A;  1H0M A;  1IN4 A;  4IJA A;  4ENK A;  4ZZL A;  1J75 A;  2HKX A;  3F8N A;  3BJ6 A;  2P6T A;  4HF2 A;  2E7X A;  3M9A A;  4GGG A;  1XMA A;  2OBP A;  1EV7 A;  2G7U A;  1Z6T A;  2NNN A;  1R7J A;  1Z6R A;  4RB1 A;  1KQ9 A;  1R23 A;  4FT8 A;  1FYL A;  3Q9S A;  4MQ9 F;  4KNY A;  1ULY A;  2ZME B;  2A61 A;  3ZN0 A;  2H94 A;  3SFZ A;  5E8G A;  4GCV A;  4OMZ A;  2MH2 A;  4WCG A;  1FNN A;  1H9G A;  2V1D A;  2EFP A;  2F5F A;  1TNS A;  2EA4 A;  2BEO A;  2PQ8 A;  5LLQ A;  2ETH A;  2XVC A;  2EWN A;  4BXU A;  1SD5 A;  2Z3Y A;  2MA3 A;  1LDD A;  3OV8 A;  4PCQ A;  2PN6 A;  5LGU A;  3KLN A;  1ZGA A;  1KA8 A;  4IRI A;  1G3Y A;  1Y0U A;  1QZZ A;  1P4A A;  2XGX A;  4NHJ A;  2NS0 A;  4OIO F;  1OR7 A;  2O0Y A;  1R58 A;  2PI0 A;  5LBQ A;  4G6D A;  4HLX A;  5L3F A;  2IA2 A;  4IF4 A;  2O3F A;  4L5J A;  2BBY A;  3ROU A;  5BS6 A;  3V7S A;  1SD4 A;  4LLG F;  1XSD A;  3O3K A;  4LG0 A;  4KN7 X;  4EV0 A;  1YS6 A;  1Q1H A;  1OYI A;  2ESN A;  1YS7 A;  3GLX A;  4LFU A;  5LRS A;  2CWE A;  2COM A;  2KJC A;  5AIQ A;  1XCB A;  5ED4 A;  1V4R A;  2CYY A;  3GVA A;  4B8X A;  3F22 A;  1XD7 A;  3ERE D;  5BMZ A;  3LQR A;  3CJN A;  2ZKZ A;  2HS5 A;  3V7R A;  4HOB A;  3BRO A;  4EGY A;  1D8K A;  2XKO A;  4D0P A;  2FF4 A;  2QQA A;  3LQQ A;  2MLG A;  4ZYH A;  5E8I A;  1XGS A;  3CUO A;  5BPD A;  1MKM A;  3IHU A;  5LEJ A;  3HRS A;  2QM3 A;  3WTS C;  4UUV A;  1KU9 A;  3NQO A;  4Q47 A;  2L02 A;  4A0Z A;  1IXS B;  4B09 A;  1YIO A;  2K4B A;  4L5I A;  2FBK A;  3BOQ A;  1JXS A;  3SXY A;  2QZ8 A;  2ZBK A;  4ZYD A;  4KMU X;  3H3Z A;  3HSF A;  3PFI A;  2HFH A;  1QPM A;  1W4M A;  2KIF A;  4OIN F;  2Y0M A;  5DDG A;  2HGC A;  4P9U A;  2V1U A;  2DU9 A;  4G94 A;  5BOX A;  3E6M A;  1K6O A;  2M87 A;  5HS7 A;  3QU6 A;  1Z1D A;  3WTX C;  1U5T A;  2IA1 A;  2BGC A;  5DUK A;  4Q4Z F;  1JHF A;  1I1G A;  4OMY A;  2VOD A;  5A2Q Z;  1LQ1 A;  4JK1 X;  2PFB A;  2RN7 A;  5CLS A;  4EM2 A;  1PP7 U;  3CUQ A;  2PG4 A;  1SFE A;  5LGT A;  4YII A;  2CFX A;  1QBJ A;  4NQW A;  3MWM A;  2EFN A;  4PGH A;  1C0W A;  2A6H F;  2UXN A;  2FBH A;  2XUB A;  4UVC A;  3VFZ A;  4HF0 A;  2MD5 A;  3WE2 A;  4EVI A;  2P7C B;  1J7K A;  4Y13 A;  4UV8 A;  2EJR A;  4ESF A;  4RGX A;  2DFI A;  3N4M A;  4XLP F;  3B02 A;  4IHS A;  1ZRF A;  4XRF A;  5KK1 A;  2K4J A;  4HQE A;  4KT5 C;  1SFX A;  5E20 A;  5BQT A;  1D8J A;  3JTH A;  3ABU A;  2IW5 A;  1RUO A;  4Q5S F;  3T5X A;  2GXG A;  3I58 A;  4UXN A;  1I5Z A;  2Z9O A;  1ZRC A;  1XGN A;  3E5U A;  2BV6 A;  2OZU A;  2DQR A;  5CVR A;  2KJB A;  2F2E A;  1SD6 A;  1O3T A;  2OAZ A;  4M72 A;  5ERI A;  2YSR A;  1BBY A;  2KIM A;  3FXU A;  5E1X A;  1XN7 A;  3KE2 A;  2GZW A;  3KP4 A;  2NAZ A;  5H6Q A;  4S05 A;  1Z05 A;  1W5S A;  2H09 A;  4P96 A;  3N97 A;  3SQN A;  3ZQ7 A;  5DYM A;  5DCM A;  3JSO A;  1FX7 A;  1FPQ A;  3TQN A;  2FE3 A;  2DAO A;  2HR3 A;  4MQV A;  1XGM A;  2ZFW A;  1U78 A;  4A5M A;  1FYM A;  2IVM A;  2L4M A;  1ZHF A;  2JSC A;  4WXD A;  3W6K B;  1AWC A;  3QPT A;  4MNU A;  1KYZ A;  4CZZ A;  1B1B A;  2P6S A;  1UST A;  4M6Y A;  3WU0 A;  3COA C;  1BC7 C;  2VOO A;  4XSZ F;  3IWF A;  3I54 A;  1LJ9 A;  1RZ4 A;  3QP5 A;  3I53 A;  3WTZ A;  3HUG A;  5ILV A;  4RAZ A;  5BPI A;  2A68 F;  5TRD A;  3MZY A;  3RKW A;  3F23 A;  2ACJ A;  4DNC A;  2KKO A;  4LB6 B;  3K2Z A;  2EA2 A;  1YTY A;  1I6X A;  4UV9 A;  2AS5 F;  5HDN A;  4OIP F;  4IPA A;  1CF7 A;  3C18 A;  1GHC A;  2YX4 A;  4ETS A;  4U7B A;  1R5H A;  1R22 A;  4KUM A;  2R7F A;  3LST A;  5HLH A;  3J7A O;  2Q8K A;  2PLY A;  3EQL F;  5E1Z B;  3FF5 A;  2RC4 A;  2ISZ A;  2ADU A;  1QGP A;  1IAW A;  2V1X A;  2GA2 A;  4HX7 A;  2F5E A;  1G3S A;  3CDH A;  4AIJ A;  2WTE A;  3BPV A;  3V8L A;  2V9V A;  1SFU A;  1S3J A;  3FWE A;  3PQJ A;  1MJ9 A;  2VE8 A;  5ICG A;  3HRT A;  3V8J A;  2UXX A;  3WGI A;  5KVR A;  1U6G A;  2F5D A;  3E3V A;  2G9W A;  2RNJ A;  2XKP A;  5K5R A;  1YFH A;  1D5V A;  1BIB A;  3S2W A;  3WOD F;  1DP7 P;  2ZME A;  3EUH A;  2CO5 A;  1OYW A;  1L3L A;  3RDI A;  1HQC A;  1FC3 A;  4UVB A;  5DUI A;  3GEZ A;  1B6A A;  3K1N A;  3WTU C;  4BQA A;  4ON0 A;  2QLZ A;  4G7H F;  2K02 A;  1HXD A;  2PBI A;  1HKT A;  2GIV A;  2HOE A;  3BZ6 A;  2UZK A;  1ZG3 A;  5AON A;  4BH9 A;  2XV4 S;  1G6N A;  5FFZ A;  1TW2 A;  4P9F A;  1F1Z A;  4A6E A;  3SZP A;  3RJP A;  5ICF A;  2YU3 A;  3ECH A;  4R8H A;  4FX4 A;  5DD8 A;  2O6G E;  4AIH A;  1ODD A;  2E1N A;  4I0A A;  3JAM Z;  4PGG A;  2DT5 A;  1H9T A;  2H6C A;  6PAX A;  1LB2 A;  2FOK A;  1TQI A;  4HAM A;  3P9C A;  5FB2 A;  5IT9 K;  5EEH A;  4N9H A;  5K5O A;  1B9M A;  1R36 A;  2X4H A;  1ZG5 A;  1XMK A;  1R1U A;  4KIB A;  1PP8 F;  3RPQ A;  3GFJ A;  2FNP A;  3QU3 A;  1O3S A;  1GXP A;  1J9I A;  4P5O A;  3GFM A;  2DLL A;  3LWF A;  3GFL A;  3KP6 A;  1V3F A;  2OA4 A;  3KP5 A;  2JRT A;  2X0L A;  2A6E F;  2VN2 A;  2LKP A;  3DFG A;  1T39 A;  4LLN A;  4I02 A;  2JTV A;  3D5L A;  3P9K A;  1KGS A;  2P5K A;  1P92 A;  1U3E M;  4L9V A;  4ENJ A;  2NNY A;  1Z7U A;  3ABT A;  4OOI A;  1HKS A;  2GWR A;  1UHW A;  4XSX F;  4HX8 A;  4JBA A;  4HBL A;  3MCZ A;  4N0B A;  5FFX A;  3G3Z A;  2HDC A;  3DQV C;  4EJO A;  3J80 Z;  3I64 A;  4FX0 A;  1HST A;  5D5V B;  1U8R A;  2XAS A;  1G3T A;  4G9Y A;  3F3X A;  4WXC A;  3RTR A;  1WWX A;  2DO7 A;  3ECO A;  2FSW A;  2D45 A;  5JHU A;  1F4K A;  4CHU A;  1E17 A;  3DF8 A;  1RNL A;  2VE9 A;  1JE8 A;  1ON1 A;  4M9Z A;  1RIO H;  3ZMS A;  2D1H A;  1SMY F;  2EB7 A;  1NHA A;  1O3Q A;  2W84 A;  1P4X A;  2C6Y A;  2Y48 A;  2ISY A;  2RKH A;  3Q9V A;  3HTS B;  2GAU A;  3J81 Z;  3L09 A;  2IRF G;  1F5T A;  4HZF A;  3CTA A;  3G73 A;  5JR3 A;  3I0T A;  1HBX G;  2OD5 A;  2V6C A;  3WG9 A;  4K2E A;  2AXL A;  1XDS A;  1I27 A;  2Q2E A;  3C1D A;  4CIC A;  3HRU A;  3O6B B;  2ESH A;  3KP3 A;  2XAF A;  4N9I A;  4KFC A;  3P9I A;  2ZNZ A;  4ZYE A;  2UWM A;  4BYY A;  1T0F A;  2LF8 A;  4YIF A;  4ZZD A;  2A07 F;  2QBY B;  3NEU A;  1W7P B;  2K7L A;  5L3D A;  4U88 A;  2DBB A;  1W5T A;  2O03 A;  2HYF A;  5JVT A;  2O8X A;  1KQ8 A;  5FGM A;  4UVA A;  4HA8 A;  2JZY A; 
#chains in the Genus database with same CATH topology
 2P8T A;  3KYD B;  5GPA A;  2AO9 A;  2F6C A;  1VQ6 I;  3R0A A;  4HYE A;  4KYW A;  1J5Y A;  3TO7 A;  4X6A J;  2HZD A;  2E35 A;  3U21 A;  1E3O C;  3RPU A;  2JQ7 A;  3VOD A;  1QNT A;  3UKG A;  3D0S A;  1ITY A;  4JX5 A;  3FK6 A;  4GXO A;  3HKZ A;  4EJU A;  4PDK A;  2CQ7 A;  4BDZ A;  1G4D A;  2M3A A;  3QWL A;  2OCC H;  3OS0 A;  1D1C A;  3OOU A;  2ME6 A;  2ZJ2 A;  2W57 A;  4M3G A;  1IF1 A;  1VQ7 I;  2NXN B;  4RB2 C;  3TDZ C;  3GXO A;  4ESB A;  3M3Y J;  3OYH A;  3ZMD A;  4V19 K;  3F8M A;  1X1C A;  2FMY A;  3LA7 A;  3FBI B;  3L1P A;  1Y39 A;  1FZP B;  3PNV A;  3OR2 C;  2M1B A;  4CO8 A;  2RRE A;  2UUZ A;  1FOX A;  3I59 B;  1J09 A;  5JI6 A;  4NB5 A;  4JX4 A;  2IPQ X;  4FE4 A;  3JRI A;  2JVH A;  4DYR A;  1WPK A;  3F8F A;  2WC2 A;  1QQI A;  3MEX A;  3TO9 A;  1MBJ A;  3BLY A;  3MKL A;  4RM2 A;  3F21 A;  4CZC A;  3GLL A;  4ZH4 F;  5C3E J;  1K78 B;  1W36 D;  5FKL A;  1TQM A;  4XN0 A;  5EF6 A;  3CCS I;  3BG9 A;  4KDP A;  5HLG A;  3R6S A;  4BE2 A;  5D4S A;  4CH7 A;  2XRO A;  2Z33 A;  1QPI A;  2QSF X;  3FM5 A;  3JR9 A;  3ONQ A;  2HDW A;  2RGV A;  4RAY A;  3CMY A;  5FLX Z;  1K79 A;  1ZR4 A;  2IGO A;  3OYJ A;  3KZI C;  4M71 A;  1MZB A;  1YO5 C;  1FIA A;  5M5W J;  2HQN A;  3WTY C;  4AVZ A;  1MD0 A;  1HW2 A;  2VOP A;  4XOT A;  4CCN A;  1FIP A;  3IAS 2;  1FEX A;  3CO7 C;  3DEU A;  1O7L A;  1X3U A;  4RGS A;  1ZH5 A;  3CES A;  3MD2 A;  2VIX A;  1FT9 A;  1LFB A;  2Y2Z A;  4WX9 A;  1EF4 A;  2M8E A;  1SAU A;  1K6Y A;  3L00 A;  4EAT A;  5A2Q K;  5EDN A;  3IH4 A;  1R71 A;  2OC6 A;  1MJA A;  3EYI A;  3CZ6 A;  2M7B A;  2EIJ H;  5GAE J;  2PMZ A;  3C2B A;  3SZG A;  1TLH B;  1H88 C;  1QO0 D;  4NC7 A;  1PDN C;  3HIF A;  5HNF A;  5K1Y A;  2BE5 F;  4HX4 A;  2QQ9 A;  5E79 C;  1X1B A;  4U0W A;  1X1A A;  3CJQ B;  4F55 A;  3IC7 A;  1DGR M;  3LFU A;  2K40 A;  4M3B A;  3CMM A;  4EJV A;  3CMA I;  5IY5 H;  4XIC A;  1O3R A;  2WV0 A;  1XDU A;  2R7Z J;  3O8G A;  5F6F A;  2Q0O A;  3OR1 C;  3GX4 X;  1T8I A;  2H8W A;  3G1M A;  2KL4 A;  3UR3 C;  2RQQ A;  5DTD A;  4FET A;  1N75 A;  1OCT C;  1YIJ I;  2L0K A;  5CVI A;  4ASN A;  1HW1 A;  4IQJ A;  1VFC A;  5F04 A;  1SVO A;  2JA8 J;  3BTJ A;  1LEB A;  1HW5 A;  4B43 A;  4FIS A;  4DQ2 A;  4CCJ A;  1AHD P;  3WHC A;  4C3J J;  5J1Y A;  1LUJ B;  4A5N A;  3GZ6 A;  2DK8 A;  2JWT A;  1QVT A;  5D5U B;  3ULQ B;  2F4O B;  1WQ2 A;  2NOJ B;  1YHQ I;  3T0Y A;  2X6W A;  3OIQ A;  1FWZ A;  1T38 A;  4DW6 A;  3CCE I;  4GYG A;  1DUX C;  2L01 A;  4WK8 F;  3BG5 A;  2LDU A;  3BG3 A;  2XAH A;  3HHH A;  5CYV A;  1B4A A;  2LY9 A;  2QKL B;  3OYL A;  1OR7 C;  2DQL A;  2FNA A;  2M34 A;  3BTI A;  3BR5 A;  5DEQ A;  2ZSI B;  1VTN C;  2KIQ A;  2P4W A;  3M8E A;  3JSP A;  3LSK A;  2XPV A;  4MFE A;  3A2K A;  2KHM A;  1U9N A;  4YEL A;  1WJD A;  3ABK H;  3BPX A;  2RV8 A;  2AQE A;  2FBI A;  1Z3X A;  1P7I A;  2MBF A;  1IN5 A;  4CCM A;  2WAQ N;  3QPL A;  5B1A H;  1YW8 A;  4M3E A;  3FXK A;  4XID A;  3LSJ A;  2E2H J;  2D2W A;  3AG4 H;  3OYN A;  1AA7 A;  5EEG A;  3ZOB A;  4BY1 J;  2WB1 A;  2AHQ A;  1REP C;  1X4P A;  1YW7 A;  5J40 A;  2PJP A;  4A3E J;  3ZQC A;  3LA3 A;  4G6Q A;  1UJ8 A;  2M45 A;  3Q5F A;  5IOZ A;  2DPD A;  1MDM B;  2H6B A;  4XBF A;  1ZN2 A;  2ELH A;  2K9M A;  2D5V A;  3FKJ A;  3R0J A;  3L2Q A;  1FTT A;  1T6S A;  3CQZ J;  4KIF A;  4Q48 A;  3C7J A;  5EEA A;  3CME I;  2NVT J;  2FEZ A;  2OPT A;  4LK0 F;  2NVU B;  2V6E A;  4AVP A;  3W6V A;  3PFY A;  1TBX A;  3HPH A;  2F48 A;  4KJZ A;  1QHH D;  5D6E A;  1B59 A;  4FHT A;  2XF6 A;  3S8P A;  2VBY A;  1Y8Q B;  4XRM A;  1G3W A;  1SFO J;  2WY8 Q;  3R4K A;  2QF7 A;  4HW0 A;  5HLT A;  1R00 A;  2MYS A;  1WJB A;  1U9O A;  3O2P E;  1LVA A;  2GLO A;  2DMQ A;  2DMN A;  1GV5 A;  1E2X A;  2IP2 A;  4AC0 A;  5CKT A;  4DYC A;  4OIQ F;  1GDT A;  2NRA C;  1MSE C;  2IEK A;  3G1L A;  3M07 A;  4F92 B;  3FM3 A;  3E5X A;  4WXH A;  4MTD A;  4RAF A;  2VLA A;  2OZ6 A;  3ERM A;  4BBS J;  1S8N A;  1T2K A;  4D7M A;  1S6L A;  5KHD A;  1MBK A;  2VBZ A;  1MMD A;  3REO A;  1KU7 A;  3CC4 I;  3KET A;  1B9N A;  3F8B A;  3DU5 A;  2PMH A;  3B73 A;  3RIR A;  4S0H B;  2L2O A;  1B72 B;  2HKO A;  2R92 J;  3OOP A;  1IRZ A;  2FQ3 A;  5KNL A;  1KU3 A;  3CCY A;  2L3D A;  3T1B A;  4EJW A;  4QLC U;  2ZJP F;  1RR7 A;  2RAE A;  1T33 A;  3I56 I;  1FP2 A;  3HRM A;  2P5V A;  4IVN A;  1Z9C A;  1FOK A;  5J6X A;  5EG0 B;  5LD2 C;  4BE0 A;  3E0J B;  3HEF A;  2M2E A;  1O57 A;  2L9N A;  4TV7 A;  1ZKG A;  3BCB A;  4I7H A;  1P6R A;  1JTX A;  4RBO A;  2HPI A;  3NRV A;  1TW3 A;  2M30 A;  2PEX A;  3BTC A;  5DS9 A;  5H20 A;  2OQR A;  1ZLK A;  4XM3 A;  5D6F A;  1EH6 A;  2MC4 A;  4MEY F;  5HDG A;  4YG2 F;  3K70 D;  4L9J A;  1SAX A;  3K10 A;  1S29 A;  4RB0 A;  4S04 A;  3KYC B;  2DMU A;  3M8F A;  1IRG A;  1IN7 A;  2F4I A;  2X9D A;  4BUP A;  1WI9 A;  5L3C A;  2DT7 B;  2NYX A;  4I2O A;  5FKM A;  1GV2 A;  3L2R A;  1U5T C;  1BOA A;  2X51 A;  3TL4 X;  3BY6 A;  1J0R A;  3HOT A;  2B7E A;  4R79 A;  3FDY A;  3ML6 A;  1HOM A;  1IXR C;  4RS8 A;  4I01 A;  2EZL A;  3WGG A;  4MEX F;  1LVK A;  3MVP A;  2QQ8 A;  1UZC A;  3A01 B;  1ZGW A;  4UHT A;  4Y15 A;  1ZRD A;  2A05 A;  2BVL A;  2E1M B;  2M0M A;  1HA8 A;  1WI3 A;  1TWH J;  1OYY A;  3PUF A;  3CUQ C;  1VF9 A;  3DLL F;  3H9J A;  1R1T A;  1LNW A;  3HSE A;  4D7N A;  4BHC A;  5E1W A;  1STZ A;  2O61 A;  5CVU A;  2CQN A;  2VT3 A;  3P5J A;  2FOW A;  1IW7 F;  3HTU A;  4HV5 A;  1EH8 A;  4LMY A;  5FKK A;  4ZJZ A;  4A93 J;  3DPL C;  5HDK A;  2VJJ A;  3GBG A;  2VUM J;  3T8R A;  3ASN H;  4I98 B;  5IT3 A;  1WSU A;  3WU2 C;  3CF5 F;  5HOD A;  1T08 B;  2H8R A;  4ZYG A;  2B9S A;  2XGE A;  3C2H A;  5HNH A;  1J2X A;  1K4T A;  2DMP A;  4KIC A;  4XLH A;  2EK5 A;  5LEK A;  2KRC A;  1YX3 A;  3Q0U A;  2HEO A;  1U2W A;  1WHU A;  1NG7 A;  3GUD A;  2CSO A;  3ZMT A;  5D5W B;  2ZXJ A;  3WG7 H;  5DM6 F;  3DU6 A;  2R7V A;  3H5R A;  3TOB A;  4BEH A;  3TGN A;  2M4G A;  3FMR A;  3OYK A;  1MMG A;  3PL8 A;  2VKE A;  2JN6 A;  4IRH A;  1DU0 A;  2VL8 A;  1L0O C;  3H3U A;  2KMU A;  3S1M J;  2VON A;  5JLX A;  1IN6 A;  5M5Y J;  1JT6 A;  2A5Y B;  2R3S A;  2DMT A;  2EQR A;  5CVJ A;  4XLN F;  4KMF A;  1IDZ A;  5EZH A;  3VPR A;  4ESJ A;  5E3O A;  3QRF F;  1ZYR F;  3K1P A;  2R7W A;  3GTK J;  3V7C A;  3BQZ A;  3H5A A;  4E7L A;  3U1D A;  5EGO B;  3R61 A;  2R7O A;  1LE8 B;  3IH3 A;  2STT A;  3SHF A;  1LFP A;  2IGK A;  3BWG A;  3K4N A;  3QOD A;  1UHM A;  3BR2 A;  2QQB A;  3MZH A;  1LDK B;  1DGW Y;  1ORK A;  3VYR B;  4PJJ A;  2MW8 A;  1JJ8 C;  2E1C A;  2BW3 A;  1FOY A;  1Z91 A;  3MAJ A;  3NAU A;  1JKQ C;  4QTR A;  1AKH A;  3HOU J;  2E7W A;  5DV5 A;  1IUF A;  1BI1 A;  4E6K G;  4CGZ A;  1QZY A;  4LJZ F;  4WWC A;  3HBL A;  1VI0 A;  2R5Y A;  1OKR A;  4ZTJ A;  3VEP A;  1BJZ A;  1OCP A;  2K9S A;  2QEN A;  1TT0 A;  3E97 A;  2R5Z A;  1MSF C;  3KEQ A;  2EV0 A;  3I9V 2;  3FHZ A;  2LMD A;  1DDN A;  2HTS A;  1BIA A;  5C44 J;  1D3Y A;  1R5I D;  3HGG A;  2LVS A;  1YLF A;  4CYD A;  1VQ4 I;  1LPQ A;  3L2C A;  2L7F P;  2XF7 A;  2ZXH A;  4JQF A;  3I4P A;  4UUS B;  4OAY A;  1MJB A;  5LGN A;  3DBH B;  2DA6 A;  3JAM K;  1OCZ H;  5J3L A;  4EJT A;  3L9F A;  1XCV A;  5HS8 A;  2EFW A;  3J7Y J;  4EGZ A;  5IOY A;  4G8X A;  3HOY J;  1WVR A;  4U7D A;  2IAI A;  3OYM A;  2COB A;  3JTG A;  2WAQ A;  3HC7 A;  1DPU A;  3WHB A;  3KCC A;  2L9R A;  2HVS A;  1YYV A;  3QP6 A;  2BY0 A;  4DJA A;  3D5R C;  3L2W A;  4L9T A;  1PUF A;  1HSJ A;  2L9S A;  2JT1 A;  4RLQ A;  4OAZ A;  2BYV E;  2EFO A;  2LBF B;  2FRH A;  4RM3 A;  2JPB A;  2XPW A;  3MKW B;  4HF1 A;  1JKP C;  2W85 A;  2CUF A;  2YPR A;  4YFN F;  1DPR A;  2Z5U A;  5F08 A;  5E17 F;  3LAJ A;  2O7O A;  2BY3 A;  4ENM A;  4CA0 A;  3W3C A;  2W00 A;  4XQF A;  2QBY A;  3LA2 A;  1W7P A;  4M73 A;  3KFW X;  2CG4 A;  4BJ6 C;  4RDU A;  1MBH A;  4XOR A;  4XRS A;  5E3M A;  1H89 C;  3HG9 A;  3HXL A;  2WB1 N;  4LB5 A;  3K9T A;  5F1R A;  2CQK A;  2CV0 A;  4A0X A;  5HS9 A;  2V7F A;  1UMQ A;  4IQ4 A;  1P4W A;  1T98 A;  2TDX A;  3VOE A;  4HNU A;  1O4X A;  4D9J A;  3M1E A;  4N4O B;  4KN4 X;  4LLL A;  2KIS A;  3S1R J;  1BL0 A;  4NDL A;  3EET A;  2L4A A;  3F6V A;  4EMS A;  4L0Y B;  2LOO A;  1ZG1 A;  2IS2 A;  2GA1 A;  2P7V B;  3BZK A;  5BNG A;  1S72 I;  3FXO A;  3WTW C;  2IA0 A;  5ICC A;  3M7G A;  5AIP A;  1FLI A;  2IGM A;  2MAB A;  2VKH A;  3JW4 A;  4L0Z B;  3K69 A;  1TP4 A;  3K4J A;  3ZQH A;  2KT0 A;  2MLK A;  5F64 A;  1A36 A;  1IRX A;  3HHG A;  3CC2 I;  4ZC3 A;  2VBX A;  2IS6 A;  1A6I A;  1BI0 A;  2V79 A;  4M74 A;  2H27 A;  2ZXW H;  2CU7 A;  3OIO A;  2NVQ J;  4A0Y A;  3CLO A;  3WTT C;  2MGQ A;  3J80 K;  2QSG X;  2L54 A;  2Z99 A;  2EIN H;  2IJL A;  1ACI A;  3RYP A;  3G6E I;  4O6J A;  5FD5 A;  2M8G X;  3SFI A;  3GYH X;  4AYB N;  4BAY A;  3KP7 A;  3EUA A;  5LRR A;  5L3G A;  4E7I A;  1UG2 A;  1FJL A;  1BC8 C;  1TT5 B;  1TQP A;  3I59 A;  3VYS B;  1HKQ A;  4BKX A;  1JUS A;  4M9S A;  3OY9 A;  2H1K A;  4XR6 A;  2CH0 A;  1UFM A;  2CUJ A;  1QA6 A;  2KFD A;  4UUT A;  3L2U A;  2MH9 A;  4GO1 A;  2A3S A;  4AWX B;  1SD7 A;  2XAJ A;  5K5Q A;  4H0E A;  2R7Q A;  1VZ0 A;  2QGU A;  3G2B A;  1K78 A;  2W48 A;  3OIP A;  3FZV A;  2FA5 A;  4HDV A;  3AL0 C;  4A3D J;  3KZZ A;  1RPW A;  4LG0 B;  1KU2 A;  2KIU A;  3IL2 A;  4Y17 A;  1Z7L A;  2JA6 J;  2P0W A;  2EV5 A;  3KLO A;  4HQM A;  3TW6 A;  1QU3 A;  4E7K A;  3RYR A;  3H92 A;  5C4X J;  2RDP A;  1OLT A;  3CCM I;  2RQP A;  4NNJ A;  4ZTF A;  3DP7 A;  1NG6 A;  2XSD C;  3GTO J;  4JYK A;  3IRR A;  4A3F J;  5M5X J;  2K27 A;  2STW A;  2QVO A;  3HSR A;  4B47 A;  4DZP A;  3GO5 A;  3J81 K;  1FTZ A;  2FXA A;  1W7P D;  4DZJ A;  4EM0 B;  4GYI A;  5HVQ C;  2HQR A;  1W1W E;  1WJF A;  1MBE A;  2E71 A;  3EPZ A;  1TTY A;  3K4M A;  1XG1 A;  2DK5 A;  4HV6 A;  2HZT A;  4PZJ A;  3KZY A;  4F7Z A;  1IGN A;  2QUF A;  4XRS G;  2ZME C;  5B66 C;  4UNO A;  3EUH C;  4BHB A;  4E70 A;  1VQK I;  1FBU A;  4ZDO A;  2CGP A;  1AOY A;  4A3L J;  3I55 I;  3KYL A;  2KRF A;  5FRO A;  3TBI A;  4G7O F;  1USS A;  1RUN A;  1A04 A;  3Q0W A;  2OUM A;  1XB4 A;  1RET A;  4B3A A;  4C2U A;  5K7F A;  4JP0 A;  4DOZ A;  1ONV A;  1S7A A;  4P55 A;  4F3Q A;  4QPO A;  5E3N A;  3Q0V A;  1K7A A;  5DCF A;  3TO6 A;  4KIG A;  4OIR F;  4BQO A;  2OU2 A;  3F72 A;  3IWZ A;  4AIK A;  2LKX A;  3PSI A;  2HWV A;  1P9Q C;  3AG1 H;  3OMY A;  3K4L A;  1F36 A;  2ECB A;  3GFI A;  1LFU P;  1YE9 A;  4KIT B;  1RKW A;  1TL8 A;  4A3M J;  2X6O A;  5D8L B;  1BN5 A;  5TJJ A;  1YRN B;  1EH7 A;  3GWZ A;  4DIQ A;  3ZMV A;  2DW4 A;  2YUS A;  2ME0 A;  1GVJ A;  1IRF A;  4YEJ A;  2R7R A;  5D8K B;  3FXQ A;  1VQM I;  2IS4 A;  4Y4R A;  3TDU C;  1WRJ A;  2ZSH B;  2IGN A;  4H4K C;  3H9G A;  2FML A;  4FAS D;  1MND A;  2LP0 A;  3F6O A;  4XOP A;  3PJR A;  3DBR B;  4FTH A;  2D1V A;  1W0U A;  2E36 A;  4O5V A;  2NS8 A;  2VBW A;  4EM1 A;  1K4S A;  1RES A;  2K9N A;  3DXJ F;  5L3E A;  2VI6 A;  4L9N A;  2H1L A;  5B1B H;  3TW7 A;  1ZAO A;  2ELK A;  2JVG A;  3CO6 C;  4ENN A;  3S1Q J;  1U5T B;  1XTA A;  1ETK A;  4LD5 A;  4IX7 A;  1D0X A;  3PO2 J;  2GXA A;  5IYD J;  3GW2 A;  1SEU A;  3CJT B;  3S17 J;  1D1B A;  2DI3 A;  3GF2 A;  2YR2 A;  4BNC A;  2ELJ A;  1TWF J;  4JOM A;  2CQX A;  3RCO A;  3U9G A;  3TKY A;  4G7Z F;  2HQ5 A;  2NVY J;  2XIG A;  3ZN1 A;  3W2A A;  3TMO A;  3K4K A;  1A5J A;  4IXA A;  4A12 A;  3F8C A;  4V2F A;  5ILS A;  2IT0 A;  3H3V K;  2R7T A;  2GOX B;  4BHP A;  4BGD A;  2GXB A;  3CUQ B;  3FMS A;  2Z16 A;  3PQK A;  4J01 A;  2G7H A;  4RB3 C;  1MDM A;  1PJR A;  4NUB A;  3LSG A;  2TCT A;  4NQW B;  3LAP A;  1IXC A;  3RSN A;  5ICE A;  1OMI A;  3A1Y A;  3JRG A;  1BI3 A;  3S3N A;  3DV8 A;  3QPH A;  1G2H A;  3FX3 A;  5EYR A;  5FLX K;  3HL2 A;  4BJT A;  4R1H A;  3TED A;  2MSY A;  2L7Z A;  4O3M A;  2HXI A;  5K7H A;  1NK2 P;  2PMU A;  1QHG A;  3KP2 A;  2K9Q A;  1VQ9 I;  3DWL E;  3WGH A;  1WKM A;  4LIV A;  3Q3S A;  3GZ5 A;  2LNB A;  1FY7 A;  1OCR H;  2CMP A;  4YIR X;  2WBM A;  4PFO A;  2F5V A;  4BU2 A;  4CDG A;  2EZH A;  5D5X B;  2NS7 A;  1XC5 A;  2GQQ A;  3LSP A;  3HDD A;  1MMN A;  1XGO A;  5HLI A;  1F9N A;  1MGT A;  4HLY A;  3IKT A;  4LK1 F;  3ELK A;  4CXF A;  2KZV A;  1V54 H;  3O8H A;  1R4M B;  3VWB A;  3FMQ A;  4A2U A;  5ILU A;  2X6Y A;  4CSW A;  1B72 A;  1FBS A;  2Y9Z A;  3BR3 A;  5HOO A;  4XNF A;  4LIT A;  2ZXI A;  3ISP A;  1ON2 A;  2XDV A;  2OJE D;  1D5Y A;  1ZRE A;  4OU0 A;  5CJ9 A;  2V26 A;  5F0C A;  3SZT A;  1S5L C;  3DPT A;  5J1U A;  2Y75 A;  3D5S C;  3W6J B;  2XSJ C;  3E5Q A;  1M1E B;  3LFK A;  4IRG A;  3S32 A;  1OPC A;  3ZMU A;  5EG0 A;  1WH5 A;  3E6B A;  4IHT A;  1BI2 A;  2VQL A;  1Y1W J;  1YOV B;  3PNT A;  4YFX F;  5JFR A;  3PSF A;  2J5O A;  2CUZ A;  2FX0 A;  2VC0 A;  2O8K A;  3WU1 B;  1YW9 A;  4I0B A;  2EIK H;  5LHH A;  5FO5 A;  2XRL A;  2M5W A;  5B5E C;  2DDB A;  2R7D A;  3CD6 I;  4PJM A;  3S15 J;  3V8K A;  2A69 F;  1FP1 D;  2DOE A;  4CUG A;  4XKV A;  2NOG A;  4IHV A;  1YG2 A;  2HTJ A;  5H2F C;  1Z77 A;  3C3W A;  1P2F A;  3EDP A;  2XB5 A;  2QWW A;  3CP8 A;  1FBQ A;  3CCJ I;  3IRQ A;  4AD9 A;  1JI8 A;  1XPX A;  3V4G A;  4F93 B;  3MFK A;  3BJO A;  4IHX A;  3ASO H;  3VYU B;  3RKY A;  2ZO4 A;  3L7W A;  3QAH A;  3P7N A;  1ZAR A;  4HSR A;  3A01 A;  4M6X A;  3JRD A;  2HYG D;  5DCM B;  1W36 C;  2ZNY A;  3F9K A;  2OTL I;  4AYB A;  3FKI J;  3I5U A;  3GTJ J;  2LY2 A;  4IHY A;  4RGU A;  5DD4 A;  4D5F A;  5CVV A;  2DTR A;  4HDU A;  2DA4 A;  4RGR A;  2FU4 A;  2VXZ A;  1RI7 A;  3ZMZ A;  4CYC B;  2VKV A;  2J5P A;  1RKT A;  1S7O A;  4EQQ A;  2BHY A;  3T8T A;  4XKB A;  2F5C A;  1V5F A;  4L18 B;  3BP8 A;  5E18 F;  1LDJ A;  3AFH A;  3I4M J;  1BJA A;  3GTL J;  2K3P A;  3DKW A;  2EV6 A;  1XS9 A;  4LGW A;  3RKX A;  3IP4 B;  3QOP A;  1UB9 A;  1R1V A;  2OQG A;  2XAQ A;  3IUO A;  3CCU I;  3HYI A;  4Y3O A;  2RVC A;  1BW6 A;  1FSH A;  3WTV C;  2MD0 A;  3BR6 A;  4PUS A;  4PSW A;  2YS9 A;  2V9P A;  4BQQ A;  1HC8 A;  2E2I J;  4MTE A;  2DA3 A;  3W2W A;  1MMS A;  2WWY A;  2VC1 A;  3OS1 A;  1XSV A;  1ETQ A;  1R5G A;  2L7K A;  3HJE A;  3KEO A;  1YX5 A;  4W97 A;  5J8F A;  3AAF A;  1ZLJ A;  2K86 A;  2DPU A;  2XAG A;  1ETO A;  2B63 J;  2KQR A;  1JHH A;  2EFQ A;  3I71 A;  4PJ0 C;  5GTI C;  1J59 A;  4N4N B;  2QYO A;  2BXZ A;  2MC3 A;  4I09 A;  1IC8 A;  5LHI A;  1X19 A;  5LHG A;  1FSE A;  2BVM A;  1IN8 A;  3JRA A;  3K1M A;  1KYW A;  2F4M B;  4NC8 A;  2DJI A;  1ZR2 A;  4BXX J;  2ZCW A;  3G1O A;  5FD6 A;  2XRN A;  1RC9 A;  1BM9 A;  4YFK F;  2IXS A;  3IKV A;  3S1N J;  5GPC A;  3EUK L;  2LR8 A;  2JPC A;  3TOA A;  2LSO A;  2XHK A;  3LSI A;  2W25 A;  3R60 A;  3HUG B;  4RLF A;  4IO9 F;  2CW0 F;  4B4C A;  1JJ6 C;  1FOW A;  5EGO A;  3LNQ A;  4RAG A;  2LD5 A;  1LE8 A;  2VPR A;  2OTJ I;  1QRY A;  1XSX A;  4X0G A;  1TNT A;  5IT9 Z;  4FCY A;  1IUY A;  2W24 A;  3EYY A;  5J8C A;  1WCM J;  1I1S A;  1CGP A;  3K4C A;  4Z2Y A;  3WE3 A;  2PJR B;  3K0L A;  5F0F A;  5J4Y A;  5IYC J;  4KA4 A;  3HOS A;  1FYK A;  3E6D A;  4A3B J;  1S9H A;  2VAS A;  1YQA A;  1KQ0 A;  2LK2 A;  3BDD A;  1SMT A;  4U0Y A;  3CLQ A;  1N77 A;  3ZPL A;  3E6C C;  1ZGJ A;  5H6R A;  2B0L A;  5K7Z A;  4QWQ A;  2LF7 A;  2DDA A;  3AG3 H;  3HB9 A;  4A6D A;  3K2A A;  2E19 A;  5L3B A;  3L2V A;  3M4O J;  1CF7 B;  1LEA A;  3MQ0 A;  4U0V A;  1UCR A;  3RQI A;  3ZQG A;  4BBR J;  3J7Z I;  3OYD A;  1JGG A;  5FRN A;  1IZ1 A;  2YX7 A;  1T95 A;  1HF0 A;  3RI4 A;  3HOW J;  2E34 A;  4MHG A;  3U2R A;  3VB2 A;  1PUE E;  3A0H C;  2VT2 A;  3ZP5 A;  1HCR A;  2P5L C;  3BJA A;  3CDL A;  3W2V A;  4WF2 A;  1GXQ A;  4DGW B;  3S3O A;  3FIW A;  2IS1 A;  2BZT A;  2KRH A;  1JUP A;  5D4R A;  4M9X A;  3OYA A;  2HPM A;  1JGS A;  1O7F A;  4MGR A;  2OV7 A;  1WGX A;  3FXR A;  1ERD A;  4UUS A;  2EH3 A;  3AL0 B;  1H0M A;  1HLV A;  1X2N A;  1IN4 A;  4IJA A;  4ENK A;  4AM3 A;  3RZD J;  4ZZL A;  4E7Z A;  1J75 A;  2HKX A;  3F8N A;  2DJN A;  3BJ6 A;  2P6T A;  4HF2 A;  2E7X A;  1K83 J;  3CCQ I;  3H9Q A;  3FXM A;  2LKS A;  2JJ7 A;  3M9A A;  2DCE A;  4GGG A;  1XMA A;  2LBF A;  2Q1Z B;  1MBF A;  2WAE A;  2OBP A;  2Y69 H;  1EV7 A;  2G7U A;  1MH3 A;  3MKZ A;  1Z6T A;  2MFZ A;  2NNN A;  2KLO A;  1R7J A;  3PUB A;  4C3I J;  1Z6R A;  4CCK A;  4RB1 A;  2W4S A;  1KQ9 A;  1R23 A;  4FT8 A;  1FYL A;  3DTE A;  4AID A;  1V55 H;  3Q9S A;  1UEL B;  4MQ9 F;  4U87 A;  2O9L A;  4KNY A;  3OWT A;  1ULY A;  2ZME B;  3VSK A;  2A61 A;  3ZN0 A;  2CW7 A;  2H94 A;  4BQN A;  1Z3Y A;  3SFZ A;  1Z67 A;  5E8G A;  1JTY A;  5GAH J;  3BT9 A;  1TWC J;  2X1D A;  3DLA A;  4GCV A;  3E7L A;  4OMZ A;  2MH2 A;  1W5C C;  2Z1D A;  3KEY A;  4ITV A;  4WCG A;  4C2T A;  4XK4 A;  1FNN A;  1H9G A;  2V1D A;  1E3P A;  2R0Q C;  3E1S A;  5J47 A;  2EFP A;  3KX2 A;  2W1O A;  1FMV A;  2F5F A;  2JSP A;  4EEF G;  1R49 A;  1TNS A;  2EA4 A;  4IZZ A;  2E60 A;  1OJL A;  2BEO A;  2PQ8 A;  5LLQ A;  1GT0 C;  2ID6 A;  2ETH A;  2XVC A;  4IOA F;  2EWN A;  2EZI A;  1BOB A;  4BXU A;  2RNG A;  1SD5 A;  1ETW A;  3S3M A;  2Z3Y A;  2VB6 A;  1X3Z B;  1LDD A;  2MA3 A;  3OV8 A;  2PN6 A;  4PCQ A;  5LGU A;  5IP7 J;  2R4G A;  1EKE A;  4Y33 A;  2K85 A;  3KLN A;  1ZGA A;  2KZG A;  3JCU C;  1GVD A;  1KA8 A;  2QSH X;  4IRI A;  1YJW I;  3K70 C;  4A69 C;  3K4B A;  4KT6 A;  1G3Y A;  1Y0U A;  1QZZ A;  1P4A A;  2XGX A;  3CDI A;  4NHJ A;  2NS0 A;  4OIO F;  1OR7 A;  4NC6 A;  2AXT C;  1MH4 A;  4F52 A;  2M4K A;  4IL6 C;  1K61 A;  3ZGK A;  2O0Y A;  1R58 A;  2L7M P;  1B8I B;  3TP3 A;  1MNM C;  1WJ5 A;  3SEQ A;  1UHS A;  2JUG A;  2PX9 A;  2PI0 A;  5DM7 F;  5LBQ A;  4G6D A;  4HLX A;  1A31 A;  5L3F A;  3A03 A;  2A6T A;  2IA2 A;  4IF4 A;  2EIM H;  5IP6 A;  3MMY B;  2O3F A;  4L5J A;  3LOC A;  2BBY A;  3ROU A;  5BS6 A;  3V7S A;  1SD4 A;  2X1C A;  4Y7N J;  4G6T B;  4LLG F;  1XSD A;  3O3K A;  4LG0 A;  9ANT A;  1MNE A;  1VND A;  4KN7 X;  3V42 A;  4EV0 A;  1TZL A;  1YS6 A;  1Q1H A;  1OYI A;  2ESN A;  1YS7 A;  3GLX A;  4BAC A;  1I39 A;  4LFU A;  5GP9 A;  5TGT A;  2KPM A;  5LRS A;  3A4C A;  2JMW A;  2JRM A;  2YU9 J;  2CWE A;  4I76 A;  2COM A;  2I5U A;  2KJC A;  5AIQ A;  1TWA J;  2XPU A;  1XCB A;  1I3A A;  5ED4 A;  1XX5 A;  1V4R A;  3ZXS A;  2CYY A;  3GVA A;  4B8X A;  3F22 A;  1BR4 A;  1WJE A;  1XD7 A;  2GIZ A;  2ICW G;  3FXL A;  3NWT A;  3ERE D;  5BMZ A;  4A3G J;  3LQR A;  3CJN A;  2VJ4 A;  2ZKZ A;  2HS5 A;  3V7R A;  4PJN A;  2Z2S B;  4HOB A;  2EZK A;  2UV1 A;  3BRO A;  1SVL A;  4EGY A;  1D8K A;  1VQO I;  2XKO A;  4D0P A;  5FLM J;  5EJC A;  2W7N A;  2FF4 A;  4BL0 B;  3SJM A;  4MIM A;  4RMN A;  4MLO A;  4D5C A;  2QQA A;  3LQQ A;  2MLG A;  1I3Q J;  4HST A;  4ZYH A;  5E8I A;  4E7J A;  1XGS A;  4HNT A;  1A6Q A;  2WY7 Q;  2R93 J;  3CUO A;  2LFB A;  4IEJ A;  5BPD A;  3DKX A;  1MKM A;  4BS9 A;  1Q1V A;  3IHU A;  1JKR C;  2XGC A;  1D0Y A;  5LEJ A;  3HRS A;  2JUC A;  2QM3 A;  3WTS C;  4UUV A;  4PFP A;  1KU9 A;  2HU9 A;  2X85 A;  4C9Y A;  4BDY A;  2LRE A;  3ZQL A;  2VQC A;  1APL C;  1NH3 A;  2BHZ A;  3NQO A;  2K9L A;  2GOM A;  3S93 A;  4Q47 A;  2L02 A;  5IYB J;  4ZYA A;  4A0Z A;  1IXS B;  4B09 A;  5FRM A;  1YIO A;  2K4B A;  3ESW B;  4L5I A;  2FBK A;  1YRN A;  3BOQ A;  2CW8 A;  1JXS A;  3SXY A;  3OYB A;  2QZ8 A;  2ZBK A;  4ZYD A;  1U8B A;  3HZJ A;  4KMU X;  3H3Z A;  3HSF A;  3PFI A;  4V2G A;  2HFH A;  1QPM A;  1W4M A;  2KIF A;  4OIN F;  2Y0M A;  5DDG A;  2HGC A;  4P9U A;  1VQ8 I;  3J7A Y;  2DA5 A;  1IJW C;  1MBG A;  1V5E A;  3FK7 A;  2V1U A;  2DU9 A;  4G94 A;  5JHF A;  3B6C A;  5BOX A;  3E6M A;  1K6O A;  2M87 A;  3OYE A;  3JRF A;  5JVG F;  5HS7 A;  3QU6 A;  1JUM A;  1YJ9 I;  3NWS A;  1Z1D A;  3WTX C;  1DP3 A;  1U5T A;  2IA1 A;  1N25 A;  2XAU A;  1Y0N A;  2BGC A;  5F27 A;  1JKO C;  5DUK A;  1OFC X;  3ABL H;  4Q4Z F;  1JHF A;  1I1G A;  1Y8R B;  2Y9Y A;  4OMY A;  1I50 J;  2VOD A;  1KON A;  1CQT A;  2LG4 A;  2WV1 A;  5A2Q Z;  1LQ1 A;  4JK1 X;  2DYS H;  3CCL I;  4II3 A;  3S2D J;  2PFB A;  2QA4 I;  2RN7 A;  1ZTR A;  5CLS A;  4EM2 A;  1PP7 U;  3CUQ A;  2PG4 A;  2Q2E B;  1SFE A;  2FJ1 A;  2M9H A;  3ZQI A;  1RR8 C;  5LGT A;  3FHN A;  4E7S A;  3JRE A;  3VYT B;  4YII A;  4B48 A;  2CFX A;  1QBJ A;  4NQW A;  4HNV A;  3MWM A;  1WFX A;  2EFN A;  4PGH A;  1C0W A;  1ZK8 A;  1WJA A;  2A6H F;  2UXN A;  4W1U A;  2FBH A;  3BR1 A;  2XUB A;  2DFH A;  4UVC A;  1W0T A;  3VFZ A;  2CFO A;  3QYB A;  2BOL A;  4HF0 A;  5F1J A;  2MD5 A;  3WE2 A;  4EVI A;  2P7C B;  4GRI A;  1J7K A;  4Y13 A;  1R4N B;  3DCF A;  4UV8 A;  2EJR A;  2FUG 2;  3CF2 A;  4ESF A;  3GZN B;  2DFI A;  4RGX A;  3N4M A;  4XLP F;  1X58 A;  2P81 A;  3M8J A;  3B02 A;  2CQQ A;  1X2M A;  3DEE A;  1NTC A;  1GLN A;  2LC2 A;  1ZRF A;  4IHS A;  4XRF A;  5KK1 A;  2JA5 J;  2K4J A;  2L9V A;  4M6V A;  4HQE A;  2CRG A;  4KT5 C;  1SFX A;  4I6Z A;  4XKW A;  5E20 A;  5BQT A;  3LSH A;  4MO7 A;  2WAD A;  1D8J A;  1IG7 A;  5GTH C;  4AUX A;  2R7X A;  3JTH A;  3ABU A;  2IW5 A;  2EBI A;  2K3F A;  1RUO A;  4Q5S F;  3T5X A;  2GXG A;  3I58 A;  4UXN A;  1UG0 A;  1I5Z A;  1AU7 A;  2Z9O A;  1ZRC A;  2HOS A;  4J19 A;  1XGN A;  3E5U A;  2BV6 A;  3HOZ J;  5KAF C;  2FQ4 A;  1X4O A;  5LFA A;  2OZU A;  3DTI A;  4IOC F;  4BXF A;  4D1Q A;  3G71 I;  1OIS A;  2DQR A;  5CVR A;  3S16 J;  1A35 A;  2KJB A;  4BE1 A;  2F2E A;  1SD6 A;  4M3F A;  1O3T A;  2OF7 A;  2OAZ A;  4M72 A;  3CCV I;  5ERI A;  1IO2 A;  2E2J J;  4XKC A;  2ZB9 A;  3RPU D;  2O5R A;  3OS2 A;  1D0Z A;  4IKF A;  2BY1 A;  2YSR A;  3S2H J;  1Y1V J;  1T56 A;  2BXY A;  2KIM A;  1BBY A;  3FXU A;  1R6R A;  1EA3 A;  4I99 C;  5E1X A;  1XN7 A;  3KE2 A;  2GZW A;  5FJ8 J;  3KP4 A;  4XLA A;  3QPS A;  2NAZ A;  5H6Q A;  3HM5 A;  2DA1 A;  1BA5 A;  4S05 A;  2V4J C;  2JK3 A;  3DEW A;  4E7H A;  3HGY A;  1Z05 A;  3QQA A;  1W5S A;  1KZH A;  2H09 A;  4P96 A;  3HOX J;  1D1A A;  3SQN A;  3ZQ7 A;  3N97 A;  1NK3 P;  2M7A A;  1Y6I A;  5DYM A;  5DCM A;  3CP2 A;  4Z6Y A;  1ZQ3 P;  3OYG A;  3JSO A;  1FX7 A;  4B1R A;  3OSG A;  1FPQ A;  3TQN A;  2FE3 A;  2Y0S N;  2DAO A;  4CYC A;  2VQG A;  2HQA A;  4PK4 A;  2HR3 A;  4MQV A;  2BY2 A;  3PIO F;  3SEZ A;  1XGM A;  2ZFW A;  2HYJ A;  2LY1 A;  3JRC A;  1U78 A;  4A5M A;  5B3S H;  4DBQ A;  1FYM A;  4A3J J;  4OWR B;  2IVM A;  2L4M A;  1ZHF A;  4G12 A;  3CC7 I;  2JSC A;  4WXD A;  1Z21 A;  3K7A J;  3UNG C;  3W6K B;  1AWC A;  3VDX A;  4CCO A;  3QPT A;  4LG3 A;  3GCM A;  1ZEL A;  4MNU A;  1KYZ A;  5FKN A;  4CZZ A;  3AKZ A;  1OQY A;  1B1B A;  4B44 A;  2P6S A;  2EPF A;  5CQE A;  1UST A;  2IBD A;  4XMY A;  4E4H A;  2MG4 A;  2FD5 A;  3PM1 A;  3H5N A;  4M6Y A;  3WU0 A;  4UB6 C;  4BJ5 C;  3COA C;  3GTQ J;  3DKY A;  5GAD J;  1BC7 C;  2VOO A;  3M1C A;  4XSZ F;  3IWF A;  4QSH A;  1LKX A;  3I54 A;  4ZDP A;  1LJ9 A;  1YJN I;  1RZ4 A;  4QIW N;  3QP5 A;  4IHW A;  3I53 A;  5IPA A;  2E5N A;  5IP9 J;  1IDY A;  1ETX A;  3WTZ A;  3HUG A;  5ILV A;  3SYT A;  4RAZ A;  5BPI A;  2A68 F;  5TRD A;  3MZY A;  2X48 A;  1VQ5 I;  3RKW A;  3BZC A;  3F23 A;  3BQY A;  3IH2 A;  2ACJ A;  2AQF A;  2HI3 A;  4XON A;  4DNC A;  2E1O A;  2DTZ A;  3SDG A;  2KKO A;  4LB6 B;  3K2Z A;  2PJR A;  4Y52 J;  2XF5 A;  2EA2 A;  1YTY A;  3A0B C;  1I6X A;  4UV9 A;  2AS5 F;  4JX6 A;  1T0F C;  2E5Z A;  3CJR B;  5HDN A;  5TIS C;  2XGD A;  4LOC A;  4OIP F;  3PIP F;  3HOV J;  4IPA A;  1UAA A;  4NBQ A;  2LRD A;  3AG2 H;  1CF7 A;  3C18 A;  2CV1 A;  1GHC A;  2KDZ A;  3H36 A;  2YX4 A;  4LIU A;  3GTM J;  4ETS A;  1HDD C;  2W82 A;  4U7B A;  4C2M J;  1R5H A;  1R22 A;  4KUM A;  2R7F A;  3FBN B;  3LST A;  5HLH A;  3J7A O;  3OL4 A;  2Q8K A;  2GM4 A;  2PLY A;  3EQL F;  5E1Z B;  1WH7 A;  3FF5 A;  4FQG A;  4ABZ A;  2RC4 A;  2ISZ A;  1ETY A;  2ADU A;  4AU7 A;  1QGP A;  3SDB A;  1IAW A;  2V1X A;  2GA2 A;  4HX7 A;  2F5E A;  1G3S A;  3CDH A;  4AIJ A;  2HDD A;  4HPQ A;  2WTE A;  3BPV A;  3V8L A;  2V9V A;  1SFU A;  1S3J A;  3FWE A;  1FMW A;  3PQJ A;  1MJ9 A;  2VE8 A;  3H35 A;  2DFE A;  5ICG A;  2LH9 A;  3HRT A;  4HG2 A;  3FIS A;  3V8J A;  2UXX A;  4HEA 2;  3WGI A;  5KVR A;  3C2G A;  3FXJ A;  1U6G A;  2F5D A;  3E3V A;  1R9T J;  2LYC A;  1PYV A;  2G9W A;  2RNJ A;  2XKP A;  3G4S I;  5K5R A;  1YFH A;  1D5V A;  1BIB A;  3BCA A;  1ETV A;  3S2W A;  3WOD F;  1DP7 P;  3HKZ N;  2ZME A;  3EUH A;  2V9K A;  2CO5 A;  1OYW A;  1L3L A;  1I6H J;  3OSF A;  3RDI A;  2HVQ A;  1OCC H;  1HQC A;  4BY7 J;  4DYQ A;  1BR2 A;  1FC3 A;  2ECC A;  1PVE A;  4UVB A;  1EJ9 A;  2LTP A;  4CCL A;  5DUI A;  3GEZ A;  1B6A A;  3K1N A;  3WTU C;  4BQA A;  4ON0 A;  2QLZ A;  5FLV A;  1BR1 A;  2JA2 A;  5CQG A;  2R7U A;  4G7H F;  1WZ2 A;  2K02 A;  1HXD A;  3LMM A;  3S14 J;  1X1D A;  2X1E A;  2PBI A;  1HKT A;  2GIV A;  2HOE A;  3TP0 A;  3BZ6 A;  2UZK A;  1P7J A;  4RA2 A;  1ZG3 A;  3NAR A;  5AON A;  4BH9 A;  3OL3 A;  2XV4 S;  1TC3 C;  1G6N A;  5FFZ A;  1TW2 A;  2K5C A;  5E3L A;  2ID3 A;  4P9F A;  2DA7 A;  3RZO J;  1F1Z A;  4A6E A;  5FKO A;  3RJP A;  2M0C A;  3SZP A;  3JRB A;  5ICF A;  4HRI A;  2YU3 A;  3ECH A;  3MN2 A;  4FE7 A;  4R8H A;  4FX4 A;  2VQH A;  5DD8 A;  3JRH A;  2O6G E;  1SC7 A;  4AIH A;  3BC8 A;  2DN0 A;  5M3M J;  4A3K J;  1ODD A;  2E1N A;  3IV5 A;  4I0A A;  4XLE A;  3ZQF A;  3JAM Z;  4PGG A;  1IV8 A;  3QOE A;  4PSX A;  2DT5 A;  1QZE A;  2H6C A;  2OCE A;  1H9T A;  4UB8 C;  2QEX I;  3IAM 2;  6PAX A;  2Y30 A;  1TWG J;  1LB2 A;  2DXI A;  2FOK A;  1TQI A;  4HAM A;  2KDO A;  3N05 A;  3H1C A;  3P9C A;  5FB2 A;  5IT9 K;  2DOA A;  5EEH A;  4C3H J;  4N9H A;  5K5O A;  1B9M A;  1R36 A;  2X4H A;  1ZG5 A;  1B8I A;  1XMK A;  2ZJQ F;  1R1U A;  2VJI A;  4KIB A;  1PP8 F;  3QYF A;  3RPQ A;  4YRV A;  2DYR H;  3GFJ A;  2FNP A;  2G0E A;  3QU3 A;  2I8D A;  1O3S A;  1GXP A;  1J9I A;  3I3L A;  1IV6 A;  4P5O A;  3GFM A;  1VQL I;  3H0D A;  2DLL A;  2PMZ N;  2WAF A;  1SVM A;  3LWF A;  5CPR B;  1DU6 A;  3GFL A;  3KP6 A;  1S7E A;  3LSR A;  1V3F A;  4A3C J;  2OA4 A;  3KP5 A;  4MFD A;  4XL9 A;  2CUE A;  2JRT A;  3K6G A;  2X0L A;  4GDF A;  2A6E F;  2VN2 A;  3U1K A;  2LKP A;  2HXO A;  3DFG A;  1T39 A;  4LLN A;  2HNH A;  4I02 A;  2JTV A;  3D5L A;  1F43 A;  2A5W A;  3OYI A;  3P9K A;  1VQN I;  1KGS A;  2P5K A;  1P92 A;  1E0E A;  1MW7 A;  4M3D A;  1RRJ A;  3DBL B;  1U3E M;  3OYC A;  4L9V A;  2Y0S A;  4QPQ A;  4ENJ A;  2NNY A;  1Z7U A;  2V1N A;  4B3X A;  3ABT A;  4OOI A;  3ZR8 X;  3DTK A;  1HKS A;  2N8G A;  2LLK A;  2ZJR F;  2L5Q A;  2GWR A;  1UHW A;  3HPG A;  4BEH B;  4XSX F;  4HX8 A;  4JBA A;  1G8X A;  2WA0 A;  3B6A A;  1YI2 I;  1QVU A;  4HBL A;  3LL7 A;  3MCZ A;  4N0B A;  5FFX A;  2DOD A;  4F91 B;  3G3Z A;  1DQU A;  2HDC A;  3DQV C;  4EJO A;  3ZQQ A;  5EZG A;  3J80 Z;  3I64 A;  3CCR I;  4FX0 A;  2HOT A;  1HST A;  2CV2 A;  1ENH A;  1HDP A;  5D5V B;  1Y56 A;  2KP6 A;  1U8R A;  2XAS A;  1G3T A;  2VPL A;  3KIO A;  4UY8 I;  1BW5 A;  3OYF A;  3MZ8 A;  4G9Y A;  4KIS A;  4ZDL A;  3GTG J;  2GBY A;  3F3X A;  2BW3 B;  4WXC A;  3RTR A;  3BG7 A;  5J1R A;  1WWX A;  2DO7 A;  1N78 A;  1AKH B;  3ECO A;  2FSW A;  4GFB A;  1MIJ A;  2D45 A;  3BR0 A;  5JHU A;  1U0J A;  4XLF A;  1F4K A;  4CHU A;  1E17 A;  3DF8 A;  1RNL A;  2VE9 A;  1WJC A;  2I10 A;  1JE8 A;  1ON1 A;  4M9Z A;  2NVX J;  1E3H A;  1RIO H;  2R5Y B;  3ZMS A;  2D1H A;  5F0H A;  1X3W B;  1SMY F;  2R5Z B;  2DT6 A;  3F0C A;  2EB7 A;  1NHA A;  3D1N I;  2VKD A;  1O3Q A;  2W84 A;  1P4X A;  2XB0 X;  2C6Y A;  2Y48 A;  2ISY A;  2E1M C;  2RKH A;  3Q9V A;  3ZCO A;  4XN3 A;  1G59 A;  3HTS B;  3GTP J;  1X1P A;  2VXD A;  1YIT I;  2GAU A;  3J81 Z;  3L09 A;  4X1E A;  1Z0X A;  3GME A;  2VJ5 A;  2ZFU A;  3A02 A;  2IRF G;  2JA7 J;  2CJJ A;  1F5T A;  3RQ4 A;  4XLC A;  4HZF A;  3PNY A;  4ANJ A;  2EIL H;  3BTL A;  1GUU A;  1SAN A;  3CTA A;  2HVR A;  3G73 A;  1POG A;  2CS3 A;  4L5E A;  5JR3 A;  3VSL A;  2HOA A;  3I0T A;  1HBX G;  2OD5 A;  2V6C A;  1SFK A;  4C30 A;  1V5G A;  3WG9 A;  4K2E A;  2AXL A;  4II2 A;  4A3I J;  1JT0 A;  1OCO H;  5GAG J;  1XMX A;  1XDS A;  2QCO A;  1I27 A;  2ZC2 A;  2Q2E A;  3C1D A;  4CIC A;  4DBR A;  1PUF B;  1MMA A;  1VQP I;  3HRU A;  3O6B B;  2X6X A;  2ESH A;  3KP3 A;  3MKY B;  2DFF A;  2XAF A;  5KCM A;  3ZRG A;  4N9I A;  5M3F J;  1H8A C;  5KAI C;  3H0G J;  5C4J J;  4KFC A;  3ABM H;  5J4V A;  5JLW A;  3I4N J;  3P9I A;  2ZNZ A;  2R7S A;  4ZYE A;  2UWM A;  4BYY A;  4J00 A;  2TRT A;  2Y31 A;  1T0F A;  2DOF A;  2LF8 A;  4YIF A;  4ZZD A;  2A07 F;  4P1W A;  2QBY B;  3LSM A;  3NEU A;  1W7P B;  3X2Q H;  2K7L A;  4PJL A;  4U88 A;  5L3D A;  2DBB A;  1W5T A;  2DA2 A;  2O03 A;  3DPU A;  2HYF A;  3BG6 A;  5JVT A;  2O8X A;  1KQ8 A;  5FGM A;  3PO3 J;  3KPH A;  4UVA A;  2XC7 A;  3RKQ A;  4HA8 A;  3QYE A;  2QKM B;  2JZY A; 
#chains in the Genus database with same CATH homology
 2P8T A;  3R0A A;  4HYE A;  4KYW A;  1J5Y A;  3TO7 A;  3RPU A;  3VOD A;  1QNT A;  3D0S A;  4GXO A;  4EJU A;  4PDK A;  1G4D A;  2ZJ2 A;  2W57 A;  1IF1 A;  4RB2 C;  3TDZ C;  3GXO A;  4ESB A;  3ZMD A;  3F8M A;  2FMY A;  3LA7 A;  1FZP B;  2M1B A;  4CO8 A;  3I59 B;  5JI6 A;  4NB5 A;  2IPQ X;  3F8F A;  2WC2 A;  1QQI A;  3MEX A;  3TO9 A;  3F21 A;  4ZH4 F;  1K78 B;  1TQM A;  4KDP A;  5HLG A;  3R6S A;  5D4S A;  2XRO A;  2Z33 A;  3FM5 A;  2RGV A;  4RAY A;  5FLX Z;  1K79 A;  4M71 A;  1MZB A;  1YO5 C;  2HQN A;  3WTY C;  1MD0 A;  1HW2 A;  2VOP A;  3CO7 C;  3DEU A;  1O7L A;  1X3U A;  4RGS A;  1ZH5 A;  1FT9 A;  4WX9 A;  2M8E A;  3L00 A;  5A2Q K;  1MJA A;  3EYI A;  1TLH B;  1QO0 D;  1PDN C;  3HIF A;  5K1Y A;  2BE5 F;  4HX4 A;  2QQ9 A;  4U0W A;  3IC7 A;  4EJV A;  1O3R A;  2WV0 A;  1XDU A;  5F6F A;  2Q0O A;  3GX4 X;  5CVI A;  4ASN A;  1HW1 A;  1LEB A;  1HW5 A;  4DQ2 A;  4A5N A;  3GZ6 A;  2DK8 A;  5D5U B;  3ULQ B;  1WQ2 A;  3T0Y A;  1FWZ A;  1T38 A;  4GYG A;  1DUX C;  2L01 A;  4WK8 F;  2LDU A;  3HHH A;  2XAH A;  5CYV A;  1B4A A;  2DQL A;  2FNA A;  1VTN C;  5DEQ A;  2P4W A;  3M8E A;  3JSP A;  3BPX A;  2RV8 A;  2FBI A;  2MBF A;  1IN5 A;  1YW8 A;  2D2W A;  5EEG A;  1REP C;  1YW7 A;  2PJP A;  3LA3 A;  4G6Q A;  2M45 A;  3Q5F A;  2DPD A;  1MDM B;  2H6B A;  4XBF A;  1ZN2 A;  2ELH A;  3R0J A;  1T6S A;  4KIF A;  4Q48 A;  3C7J A;  2FEZ A;  4LK0 F;  4AVP A;  1TBX A;  5D6E A;  1B59 A;  4FHT A;  2VBY A;  1G3W A;  3R4K A;  4HW0 A;  1R00 A;  3O2P E;  1LVA A;  1E2X A;  2IP2 A;  4OIQ F;  2NRA C;  3FM3 A;  3E5X A;  4WXH A;  4MTD A;  2OZ6 A;  1S8N A;  1T2K A;  1S6L A;  2VBZ A;  3REO A;  1KU7 A;  3KET A;  1B9N A;  3F8B A;  2PMH A;  3B73 A;  3RIR A;  2HKO A;  3OOP A;  2FQ3 A;  1KU3 A;  2L3D A;  3T1B A;  4EJW A;  4QLC U;  1FP2 A;  3HRM A;  2P5V A;  4IVN A;  1Z9C A;  1FOK A;  5J6X A;  1O57 A;  4TV7 A;  4I7H A;  1P6R A;  3NRV A;  1TW3 A;  2M30 A;  2PEX A;  5H20 A;  2OQR A;  1ZLK A;  5D6F A;  1EH6 A;  4MEY F;  5HDG A;  4YG2 F;  4L9J A;  1SAX A;  1S29 A;  4RB0 A;  4S04 A;  3M8F A;  1IRG A;  1IN7 A;  1WI9 A;  5L3C A;  2NYX A;  4I2O A;  1U5T C;  1BOA A;  3BY6 A;  1J0R A;  3HOT A;  4R79 A;  3ML6 A;  1IXR C;  4RS8 A;  4I01 A;  3WGG A;  4MEX F;  4UHT A;  4Y15 A;  1ZRD A;  1OYY A;  3CUQ C;  1R1T A;  1LNW A;  3HSE A;  4BHC A;  5E1W A;  1STZ A;  2O61 A;  5CVU A;  2VT3 A;  1IW7 F;  3HTU A;  4HV5 A;  1EH8 A;  4LMY A;  3DPL C;  5HDK A;  3T8R A;  4I98 B;  5IT3 A;  1WSU A;  4ZYG A;  1J2X A;  4KIC A;  2EK5 A;  5LEK A;  2HEO A;  1U2W A;  3GUD A;  2CSO A;  3ZMT A;  5D5W B;  2ZXJ A;  3TOB A;  3TGN A;  3FMR A;  4IRH A;  1L0O C;  3H3U A;  2VON A;  1IN6 A;  2A5Y B;  4KMF A;  2R3S A;  5CVJ A;  4XLN F;  4ESJ A;  3QRF F;  1ZYR F;  3K1P A;  3V7C A;  3U1D A;  3R61 A;  2STT A;  3SHF A;  3BWG A;  1UHM A;  2QQB A;  3MZH A;  1LDK B;  2E1C A;  1Z91 A;  3MAJ A;  2E7W A;  5DV5 A;  1BI1 A;  4CGZ A;  1QZY A;  4LJZ F;  4WWC A;  1OKR A;  3VEP A;  2QEN A;  3E97 A;  3KEQ A;  2EV0 A;  3FHZ A;  1DDN A;  2HTS A;  1BIA A;  1D3Y A;  1YLF A;  4CYD A;  3L2C A;  4JQF A;  3I4P A;  1MJB A;  5LGN A;  3JAM K;  4EJT A;  3L9F A;  1XCV A;  5HS8 A;  2EFW A;  4EGZ A;  4G8X A;  4U7D A;  3JTG A;  1DPU A;  3KCC A;  1YYV A;  3QP6 A;  4L9T A;  1HSJ A;  2JT1 A;  2BYV E;  2EFO A;  2FRH A;  2JPB A;  4HF1 A;  2W85 A;  2YPR A;  4YFN F;  1DPR A;  2Z5U A;  5E17 F;  3LAJ A;  4ENM A;  2QBY A;  3LA2 A;  1W7P A;  4M73 A;  3KFW X;  2CG4 A;  4LB5 A;  3K9T A;  5F1R A;  2CQK A;  4A0X A;  5HS9 A;  1P4W A;  1T98 A;  2TDX A;  3VOE A;  3M1E A;  4KN4 X;  4LLL A;  3EET A;  2L4A A;  3F6V A;  4EMS A;  4L0Y B;  1ZG1 A;  2GA1 A;  2P7V B;  3WTW C;  2IA0 A;  5ICC A;  3M7G A;  5AIP A;  1FLI A;  3JW4 A;  4L0Z B;  3K69 A;  2MLK A;  5F64 A;  3HHG A;  2VBX A;  1BI0 A;  2V79 A;  4M74 A;  2H27 A;  4A0Y A;  3CLO A;  3WTT C;  3J80 K;  2L54 A;  2Z99 A;  2IJL A;  3RYP A;  4O6J A;  5FD5 A;  3GYH X;  4BAY A;  3KP7 A;  5LRR A;  5L3G A;  1BC8 C;  1TQP A;  3I59 A;  1HKQ A;  4M9S A;  1UFM A;  2MH9 A;  4GO1 A;  2A3S A;  4AWX B;  1SD7 A;  2XAJ A;  5K5Q A;  4H0E A;  1K78 A;  3FZV A;  2FA5 A;  4HDV A;  3KZZ A;  4LG0 B;  1KU2 A;  2KIU A;  3IL2 A;  4Y17 A;  2EV5 A;  3KLO A;  4HQM A;  3RYR A;  3H92 A;  2RDP A;  2RQP A;  3DP7 A;  3IRR A;  2K27 A;  2STW A;  2QVO A;  3HSR A;  3GO5 A;  3J81 K;  2FXA A;  1W7P D;  4EM0 B;  4GYI A;  5HVQ C;  2HQR A;  1TTY A;  2DK5 A;  4HV6 A;  2HZT A;  4PZJ A;  3KZY A;  4F7Z A;  2QUF A;  4UNO A;  4BHB A;  4E70 A;  1FBU A;  2CGP A;  1AOY A;  2KRF A;  4G7O F;  1USS A;  1RUN A;  1A04 A;  1XB4 A;  1ONV A;  1S7A A;  4P55 A;  1K7A A;  5DCF A;  3TO6 A;  4KIG A;  4OIR F;  2OU2 A;  3F72 A;  3IWZ A;  4AIK A;  2HWV A;  3GFI A;  5D8L B;  1BN5 A;  5TJJ A;  1EH7 A;  3GWZ A;  3ZMV A;  2DW4 A;  1GVJ A;  1IRF A;  5D8K B;  3FXQ A;  3TDU C;  1WRJ A;  2FML A;  3F6O A;  2D1V A;  4O5V A;  4EM1 A;  2VBW A;  3DXJ F;  5L3E A;  4L9N A;  1ZAO A;  4ENN A;  3CO6 C;  1U5T B;  4LD5 A;  3GW2 A;  2DI3 A;  3GF2 A;  2YR2 A;  4BNC A;  3U9G A;  3TKY A;  4G7Z F;  3ZN1 A;  2XIG A;  4IXA A;  4A12 A;  3F8C A;  5ILS A;  2IT0 A;  4BHP A;  2GXB A;  3CUQ B;  3FMS A;  3PQK A;  2G7H A;  4RB3 C;  1MDM A;  3LAP A;  1IXC A;  5ICE A;  1OMI A;  1BI3 A;  3DV8 A;  3QPH A;  3FX3 A;  5FLX K;  4R1H A;  4O3M A;  2PMU A;  3KP2 A;  3WGH A;  1WKM A;  3GZ5 A;  2LNB A;  1FY7 A;  4CDG A;  5D5X B;  2GQQ A;  1XGO A;  5HLI A;  1F9N A;  1MGT A;  4HLY A;  3IKT A;  4LK1 F;  3ELK A;  4CXF A;  3FMQ A;  4A2U A;  5ILU A;  1FBS A;  5HOO A;  3ISP A;  1ON2 A;  1ZRE A;  4OU0 A;  5CJ9 A;  3SZT A;  3DPT A;  2Y75 A;  3W6J B;  3E5Q A;  3LFK A;  4IRG A;  1OPC A;  3ZMU A;  3E6B A;  4IHT A;  1BI2 A;  4YFX F;  5JFR A;  2J5O A;  2VC0 A;  3WU1 B;  1YW9 A;  4I0B A;  5LHH A;  5FO5 A;  2M5W A;  2R7D A;  3V8K A;  2A69 F;  1FP1 D;  1YG2 A;  2HTJ A;  3C3W A;  1P2F A;  3EDP A;  2QWW A;  1FBQ A;  3IRQ A;  4AD9 A;  3V4G A;  3MFK A;  3BJO A;  3RKY A;  2ZO4 A;  3L7W A;  3QAH A;  3P7N A;  1ZAR A;  4M6X A;  2HYG D;  5DCM B;  2ZNY A;  3I5U A;  4RGU A;  5DD4 A;  5CVV A;  2DTR A;  4HDU A;  4RGR A;  2FU4 A;  2VXZ A;  1RI7 A;  3ZMZ A;  2J5P A;  1S7O A;  4EQQ A;  3T8T A;  2F5C A;  4L18 B;  3BP8 A;  5E18 F;  1LDJ A;  1BJA A;  3DKW A;  2EV6 A;  4LGW A;  3RKX A;  3QOP A;  1UB9 A;  1R1V A;  2OQG A;  2XAQ A;  3HYI A;  2RVC A;  1FSH A;  3WTV C;  4MTE A;  2WWY A;  2VC1 A;  1XSV A;  1R5G A;  3KEO A;  3AAF A;  5J8F A;  1ZLJ A;  2K86 A;  2DPU A;  2XAG A;  1JHH A;  2EFQ A;  3I71 A;  1J59 A;  2QYO A;  2MC3 A;  4I09 A;  5LHI A;  5LHG A;  1FSE A;  1IN8 A;  3K1M A;  1KYW A;  2ZCW A;  5FD6 A;  2XRN A;  1BM9 A;  4YFK F;  3IKV A;  2JPC A;  3TOA A;  2LSO A;  2XHK A;  2W25 A;  3R60 A;  2CW0 F;  1XSX A;  1TNT A;  5IT9 Z;  1IUY A;  2W24 A;  3EYY A;  5J8C A;  1I1S A;  1CGP A;  4Z2Y A;  3WE3 A;  3K0L A;  4KA4 A;  3HOS A;  1FYK A;  3E6D A;  1YQA A;  1KQ0 A;  3BDD A;  1SMT A;  4U0Y A;  3ZPL A;  3E6C C;  1ZGJ A;  5H6R A;  2B0L A;  4QWQ A;  2LF7 A;  4A6D A;  5L3B A;  1CF7 B;  1LEA A;  3MQ0 A;  4U0V A;  1UCR A;  1IZ1 A;  2YX7 A;  3RI4 A;  4MHG A;  3U2R A;  3VB2 A;  1PUE E;  2VT2 A;  3ZP5 A;  2P5L C;  3BJA A;  4WF2 A;  1GXQ A;  5D4R A;  4M9X A;  1JGS A;  1O7F A;  4MGR A;  3FXR A;  1H0M A;  1IN4 A;  4IJA A;  4ENK A;  4ZZL A;  1J75 A;  2HKX A;  3F8N A;  3BJ6 A;  2P6T A;  4HF2 A;  2E7X A;  3M9A A;  4GGG A;  1XMA A;  2OBP A;  1EV7 A;  2G7U A;  1Z6T A;  2NNN A;  1R7J A;  1Z6R A;  4RB1 A;  1KQ9 A;  1R23 A;  4FT8 A;  1FYL A;  3Q9S A;  4MQ9 F;  4KNY A;  1ULY A;  2ZME B;  2A61 A;  3ZN0 A;  2H94 A;  3SFZ A;  5E8G A;  4GCV A;  4OMZ A;  2MH2 A;  4WCG A;  1FNN A;  1H9G A;  2V1D A;  2EFP A;  2F5F A;  1TNS A;  2EA4 A;  2BEO A;  2PQ8 A;  5LLQ A;  2ETH A;  2XVC A;  2EWN A;  4BXU A;  1SD5 A;  2Z3Y A;  2MA3 A;  1LDD A;  3OV8 A;  4PCQ A;  2PN6 A;  5LGU A;  3KLN A;  1ZGA A;  1KA8 A;  4IRI A;  1G3Y A;  1Y0U A;  1QZZ A;  1P4A A;  2XGX A;  4NHJ A;  2NS0 A;  4OIO F;  1OR7 A;  2O0Y A;  1R58 A;  2PI0 A;  5LBQ A;  4G6D A;  4HLX A;  5L3F A;  2IA2 A;  4IF4 A;  2O3F A;  4L5J A;  2BBY A;  3ROU A;  5BS6 A;  3V7S A;  1SD4 A;  4LLG F;  1XSD A;  3O3K A;  4LG0 A;  4KN7 X;  4EV0 A;  1YS6 A;  1Q1H A;  1OYI A;  2ESN A;  1YS7 A;  3GLX A;  4LFU A;  5LRS A;  2CWE A;  2COM A;  2KJC A;  5AIQ A;  1XCB A;  5ED4 A;  1V4R A;  2CYY A;  3GVA A;  4B8X A;  3F22 A;  1XD7 A;  3ERE D;  5BMZ A;  3LQR A;  3CJN A;  2ZKZ A;  2HS5 A;  3V7R A;  4HOB A;  3BRO A;  4EGY A;  1D8K A;  2XKO A;  4D0P A;  2FF4 A;  2QQA A;  3LQQ A;  2MLG A;  4ZYH A;  5E8I A;  1XGS A;  3CUO A;  5BPD A;  1MKM A;  3IHU A;  5LEJ A;  3HRS A;  2QM3 A;  3WTS C;  4UUV A;  1KU9 A;  3NQO A;  4Q47 A;  2L02 A;  4A0Z A;  1IXS B;  4B09 A;  1YIO A;  2K4B A;  4L5I A;  2FBK A;  3BOQ A;  1JXS A;  3SXY A;  2QZ8 A;  2ZBK A;  4ZYD A;  4KMU X;  3H3Z A;  3HSF A;  3PFI A;  2HFH A;  1QPM A;  1W4M A;  2KIF A;  4OIN F;  2Y0M A;  5DDG A;  2HGC A;  4P9U A;  2V1U A;  2DU9 A;  4G94 A;  5BOX A;  3E6M A;  1K6O A;  2M87 A;  5HS7 A;  3QU6 A;  1Z1D A;  3WTX C;  1U5T A;  2IA1 A;  2BGC A;  5DUK A;  4Q4Z F;  1JHF A;  1I1G A;  4OMY A;  2VOD A;  5A2Q Z;  1LQ1 A;  4JK1 X;  2PFB A;  2RN7 A;  5CLS A;  4EM2 A;  1PP7 U;  3CUQ A;  2PG4 A;  1SFE A;  5LGT A;  4YII A;  2CFX A;  1QBJ A;  4NQW A;  3MWM A;  2EFN A;  4PGH A;  1C0W A;  2A6H F;  2UXN A;  2FBH A;  2XUB A;  4UVC A;  3VFZ A;  4HF0 A;  2MD5 A;  3WE2 A;  4EVI A;  2P7C B;  1J7K A;  4Y13 A;  4UV8 A;  2EJR A;  4ESF A;  4RGX A;  2DFI A;  3N4M A;  4XLP F;  3B02 A;  4IHS A;  1ZRF A;  4XRF A;  5KK1 A;  2K4J A;  4HQE A;  4KT5 C;  1SFX A;  5E20 A;  5BQT A;  1D8J A;  3JTH A;  3ABU A;  2IW5 A;  1RUO A;  4Q5S F;  3T5X A;  2GXG A;  3I58 A;  4UXN A;  1I5Z A;  2Z9O A;  1ZRC A;  1XGN A;  3E5U A;  2BV6 A;  2OZU A;  2DQR A;  5CVR A;  2KJB A;  2F2E A;  1SD6 A;  1O3T A;  2OAZ A;  4M72 A;  5ERI A;  2YSR A;  1BBY A;  2KIM A;  3FXU A;  5E1X A;  1XN7 A;  3KE2 A;  2GZW A;  3KP4 A;  2NAZ A;  5H6Q A;  4S05 A;  1Z05 A;  1W5S A;  2H09 A;  4P96 A;  3N97 A;  3SQN A;  3ZQ7 A;  5DYM A;  5DCM A;  3JSO A;  1FX7 A;  1FPQ A;  3TQN A;  2FE3 A;  2DAO A;  2HR3 A;  4MQV A;  1XGM A;  2ZFW A;  1U78 A;  4A5M A;  1FYM A;  2IVM A;  2L4M A;  1ZHF A;  2JSC A;  4WXD A;  3W6K B;  1AWC A;  3QPT A;  4MNU A;  1KYZ A;  4CZZ A;  1B1B A;  2P6S A;  1UST A;  4M6Y A;  3WU0 A;  3COA C;  1BC7 C;  2VOO A;  4XSZ F;  3IWF A;  3I54 A;  1LJ9 A;  1RZ4 A;  3QP5 A;  3I53 A;  3WTZ A;  3HUG A;  5ILV A;  4RAZ A;  5BPI A;  2A68 F;  5TRD A;  3MZY A;  3RKW A;  3F23 A;  2ACJ A;  4DNC A;  2KKO A;  4LB6 B;  3K2Z A;  2EA2 A;  1YTY A;  1I6X A;  4UV9 A;  2AS5 F;  5HDN A;  4OIP F;  4IPA A;  1CF7 A;  3C18 A;  1GHC A;  2YX4 A;  4ETS A;  4U7B A;  1R5H A;  1R22 A;  4KUM A;  2R7F A;  3LST A;  5HLH A;  3J7A O;  2Q8K A;  2PLY A;  3EQL F;  5E1Z B;  3FF5 A;  2RC4 A;  2ISZ A;  2ADU A;  1QGP A;  1IAW A;  2V1X A;  2GA2 A;  4HX7 A;  2F5E A;  1G3S A;  3CDH A;  4AIJ A;  2WTE A;  3BPV A;  3V8L A;  2V9V A;  1SFU A;  1S3J A;  3FWE A;  3PQJ A;  1MJ9 A;  2VE8 A;  5ICG A;  3HRT A;  3V8J A;  2UXX A;  3WGI A;  5KVR A;  1U6G A;  2F5D A;  3E3V A;  2G9W A;  2RNJ A;  2XKP A;  5K5R A;  1YFH A;  1D5V A;  1BIB A;  3S2W A;  3WOD F;  1DP7 P;  2ZME A;  3EUH A;  2CO5 A;  1OYW A;  1L3L A;  3RDI A;  1HQC A;  1FC3 A;  4UVB A;  5DUI A;  3GEZ A;  1B6A A;  3K1N A;  3WTU C;  4BQA A;  4ON0 A;  2QLZ A;  4G7H F;  2K02 A;  1HXD A;  2PBI A;  1HKT A;  2GIV A;  2HOE A;  3BZ6 A;  2UZK A;  1ZG3 A;  5AON A;  4BH9 A;  2XV4 S;  1G6N A;  5FFZ A;  1TW2 A;  4P9F A;  1F1Z A;  4A6E A;  3SZP A;  3RJP A;  5ICF A;  2YU3 A;  3ECH A;  4R8H A;  4FX4 A;  5DD8 A;  2O6G E;  4AIH A;  1ODD A;  2E1N A;  4I0A A;  3JAM Z;  4PGG A;  2DT5 A;  1H9T A;  2H6C A;  6PAX A;  1LB2 A;  2FOK A;  1TQI A;  4HAM A;  3P9C A;  5FB2 A;  5IT9 K;  5EEH A;  4N9H A;  5K5O A;  1B9M A;  1R36 A;  2X4H A;  1ZG5 A;  1XMK A;  1R1U A;  4KIB A;  1PP8 F;  3RPQ A;  3GFJ A;  2FNP A;  3QU3 A;  1O3S A;  1GXP A;  1J9I A;  4P5O A;  3GFM A;  2DLL A;  3LWF A;  3GFL A;  3KP6 A;  1V3F A;  2OA4 A;  3KP5 A;  2JRT A;  2X0L A;  2A6E F;  2VN2 A;  2LKP A;  3DFG A;  1T39 A;  4LLN A;  4I02 A;  2JTV A;  3D5L A;  3P9K A;  1KGS A;  2P5K A;  1P92 A;  1U3E M;  4L9V A;  4ENJ A;  2NNY A;  1Z7U A;  3ABT A;  4OOI A;  1HKS A;  2GWR A;  1UHW A;  4XSX F;  4HX8 A;  4JBA A;  4HBL A;  3MCZ A;  4N0B A;  5FFX A;  3G3Z A;  2HDC A;  3DQV C;  4EJO A;  3J80 Z;  3I64 A;  4FX0 A;  1HST A;  5D5V B;  1U8R A;  2XAS A;  1G3T A;  4G9Y A;  3F3X A;  4WXC A;  3RTR A;  1WWX A;  2DO7 A;  3ECO A;  2FSW A;  2D45 A;  5JHU A;  1F4K A;  4CHU A;  1E17 A;  3DF8 A;  1RNL A;  2VE9 A;  1JE8 A;  1ON1 A;  4M9Z A;  1RIO H;  3ZMS A;  2D1H A;  1SMY F;  2EB7 A;  1NHA A;  1O3Q A;  2W84 A;  1P4X A;  2C6Y A;  2Y48 A;  2ISY A;  2RKH A;  3Q9V A;  3HTS B;  2GAU A;  3J81 Z;  3L09 A;  2IRF G;  1F5T A;  4HZF A;  3CTA A;  3G73 A;  5JR3 A;  3I0T A;  1HBX G;  2OD5 A;  2V6C A;  3WG9 A;  4K2E A;  2AXL A;  1XDS A;  1I27 A;  2Q2E A;  3C1D A;  4CIC A;  3HRU A;  3O6B B;  2ESH A;  3KP3 A;  2XAF A;  4N9I A;  4KFC A;  3P9I A;  2ZNZ A;  4ZYE A;  2UWM A;  4BYY A;  1T0F A;  2LF8 A;  4YIF A;  4ZZD A;  2A07 F;  2QBY B;  3NEU A;  1W7P B;  2K7L A;  5L3D A;  4U88 A;  2DBB A;  1W5T A;  2O03 A;  2HYF A;  5JVT A;  2O8X A;  1KQ8 A;  5FGM A;  4UVA A;  4HA8 A;  2JZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...