3F6OA

Crystal structure of arsr family transcriptional regulator, rha00566
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
MAQYPEQLNGIFQALADPTRRAVLGRLSRGPATVSELAKPFDMALPSFMKHIHFLEDSGWIRTHKQGRVRTCAIEKEPFTAVEAWLAEQQELWESRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ArsR family transcriptional regulator, RHA00566
rcsb
source organism Rhodococcus sp. rha1
molecule tags Transcription regulator
molecule keywords Probable transcriptional regulator, ArsR family protein
total genus 30
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12840 HTH_20 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f6oA00
1JGSA 4HLYA 3WTUC 2XASA 1PDNC 4AD9A 2LKPA 4FT8A 5FB2A 3I59B 3ZN1A 4BHCA 5FFXA 1ZREA 5AIPA 3V4GA 4H0EA 1ZN2A 4BHPA 3CO7C 3R6SA 2M30A 2ZO4A 3C1DA 4M6YA 2STTA 1WQ2A 4A0XA 4MTDA 1F4KA 1OPCA 1R58A 1C0WA 3C18A 5DYMA 1XCBA 1IZ1A 2MH2A 1WKMA 5ERIA 4XSZF 2A5YB 1TNSA 3TDUC 2XGXA 3ULQB 2W84A 1I1GA 1P6RA 1CF7A 1EH8A 4Y17A 4WXDA 2JTVA 4ETSA 1T6SA 2D2WA 3BDDA 1JHFA 4UVCA 2FBHA 4HDVA 1ZGAA 5LEJA 1BI0A 3RPQA 2L4AA 2PG4A 4EGZA 2V79A 3QPTA 3L2CA 1T39A 1Y0UA 3J80Z 3F8FA 5H20A 2VC1A 1DP7P 2P6TA 3I64A 2DU9A 1F5TA 4L5IA 1W7PD 2ZCWA 4PZJA 1DDNA 3EYIA 4GO1A 4O5VA 1ULYA 1UFMA 3QP5A 4GXOA 3I59A 4MNUA 3E3VA 4KIBA 3E5UA 2GXBA 1S8NA 3WTXC 1EH7A 4MEYF 4OIQF 2RNJA 5IT3A 3DP7A 5FFZA 3E5XA 2XIGA 3F6OA 3GFMA 2NAZA 1IF1A 4N9IA 4ZYEA 1MKMA 2EA4A 4KIGA 3M1EA 4G9YA 5E20A 5HVQC 2EK5A 4M9ZA 4HV5A 4EJWA 3I58A 1G3YA 4XLPF 1G6NA 1NHAA 3FXUA 4HX4A 2JT1A 2CO5A 4LJZF 5CVIA 3GX4X 4FX0A 2Q8KA 3WGGA 4N9HA 1U8RA 4LGWA 2M45A 3M9AA 4CXFA 1QBJA 4A6EA 2D1VA 2HYFA 3K1NA 4KDPA 1H9TA 2M8EA 4BAYA 3V8JA 1J5YA 5ICCA 3ZMTA 5ICFA 3FWEA 4G6QA 4LK0F 5JR3A 2V1UA 2A07F 3F6VA 5HLIA 3P7NA 4CGZA 3Q9SA 3HTSB 2MBFA 2CFXA 3TOAA 2XAGA 1HSJA 3KE2A 1YFHA 3I71A 3KCCA 1ZLKA 2DTRA 3RYPA 3IHUA 1IN6A 2HR3A 5HDNA 1SAXA 3ZMSA 2PMHA 4I7HA 2O8XA 4HQEA 2IRFG 2ETHA 2XAFA 3HRTA 1PUEE 1TQPA 2EFPA 5DDGA 3KFWX 2OZ6A 5D6FA 1HBXG 3MZHA 2KIFA 2J5OA 2HOEA 2KJBA 1OYYA 3KP5A 1RNLA 4HBLA 4DQ2A 4IHSA 3CJNA 2KIMA 4L5JA 4EM0B 1XGOA 3DPTA 2W57A 1J9IA 3RDIA 3PQJA 2HTJA 1SFXA 1STZA 3W6KB 3CUQB 4YFKF 2IA2A 1B59A 4ON0A 2A6HF 2Y75A 1WRJA 3I54A 2K02A 1BJAA 1T98A 4R79A 4RAZA 1XD7A 4A5MA 4HX7A 1ZLJA 5D4RA 3BPVA 1XGSA 5CVRA 4A5NA 3O6BB 4HQMA 5A2QK 2EFNA 4PGHA 4QWQA 3E6DA 3WE3A 1FZPB 1JE8A 3T0YA 3HOSA 2OQGA 1G3SA 4TV7A 2FMYA 3KLNA 1YQAA 1KYWA 4PDKA 2G9WA 3DFGA 3ZMDA 4YFNF 2YU3A 5DCMA 3TO9A 5ILVA 1U2WA 5LHIA 4OIPF 1Z05A 2R7DA 2FMLA 4WK8F 1SFEA 3MFKA 2LSOA 2OAZA 3ECHA 1YTYA 4IF4A 1WSUA 3FHZA 2DPDA 1B4AA 4WXCA 3VB2A 5HOOA 4MHGA 1J2XA 1BOAA 1KQ8A 1LDJA 2MH9A 1IN4A 5AONA 3J81Z 1BBYA 2PQ8A 3QRFF 2W85A 2EV6A 2EA2A 2VOPA 2P5VA 3W6JB 4KMFA 3BZ6A 1KQ9A 1BIAA 3H92A 4HA8A 1WI9A 3EDPA 2FRHA 2Z99A 3CUQC 3R0AA 1YW8A 2BV6A 4FX4A 2HDCA 3VODA 1W7PB 1SMTA 2OU2A 3NEUA 3G3ZA 5D5UB 4KT5C 1D8JA 2L01A 4IXAA 3KEOA 2PMUA 3SXYA 1FP2A 2CYYA 3HTUA 4RGRA 3K0LA 4OIRF 2QWWA 2Q2EA 4Y13A 1FSEA 5L3FA 1W4MA 2OZUA 1ON1A 1Z6RA 3CTAA 3WTZA 1FBUA 2H6BA 2YSRA 5L3GA 3WTVC 2G7HA 2MC3A 1U6GA 1YLFA 1SMYF 1IN8A 2K4BA 5BQTA 2HS5A 2DAOA 5K1YA 3ZQ7A 4EGYA 1KU3A 3HSEA 4HDUA 3ABUA 2XUBA 4UV9A 1R1TA 1KU9A 1WWXA 4KN7X 2VC0A 2HQNA 3BOQA 5JFRA 4I0BA 3ERED 1XGNA 4L0YB 3ABTA 1XDSA 2ZKZA 3HSRA 2HKOA 3MZYA 1TW2A 4CDGA 5JI6A 1KU2A 2MLGA 1UHWA 2F5DA 2NS0A 2ISYA 1SD5A 3IC7A 4HOBA 4ZYHA 5FLXK 2QENA 5A2QZ 3ZMZA 2FF4A 1OKRA 2EB7A 3F21A 3JSOA 2Y48A 3NRVA 4M9SA 2X4HA 1AWCA 3VEPA 3ML6A 2HEOA 1BIBA 4KUMA 4AIKA 4Q48A 2IT0A 2RV8A 5AIQA 4N0BA 5F6FA 3F23A 3EQLF 3WGIA 3LA3A 1F1ZA 3CO6C 4A2UA 2JPCA 5BMZA 4LG0B 2YPRA 3GVAA 5ICGA 1W5SA 1Z6TA 2WC2A 1LJ9A 2VOOA 4Q47A 2DQLA 2RVCA 5ILUA 1KA8A 4G7HF 1MDMB 4LG0A 1LQ1A 2P7CB 3KP6A 2VT3A 3ZN0A 3K1MA 2FXAA 2P5LC 3RI4A 2DK5A 1E17A 2D45A 4A12A 4FHTA 3KP3A 3D0SA 1R1VA 5KVRA 5TJJA 2OQRA 2PEXA 1U5TC 1LDKB 1P92A 2A68F 2QBYB 1S3JA 1RUOA 1KQ0A 3WE2A 2CQKA 4OU0A 3SHFA 2XAHA 1AOYA 5LGTA 3I5UA 2WTEA 1BN5A 1OR7A 3GLXA 3BP8A 4I02A 3BJAA 3RKYA 3L9FA 2STWA 3K9TA 5D4SA 5DCFA 4P55A 3JTHA 2DW4A 1FWZA 5JHUA 2VBYA 1TQMA 1FYKA 4YIIA 4OMZA 3V8KA 2L54A 1D8KA 1JXSA 2XROA 3KP2A 2FBIA 1TW3A 4A6DA 1KGSA 4WXHA 1FY7A 3OOPA 2BYVE 3ZPLA 2NNYA 2ZMEA 4HF2A 4O6JA 1YS7A 2F2EA 3F8NA 2IA1A 4R8HA 1GXQA 3KEQA 1LEBA 1BC7C 4E70A 2MLKA 4G7OF 1OYIA 5CVUA 1FNNA 2ISZA 2V9VA 3BJ6A 3L7WA 4DNCA 2P8TA 1YW9A 1ZHFA 3LAJA 1P4AA 2HGCA 5K5RA 2VBZA 2EJRA 3REOA 3KP7A 2IP2A 2NRAC 1OYWA 1RI7A 4L9TA 4RGXA 3FXQA 5D5VB 4IJAA 3DF8A 5LGUA 1S29A 4EM2A 2FU4A 2HFHA 1GHCA 3O2PE 4U7DA 2VN2A 2A3SA 4HAMA 4M71A 1ZG1A 5LHGA 4KICA 4AWXB 3WTTC 3H3ZA 1FYMA 4HV6A 1DUXC 2IW5A 2M1BA 4AIJA 3SZPA 4ZYGA 5KK1A 2HYGD 3I0TA 5E1ZB 3JAMZ 2QLZA 5ED4A 3WTWC 3Q5FA 2FNPA 2M87A 2MA3A 1Z91A 4XSXF 2VBXA 2JPBA 1Z7UA 1P4XA 5FD5A 2EV0A 2QBYA 3DPLC 3MCZA 1HKSA 4HX8A 4IPAA 5E18F 4ASNA 2FBKA 4Q5SF 2DPUA 2VODA 2H09A 1R7JA 4BXUA 3LAPA 2Y0MA 2L3DA 5LLQA 1SD4A 2G7UA 4ENJA 3HRUA 3RKXA 4RS8A 1MJ9A 1O7LA 3E6MA 3RPUA 3FXRA 4JK1X 4CZZA 1I5ZA 5K5QA 4CICA 3FM3A 1G3WA 2LF7A 1T0FA 1LB2A 4KNYA 2FE3A 1FP1D 3DXJF 1R00A 5LGNA 3QOPA 2MD5A 5FO5A 2E1NA 1DPUA 2FQ3A 4OMYA 1ZRCA 4HYEA 2H6CA 1U3EM 1YIOA 4G94A 3GF2A 2ZNZA 4WCGA 5EEGA 3GFIA 3NQOA 1J59A 4G6DA 5ILSA 1T2KA 2QQBA 1HKQA 5TRDA 3GW2A 3PQKA 3RKWA 1QQIA 5J6XA 4A0YA 4LLGF 5J8CA 2ZJ2A 2X0LA 3WTSC 2UXNA 5HDKA 1IW7F 4IRIA 1R1UA 1IUYA 3DEUA 4CHUA 3S2WA 3TOBA 2JSCA 5FGMA 2XVCA 4I0AA 3KLOA 3K2ZA 3BPXA 5HDGA 1IXCA 1B6AA 4L9JA 1SD7A 3BJOA 4GCVA 2JRTA 3RIRA 4CO8A 2DBBA 1ZAOA 1U5TB 4EVIA 2V1DA 4EV0A 4I01A 3F3XA 4RGSA 2DK8A 3T8TA 3C3WA 3GO5A 3HUGA 1MJAA 2ADUA 2HTSA 4JQFA 4XRFA 4GYGA 2VXZA 2O61A 4ESJA 4ZZLA 1L0OC 2P4WA 3KZYA 1PP7U 5DEQA 2BEOA 2PN6A 4RB1A 2XKPA 5BPIA 3TKYA 2GQQA 2IVMA 2FNAA 4HF0A 2E7XA 3GZ5A 3G73A 3V7SA 1I6XA 3JAMK 3SFZA 2KJCA 4BHBA 3H3UA 3GUDA 4L9VA 2NYXA 4F7ZA 3D5LA 2CWEA 3C7JA 4XLNF 2Z3YA 1MGTA 4LLLA 4GYIA 1T38A 2NNNA 5E8IA 4K2EA 1MDMA 4WX9A 4P9UA 3KP4A 1HSTA 5HLHA 5H6RA 4EMSA 1SD6A 4EJUA 3T5XA 1ONVA 1FX7A 2VONA 4UXNA 2GAUA 3WTYC 2HZTA 1EV7A 3OV8A 4KA4A 3GYHX 2PLYA 4ENMA 1TQIA 4ZYDA 4U0WA 2A6EF 5LEKA 3HSFA 4M9XA 4JBAA 2E1CA 5E1WA 5IT9K 2H27A 1USTA 1FBSA 1FOKA 4I98B 4ENKA 2L4MA 1K78B 3IL2A 3QAHA 3HOTA 1D5VA 3IKVA 3DV8A 2BGCA 4L9NA 3QU3A 2ACJA 1B9MA 3DQVC 1JHHA 3P9IA 5E17F 1H0MA 4AIHA 4I2OA 2Z33A 1XGMA 1S6LA 4HW0A 3WU1B 4P9FA 1A04A 2QUFA 3CDHA 2F5FA 2IA0A 4EM1A 3FX3A 1EH6A 4A0ZA 3LA7A 5L3BA 3V8LA 1XN7A 3PFIA 3FM5A 4B8XA 2LDUA 1TBXA 1GVJA 3JW4A 2ZMEB 4O3MA 5F64A 1BI2A 1RUNA 1E2XA 3B73A 3ECOA 3J81K 4OIOF 2DFIA 4S05A 4NHJA 2KIUA 2RC4A 2R7FA 3LSTA 2XHKA 2PI0A 4PCQA 4I09A 3F8BA 4M72A 2P5KA 2W25A 4KN4X 3IRRA 1LNWA 3RTRA 2HWVA 2W24A 2JZYA 4MTEA 4IRHA 1L3LA 3KETA 3DKWA 1XDUA 1YW7A 3Q9VA 1IN5A 4D0PA 4HZFA 4WWCA 2UXXA 1TNTA 2FA5A 1YYVA 3GXOA 1Q1HA 5EEHA 3SZTA 3L09A 3MEXA 1I1SA 3IKTA 5E1XA 1F9NA 2EFOA 3RJPA 3FF5A 5CVJA 1OMIA 3T1BA 4U7BA 3LQQA 4HLXA 1ZYRF 3CLOA 2COMA 4AVPA 3SQNA 1QZZA 1P4WA 3GFJA 1UB9A 1V4RA 2O6GE 1FLIA 5DCMB 1UHMA 1S7AA 2BE5F 2QYOA 4ZZDA 1IRGA 2K7LA 2HQRA 4IVNA 3N97A 2YR2A 2O03A 2RQPA 1K79A 3F8MA 2KKOA 4LD5A 3QU6A 1J7KA 5JVTA 2EWNA 5CJ9A 2M5WA 4MQ9F 1K7AA 4LK1F 3COAC 3F8CA 2D1HA 3EYYA 2CG4A 4B09A 3TO7A 1G3TA 3TQNA 2VT2A 4KFCA 1IXSB 3ROUA 2GIVA 1RIOH 3I4PA 1XSVA 3WG9A 2K27A 1B9NA 2AXLA 3JSPA 2ZXJA 2CGPA 3GZ6A 1USSA 3EETA 2B0LA 4UVAA 4OINF 3U9GA 3E6BA 3HIFA 3FMQA 2ESNA 1GXPA 2VE9A 2F5CA 5L3CA 4MEXF 2O0YA 1MZBA 2WWYA 2FSWA 3ZMUA 4RB2C 2DT5A 1XB4A 2CSOA 2Z9OA 4ESBA 2C6YA 5K5OA 3AAFA 2XKOA 1D3YA 5BOXA 1W7PA 3VOEA 3IWZA 1FC3A 3BROA 2PFBA 4Y15A 1XCVA 4QLCU 2RKHA 4R1HA 3K1PA 3R60A 5FLXZ 4IRGA 1FT9A 2GWRA 5ICEA 5IT9Z 2P7VB 4P5OA 6PAXA 2BBYA 1HW1A 5CLSA 2ZNYA 4P96A 2QM3A 1W5TA 3HRSA 1R5GA 1P2FA 4LMYA 2WV0A 1K6OA 2XRNA 3TGNA 4IHTA 2XAQA 1HW2A 4KMUX 1BC8C 1PP8F 1KYZA 3FMRA 2DLLA 1ZARA 3M8EA 4PGGA 1O57A 1Z1DA 5HS8A 1O3RA 5L3DA 1MJBA 5E8GA 4U88A 1J75A 1LEAA 3LQRA 3R4KA 1U5TA 5DUKA 5H6QA 2ELHA 4EJOA 4HF1A 4UNOA 3GEZA 3MAJA 4KIFA 3E5QA 2V1XA 3HHHA 5DD8A 1LDDA 5L3EA 3FZVA 5BS6A 4Z2YA 5CYVA 1QPMA 3J80K 2K4JA 4XBFA 2RDPA 1U78A 4UV8A 1Z9CA 3V7CA 3ISPA 3IRQA 2QQAA 2GA2A 1FBQA 2RGVA 1IN7A 3VFZA 5D6EA 2IPQX 3WGHA 2UZKA 2ZBKA 4RB3C 4G8XA 1TTYA 1LVAA 1J0RA 1VTNC 2OA4A 1ZRDA 4MGRA 5HS7A 1FSHA 2QQ9A 2CW0F 1H9GA 1FPQA 2GZWA 3LFKA 4UHTA 4M74A 2QZ8A 3V7RA 2PJPA 3WODF 3R61A 1ON2A 3F22A 3J7AO 1XMKA 2DO7A 3RYRA 5BPDA 4U0YA 5D5XB 2LNBA 4G7ZF 3M8FA 1CGPA 3GFLA 4ESFA 1X3UA 2DQRA 3HHGA 1FYLA 1ZRFA 2PBIA 3GWZA 4YG2F 3ZP5A 4EQQA 1XMAA 1O7FA 4UUVA 5DUIA 1HW5A 1I27A 4YFXF 3TDZC 3QP6A 1UCRA 1BI1A 2XV4S 2L02A 3KZZA 2Q0OA 5LRSA 1DPRA 2OD5A 3BWGA 2GXGA 1ZG3A 5LBQA 2DI3A 3LWFA 4Q4ZF 1TLHB 5HS9A 1YS6A 4MQVA 4RGUA 4BYYA 1YO5C 5FD6A 2FEZA 2R3SA 4S04A 4RAYA 2AS5F 2A69F 1ZGJA 2P6SA 3LA2A 4M6XA 5HLGA 4LLNA 2OBPA 1R5HA 4UVBA 3BY6A 2K86A 2O3FA 4LB6B 3WU0A 1KU7A 3F72A 5DD4A 1G4DA 1IXRC 4U0VA 1BI3A 2KRFA 3ZMVA 2VBWA 4L18B 5D8LB 4BH9A 4GGGA 1R22A 3CUQA 3T8RA 2ESHA 2A61A 3CUOA 5DV5A 2YX7A 1IAWA 2EV5A 1CF7B 2Z5UA 1QGPA 3O3KA 2UWMA 5LHHA 5D5WB 3U1DA 3R0JA 3L00A 2LF8A 1SFUA 5F1RA 2EFQA 1REPC 4L0ZB 1R36A 5CVVA 3I53A 1ODDA 4CYDA 4M73A 3IWFA 4LB5A 4ENNA 2HKXA 2IJLA 1HQCA 2J5PA 3MWMA 3E6CC 1O3TA 4ZH4F 2RN7A 4WF2A 4NB5A 4EJVA 3N4MA 1QZYA 1HKTA 2V6CA 3TO6A 5LRRA 5J8FA 4RB0A 1O3SA 3P9KA 1ZG5A 2YX4A 4BNCA 1QNTA 3FMSA 2QVOA 3K69A 4NQWA 2VE8A 1QO0D 3B02A 1XSXA 3QPHA 1XSDA 4BQAA 4YIFA 3HYIA 1R23A 1S7OA 3M7GA 4OOIA 1IRFA 3U2RA 2F5EA 3P9CA 3JTGA 1V3FA 3E97A 1BM9A 2E7WA 1B1BA 3HRMA 5D8KB 2TDXA 3MQ0A 2XAJA 1YG2A 1O3QA 4EJTA 2FOKA 2H94A 2EFWA 2GA1A 1K78A 1HXDA 3EUHA 4LFUA 1RZ4A 4KYWA 3ELKA 2ZFWA 1ZH5A 1MD0A
chains in the Genus database with same CATH superfamily
2K9SA 1VQ7I 3J7AY 1JGSA 4HLYA 3WTUC 2XASA 1PDNC 1RKWA 4AD9A 2LKPA 3S3OA 4FT8A 5FB2A 3I59B 1U0JA 3ZN1A 2HNHA 2A05A 4BHCA 5FFXA 2M7BA 1ZREA 1ITYA 5AIPA 4E7LA 3V4GA 4H0EA 2WB1A 4NQWB 1ZN2A 4BHPA 3G1OA 3CO7C 3R6SA 1MSFC 2R92J 2M30A 1PVEA 4B44A 2ZO4A 3C1DA 4M6YA 2STTA 1WQ2A 4XOPA 4A0XA 4RM3A 4MTDA 1F4KA 1OPCA 1R58A 2JUCA 2LC2A 5M5XJ 1X1PA 3MKYB 4BY7J 1C0WA 3C18A 4XKWA 1TT0A 3AG1H 2ID3A 2IGMA 3PSIA 5DYMA 1XCBA 3FK6A 4I6ZA 3ABLH 5HNHA 1IZ1A 3B6AA 2KRHA 2MH2A 1WKMA 5ERIA 4XSZF 2A5YB 3EUAA 1TNSA 3TDUC 2IEKA 2XGXA 2F5VA 1W0TA 3ULQB 2CQXA 2W84A 1I1GA 1P6RA 4G12A 1NH3A 1CF7A 1R5ID 3S1QJ 3M8JA 1EH8A 3SEQA 4U87A 4Y17A 1X1AA 4WXDA 2JTVA 1PUFA 1U9OA 1T6SA 4ETSA 2D2WA 3BDDA 1JHFA 4BQQA 4EEFG 4UVCA 2FBHA 3K6GA 1IJWC 2EPFA 2QKMB 4HDVA 1ZGAA 5LEJA 3A1YA 1BI0A 2LD5A 3RPQA 1YX3A 4IQJA 1UHSA 2JMWA 2L4AA 2PG4A 1APLC 4EGZA 5KAIC 2V79A 3QPTA 3L2CA 3PIOF 1R4NB 1T39A 1Y0UA 1MBKA 5M5WJ 3J80Z 3F8FA 5H20A 2WAEA 2VC1A 1DP7P 2P6TA 3I64A 2NS7A 2DU9A 4BQNA 1F5TA 4L5IA 1W7PD 2DOFA 2ZCWA 2KDZA 4X6AJ 3H35A 4RBOA 2X9DA 5CKTA 4PZJA 1DDNA 1RKTA 4ZDPA 3EYIA 4GO1A 4O5VA 1ULYA 1WZ2A 1V54H 1UFMA 3QP5A 4GXOA 3I59A 4E7ZA 4MNUA 2Z16A 2V26A 4CCKA 3E3VA 3QYFA 4PSXA 5KHDA 2ELKA 4KIBA 3E5UA 2GXBA 1S8NA 3WTXC 4FASD 4ITVA 3K70C 1EH7A 3ASNH 4X0GA 1FMWA 1MIJA 4MEYF 1SFOJ 4AYBN 4OIQF 2RNJA 5IT3A 3DP7A 4JX4A 5FFZA 3TP3A 4AIDA 1DU6A 1EJ9A 1IGNA 3E5XA 2M4GA 4NC7A 3L2UA 2NVQJ 2Y9ZA 5EG0A 3BG6A 3UNGC 3FISA 2XIGA 3F6OA 3GFMA 1H89C 3G2BA 2NAZA 2N8GA 1IF1A 2O5RA 2E1OA 4N9IA 5DTDA 2V1NA 4ZYEA 1MKMA 2XPWA 2EA4A 4KIGA 3M1EA 4G9YA 5E20A 5HVQC 2EK5A 4M9ZA 2VUMJ 1ZGWA 3ABMH 4BEHA 4BE0A 2MD0A 1WGXA 1P7JA 5J1YA 1JUMA 2ZXIA 4HV5A 4XLFA 3I58A 4EJWA 4FTHA 4A3LJ 1G3YA 4XLPF 1G6NA 1NHAA 4CCJA 3G4SI 3FXUA 4YEJA 2XC7A 4HX4A 4ZTJA 2JT1A 2CO5A 2KZGA 4LJZF 2ZB9A 5IY5H 4F92B 2ZJPF 4DZJA 1N77A 1XX5A 5CVIA 5F1JA 1A35A 3GX4X 4FX0A 2DOEA 2Q8KA 3QWLA 4N9HA 3WGGA 1PJRA 2X6OA 1NTCA 2VPRA 4LGWA 3JRGA 1U8RA 1R49A 2M45A 3M9AA 4CXFA 1QBJA 3V42A 4A6EA 2EZKA 2D1VA 2HYFA 3K1NA 5GADJ 1H8AC 4KDPA 2KRCA 1IC8A 1H9TA 2M8EA 4B47A 2IS1A 4BAYA 3V8JA 1J5YA 3CZ6A 1W36D 4BGDA 3LSJA 5ICCA 3ZMTA 1LKXA 5ICFA 1X2NA 4DYQA 2BOLA 3QQAA 3FWEA 5FKLA 4UUTA 2LKXA 3TW6A 3GTKJ 3DU5A 4G6QA 2LYCA 4LK0F 5JR3A 2V1UA 2LTPA 3KX2A 1FIAA 4AU7A 2A07F 1WJBA 3F6VA 5HLIA 3P7NA 1KONA 3JR9A 2EINH 4CGZA 1WJAA 3Q9SA 1MH4A 3HTSB 2MBFA 5H2FC 2CFXA 3TOAA 2XAGA 1HSJA 3KE2A 2HOAA 3MMYB 2XAUA 2R7QA 1YFHA 1YRNB 1X3ZB 3I71A 3KCCA 1LE8A 4BU2A 1ZLKA 1LPQA 2EZIA 1TP4A 1X1DA 2DTRA 3RYPA 4DOZA 5GPAA 2Z2SB 3IHUA 1IN6A 2HR3A 2DMUA 3GTPJ 1SFKA 2F4MB 5HDNA 3IH2A 2DMQA 2IAIA 1SAXA 2B63J 3RZDJ 3ZMSA 2ECBA 2PMHA 4I7HA 3A4CA 2O8XA 2XPVA 3BCBA 4FQGA 3TMOA 3HOVJ 2CUFA 4HQEA 1YHQI 4ANJA 2IRFG 3Q0VA 2FX0A 2ETHA 2XAFA 3HRTA 4D1QA 3HOWJ 1PUEE 1TQPA 2EFPA 1JJ6C 2L0KA 5DDGA 3KFWX 1OISA 2OZ6A 2YS9A 5D6FA 5EZGA 4B3XA 1HBXG 3MZHA 4XR6A 2KIFA 1ETYA 2LFBA 3DTEA 2CRGA 1MBJA 2J5OA 2HOEA 1JT6A 1OYYA 2KJBA 2Y30A 3KP5A 3NARA 4KISA 4BACA 1RNLA 4HBLA 4DQ2A 1S5LC 2IS2A 3BG9A 3OYLA 2VKVA 4IHSA 2DMTA 1W36C 5HNFA 4XLCA 3CJNA 1WJ5A 4XIDA 2WBMA 4V2GA 3FBNB 4JP0A 2F4OB 2KIMA 4L5JA 4EM0B 1XGOA 2LVSA 2W57A 3DPTA 1J9IA 3RDIA 5E3LA 2B7EA 3PQJA 2LY1A 2HTJA 1SFXA 1STZA 2R7OA 3W6KB 3GCMA 3A01A 3CUQB 4YFKF 3LSPA 2IA2A 4LIUA 1JTXA 1YIJI 5K7FA 1B59A 2DCEA 1Z77A 2DA2A 4ON0A 2ME6A 1MW7A 3S2HJ 4F93B 3I55I 2A6HF 2Y75A 3TW7A 3OYAA 1AU7A 3DLAA 5B66C 2DYSH 1NG7A 3CJQB 1WRJA 3I54A 2K02A 1BJAA 1T98A 2XF7A 3OWTA 4R79A 2XB5A 4RAZA 2L9RA 1XD7A 4A5MA 2HDDA 2V9PA 1D1AA 4HX7A 3FXKA 1ZLJA 4II3A 3BPVA 5D4RA 2R5ZB 1XGSA 4LIVA 5CVRA 4A5NA 3O6BB 2O8KA 2I10A 4HQMA 3K4LA 5A2QK 3H9GA 2EFNA 2L7ZA 4PGHA 3OS1A 2HVSA 4J00A 4QWQA 3E6DA 3WE3A 1FZPB 1JE8A 3LSGA 3T0YA 3PNVA 3HOSA 3CC4I 2OQGA 5EEAA 1G3SA 3LSIA 3HOZJ 4TV7A 1MMGA 2OTLI 2FMYA 3KLNA 1T0FC 1YQAA 3HL2A 1KYWA 4PDKA 3PUBA 4XORA 1LFUP 2G9WA 3DFGA 3ZMDA 3PM1A 2R0QC 3IP4B 1W5CC 2YU3A 4YFNF 3L2VA 5DCMA 4E7JA 2QCOA 3PO2J 2ZSHB 3LSMA 3TO9A 5ILVA 1U2WA 5LHIA 3IH3A 1AHDP 1Z05A 2ICWG 4OIPF 2R7DA 2FMLA 3K4JA 1SFEA 4WK8F 2LSOA 2OAZA 3MFKA 3HOYJ 3ECHA 1Q1VA 1HA8A 1E3OC 1MH3A 3A0HC 1YTYA 4IF4A 1WSUA 3FHZA 4NNJA 2DPDA 2JVGA 1B4AA 4WXCA 3VB2A 5HOOA 2K9LA 3HKZN 4MHGA 1J2XA 1BOAA 1KQ8A 1K4SA 1LDJA 2GOMA 3FDYA 2MH9A 1UELB 1IN4A 5AONA 3Q3SA 3J81Z 3BTCA 1BBYA 2K3PA 2PQ8A 3QRFF 1FOWA 2CFOA 2W85A 2DT7B 2EV6A 2VASA 4UUSA 4ZC3A 2EA2A 3OYGA 1G8XA 2VOPA 2P5VA 2YUSA 3W6JB 2B9SA 4KMFA 2DA3A 3BZ6A 1KQ9A 1BIAA 3BR3A 3H92A 4HA8A 3AG2H 1JKQC 1WI9A 1Z21A 3DCFA 2BY0A 2KIQA 3EDPA 2FRHA 2Z99A 5M5YJ 3ZQFA 5C4JJ 3CUQC 3R0AA 1D0YA 3CDIA 3IH4A 4CYCA 1X4PA 3OYCA 2E2HJ 3Q0WA 1HDPA 5FKMA 1IRXA 1YW8A 1P7IA 2BV6A 2DYRH 4XLHA 2ZFUA 2BVMA 2WY8Q 4B1RA 4FETA 4FX4A 2HDCA 1A36A 1W7PB 1SMTA 2OU2A 3VODA 1G2HA 2QSFX 3NEUA 3G3ZA 5D5UB 2EQRA 4KT5C 1D8JA 2Y69H 5K7ZA 1R6RA 1SAUA 1J09A 1RR7A 2L01A 2IGKA 1ACIA 4IXAA 3KEOA 1LFBA 2PMUA 3SXYA 3GTLJ 1FP2A 2CYYA 3HTUA 4RGRA 3K0LA 3SDGA 1MNMC 4OIRF 2QWWA 5EG0B 1N78A 2VKEA 4PSWA 3J7YJ 2Q2EA 1BR4A 4Y13A 4F91B 1FSEA 5L3FA 2XSDC 3S1NJ 1W4MA 3PUFA 2IS4A 1SVLA 2OZUA 2ZXWH 1ON1A 2AXTC 1Z6RA 3CTAA 1VQLI 1FOXA 3WTZA 1FBUA 3Q0UA 2H6BA 2Q1ZB 3OR2C 4YRVA 4XN3A 2YSRA 4ZJZA 5L3GA 2DTZA 3WTVC 1OLTA 2G7HA 4XKBA 2MC3A 2ME0A 3RKQA 2JK3A 1U6GA 1YLFA 3VWBA 2A6TA 1SMYF 3H5RA 1IN8A 2K4BA 4Y33A 5BQTA 2HS5A 2DAOA 5K1YA 2DDBA 1POGA 3ZQ7A 4EGYA 4XONA 2OTJI 1KU3A 3HSEA 1ZKGA 3W2WA 4HDUA 3ABUA 3SZGA 2XUBA 4UV9A 4E7SA 1R1TA 1QA6A 1G59A 2K9MA 2H1KA 1KU9A 1WWXA 3ERMA 3J7ZI 3OYKA 1FTZA 4KN7X 2G0EA 2EBIA 2HQNA 2VC0A 3BOQA 4I0BA 4QIWN 5JFRA 3ERED 1XGNA 4KITB 4W97A 4L0YB 3ABTA 1XDSA 2ZKZA 1E3HA 3DTIA 2VQHA 1VQOI 5FLMJ 3HSRA 4IOCF 1XMXA 3I56I 4E6KG 2HKOA 3MZYA 3ZQCA 1TW2A 1OCZH 1QVTA 3TL4X 4CDGA 5JI6A 1KU2A 2I8DA 2EIJH 2MLGA 1UHWA 2F5DA 2GM4A 2NS0A 2ISYA 1SD5A 5DM7F 1X58A 2H8RA 1IUFA 3IC7A 4HOBA 3CCUI 4ZYHA 4HRIA 3OS2A 5FLXK 1VQKI 1YJ9I 5FLVA 2QENA 4NC6A 5A2QZ 3ZMZA 2HPIA 2FF4A 1OKRA 3CC7I 2EB7A 3F21A 4Y3OA 3JSOA 2UUZA 3BQYA 3LSKA 4LG3A 2XGEA 1ZR2A 1HF0A 1JKRC 2Y48A 3NRVA 3H1CA 3GZNB 2HVRA 4M9SA 1VZ0A 1OCPA 2X4HA 1AWCA 3NAUA 3VEPA 2JUGA 3ML6A 1BIBA 4KUMA 2HEOA 1UZCA 4AIKA 4Q48A 3S2DJ 2IT0A 3CESA 2RV8A 1WVRA 5AIQA 5BNGA 4N4OB 4N0BA 3GMEA 5F6FA 3F23A 3EQLF 1VQ8I 1EA3A 2L9NA 3WU2C 1X4OA 3WGIA 3LA3A 1F1ZA 3CO6C 4X1EA 5GPCA 1SVMA 4A2UA 2JPCA 3LNQA 5BMZA 4LG0B 2YPRA 3GVAA 3SEZA 5ICGA 1W5SA 1Z6TA 2WC2A 3H0GJ 1VQ5I 1LJ9A 5HODA 1BA5A 2CUEA 2VOOA 3DPUA 4Q47A 2DQLA 1HCRA 4JYKA 2RVCA 5ILUA 1KA8A 1TC3C 4CCNA 4G7HF 2WAQN 2BZTA 3BG3A 2RREA 1MDMB 4LG0A 1LQ1A 2P7CB 2LREA 1A31A 2OPTA 3ZGKA 3KP6A 3DU6A 1TL8A 2MC4A 2VT3A 1GLNA 1I50J 3ZN0A 2KFDA 3CCJI 3CCQI 1OCCH 2X85A 2CQQA 3G71I 4NC8A 4XKVA 2QEXI 1ETWA 5IYDJ 3K1MA 2FXAA 2P5LC 2ZXHA 2W82A 3RI4A 1S9HA 2DK5A 3OS0A 4BE2A 1E17A 1NG6A 3K4BA 2D45A 3JRDA 4Z6YA 3S3MA 4A12A 4FHTA 3KP3A 1OQYA 1T95A 3D0SA 1R1VA 1WPKA 1BW5A 3GTMJ 5KVRA 5TJJA 2OQRA 2PEXA 1U5TC 5GAEJ 1LDKB 1P92A 2CW8A 2A68F 4QPQA 2QGUA 3HJEA 4A3CJ 2DA6A 2QBYB 3BG5A 1S3JA 2L9SA 2M2EA 1TWHJ 4L5EA 4RAGA 1RUOA 1ETVA 1KQ0A 3WE2A 5GAGJ 4LITA 2DFFA 2CQKA 4OU0A 1FEXA 2CUZA 1K6YA 3SHFA 5LD2C 2M9HA 1ORKA 2KPMA 2XAHA 1AOYA 5LGTA 1B72A 1HC8A 4XRSA 1UG2A 3I5UA 3DKYA 3GLXA 2WTEA 1BN5A 1OR7A 2X6WA 4QSHA 5DM6F 1FMVA 1YITI 1MBFA 2CH0A 3BP8A 4I02A 3BJAA 3RKYA 3L9FA 2VQCA 4H4KC 2STWA 3DEEA 2EZLA 3K9TA 5D4SA 3HOXJ 5DCFA 3PSFA 2OJED 3FXMA 4P55A 3JTHA 1QU3A 3P5JA 2W7NA 2DW4A 1FWZA 5JHUA 1ETOA 4HSRA 2MABA 2HPMA 2E36A 1YOVB 2VBYA 1TQMA 3K4MA 4S0HB 3PNYA 4DZPA 5GTHC 2QF7A 2KLOA 2VQLA 2VKDA 3RPUD 3BR2A 1FYKA 4YIIA 5J47A 4BS9A 4OMZA 3FHNA 3V8KA 1BR1A 4BXXJ 2L54A 3OYEA 1D8KA 2W4SA 1JXSA 2XROA 5EZHA 3JREA 1ETXA 3OY9A 3KP2A 4GDFA 2FBIA 3CP8A 1TW3A 4A6DA 4D9JA 1KGSA 4WXHA 1FY7A 3OOPA 2BW3A 2BYVE 3HC7A 3ZPLA 2K3FA 2LY2A 2NNYA 2ZMEA 4HF2A 3NWTA 4O6JA 4DGWB 4CUGA 2L2OA 4DYRA 1YI2I 1YS7A 3HPHA 2F2EA 1WJFA 3F8NA 2IA1A 4R8HA 2BY1A 1GXQA 3KEQA 2NVYJ 3HGGA 4UUSB 1LEBA 3ASOH 1A6IA 4IHVA 2VJ5A 1BC7C 1XTAA 2O9LA 4E70A 2PJRA 2GOXB 2MLKA 2V7FA 4G7OF 2JJ7A 2R4GA 1OYIA 5CVUA 4HNTA 1FNNA 2ISZA 1E0EA 2V9VA 3BJ6A 5B5EC 2HQ5A 3L7WA 4DNCA 2P8TA 1YW9A 1ZHFA 3LAJA 1Y1WJ 1P4AA 5F27A 2CU7A 2HGCA 5K5RA 2VPLA 2VBZA 2EJRA 2HQAA 3REOA 3OYHA 1T08B 3KP7A 1K4TA 1O4XA 2IP2A 3K4KA 3OIOA 2NRAC 3CCYA 4HG2A 2JQ7A 1OYWA 1RI7A 4L9TA 4RGXA 5EGOA 3FXOA 1HOMA 3FXQA 2M3AA 5D5VB 4IJAA 3CJRB 1IDYA 3DF8A 3HZJA 5LGUA 4CH7A 3ZQGA 1S29A 2CJJA 3K7AJ 4EM2A 1QVUA 5J1UA 2FU4A 5DS9A 2VXDA 2HFHA 4P1WA 1GHCA 4J01A 3O2PE 4GFBA 4U7DA 2VN2A 3SDBA 3C2BA 2A3SA 2M0MA 4V19K 2JSPA 4HAMA 4E4HA 4M71A 1ZG1A 5LHGA 1ZR4A 4KICA 4AWXB 1JI8A 3WTTC 3H3ZA 1OFCX 2QKLB 1FYMA 4HV6A 4PJMA 3L2QA 5IP9J 3EUHC 5EDNA 2IW5A 2M1BA 4IO9F 4AIJA 1DUXC 1RETA 3SZPA 4ZYGA 5KK1A 2HYGD 3I0TA 2COBA 2ECCA 5E1ZB 2RAEA 3JAMZ 1A6QA 4XLEA 2E1MC 5JLXA 5IP6A 3CMMA 3LL7A 1R4MB 3VPRA 3TEDA 4D5CA 2QLZA 1MMAA 5ED4A 3WTWC 3Q5FA 2FNPA 3BZKA 2M87A 2W00A 4EATA 1YE9A 3BZCA 2MA3A 3A01B 1D5YA 1Z91A 3EUKL 4C30A 1X1BA 3DTKA 4XSXF 3VSKA 2VBXA 2JPBA 1JGGA 2FOWA 1Z7UA 3S32A 1P4XA 3BR6A 1I39A 5FD5A 2EV0A 2QBYA 3DPLC 3OYBA 3MCZA 3CMEI 3FIWA 1SC7A 1HKSA 1Y8QB 4HX8A 4IPAA 5E18F 3G6EI 3HG9A 4ASNA 2OCEA 2FBKA 2LRDA 1FTTA 4Q5SF 3ZXSA 2DPUA 3OIQA 4XLAA 2OUMA 2VODA 1RR8C 2H09A 4BY1J 1R7JA 3W6VA 5KNLA 1I6HJ 4BXUA 3LAPA 3OYDA 2BXZA 2Y0MA 2L3DA 3M07A 5FRMA 5LLQA 4HSTA 1VQ4I 4YELA 2HI3A 3OOUA 1B72B 2WY7Q 4FISA 5E3MA 3CMAI 5E79C 4ZYAA 1SD4A 2G7UA 2DFEA 4ENJA 3HRUA 3RKXA 4RS8A 1MJ9A 1O7LA 3E6MA 2WAFA 3CLQA 3RPUA 1SEUA 3S16J 2FQ4A 3FXRA 4V2FA 1WHUA 2DJNA 3CDLA 4JK1X 5TISC 3HXLA 4CZZA 4MIMA 2CV1A 1I5ZA 5K5QA 1T33A 4CICA 3FM3A 2Y9YA 4C3HJ 1G3WA 5B3SH 1FJLA 2LF7A 1YJWI 1T0FA 1LB2A 4A69C 4KNYA 3VYSB 2FE3A 4N4NB 1FP1D 2CQ7A 4DW6A 3DXJF 1R00A 2EILH 5LGNA 3OL4A 2MD5A 3G1MA 3QOPA 5FO5A 4IKFA 3S8PA 2F6CA 4G6TB 4C9YA 2E1NA 3K70D 3H36A 1DPUA 2FQ3A 4OMYA 4XRSG 1ZRCA 4HYEA 2H6CA 2MGQA 1U3EM 1YIOA 4G94A 2R5YB 1YRNA 3GF2A 1K83J 3CF5F 2ZNZA 4WCGA 2NVXJ 1OCOH 4HNVA 5EEGA 3GFIA 2JA7J 3NQOA 1J59A 4G6DA 5ILSA 4F3QA 1T2KA 2QQBA 1HKQA 5TRDA 5M3FJ 3GW2A 1NK2P 3PQKA 3RKWA 1A5JA 4NDLA 1QQIA 5J6XA 4A0YA 4DBRA 4LLGF 5J8CA 1UAAA 2ZJ2A 1E3PA 2X0LA 3WTSC 2UXNA 5HDKA 1IW7F 4PFOA 4IRIA 3H5AA 3ESWB 1R1UA 4C3JJ 5JHFA 2BY2A 1IUYA 3CQZJ 3DEUA 4E7IA 4CHUA 3S2WA 3TOBA 2JSCA 5FGMA 2JRMA 4IL6C 3E0JB 2XVCA 2X48A 4I0AA 3KLOA 1ZK8A 3K2ZA 2V9KA 3JRBA 2R7VA 2DN0A 1VI0A 3BPXA 3F0CA 1QHHD 5HDGA 1IXCA 1B6AA 4L9JA 2LKSA 4DIQA 5KAFC 1SD7A 2HYJA 3BJOA 4XICA 4GCVA 2JRTA 1V55H 3RIRA 3QODA 3H3VK 3LSRA 1ZTRA 2XGCA 3AL0B 4CO8A 3HKZA 5IYBJ 2DBBA 2X6XA 1ZAOA 1U5TB 3LOCA 4EVIA 2JA2A 2V1DA 3BR5A 2NXNB 3HUGB 4EV0A 4IHXA 4QTRA 4I01A 2M8GX 3FXJA 3F3XA 2E19A 4IOAF 4RGSA 2IBDA 3S14J 2DK8A 2WAQA 3T8TA 3C3WA 1I3AA 1D0XA 2L9VA 3GO5A 1Y6IA 4B43A 3D1NI 1XS9A 3HUGA 1MJAA 3ZOBA 1VQPI 1W0UA 2ADUA 5F0HA 2HTSA 3OMYA 2L7FP 4JQFA 4XRFA 5C44J 1ETKA 4GYGA 2VXZA 2O61A 4ESJA 1V5GA 1MNDA 4ZZLA 1L0OC 4DBQA 2P4WA 5FJ8J 3KZYA 1PP7U 5DEQA 3DWLE 2BEOA 2PN6A 4RB1A 2XKPA 5BPIA 3TKYA 2GQQA 2E1MB 1U9NA 4JX5A 2IVMA 4M3BA 2FNAA 4HF0A 2E7XA 3GZ5A 2DT6A 3LFUA 3G73A 3V7SA 1I6XA 3JAMK 3HOUJ 2NVUB 3SFZA 4MO7A 2KJCA 1AA7A 2NOJB 4BHBA 2MFZA 2VL8A 3H3UA 5GTIC 2HVQA 5FROA 3GUDA 4L9VA 3TP0A 2NYXA 4F7ZA 3D5LA 2CWEA 3S17J 3C7JA 4XLNF 2Z3YA 3SYTA 3N05A 1XC5A 3PO3J 1MGTA 4LLLA 4KT6A 3CCRI 3X2QH 3AG3H 4GYIA 1T38A 2NNNA 5IYCJ 5E8IA 2F4IA 1W1WE 4K2EA 3M4OJ 1MDMA 4WX9A 2HXOA 4P9UA 2BHZA 3TBIA 3PIPF 3NWSA 4AYBA 3KP4A 1JUSA 1HSTA 2OF7A 5HLHA 2FJ1A 5H6RA 2WADA 3L2RA 4EMSA 1BW6A 1SD6A 1MMDA 4EJUA 4KJZA 3T5XA 1WFXA 1ONVA 2KDOA 1FX7A 2VONA 4UXNA 3VYUB 2GAUA 1QPIA 2DODA 3WTYC 3JRAA 2HZTA 3ZCOA 1EV7A 3OV8A 4KA4A 3GYHX 3U21A 3JCUC 2PLYA 1WH5A 4OAYA 3GTOJ 1TQIA 4ENMA 4ZYDA 4MFEA 4RDUA 4U0WA 2A6EF 3VYTB 5LEKA 4D7NA 3HSFA 4M9XA 3C2HA 4CCOA 4JBAA 2E1CA 2DFHA 5E1WA 5IT9K 3AG4H 1WJCA 2H27A 1RESA 1FBSA 1USTA 1TT5B 1FOKA 4I98B 2AQEA 3JRHA 2EIKH 4ENKA 3I4MJ 2L4MA 4M3FA 4E7KA 1K78B 1DGRM 3ZRGA 3VYRB 1Z3XA 3B6CA 3IL2A 3QAHA 3HOTA 1D5VA 2GIZA 2VJIA 3A2KA 1F43A 2VKHA 3U1KA 1OCRH 1CQTA 3IKVA 3DV8A 4CYCB 2BGCA 4L9NA 3PJRA 3QU3A 4A3DJ 2EIMH 1MNEA 2XSJC 1QHGA 5FKKA 1BOBA 2ACJA 1B9MA 4OAZA 2H1LA 2R5YA 3OYJA 3DQVC 2VJJA 1JHHA 4BJ5C 2LY9A 3P9IA 5E17F 1H0MA 4AIHA 5GP9A 4I2OA 5C4XJ 2Y31A 1GVDA 2CUJA 1R71A 2R7ZJ 2Z33A 4FE4A 1XGMA 3AFHA 4HPQA 1ETQA 3E1SA 2R7TA 4HNUA 1S6LA 3GTGJ 4HW0A 5EYRA 3WU1B 1UJ8A 3MKZA 4RA2A 4P9FA 2KZVA 1A04A 1MBGA 4PJNA 2QUFA 3CDHA 2F5FA 2IA0A 3C2GA 4IX7A 5GAHJ 4RAFA 1EKEA 2XGDA 4AC0A 3OSGA 5B1AH 2MSYA 4EM1A 2JVHA 3FX3A 1EH6A 4A0ZA 3LA7A 2X1CA 5L3BA 2DDAA 5CQGA 3V8LA 4YIRX 1XN7A 3CCEI 2IS6A 3PFIA 2L5QA 3FM5A 4B8XA 2LDUA 2E2IJ 1IG7A 2IGOA 1TBXA 4M6VA 3OSFA 4IEJA 4C2UA 1GVJA 3JW4A 2ZMEB 2H8WA 4O3MA 4XM3A 2X1EA 5F64A 1BI2A 3SJMA 1RUNA 1E2XA 3HPGA 2R7WA 5TGTA 3B73A 1WCMJ 3ECOA 1MSEC 2JWTA 2XDVA 3J81K 4OIOF 2DFIA 2CS3A 3A0BC 4PK4A 4S05A 4NHJA 2KIUA 3OYIA 2RC4A 2R7FA 3LSTA 3S1MJ 2XHKA 5IOZA 2PI0A 4PCQA 2LP0A 4I09A 1LUJB 3F8BA 1XPXA 2VIXA 4M72A 2FD5A 2P5KA 2W25A 4KN4X 3VDXA 1T56A 3IRRA 1LNWA 3RTRA 2MG4A 2E5ZA 2HWVA 2W24A 2JZYA 4MTEA 4XNFA 3D5SC 3HEFA 2JA8J 4A93J 4B3AA 4IRHA 1L3LA 1S7EA 3ZQQA 3KETA 3DKWA 1XDUA 2M7AA 4NUBA 1YW7A 4C2TA 3Q9VA 3RSNA 3VSLA 1IN5A 2DA1A 4D0PA 4IHWA 3JRIA 4HZFA 4BJTA 1R9TJ 1DGWY 3DEWA 2NS8A 4WWCA 3O8GA 3ZQIA 2UXXA 1TNTA 2FA5A 3K4NA 4CA0A 3QYEA 4B48A 1YYVA 3GXOA 2EH3A 1Q1HA 5EEHA 3SZTA 3L09A 1KZHA 2VLAA 4I99C 1TWFJ 3ONQA 3MEXA 3PFYA 4II2A 1I1SA 3IKTA 2V4JC 2R7SA 5E1XA 1F9NA 4DJAA 2EFOA 3RJPA 2V6EA 3FF5A 5CVJA 1OMIA 3T1BA 3IAM2 4U7BA 2ZMEC 3LQQA 2BXYA 4HLXA 1ZYRF 3CLOA 1BJZA 2COMA 4AVPA 3SQNA 1QZZA 2Y2ZA 1GV2A 1P4WA 3GFJA 1UB9A 4BDZA 1V4RA 3BQZA 5J4VA 3BG7A 2O6GE 1FLIA 4PJJA 5DCMB 5F0FA 3IV5A 1Y56A 1VQNI 3K10A 1UHMA 1S7AA 2BE5F 4GRIA 5J1RA 4A3IJ 2QYOA 4ZZDA 1B8IA 3MN2A 4NBQA 1IRGA 1FIPA 2K7LA 2HQRA 2TCTA 3AKZA 5CPRB 4IVNA 5E3OA 3A03A 3N97A 1GUUA 2YR2A 2O03A 2DMPA 4C2MJ 2R7XA 2RQPA 1K79A 1ENHA 4A3GJ 4ZDOA 3F8MA 4IQ4A 1VF9A 4PJ0C 2KKOA 3S93A 4LD5A 3QU6A 1J7KA 2XB0X 5JVTA 2BVLA 2AQFA 2EWNA 5CJ9A 3HDDA 2M5WA 4MQ9F 1WH7A 3I9V2 5KCMA 4LK1F 1K7AA 3UKGA 2KQRA 4AUXA 5M3MJ 3COAC 1LVKA 2D1HA 3F8CA 2E34A 3EYYA 3H9QA 4M3DA 2CG4A 4B09A 1V5EA 3TO7A 2XRLA 3S1RJ 1G3TA 1P9QC 3BR1A 3TQNA 2VT2A 3SFIA 2R7UA 2P81A 3OL3A 3OYMA 4KFCA 3DKXA 1OCTC 2FUG2 2BHYA 1IXSB 3MD2A 3ROUA 2GIVA 2PMZA 1RIOH 3I4PA 1XSVA 3WG9A 2K27A 3FKIJ 4XMYA 3BR0A 1RRJA 1B9NA 2AXLA 3JSPA 2ZXJA 2Y0SA 4BJ6C 2CGPA 3GZ6A 4XN0A 1USSA 4IHYA 1GV5A 4CZCA 2ZJQF 3EETA 2B0LA 4UVAA 4OINF 1PUFB 3U9GA 2KISA 4MFDA 3BTIA 3E6BA 2IXSA 1JTYA 3HIFA 3FMQA 4B4CA 2ESNA 1GXPA 5F0CA 2VE9A 3CCSI 4J19A 2F5CA 4PUSA 4I76A 5L3CA 4MEXF 2UV1A 1X1CA 2O0YA 2TRTA 4BXFA 2QA4I 5EGOB 1MZBA 4XK4A 2WWYA 1Z7LA 2FSWA 3ZMUA 2DT5A 4RB2C 1X2MA 1XB4A 2CSOA 3BC8A 2Z9OA 1ERDA 1QZEA 2M4KA 1FOYA 4ESBA 2C6YA 2QSHX 3A02A 5K5OA 3AAFA 2XKOA 4M3GA 4A3JJ 1D3YA 2P0WA 5BOXA 1W7PA 3PNTA 3VOEA 3JRFA 3IWZA 1FC3A 3BROA 2PFBA 4UB8C 4Y15A 1XCVA 1RC9A 4QLCU 4CSWA 2RKHA 4R1HA 3FK7A 2OCCH 2PMZN 1ZQ3P 2K9NA 4F52A 3S15J 1Y39A 4UY8I 3W2AA 2CV0A 3K1PA 3R60A 5FLXZ 1D1BA 4IRGA 5J40A 1DU0A 1FT9A 2GWRA 5ICEA 5IT9Z 2P7VB 4P5OA 6PAXA 1QRYA 2BBYA 3DBRB 4XRMA 4A3BJ 3RQ4A 1HW1A 5CLSA 2ZNYA 2VJ4A 4P96A 3ZR8X 3KYCB 1MBEA 2QM3A 1D1CA 3DLLF 2ZSIB 1W5TA 1WI3A 2LLKA 1JJ8C 1Y1VJ 3HRSA 1TWGJ 1R5GA 1IO2A 1P2FA 4LMYA 2WV0A 5LFAA 1TZLA 3HM5A 2X1DA 1K6OA 2K40A 2XRNA 3KEYA 4OWRB 2NOGA 3TGNA 4IHTA 2XAQA 1HW2A 1D0ZA 3MKLA 4KMUX 1S72I 1BC8C 4HEA2 4D7MA 1PP8F 1HDDC 1KYZA 3FMRA 3WHCA 4MLOA 2LG4A 2DLLA 3H9JA 2DA5A 1ZARA 3LSHA 3O8HA 3HGYA 4D5FA 2BY3A 4XQFA 3M8EA 3H5NA 5J3LA 4PGGA 1VFCA 1O57A 1UMQA 1Z1DA 5HS8A 4QPOA 1O3RA 3GBGA 5L3DA 3MVPA 5IPAA 4A3EJ 1MJBA 5E8GA 4U88A 1J75A 2HOSA 1LEAA 3LQRA 2LBFB 3R4KA 1U5TA 5DUKA 5H6QA 4LOCA 2X6YA 2ELHA 2LH9A 3CMYA 4EJOA 3KYLA 4HF1A 4UNOA 3GEZA 4M3EA 1IV6A 3MAJA 4KIFA 1AKHB 5E3NA 3E5QA 1H88C 2V1XA 3HHHA 5DD8A 1LDDA 4FE7A 2LOOA 5L3EA 5JLWA 3FZVA 2O7OA 2DJIA 2KL4A 4W1UA 1AKHA 1HLVA 1NK3P 2VB6A 5BS6A 1IRZA 3K4CA 2X51A 2ELJA 4Z2YA 5CYVA 1QPMA 2BW3B 2JN6A 3J80K 2K4JA 2R93J 4XBFA 3FKJA 4F55A 2RDPA 1U78A 4UV8A 2ID6A 3DBHB 2HXIA 1Z9CA 3CCMI 3V7CA 3ISPA 4IZZA 3IRQA 2QQAA 2GA2A 1FBQA 2RGVA 1IN7A 3VFZA 5D6EA 2IPQX 2CV2A 3WGHA 2UZKA 2ZBKA 4RB3C 4BEHB 1F36A 3GLLA 2OC6A 3L2WA 4G8XA 1TTYA 5FKOA 1LVAA 1J0RA 1VTNC 4BBSJ 1GDTA 4Y7NJ 2Z1DA 4XL9A 2OA4A 1BL0A 5HLTA 1ZRDA 4MGRA 5HS7A 1FSHA 2QQ9A 2CW0F 1H9GA 1V5FA 1FPQA 2GZWA 3LFKA 4UHTA 4M74A 2QZ8A 3V7RA 1Y0NA 4BQOA 2R5ZA 2PJPA 1VQMI 3WODF 1EF4A 1VNDA 2HZDA 1LFPA 1N75A 3I4NJ 3R61A 1ON2A 2KT0A 3F22A 4BKXA 3J7AO 2M0CA 3PL8A 4PJLA 1XMKA 2DO7A 3IAS2 3RYRA 5BPDA 2E71A 3EPZA 5D5XB 4U0YA 1LE8B 1JKOC 2LNBA 4G7ZF 2LBFA 3M8FA 1CGPA 2DA4A 3KPHA 3GFLA 2RNGA 4ESFA 1X3UA 1BR2A 2DQRA 2MW8A 3HHGA 3ZQHA 1FYLA 3BTJA 1ZRFA 2LMDA 3OR1C 4Y4RA 4A3FJ 3MZ8A 2PBIA 3GWZA 4YG2F 5EF6A 2OV7A 4EQQA 1XMAA 3ZP5A 2KMUA 3G1LA 4BE1A 1O7FA 4UUVA 3JRCA 2LK2A 5DUIA 2XF6A 1RPWA 1HW5A 2JA5J 1TWCJ 2E5NA 1I27A 2DMNA 2L7MP 4BDYA 1OR7C 4YFXF 2DXIA 3TDZC 2WA0A 2K9QA 2K5CA 3QP6A 1UCRA 2AHQA 4JOMA 1DP3A 1BI1A 4RMNA 2WB1N 2XV4S 3W3CA 2L02A 2RQQA 3GTJJ 5K7HA 4A3KJ 3KZZA 2Q0OA 3OYFA 5LRSA 3QPLA 1DPRA 2OD5A 3BWGA 3D5RC 4UB6C 2D5VA 2GXGA 1MMNA 3IUOA 1ZG3A 5LBQA 2DI3A 3LWFA 3E7LA 1Z0XA 5J4YA 1K61A 2R7RA 4Q4ZF 3AL0C 1TLHB 5HS9A 5CQEA 3S3NA 1VQ6I 3CD6I 1YS6A 4MQVA 4RGUA 4BYYA 3QYBA 1IDZA 1YO5C 5FD6A 2FEZA 2R3SA 1IV8A 1XG1A 1GT0C 4S04A 1MBHA 2KHMA 4C3IJ 4RAYA 2Q2EB 2AS5F 2VI6A 3H0DA 2A69F 1ZGJA 2P6SA 3ZQLA 3LA2A 4M6XA 5HLGA 1M1EB 2F48A 4JX6A 4LLNA 3KIOA 2KP6A 1T8IA 2OBPA 5B1BH 3BLYA 3GTQJ 1R5HA 1WJEA 3BY6A 4UVBA 1Y8RB 2IGNA 2K86A 2O3FA 2DA7A 4LB6B 3WG7H 3BCAA 2EZHA 3HB9A 2L7KA 2WV1A 3QPSA 3WU0A 1KU7A 3F72A 3M1CA 5DD4A 1G4DA 1IXRC 4U0VA 1X3WB 1BI3A 2KRFA 3ZMVA 3CCVI 2VBWA 4L18B 3BTLA 1ZELA 5D8LB 4BH9A 4GGGA 1R22A 3CUQA 3T8RA 2ESHA 2A61A 1TWAJ 3K2AA 2HDWA 3RCOA 1SANA 3CUOA 3I3LA 5DV5A 4ZTFA 2YX7A 3UR3C 1IAWA 2QQ8A 2EV5A 1CF7B 2Z5UA 1SVOA 1QGPA 3KZIC 3O3KA 2UWMA 2CW7A 3CP2A 5LHHA 5D5WB 4FCYA 3U1DA 3R0JA 3L00A 2LF8A 3BT9A 4PFPA 1SFUA 5F1RA 2HOTA 2EFQA 1REPC 1YJNI 4BUPA 2MYSA 3W2VA 4L0ZB 1R36A 5CVVA 3I53A 4ABZA 3L1PA 1WJDA 1ODDA 4CYDA 4M73A 5JVGF 2W1OA 3OIPA 5F08A 2GXAA 2DOAA 3IWFA 2GLOA 4ENNA 4LB5A 2HKXA 2IJLA 3DBLB 2XF5A 3CC2I 1HQCA 2J5PA 4XKCA 3MWMA 1I3QJ 3E6CC 1O3TA 4ZH4F 2RN7A 1Z3YA 4WF2A 4NB5A 3WHBA 1X19A 4EJVA 3N4MA 3RZOJ 2Y0SN 1DQUA 1QZYA 2ZC2A 2V6CA 1HKTA 3TO6A 9ANTA 5LRRA 5C3EJ 1PYVA 3OYNA 4E7HA 4DYCA 3CCLI 5J8FA 4AM3A 2QSGX 4RB0A 3HBLA 3P9KA 4AVZA 1O3SA 2K85A 1ZG5A 2E35A 2GBYA 3CF2A 2YX4A 4RLQA 4BNCA 2E2JJ 1QNTA 2CMPA 5FRNA 3CJTB 3LMMA 2CQNA 1UG0A 4RLFA 4ZDLA 3M3YJ 3FMSA 1OJLA 1MMSA 2NVTJ 5F04A 2PJRB 3RQIA 2QVOA 3K69A 3FXLA 4NQWA 2YU9J 2VE8A 2XPUA 4RM2A 1QO0D 3B02A 4CCMA 1XSXA 3QPHA 4XOTA 4BBRJ 1XSDA 4BQAA 3F9KA 3QOEA 1JUPA 4YIFA 2AO9A 3HYIA 1R23A 3FBIB 2I5UA 1S7OA 3M7GA 4OOIA 1IRFA 3U2RA 2F5EA 2A5WA 4BL0B 3P9CA 1VQ9I 1JT0A 5FKNA 2HU9A 2M34A 3JTGA 1V3FA 3E97A 1U8BA 1BM9A 1JKPC 2E7WA 1B8IB 1B1BA 3HRMA 5D8KB 3MKWB 2TDXA 3MQ0A 2XAJA 1YG2A 1N25A 5IOYA 3ABKH 1O3QA 2VQGA 1Z67A 4EJTA 2FOKA 3KYDB 2PX9A 2H94A 4Y52J 5IP7J 2GA1A 2EFWA 4A3MJ 2JA6J 2LR8A 1K78A 1HXDA 3EUHA 2ZJRF 2W48A 4LFUA 1YX5A 2E60A 1RZ4A 5EJCA 4KYWA 3ELKA 4CCLA 2ZFWA 1ZH5A 1MD0A
chains in the Genus database with same CATH topology
1JGSA 4HLYA 3WTUC 2XASA 1PDNC 4AD9A 2LKPA 4FT8A 5FB2A 3I59B 3ZN1A 4BHCA 5FFXA 1ZREA 5AIPA 3V4GA 4H0EA 1ZN2A 4BHPA 3CO7C 3R6SA 2M30A 2ZO4A 3C1DA 4M6YA 2STTA 1WQ2A 4A0XA 4MTDA 1F4KA 1OPCA 1R58A 1C0WA 3C18A 5DYMA 1XCBA 1IZ1A 2MH2A 1WKMA 5ERIA 4XSZF 2A5YB 1TNSA 3TDUC 2XGXA 3ULQB 2W84A 1I1GA 1P6RA 1CF7A 1EH8A 4Y17A 4WXDA 2JTVA 4ETSA 1T6SA 2D2WA 3BDDA 1JHFA 4UVCA 2FBHA 4HDVA 1ZGAA 5LEJA 1BI0A 3RPQA 2L4AA 2PG4A 4EGZA 2V79A 3QPTA 3L2CA 1T39A 1Y0UA 3J80Z 3F8FA 5H20A 2VC1A 1DP7P 2P6TA 3I64A 2DU9A 1F5TA 4L5IA 1W7PD 2ZCWA 4PZJA 1DDNA 3EYIA 4GO1A 4O5VA 1ULYA 1UFMA 3QP5A 4GXOA 3I59A 4MNUA 3E3VA 4KIBA 3E5UA 2GXBA 1S8NA 3WTXC 1EH7A 4MEYF 4OIQF 2RNJA 5IT3A 3DP7A 5FFZA 3E5XA 2XIGA 3F6OA 3GFMA 2NAZA 1IF1A 4N9IA 4ZYEA 1MKMA 2EA4A 4KIGA 3M1EA 4G9YA 5E20A 5HVQC 2EK5A 4M9ZA 4HV5A 4EJWA 3I58A 1G3YA 4XLPF 1G6NA 1NHAA 3FXUA 4HX4A 2JT1A 2CO5A 4LJZF 5CVIA 3GX4X 4FX0A 2Q8KA 3WGGA 4N9HA 1U8RA 4LGWA 2M45A 3M9AA 4CXFA 1QBJA 4A6EA 2D1VA 2HYFA 3K1NA 4KDPA 1H9TA 2M8EA 4BAYA 3V8JA 1J5YA 5ICCA 3ZMTA 5ICFA 3FWEA 4G6QA 4LK0F 5JR3A 2V1UA 2A07F 3F6VA 5HLIA 3P7NA 4CGZA 3Q9SA 3HTSB 2MBFA 2CFXA 3TOAA 2XAGA 1HSJA 3KE2A 1YFHA 3I71A 3KCCA 1ZLKA 2DTRA 3RYPA 3IHUA 1IN6A 2HR3A 5HDNA 1SAXA 3ZMSA 2PMHA 4I7HA 2O8XA 4HQEA 2IRFG 2ETHA 2XAFA 3HRTA 1PUEE 1TQPA 2EFPA 5DDGA 3KFWX 2OZ6A 5D6FA 1HBXG 3MZHA 2KIFA 2J5OA 2HOEA 2KJBA 1OYYA 3KP5A 1RNLA 4HBLA 4DQ2A 4IHSA 3CJNA 2KIMA 4L5JA 4EM0B 1XGOA 3DPTA 2W57A 1J9IA 3RDIA 3PQJA 2HTJA 1SFXA 1STZA 3W6KB 3CUQB 4YFKF 2IA2A 1B59A 4ON0A 2A6HF 2Y75A 1WRJA 3I54A 2K02A 1BJAA 1T98A 4R79A 4RAZA 1XD7A 4A5MA 4HX7A 1ZLJA 5D4RA 3BPVA 1XGSA 5CVRA 4A5NA 3O6BB 4HQMA 5A2QK 2EFNA 4PGHA 4QWQA 3E6DA 3WE3A 1FZPB 1JE8A 3T0YA 3HOSA 2OQGA 1G3SA 4TV7A 2FMYA 3KLNA 1YQAA 1KYWA 4PDKA 2G9WA 3DFGA 3ZMDA 4YFNF 2YU3A 5DCMA 3TO9A 5ILVA 1U2WA 5LHIA 4OIPF 1Z05A 2R7DA 2FMLA 4WK8F 1SFEA 3MFKA 2LSOA 2OAZA 3ECHA 1YTYA 4IF4A 1WSUA 3FHZA 2DPDA 1B4AA 4WXCA 3VB2A 5HOOA 4MHGA 1J2XA 1BOAA 1KQ8A 1LDJA 2MH9A 1IN4A 5AONA 3J81Z 1BBYA 2PQ8A 3QRFF 2W85A 2EV6A 2EA2A 2VOPA 2P5VA 3W6JB 4KMFA 3BZ6A 1KQ9A 1BIAA 3H92A 4HA8A 1WI9A 3EDPA 2FRHA 2Z99A 3CUQC 3R0AA 1YW8A 2BV6A 4FX4A 2HDCA 3VODA 1W7PB 1SMTA 2OU2A 3NEUA 3G3ZA 5D5UB 4KT5C 1D8JA 2L01A 4IXAA 3KEOA 2PMUA 3SXYA 1FP2A 2CYYA 3HTUA 4RGRA 3K0LA 4OIRF 2QWWA 2Q2EA 4Y13A 1FSEA 5L3FA 1W4MA 2OZUA 1ON1A 1Z6RA 3CTAA 3WTZA 1FBUA 2H6BA 2YSRA 5L3GA 3WTVC 2G7HA 2MC3A 1U6GA 1YLFA 1SMYF 1IN8A 2K4BA 5BQTA 2HS5A 2DAOA 5K1YA 3ZQ7A 4EGYA 1KU3A 3HSEA 4HDUA 3ABUA 2XUBA 4UV9A 1R1TA 1KU9A 1WWXA 4KN7X 2VC0A 2HQNA 3BOQA 5JFRA 4I0BA 3ERED 1XGNA 4L0YB 3ABTA 1XDSA 2ZKZA 3HSRA 2HKOA 3MZYA 1TW2A 4CDGA 5JI6A 1KU2A 2MLGA 1UHWA 2F5DA 2NS0A 2ISYA 1SD5A 3IC7A 4HOBA 4ZYHA 5FLXK 2QENA 5A2QZ 3ZMZA 2FF4A 1OKRA 2EB7A 3F21A 3JSOA 2Y48A 3NRVA 4M9SA 2X4HA 1AWCA 3VEPA 3ML6A 2HEOA 1BIBA 4KUMA 4AIKA 4Q48A 2IT0A 2RV8A 5AIQA 4N0BA 5F6FA 3F23A 3EQLF 3WGIA 3LA3A 1F1ZA 3CO6C 4A2UA 2JPCA 5BMZA 4LG0B 2YPRA 3GVAA 5ICGA 1W5SA 1Z6TA 2WC2A 1LJ9A 2VOOA 4Q47A 2DQLA 2RVCA 5ILUA 1KA8A 4G7HF 1MDMB 4LG0A 1LQ1A 2P7CB 3KP6A 2VT3A 3ZN0A 3K1MA 2FXAA 2P5LC 3RI4A 2DK5A 1E17A 2D45A 4A12A 4FHTA 3KP3A 3D0SA 1R1VA 5KVRA 5TJJA 2OQRA 2PEXA 1U5TC 1LDKB 1P92A 2A68F 2QBYB 1S3JA 1RUOA 1KQ0A 3WE2A 2CQKA 4OU0A 3SHFA 2XAHA 1AOYA 5LGTA 3I5UA 2WTEA 1BN5A 1OR7A 3GLXA 3BP8A 4I02A 3BJAA 3RKYA 3L9FA 2STWA 3K9TA 5D4SA 5DCFA 4P55A 3JTHA 2DW4A 1FWZA 5JHUA 2VBYA 1TQMA 1FYKA 4YIIA 4OMZA 3V8KA 2L54A 1D8KA 1JXSA 2XROA 3KP2A 2FBIA 1TW3A 4A6DA 1KGSA 4WXHA 1FY7A 3OOPA 2BYVE 3ZPLA 2NNYA 2ZMEA 4HF2A 4O6JA 1YS7A 2F2EA 3F8NA 2IA1A 4R8HA 1GXQA 3KEQA 1LEBA 1BC7C 4E70A 2MLKA 4G7OF 1OYIA 5CVUA 1FNNA 2ISZA 2V9VA 3BJ6A 3L7WA 4DNCA 2P8TA 1YW9A 1ZHFA 3LAJA 1P4AA 2HGCA 5K5RA 2VBZA 2EJRA 3REOA 3KP7A 2IP2A 2NRAC 1OYWA 1RI7A 4L9TA 4RGXA 3FXQA 5D5VB 4IJAA 3DF8A 5LGUA 1S29A 4EM2A 2FU4A 2HFHA 1GHCA 3O2PE 4U7DA 2VN2A 2A3SA 4HAMA 4M71A 1ZG1A 5LHGA 4KICA 4AWXB 3WTTC 3H3ZA 1FYMA 4HV6A 1DUXC 2IW5A 2M1BA 4AIJA 3SZPA 4ZYGA 5KK1A 2HYGD 3I0TA 5E1ZB 3JAMZ 2QLZA 5ED4A 3WTWC 3Q5FA 2FNPA 2M87A 2MA3A 1Z91A 4XSXF 2VBXA 2JPBA 1Z7UA 1P4XA 5FD5A 2EV0A 2QBYA 3DPLC 3MCZA 1HKSA 4HX8A 4IPAA 5E18F 4ASNA 2FBKA 4Q5SF 2DPUA 2VODA 2H09A 1R7JA 4BXUA 3LAPA 2Y0MA 2L3DA 5LLQA 1SD4A 2G7UA 4ENJA 3HRUA 3RKXA 4RS8A 1MJ9A 1O7LA 3E6MA 3RPUA 3FXRA 4JK1X 4CZZA 1I5ZA 5K5QA 4CICA 3FM3A 1G3WA 2LF7A 1T0FA 1LB2A 4KNYA 2FE3A 1FP1D 3DXJF 1R00A 5LGNA 3QOPA 2MD5A 5FO5A 2E1NA 1DPUA 2FQ3A 4OMYA 1ZRCA 4HYEA 2H6CA 1U3EM 1YIOA 4G94A 3GF2A 2ZNZA 4WCGA 5EEGA 3GFIA 3NQOA 1J59A 4G6DA 5ILSA 1T2KA 2QQBA 1HKQA 5TRDA 3GW2A 3PQKA 3RKWA 1QQIA 5J6XA 4A0YA 4LLGF 5J8CA 2ZJ2A 2X0LA 3WTSC 2UXNA 5HDKA 1IW7F 4IRIA 1R1UA 1IUYA 3DEUA 4CHUA 3S2WA 3TOBA 2JSCA 5FGMA 2XVCA 4I0AA 3KLOA 3K2ZA 3BPXA 5HDGA 1IXCA 1B6AA 4L9JA 1SD7A 3BJOA 4GCVA 2JRTA 3RIRA 4CO8A 2DBBA 1ZAOA 1U5TB 4EVIA 2V1DA 4EV0A 4I01A 3F3XA 4RGSA 2DK8A 3T8TA 3C3WA 3GO5A 3HUGA 1MJAA 2ADUA 2HTSA 4JQFA 4XRFA 4GYGA 2VXZA 2O61A 4ESJA 4ZZLA 1L0OC 2P4WA 3KZYA 1PP7U 5DEQA 2BEOA 2PN6A 4RB1A 2XKPA 5BPIA 3TKYA 2GQQA 2IVMA 2FNAA 4HF0A 2E7XA 3GZ5A 3G73A 3V7SA 1I6XA 3JAMK 3SFZA 2KJCA 4BHBA 3H3UA 3GUDA 4L9VA 2NYXA 4F7ZA 3D5LA 2CWEA 3C7JA 4XLNF 2Z3YA 1MGTA 4LLLA 4GYIA 1T38A 2NNNA 5E8IA 4K2EA 1MDMA 4WX9A 4P9UA 3KP4A 1HSTA 5HLHA 5H6RA 4EMSA 1SD6A 4EJUA 3T5XA 1ONVA 1FX7A 2VONA 4UXNA 2GAUA 3WTYC 2HZTA 1EV7A 3OV8A 4KA4A 3GYHX 2PLYA 4ENMA 1TQIA 4ZYDA 4U0WA 2A6EF 5LEKA 3HSFA 4M9XA 4JBAA 2E1CA 5E1WA 5IT9K 2H27A 1USTA 1FBSA 1FOKA 4I98B 4ENKA 2L4MA 1K78B 3IL2A 3QAHA 3HOTA 1D5VA 3IKVA 3DV8A 2BGCA 4L9NA 3QU3A 2ACJA 1B9MA 3DQVC 1JHHA 3P9IA 5E17F 1H0MA 4AIHA 4I2OA 2Z33A 1XGMA 1S6LA 4HW0A 3WU1B 4P9FA 1A04A 2QUFA 3CDHA 2F5FA 2IA0A 4EM1A 3FX3A 1EH6A 4A0ZA 3LA7A 5L3BA 3V8LA 1XN7A 3PFIA 3FM5A 4B8XA 2LDUA 1TBXA 1GVJA 3JW4A 2ZMEB 4O3MA 5F64A 1BI2A 1RUNA 1E2XA 3B73A 3ECOA 3J81K 4OIOF 2DFIA 4S05A 4NHJA 2KIUA 2RC4A 2R7FA 3LSTA 2XHKA 2PI0A 4PCQA 4I09A 3F8BA 4M72A 2P5KA 2W25A 4KN4X 3IRRA 1LNWA 3RTRA 2HWVA 2W24A 2JZYA 4MTEA 4IRHA 1L3LA 3KETA 3DKWA 1XDUA 1YW7A 3Q9VA 1IN5A 4D0PA 4HZFA 4WWCA 2UXXA 1TNTA 2FA5A 1YYVA 3GXOA 1Q1HA 5EEHA 3SZTA 3L09A 3MEXA 1I1SA 3IKTA 5E1XA 1F9NA 2EFOA 3RJPA 3FF5A 5CVJA 1OMIA 3T1BA 4U7BA 3LQQA 4HLXA 1ZYRF 3CLOA 2COMA 4AVPA 3SQNA 1QZZA 1P4WA 3GFJA 1UB9A 1V4RA 2O6GE 1FLIA 5DCMB 1UHMA 1S7AA 2BE5F 2QYOA 4ZZDA 1IRGA 2K7LA 2HQRA 4IVNA 3N97A 2YR2A 2O03A 2RQPA 1K79A 3F8MA 2KKOA 4LD5A 3QU6A 1J7KA 5JVTA 2EWNA 5CJ9A 2M5WA 4MQ9F 1K7AA 4LK1F 3COAC 3F8CA 2D1HA 3EYYA 2CG4A 4B09A 3TO7A 1G3TA 3TQNA 2VT2A 4KFCA 1IXSB 3ROUA 2GIVA 1RIOH 3I4PA 1XSVA 3WG9A 2K27A 1B9NA 2AXLA 3JSPA 2ZXJA 2CGPA 3GZ6A 1USSA 3EETA 2B0LA 4UVAA 4OINF 3U9GA 3E6BA 3HIFA 3FMQA 2ESNA 1GXPA 2VE9A 2F5CA 5L3CA 4MEXF 2O0YA 1MZBA 2WWYA 2FSWA 3ZMUA 4RB2C 2DT5A 1XB4A 2CSOA 2Z9OA 4ESBA 2C6YA 5K5OA 3AAFA 2XKOA 1D3YA 5BOXA 1W7PA 3VOEA 3IWZA 1FC3A 3BROA 2PFBA 4Y15A 1XCVA 4QLCU 2RKHA 4R1HA 3K1PA 3R60A 5FLXZ 4IRGA 1FT9A 2GWRA 5ICEA 5IT9Z 2P7VB 4P5OA 6PAXA 2BBYA 1HW1A 5CLSA 2ZNYA 4P96A 2QM3A 1W5TA 3HRSA 1R5GA 1P2FA 4LMYA 2WV0A 1K6OA 2XRNA 3TGNA 4IHTA 2XAQA 1HW2A 4KMUX 1BC8C 1PP8F 1KYZA 3FMRA 2DLLA 1ZARA 3M8EA 4PGGA 1O57A 1Z1DA 5HS8A 1O3RA 5L3DA 1MJBA 5E8GA 4U88A 1J75A 1LEAA 3LQRA 3R4KA 1U5TA 5DUKA 5H6QA 2ELHA 4EJOA 4HF1A 4UNOA 3GEZA 3MAJA 4KIFA 3E5QA 2V1XA 3HHHA 5DD8A 1LDDA 5L3EA 3FZVA 5BS6A 4Z2YA 5CYVA 1QPMA 3J80K 2K4JA 4XBFA 2RDPA 1U78A 4UV8A 1Z9CA 3V7CA 3ISPA 3IRQA 2QQAA 2GA2A 1FBQA 2RGVA 1IN7A 3VFZA 5D6EA 2IPQX 3WGHA 2UZKA 2ZBKA 4RB3C 4G8XA 1TTYA 1LVAA 1J0RA 1VTNC 2OA4A 1ZRDA 4MGRA 5HS7A 1FSHA 2QQ9A 2CW0F 1H9GA 1FPQA 2GZWA 3LFKA 4UHTA 4M74A 2QZ8A 3V7RA 2PJPA 3WODF 3R61A 1ON2A 3F22A 3J7AO 1XMKA 2DO7A 3RYRA 5BPDA 4U0YA 5D5XB 2LNBA 4G7ZF 3M8FA 1CGPA 3GFLA 4ESFA 1X3UA 2DQRA 3HHGA 1FYLA 1ZRFA 2PBIA 3GWZA 4YG2F 3ZP5A 4EQQA 1XMAA 1O7FA 4UUVA 5DUIA 1HW5A 1I27A 4YFXF 3TDZC 3QP6A 1UCRA 1BI1A 2XV4S 2L02A 3KZZA 2Q0OA 5LRSA 1DPRA 2OD5A 3BWGA 2GXGA 1ZG3A 5LBQA 2DI3A 3LWFA 4Q4ZF 1TLHB 5HS9A 1YS6A 4MQVA 4RGUA 4BYYA 1YO5C 5FD6A 2FEZA 2R3SA 4S04A 4RAYA 2AS5F 2A69F 1ZGJA 2P6SA 3LA2A 4M6XA 5HLGA 4LLNA 2OBPA 1R5HA 4UVBA 3BY6A 2K86A 2O3FA 4LB6B 3WU0A 1KU7A 3F72A 5DD4A 1G4DA 1IXRC 4U0VA 1BI3A 2KRFA 3ZMVA 2VBWA 4L18B 5D8LB 4BH9A 4GGGA 1R22A 3CUQA 3T8RA 2ESHA 2A61A 3CUOA 5DV5A 2YX7A 1IAWA 2EV5A 1CF7B 2Z5UA 1QGPA 3O3KA 2UWMA 5LHHA 5D5WB 3U1DA 3R0JA 3L00A 2LF8A 1SFUA 5F1RA 2EFQA 1REPC 4L0ZB 1R36A 5CVVA 3I53A 1ODDA 4CYDA 4M73A 3IWFA 4LB5A 4ENNA 2HKXA 2IJLA 1HQCA 2J5PA 3MWMA 3E6CC 1O3TA 4ZH4F 2RN7A 4WF2A 4NB5A 4EJVA 3N4MA 1QZYA 1HKTA 2V6CA 3TO6A 5LRRA 5J8FA 4RB0A 1O3SA 3P9KA 1ZG5A 2YX4A 4BNCA 1QNTA 3FMSA 2QVOA 3K69A 4NQWA 2VE8A 1QO0D 3B02A 1XSXA 3QPHA 1XSDA 4BQAA 4YIFA 3HYIA 1R23A 1S7OA 3M7GA 4OOIA 1IRFA 3U2RA 2F5EA 3P9CA 3JTGA 1V3FA 3E97A 1BM9A 2E7WA 1B1BA 3HRMA 5D8KB 2TDXA 3MQ0A 2XAJA 1YG2A 1O3QA 4EJTA 2FOKA 2H94A 2EFWA 2GA1A 1K78A 1HXDA 3EUHA 4LFUA 1RZ4A 4KYWA 3ELKA 2ZFWA 1ZH5A 1MD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JGS A;  4HLY A;  3WTU C;  2XAS A;  1PDN C;  4AD9 A;  2LKP A;  4FT8 A;  5FB2 A;  3I59 B;  3ZN1 A;  4BHC A;  5FFX A;  1ZRE A;  5AIP A;  3V4G A;  4H0E A;  1ZN2 A;  4BHP A;  3CO7 C;  3R6S A;  2M30 A;  2ZO4 A;  3C1D A;  4M6Y A;  2STT A;  1WQ2 A;  4A0X A;  4MTD A;  1F4K A;  1OPC A;  1R58 A;  1C0W A;  3C18 A;  5DYM A;  1XCB A;  1IZ1 A;  2MH2 A;  1WKM A;  5ERI A;  4XSZ F;  2A5Y B;  1TNS A;  3TDU C;  2XGX A;  3ULQ B;  2W84 A;  1I1G A;  1P6R A;  1CF7 A;  1EH8 A;  4Y17 A;  4WXD A;  2JTV A;  4ETS A;  1T6S A;  2D2W A;  3BDD A;  1JHF A;  4UVC A;  2FBH A;  4HDV A;  1ZGA A;  5LEJ A;  1BI0 A;  3RPQ A;  2L4A A;  2PG4 A;  4EGZ A;  2V79 A;  3QPT A;  3L2C A;  1T39 A;  1Y0U A;  3J80 Z;  3F8F A;  5H20 A;  2VC1 A;  1DP7 P;  2P6T A;  3I64 A;  2DU9 A;  1F5T A;  4L5I A;  1W7P D;  2ZCW A;  4PZJ A;  1DDN A;  3EYI A;  4GO1 A;  4O5V A;  1ULY A;  1UFM A;  3QP5 A;  4GXO A;  3I59 A;  4MNU A;  3E3V A;  4KIB A;  3E5U A;  2GXB A;  1S8N A;  3WTX C;  1EH7 A;  4MEY F;  4OIQ F;  2RNJ A;  5IT3 A;  3DP7 A;  5FFZ A;  3E5X A;  2XIG A;  3F6O A;  3GFM A;  2NAZ A;  1IF1 A;  4N9I A;  4ZYE A;  1MKM A;  2EA4 A;  4KIG A;  3M1E A;  4G9Y A;  5E20 A;  5HVQ C;  2EK5 A;  4M9Z A;  4HV5 A;  4EJW A;  3I58 A;  1G3Y A;  4XLP F;  1G6N A;  1NHA A;  3FXU A;  4HX4 A;  2JT1 A;  2CO5 A;  4LJZ F;  5CVI A;  3GX4 X;  4FX0 A;  2Q8K A;  3WGG A;  4N9H A;  1U8R A;  4LGW A;  2M45 A;  3M9A A;  4CXF A;  1QBJ A;  4A6E A;  2D1V A;  2HYF A;  3K1N A;  4KDP A;  1H9T A;  2M8E A;  4BAY A;  3V8J A;  1J5Y A;  5ICC A;  3ZMT A;  5ICF A;  3FWE A;  4G6Q A;  4LK0 F;  5JR3 A;  2V1U A;  2A07 F;  3F6V A;  5HLI A;  3P7N A;  4CGZ A;  3Q9S A;  3HTS B;  2MBF A;  2CFX A;  3TOA A;  2XAG A;  1HSJ A;  3KE2 A;  1YFH A;  3I71 A;  3KCC A;  1ZLK A;  2DTR A;  3RYP A;  3IHU A;  1IN6 A;  2HR3 A;  5HDN A;  1SAX A;  3ZMS A;  2PMH A;  4I7H A;  2O8X A;  4HQE A;  2IRF G;  2ETH A;  2XAF A;  3HRT A;  1PUE E;  1TQP A;  2EFP A;  5DDG A;  3KFW X;  2OZ6 A;  5D6F A;  1HBX G;  3MZH A;  2KIF A;  2J5O A;  2HOE A;  2KJB A;  1OYY A;  3KP5 A;  1RNL A;  4HBL A;  4DQ2 A;  4IHS A;  3CJN A;  2KIM A;  4L5J A;  4EM0 B;  1XGO A;  3DPT A;  2W57 A;  1J9I A;  3RDI A;  3PQJ A;  2HTJ A;  1SFX A;  1STZ A;  3W6K B;  3CUQ B;  4YFK F;  2IA2 A;  1B59 A;  4ON0 A;  2A6H F;  2Y75 A;  1WRJ A;  3I54 A;  2K02 A;  1BJA A;  1T98 A;  4R79 A;  4RAZ A;  1XD7 A;  4A5M A;  4HX7 A;  1ZLJ A;  5D4R A;  3BPV A;  1XGS A;  5CVR A;  4A5N A;  3O6B B;  4HQM A;  5A2Q K;  2EFN A;  4PGH A;  4QWQ A;  3E6D A;  3WE3 A;  1FZP B;  1JE8 A;  3T0Y A;  3HOS A;  2OQG A;  1G3S A;  4TV7 A;  2FMY A;  3KLN A;  1YQA A;  1KYW A;  4PDK A;  2G9W A;  3DFG A;  3ZMD A;  4YFN F;  2YU3 A;  5DCM A;  3TO9 A;  5ILV A;  1U2W A;  5LHI A;  4OIP F;  1Z05 A;  2R7D A;  2FML A;  4WK8 F;  1SFE A;  3MFK A;  2LSO A;  2OAZ A;  3ECH A;  1YTY A;  4IF4 A;  1WSU A;  3FHZ A;  2DPD A;  1B4A A;  4WXC A;  3VB2 A;  5HOO A;  4MHG A;  1J2X A;  1BOA A;  1KQ8 A;  1LDJ A;  2MH9 A;  1IN4 A;  5AON A;  3J81 Z;  1BBY A;  2PQ8 A;  3QRF F;  2W85 A;  2EV6 A;  2EA2 A;  2VOP A;  2P5V A;  3W6J B;  4KMF A;  3BZ6 A;  1KQ9 A;  1BIA A;  3H92 A;  4HA8 A;  1WI9 A;  3EDP A;  2FRH A;  2Z99 A;  3CUQ C;  3R0A A;  1YW8 A;  2BV6 A;  4FX4 A;  2HDC A;  3VOD A;  1W7P B;  1SMT A;  2OU2 A;  3NEU A;  3G3Z A;  5D5U B;  4KT5 C;  1D8J A;  2L01 A;  4IXA A;  3KEO A;  2PMU A;  3SXY A;  1FP2 A;  2CYY A;  3HTU A;  4RGR A;  3K0L A;  4OIR F;  2QWW A;  2Q2E A;  4Y13 A;  1FSE A;  5L3F A;  1W4M A;  2OZU A;  1ON1 A;  1Z6R A;  3CTA A;  3WTZ A;  1FBU A;  2H6B A;  2YSR A;  5L3G A;  3WTV C;  2G7H A;  2MC3 A;  1U6G A;  1YLF A;  1SMY F;  1IN8 A;  2K4B A;  5BQT A;  2HS5 A;  2DAO A;  5K1Y A;  3ZQ7 A;  4EGY A;  1KU3 A;  3HSE A;  4HDU A;  3ABU A;  2XUB A;  4UV9 A;  1R1T A;  1KU9 A;  1WWX A;  4KN7 X;  2VC0 A;  2HQN A;  3BOQ A;  5JFR A;  4I0B A;  3ERE D;  1XGN A;  4L0Y B;  3ABT A;  1XDS A;  2ZKZ A;  3HSR A;  2HKO A;  3MZY A;  1TW2 A;  4CDG A;  5JI6 A;  1KU2 A;  2MLG A;  1UHW A;  2F5D A;  2NS0 A;  2ISY A;  1SD5 A;  3IC7 A;  4HOB A;  4ZYH A;  5FLX K;  2QEN A;  5A2Q Z;  3ZMZ A;  2FF4 A;  1OKR A;  2EB7 A;  3F21 A;  3JSO A;  2Y48 A;  3NRV A;  4M9S A;  2X4H A;  1AWC A;  3VEP A;  3ML6 A;  2HEO A;  1BIB A;  4KUM A;  4AIK A;  4Q48 A;  2IT0 A;  2RV8 A;  5AIQ A;  4N0B A;  5F6F A;  3F23 A;  3EQL F;  3WGI A;  3LA3 A;  1F1Z A;  3CO6 C;  4A2U A;  2JPC A;  5BMZ A;  4LG0 B;  2YPR A;  3GVA A;  5ICG A;  1W5S A;  1Z6T A;  2WC2 A;  1LJ9 A;  2VOO A;  4Q47 A;  2DQL A;  2RVC A;  5ILU A;  1KA8 A;  4G7H F;  1MDM B;  4LG0 A;  1LQ1 A;  2P7C B;  3KP6 A;  2VT3 A;  3ZN0 A;  3K1M A;  2FXA A;  2P5L C;  3RI4 A;  2DK5 A;  1E17 A;  2D45 A;  4A12 A;  4FHT A;  3KP3 A;  3D0S A;  1R1V A;  5KVR A;  5TJJ A;  2OQR A;  2PEX A;  1U5T C;  1LDK B;  1P92 A;  2A68 F;  2QBY B;  1S3J A;  1RUO A;  1KQ0 A;  3WE2 A;  2CQK A;  4OU0 A;  3SHF A;  2XAH A;  1AOY A;  5LGT A;  3I5U A;  2WTE A;  1BN5 A;  1OR7 A;  3GLX A;  3BP8 A;  4I02 A;  3BJA A;  3RKY A;  3L9F A;  2STW A;  3K9T A;  5D4S A;  5DCF A;  4P55 A;  3JTH A;  2DW4 A;  1FWZ A;  5JHU A;  2VBY A;  1TQM A;  1FYK A;  4YII A;  4OMZ A;  3V8K A;  2L54 A;  1D8K A;  1JXS A;  2XRO A;  3KP2 A;  2FBI A;  1TW3 A;  4A6D A;  1KGS A;  4WXH A;  1FY7 A;  3OOP A;  2BYV E;  3ZPL A;  2NNY A;  2ZME A;  4HF2 A;  4O6J A;  1YS7 A;  2F2E A;  3F8N A;  2IA1 A;  4R8H A;  1GXQ A;  3KEQ A;  1LEB A;  1BC7 C;  4E70 A;  2MLK A;  4G7O F;  1OYI A;  5CVU A;  1FNN A;  2ISZ A;  2V9V A;  3BJ6 A;  3L7W A;  4DNC A;  2P8T A;  1YW9 A;  1ZHF A;  3LAJ A;  1P4A A;  2HGC A;  5K5R A;  2VBZ A;  2EJR A;  3REO A;  3KP7 A;  2IP2 A;  2NRA C;  1OYW A;  1RI7 A;  4L9T A;  4RGX A;  3FXQ A;  5D5V B;  4IJA A;  3DF8 A;  5LGU A;  1S29 A;  4EM2 A;  2FU4 A;  2HFH A;  1GHC A;  3O2P E;  4U7D A;  2VN2 A;  2A3S A;  4HAM A;  4M71 A;  1ZG1 A;  5LHG A;  4KIC A;  4AWX B;  3WTT C;  3H3Z A;  1FYM A;  4HV6 A;  1DUX C;  2IW5 A;  2M1B A;  4AIJ A;  3SZP A;  4ZYG A;  5KK1 A;  2HYG D;  3I0T A;  5E1Z B;  3JAM Z;  2QLZ A;  5ED4 A;  3WTW C;  3Q5F A;  2FNP A;  2M87 A;  2MA3 A;  1Z91 A;  4XSX F;  2VBX A;  2JPB A;  1Z7U A;  1P4X A;  5FD5 A;  2EV0 A;  2QBY A;  3DPL C;  3MCZ A;  1HKS A;  4HX8 A;  4IPA A;  5E18 F;  4ASN A;  2FBK A;  4Q5S F;  2DPU A;  2VOD A;  2H09 A;  1R7J A;  4BXU A;  3LAP A;  2Y0M A;  2L3D A;  5LLQ A;  1SD4 A;  2G7U A;  4ENJ A;  3HRU A;  3RKX A;  4RS8 A;  1MJ9 A;  1O7L A;  3E6M A;  3RPU A;  3FXR A;  4JK1 X;  4CZZ A;  1I5Z A;  5K5Q A;  4CIC A;  3FM3 A;  1G3W A;  2LF7 A;  1T0F A;  1LB2 A;  4KNY A;  2FE3 A;  1FP1 D;  3DXJ F;  1R00 A;  5LGN A;  3QOP A;  2MD5 A;  5FO5 A;  2E1N A;  1DPU A;  2FQ3 A;  4OMY A;  1ZRC A;  4HYE A;  2H6C A;  1U3E M;  1YIO A;  4G94 A;  3GF2 A;  2ZNZ A;  4WCG A;  5EEG A;  3GFI A;  3NQO A;  1J59 A;  4G6D A;  5ILS A;  1T2K A;  2QQB A;  1HKQ A;  5TRD A;  3GW2 A;  3PQK A;  3RKW A;  1QQI A;  5J6X A;  4A0Y A;  4LLG F;  5J8C A;  2ZJ2 A;  2X0L A;  3WTS C;  2UXN A;  5HDK A;  1IW7 F;  4IRI A;  1R1U A;  1IUY A;  3DEU A;  4CHU A;  3S2W A;  3TOB A;  2JSC A;  5FGM A;  2XVC A;  4I0A A;  3KLO A;  3K2Z A;  3BPX A;  5HDG A;  1IXC A;  1B6A A;  4L9J A;  1SD7 A;  3BJO A;  4GCV A;  2JRT A;  3RIR A;  4CO8 A;  2DBB A;  1ZAO A;  1U5T B;  4EVI A;  2V1D A;  4EV0 A;  4I01 A;  3F3X A;  4RGS A;  2DK8 A;  3T8T A;  3C3W A;  3GO5 A;  3HUG A;  1MJA A;  2ADU A;  2HTS A;  4JQF A;  4XRF A;  4GYG A;  2VXZ A;  2O61 A;  4ESJ A;  4ZZL A;  1L0O C;  2P4W A;  3KZY A;  1PP7 U;  5DEQ A;  2BEO A;  2PN6 A;  4RB1 A;  2XKP A;  5BPI A;  3TKY A;  2GQQ A;  2IVM A;  2FNA A;  4HF0 A;  2E7X A;  3GZ5 A;  3G73 A;  3V7S A;  1I6X A;  3JAM K;  3SFZ A;  2KJC A;  4BHB A;  3H3U A;  3GUD A;  4L9V A;  2NYX A;  4F7Z A;  3D5L A;  2CWE A;  3C7J A;  4XLN F;  2Z3Y A;  1MGT A;  4LLL A;  4GYI A;  1T38 A;  2NNN A;  5E8I A;  4K2E A;  1MDM A;  4WX9 A;  4P9U A;  3KP4 A;  1HST A;  5HLH A;  5H6R A;  4EMS A;  1SD6 A;  4EJU A;  3T5X A;  1ONV A;  1FX7 A;  2VON A;  4UXN A;  2GAU A;  3WTY C;  2HZT A;  1EV7 A;  3OV8 A;  4KA4 A;  3GYH X;  2PLY A;  4ENM A;  1TQI A;  4ZYD A;  4U0W A;  2A6E F;  5LEK A;  3HSF A;  4M9X A;  4JBA A;  2E1C A;  5E1W A;  5IT9 K;  2H27 A;  1UST A;  1FBS A;  1FOK A;  4I98 B;  4ENK A;  2L4M A;  1K78 B;  3IL2 A;  3QAH A;  3HOT A;  1D5V A;  3IKV A;  3DV8 A;  2BGC A;  4L9N A;  3QU3 A;  2ACJ A;  1B9M A;  3DQV C;  1JHH A;  3P9I A;  5E17 F;  1H0M A;  4AIH A;  4I2O A;  2Z33 A;  1XGM A;  1S6L A;  4HW0 A;  3WU1 B;  4P9F A;  1A04 A;  2QUF A;  3CDH A;  2F5F A;  2IA0 A;  4EM1 A;  3FX3 A;  1EH6 A;  4A0Z A;  3LA7 A;  5L3B A;  3V8L A;  1XN7 A;  3PFI A;  3FM5 A;  4B8X A;  2LDU A;  1TBX A;  1GVJ A;  3JW4 A;  2ZME B;  4O3M A;  5F64 A;  1BI2 A;  1RUN A;  1E2X A;  3B73 A;  3ECO A;  3J81 K;  4OIO F;  2DFI A;  4S05 A;  4NHJ A;  2KIU A;  2RC4 A;  2R7F A;  3LST A;  2XHK A;  2PI0 A;  4PCQ A;  4I09 A;  3F8B A;  4M72 A;  2P5K A;  2W25 A;  4KN4 X;  3IRR A;  1LNW A;  3RTR A;  2HWV A;  2W24 A;  2JZY A;  4MTE A;  4IRH A;  1L3L A;  3KET A;  3DKW A;  1XDU A;  1YW7 A;  3Q9V A;  1IN5 A;  4D0P A;  4HZF A;  4WWC A;  2UXX A;  1TNT A;  2FA5 A;  1YYV A;  3GXO A;  1Q1H A;  5EEH A;  3SZT A;  3L09 A;  3MEX A;  1I1S A;  3IKT A;  5E1X A;  1F9N A;  2EFO A;  3RJP A;  3FF5 A;  5CVJ A;  1OMI A;  3T1B A;  4U7B A;  3LQQ A;  4HLX A;  1ZYR F;  3CLO A;  2COM A;  4AVP A;  3SQN A;  1QZZ A;  1P4W A;  3GFJ A;  1UB9 A;  1V4R A;  2O6G E;  1FLI A;  5DCM B;  1UHM A;  1S7A A;  2BE5 F;  2QYO A;  4ZZD A;  1IRG A;  2K7L A;  2HQR A;  4IVN A;  3N97 A;  2YR2 A;  2O03 A;  2RQP A;  1K79 A;  3F8M A;  2KKO A;  4LD5 A;  3QU6 A;  1J7K A;  5JVT A;  2EWN A;  5CJ9 A;  2M5W A;  4MQ9 F;  1K7A A;  4LK1 F;  3COA C;  3F8C A;  2D1H A;  3EYY A;  2CG4 A;  4B09 A;  3TO7 A;  1G3T A;  3TQN A;  2VT2 A;  4KFC A;  1IXS B;  3ROU A;  2GIV A;  1RIO H;  3I4P A;  1XSV A;  3WG9 A;  2K27 A;  1B9N A;  2AXL A;  3JSP A;  2ZXJ A;  2CGP A;  3GZ6 A;  1USS A;  3EET A;  2B0L A;  4UVA A;  4OIN F;  3U9G A;  3E6B A;  3HIF A;  3FMQ A;  2ESN A;  1GXP A;  2VE9 A;  2F5C A;  5L3C A;  4MEX F;  2O0Y A;  1MZB A;  2WWY A;  2FSW A;  3ZMU A;  4RB2 C;  2DT5 A;  1XB4 A;  2CSO A;  2Z9O A;  4ESB A;  2C6Y A;  5K5O A;  3AAF A;  2XKO A;  1D3Y A;  5BOX A;  1W7P A;  3VOE A;  3IWZ A;  1FC3 A;  3BRO A;  2PFB A;  4Y15 A;  1XCV A;  4QLC U;  2RKH A;  4R1H A;  3K1P A;  3R60 A;  5FLX Z;  4IRG A;  1FT9 A;  2GWR A;  5ICE A;  5IT9 Z;  2P7V B;  4P5O A;  6PAX A;  2BBY A;  1HW1 A;  5CLS A;  2ZNY A;  4P96 A;  2QM3 A;  1W5T A;  3HRS A;  1R5G A;  1P2F A;  4LMY A;  2WV0 A;  1K6O A;  2XRN A;  3TGN A;  4IHT A;  2XAQ A;  1HW2 A;  4KMU X;  1BC8 C;  1PP8 F;  1KYZ A;  3FMR A;  2DLL A;  1ZAR A;  3M8E A;  4PGG A;  1O57 A;  1Z1D A;  5HS8 A;  1O3R A;  5L3D A;  1MJB A;  5E8G A;  4U88 A;  1J75 A;  1LEA A;  3LQR A;  3R4K A;  1U5T A;  5DUK A;  5H6Q A;  2ELH A;  4EJO A;  4HF1 A;  4UNO A;  3GEZ A;  3MAJ A;  4KIF A;  3E5Q A;  2V1X A;  3HHH A;  5DD8 A;  1LDD A;  5L3E A;  3FZV A;  5BS6 A;  4Z2Y A;  5CYV A;  1QPM A;  3J80 K;  2K4J A;  4XBF A;  2RDP A;  1U78 A;  4UV8 A;  1Z9C A;  3V7C A;  3ISP A;  3IRQ A;  2QQA A;  2GA2 A;  1FBQ A;  2RGV A;  1IN7 A;  3VFZ A;  5D6E A;  2IPQ X;  3WGH A;  2UZK A;  2ZBK A;  4RB3 C;  4G8X A;  1TTY A;  1LVA A;  1J0R A;  1VTN C;  2OA4 A;  1ZRD A;  4MGR A;  5HS7 A;  1FSH A;  2QQ9 A;  2CW0 F;  1H9G A;  1FPQ A;  2GZW A;  3LFK A;  4UHT A;  4M74 A;  2QZ8 A;  3V7R A;  2PJP A;  3WOD F;  3R61 A;  1ON2 A;  3F22 A;  3J7A O;  1XMK A;  2DO7 A;  3RYR A;  5BPD A;  4U0Y A;  5D5X B;  2LNB A;  4G7Z F;  3M8F A;  1CGP A;  3GFL A;  4ESF A;  1X3U A;  2DQR A;  3HHG A;  1FYL A;  1ZRF A;  2PBI A;  3GWZ A;  4YG2 F;  3ZP5 A;  4EQQ A;  1XMA A;  1O7F A;  4UUV A;  5DUI A;  1HW5 A;  1I27 A;  4YFX F;  3TDZ C;  3QP6 A;  1UCR A;  1BI1 A;  2XV4 S;  2L02 A;  3KZZ A;  2Q0O A;  5LRS A;  1DPR A;  2OD5 A;  3BWG A;  2GXG A;  1ZG3 A;  5LBQ A;  2DI3 A;  3LWF A;  4Q4Z F;  1TLH B;  5HS9 A;  1YS6 A;  4MQV A;  4RGU A;  4BYY A;  1YO5 C;  5FD6 A;  2FEZ A;  2R3S A;  4S04 A;  4RAY A;  2AS5 F;  2A69 F;  1ZGJ A;  2P6S A;  3LA2 A;  4M6X A;  5HLG A;  4LLN A;  2OBP A;  1R5H A;  4UVB A;  3BY6 A;  2K86 A;  2O3F A;  4LB6 B;  3WU0 A;  1KU7 A;  3F72 A;  5DD4 A;  1G4D A;  1IXR C;  4U0V A;  1BI3 A;  2KRF A;  3ZMV A;  2VBW A;  4L18 B;  5D8L B;  4BH9 A;  4GGG A;  1R22 A;  3CUQ A;  3T8R A;  2ESH A;  2A61 A;  3CUO A;  5DV5 A;  2YX7 A;  1IAW A;  2EV5 A;  1CF7 B;  2Z5U A;  1QGP A;  3O3K A;  2UWM A;  5LHH A;  5D5W B;  3U1D A;  3R0J A;  3L00 A;  2LF8 A;  1SFU A;  5F1R A;  2EFQ A;  1REP C;  4L0Z B;  1R36 A;  5CVV A;  3I53 A;  1ODD A;  4CYD A;  4M73 A;  3IWF A;  4LB5 A;  4ENN A;  2HKX A;  2IJL A;  1HQC A;  2J5P A;  3MWM A;  3E6C C;  1O3T A;  4ZH4 F;  2RN7 A;  4WF2 A;  4NB5 A;  4EJV A;  3N4M A;  1QZY A;  1HKT A;  2V6C A;  3TO6 A;  5LRR A;  5J8F A;  4RB0 A;  1O3S A;  3P9K A;  1ZG5 A;  2YX4 A;  4BNC A;  1QNT A;  3FMS A;  2QVO A;  3K69 A;  4NQW A;  2VE8 A;  1QO0 D;  3B02 A;  1XSX A;  3QPH A;  1XSD A;  4BQA A;  4YIF A;  3HYI A;  1R23 A;  1S7O A;  3M7G A;  4OOI A;  1IRF A;  3U2R A;  2F5E A;  3P9C A;  3JTG A;  1V3F A;  3E97 A;  1BM9 A;  2E7W A;  1B1B A;  3HRM A;  5D8K B;  2TDX A;  3MQ0 A;  2XAJ A;  1YG2 A;  1O3Q A;  4EJT A;  2FOK A;  2H94 A;  2EFW A;  2GA1 A;  1K78 A;  1HXD A;  3EUH A;  4LFU A;  1RZ4 A;  4KYW A;  3ELK A;  2ZFW A;  1ZH5 A;  1MD0 A; 
#chains in the Genus database with same CATH topology
 2K9S A;  1VQ7 I;  3J7A Y;  1JGS A;  4HLY A;  3WTU C;  2XAS A;  1PDN C;  1RKW A;  4AD9 A;  2LKP A;  3S3O A;  4FT8 A;  5FB2 A;  3I59 B;  1U0J A;  3ZN1 A;  2HNH A;  2A05 A;  4BHC A;  5FFX A;  2M7B A;  1ZRE A;  1ITY A;  5AIP A;  4E7L A;  3V4G A;  4H0E A;  2WB1 A;  4NQW B;  1ZN2 A;  4BHP A;  3G1O A;  3CO7 C;  3R6S A;  1MSF C;  2R92 J;  2M30 A;  1PVE A;  4B44 A;  2ZO4 A;  3C1D A;  4M6Y A;  2STT A;  1WQ2 A;  4XOP A;  4A0X A;  4RM3 A;  4MTD A;  1F4K A;  1OPC A;  1R58 A;  2JUC A;  2LC2 A;  5M5X J;  1X1P A;  3MKY B;  4BY7 J;  1C0W A;  3C18 A;  4XKW A;  1TT0 A;  3AG1 H;  2ID3 A;  2IGM A;  3PSI A;  5DYM A;  1XCB A;  3FK6 A;  4I6Z A;  3ABL H;  5HNH A;  1IZ1 A;  3B6A A;  2KRH A;  2MH2 A;  1WKM A;  5ERI A;  4XSZ F;  2A5Y B;  3EUA A;  1TNS A;  3TDU C;  2IEK A;  2XGX A;  2F5V A;  1W0T A;  3ULQ B;  2CQX A;  2W84 A;  1I1G A;  1P6R A;  4G12 A;  1NH3 A;  1CF7 A;  1R5I D;  3S1Q J;  3M8J A;  1EH8 A;  3SEQ A;  4U87 A;  4Y17 A;  1X1A A;  4WXD A;  2JTV A;  1PUF A;  1U9O A;  1T6S A;  4ETS A;  2D2W A;  3BDD A;  1JHF A;  4BQQ A;  4EEF G;  4UVC A;  2FBH A;  3K6G A;  1IJW C;  2EPF A;  2QKM B;  4HDV A;  1ZGA A;  5LEJ A;  3A1Y A;  1BI0 A;  2LD5 A;  3RPQ A;  1YX3 A;  4IQJ A;  1UHS A;  2JMW A;  2L4A A;  2PG4 A;  1APL C;  4EGZ A;  5KAI C;  2V79 A;  3QPT A;  3L2C A;  3PIO F;  1R4N B;  1T39 A;  1Y0U A;  1MBK A;  5M5W J;  3J80 Z;  3F8F A;  5H20 A;  2WAE A;  2VC1 A;  1DP7 P;  2P6T A;  3I64 A;  2NS7 A;  2DU9 A;  4BQN A;  1F5T A;  4L5I A;  1W7P D;  2DOF A;  2ZCW A;  2KDZ A;  4X6A J;  3H35 A;  4RBO A;  2X9D A;  5CKT A;  4PZJ A;  1DDN A;  1RKT A;  4ZDP A;  3EYI A;  4GO1 A;  4O5V A;  1ULY A;  1WZ2 A;  1V54 H;  1UFM A;  3QP5 A;  4GXO A;  3I59 A;  4E7Z A;  4MNU A;  2Z16 A;  2V26 A;  4CCK A;  3E3V A;  3QYF A;  4PSX A;  5KHD A;  2ELK A;  4KIB A;  3E5U A;  2GXB A;  1S8N A;  3WTX C;  4FAS D;  4ITV A;  3K70 C;  1EH7 A;  3ASN H;  4X0G A;  1FMW A;  1MIJ A;  4MEY F;  1SFO J;  4AYB N;  4OIQ F;  2RNJ A;  5IT3 A;  3DP7 A;  4JX4 A;  5FFZ A;  3TP3 A;  4AID A;  1DU6 A;  1EJ9 A;  1IGN A;  3E5X A;  2M4G A;  4NC7 A;  3L2U A;  2NVQ J;  2Y9Z A;  5EG0 A;  3BG6 A;  3UNG C;  3FIS A;  2XIG A;  3F6O A;  3GFM A;  1H89 C;  3G2B A;  2NAZ A;  2N8G A;  1IF1 A;  2O5R A;  2E1O A;  4N9I A;  5DTD A;  2V1N A;  4ZYE A;  1MKM A;  2XPW A;  2EA4 A;  4KIG A;  3M1E A;  4G9Y A;  5E20 A;  5HVQ C;  2EK5 A;  4M9Z A;  2VUM J;  1ZGW A;  3ABM H;  4BEH A;  4BE0 A;  2MD0 A;  1WGX A;  1P7J A;  5J1Y A;  1JUM A;  2ZXI A;  4HV5 A;  4XLF A;  3I58 A;  4EJW A;  4FTH A;  4A3L J;  1G3Y A;  4XLP F;  1G6N A;  1NHA A;  4CCJ A;  3G4S I;  3FXU A;  4YEJ A;  2XC7 A;  4HX4 A;  4ZTJ A;  2JT1 A;  2CO5 A;  2KZG A;  4LJZ F;  2ZB9 A;  5IY5 H;  4F92 B;  2ZJP F;  4DZJ A;  1N77 A;  1XX5 A;  5CVI A;  5F1J A;  1A35 A;  3GX4 X;  4FX0 A;  2DOE A;  2Q8K A;  3QWL A;  4N9H A;  3WGG A;  1PJR A;  2X6O A;  1NTC A;  2VPR A;  4LGW A;  3JRG A;  1U8R A;  1R49 A;  2M45 A;  3M9A A;  4CXF A;  1QBJ A;  3V42 A;  4A6E A;  2EZK A;  2D1V A;  2HYF A;  3K1N A;  5GAD J;  1H8A C;  4KDP A;  2KRC A;  1IC8 A;  1H9T A;  2M8E A;  4B47 A;  2IS1 A;  4BAY A;  3V8J A;  1J5Y A;  3CZ6 A;  1W36 D;  4BGD A;  3LSJ A;  5ICC A;  3ZMT A;  1LKX A;  5ICF A;  1X2N A;  4DYQ A;  2BOL A;  3QQA A;  3FWE A;  5FKL A;  4UUT A;  2LKX A;  3TW6 A;  3GTK J;  3DU5 A;  4G6Q A;  2LYC A;  4LK0 F;  5JR3 A;  2V1U A;  2LTP A;  3KX2 A;  1FIA A;  4AU7 A;  2A07 F;  1WJB A;  3F6V A;  5HLI A;  3P7N A;  1KON A;  3JR9 A;  2EIN H;  4CGZ A;  1WJA A;  3Q9S A;  1MH4 A;  3HTS B;  2MBF A;  5H2F C;  2CFX A;  3TOA A;  2XAG A;  1HSJ A;  3KE2 A;  2HOA A;  3MMY B;  2XAU A;  2R7Q A;  1YFH A;  1YRN B;  1X3Z B;  3I71 A;  3KCC A;  1LE8 A;  4BU2 A;  1ZLK A;  1LPQ A;  2EZI A;  1TP4 A;  1X1D A;  2DTR A;  3RYP A;  4DOZ A;  5GPA A;  2Z2S B;  3IHU A;  1IN6 A;  2HR3 A;  2DMU A;  3GTP J;  1SFK A;  2F4M B;  5HDN A;  3IH2 A;  2DMQ A;  2IAI A;  1SAX A;  2B63 J;  3RZD J;  3ZMS A;  2ECB A;  2PMH A;  4I7H A;  3A4C A;  2O8X A;  2XPV A;  3BCB A;  4FQG A;  3TMO A;  3HOV J;  2CUF A;  4HQE A;  1YHQ I;  4ANJ A;  2IRF G;  3Q0V A;  2FX0 A;  2ETH A;  2XAF A;  3HRT A;  4D1Q A;  3HOW J;  1PUE E;  1TQP A;  2EFP A;  1JJ6 C;  2L0K A;  5DDG A;  3KFW X;  1OIS A;  2OZ6 A;  2YS9 A;  5D6F A;  5EZG A;  4B3X A;  1HBX G;  3MZH A;  4XR6 A;  2KIF A;  1ETY A;  2LFB A;  3DTE A;  2CRG A;  1MBJ A;  2J5O A;  2HOE A;  1JT6 A;  1OYY A;  2KJB A;  2Y30 A;  3KP5 A;  3NAR A;  4KIS A;  4BAC A;  1RNL A;  4HBL A;  4DQ2 A;  1S5L C;  2IS2 A;  3BG9 A;  3OYL A;  2VKV A;  4IHS A;  2DMT A;  1W36 C;  5HNF A;  4XLC A;  3CJN A;  1WJ5 A;  4XID A;  2WBM A;  4V2G A;  3FBN B;  4JP0 A;  2F4O B;  2KIM A;  4L5J A;  4EM0 B;  1XGO A;  2LVS A;  2W57 A;  3DPT A;  1J9I A;  3RDI A;  5E3L A;  2B7E A;  3PQJ A;  2LY1 A;  2HTJ A;  1SFX A;  1STZ A;  2R7O A;  3W6K B;  3GCM A;  3A01 A;  3CUQ B;  4YFK F;  3LSP A;  2IA2 A;  4LIU A;  1JTX A;  1YIJ I;  5K7F A;  1B59 A;  2DCE A;  1Z77 A;  2DA2 A;  4ON0 A;  2ME6 A;  1MW7 A;  3S2H J;  4F93 B;  3I55 I;  2A6H F;  2Y75 A;  3TW7 A;  3OYA A;  1AU7 A;  3DLA A;  5B66 C;  2DYS H;  1NG7 A;  3CJQ B;  1WRJ A;  3I54 A;  2K02 A;  1BJA A;  1T98 A;  2XF7 A;  3OWT A;  4R79 A;  2XB5 A;  4RAZ A;  2L9R A;  1XD7 A;  4A5M A;  2HDD A;  2V9P A;  1D1A A;  4HX7 A;  3FXK A;  1ZLJ A;  4II3 A;  3BPV A;  5D4R A;  2R5Z B;  1XGS A;  4LIV A;  5CVR A;  4A5N A;  3O6B B;  2O8K A;  2I10 A;  4HQM A;  3K4L A;  5A2Q K;  3H9G A;  2EFN A;  2L7Z A;  4PGH A;  3OS1 A;  2HVS A;  4J00 A;  4QWQ A;  3E6D A;  3WE3 A;  1FZP B;  1JE8 A;  3LSG A;  3T0Y A;  3PNV A;  3HOS A;  3CC4 I;  2OQG A;  5EEA A;  1G3S A;  3LSI A;  3HOZ J;  4TV7 A;  1MMG A;  2OTL I;  2FMY A;  3KLN A;  1T0F C;  1YQA A;  3HL2 A;  1KYW A;  4PDK A;  3PUB A;  4XOR A;  1LFU P;  2G9W A;  3DFG A;  3ZMD A;  3PM1 A;  2R0Q C;  3IP4 B;  1W5C C;  2YU3 A;  4YFN F;  3L2V A;  5DCM A;  4E7J A;  2QCO A;  3PO2 J;  2ZSH B;  3LSM A;  3TO9 A;  5ILV A;  1U2W A;  5LHI A;  3IH3 A;  1AHD P;  1Z05 A;  2ICW G;  4OIP F;  2R7D A;  2FML A;  3K4J A;  1SFE A;  4WK8 F;  2LSO A;  2OAZ A;  3MFK A;  3HOY J;  3ECH A;  1Q1V A;  1HA8 A;  1E3O C;  1MH3 A;  3A0H C;  1YTY A;  4IF4 A;  1WSU A;  3FHZ A;  4NNJ A;  2DPD A;  2JVG A;  1B4A A;  4WXC A;  3VB2 A;  5HOO A;  2K9L A;  3HKZ N;  4MHG A;  1J2X A;  1BOA A;  1KQ8 A;  1K4S A;  1LDJ A;  2GOM A;  3FDY A;  2MH9 A;  1UEL B;  1IN4 A;  5AON A;  3Q3S A;  3J81 Z;  3BTC A;  1BBY A;  2K3P A;  2PQ8 A;  3QRF F;  1FOW A;  2CFO A;  2W85 A;  2DT7 B;  2EV6 A;  2VAS A;  4UUS A;  4ZC3 A;  2EA2 A;  3OYG A;  1G8X A;  2VOP A;  2P5V A;  2YUS A;  3W6J B;  2B9S A;  4KMF A;  2DA3 A;  3BZ6 A;  1KQ9 A;  1BIA A;  3BR3 A;  3H92 A;  4HA8 A;  3AG2 H;  1JKQ C;  1WI9 A;  1Z21 A;  3DCF A;  2BY0 A;  2KIQ A;  3EDP A;  2FRH A;  2Z99 A;  5M5Y J;  3ZQF A;  5C4J J;  3CUQ C;  3R0A A;  1D0Y A;  3CDI A;  3IH4 A;  4CYC A;  1X4P A;  3OYC A;  2E2H J;  3Q0W A;  1HDP A;  5FKM A;  1IRX A;  1YW8 A;  1P7I A;  2BV6 A;  2DYR H;  4XLH A;  2ZFU A;  2BVM A;  2WY8 Q;  4B1R A;  4FET A;  4FX4 A;  2HDC A;  1A36 A;  1W7P B;  1SMT A;  2OU2 A;  3VOD A;  1G2H A;  2QSF X;  3NEU A;  3G3Z A;  5D5U B;  2EQR A;  4KT5 C;  1D8J A;  2Y69 H;  5K7Z A;  1R6R A;  1SAU A;  1J09 A;  1RR7 A;  2L01 A;  2IGK A;  1ACI A;  4IXA A;  3KEO A;  1LFB A;  2PMU A;  3SXY A;  3GTL J;  1FP2 A;  2CYY A;  3HTU A;  4RGR A;  3K0L A;  3SDG A;  1MNM C;  4OIR F;  2QWW A;  5EG0 B;  1N78 A;  2VKE A;  4PSW A;  3J7Y J;  2Q2E A;  1BR4 A;  4Y13 A;  4F91 B;  1FSE A;  5L3F A;  2XSD C;  3S1N J;  1W4M A;  3PUF A;  2IS4 A;  1SVL A;  2OZU A;  2ZXW H;  1ON1 A;  2AXT C;  1Z6R A;  3CTA A;  1VQL I;  1FOX A;  3WTZ A;  1FBU A;  3Q0U A;  2H6B A;  2Q1Z B;  3OR2 C;  4YRV A;  4XN3 A;  2YSR A;  4ZJZ A;  5L3G A;  2DTZ A;  3WTV C;  1OLT A;  2G7H A;  4XKB A;  2MC3 A;  2ME0 A;  3RKQ A;  2JK3 A;  1U6G A;  1YLF A;  3VWB A;  2A6T A;  1SMY F;  3H5R A;  1IN8 A;  2K4B A;  4Y33 A;  5BQT A;  2HS5 A;  2DAO A;  5K1Y A;  2DDB A;  1POG A;  3ZQ7 A;  4EGY A;  4XON A;  2OTJ I;  1KU3 A;  3HSE A;  1ZKG A;  3W2W A;  4HDU A;  3ABU A;  3SZG A;  2XUB A;  4UV9 A;  4E7S A;  1R1T A;  1QA6 A;  1G59 A;  2K9M A;  2H1K A;  1KU9 A;  1WWX A;  3ERM A;  3J7Z I;  3OYK A;  1FTZ A;  4KN7 X;  2G0E A;  2EBI A;  2HQN A;  2VC0 A;  3BOQ A;  4I0B A;  4QIW N;  5JFR A;  3ERE D;  1XGN A;  4KIT B;  4W97 A;  4L0Y B;  3ABT A;  1XDS A;  2ZKZ A;  1E3H A;  3DTI A;  2VQH A;  1VQO I;  5FLM J;  3HSR A;  4IOC F;  1XMX A;  3I56 I;  4E6K G;  2HKO A;  3MZY A;  3ZQC A;  1TW2 A;  1OCZ H;  1QVT A;  3TL4 X;  4CDG A;  5JI6 A;  1KU2 A;  2I8D A;  2EIJ H;  2MLG A;  1UHW A;  2F5D A;  2GM4 A;  2NS0 A;  2ISY A;  1SD5 A;  5DM7 F;  1X58 A;  2H8R A;  1IUF A;  3IC7 A;  4HOB A;  3CCU I;  4ZYH A;  4HRI A;  3OS2 A;  5FLX K;  1VQK I;  1YJ9 I;  5FLV A;  2QEN A;  4NC6 A;  5A2Q Z;  3ZMZ A;  2HPI A;  2FF4 A;  1OKR A;  3CC7 I;  2EB7 A;  3F21 A;  4Y3O A;  3JSO A;  2UUZ A;  3BQY A;  3LSK A;  4LG3 A;  2XGE A;  1ZR2 A;  1HF0 A;  1JKR C;  2Y48 A;  3NRV A;  3H1C A;  3GZN B;  2HVR A;  4M9S A;  1VZ0 A;  1OCP A;  2X4H A;  1AWC A;  3NAU A;  3VEP A;  2JUG A;  3ML6 A;  1BIB A;  4KUM A;  2HEO A;  1UZC A;  4AIK A;  4Q48 A;  3S2D J;  2IT0 A;  3CES A;  2RV8 A;  1WVR A;  5AIQ A;  5BNG A;  4N4O B;  4N0B A;  3GME A;  5F6F A;  3F23 A;  3EQL F;  1VQ8 I;  1EA3 A;  2L9N A;  3WU2 C;  1X4O A;  3WGI A;  3LA3 A;  1F1Z A;  3CO6 C;  4X1E A;  5GPC A;  1SVM A;  4A2U A;  2JPC A;  3LNQ A;  5BMZ A;  4LG0 B;  2YPR A;  3GVA A;  3SEZ A;  5ICG A;  1W5S A;  1Z6T A;  2WC2 A;  3H0G J;  1VQ5 I;  1LJ9 A;  5HOD A;  1BA5 A;  2CUE A;  2VOO A;  3DPU A;  4Q47 A;  2DQL A;  1HCR A;  4JYK A;  2RVC A;  5ILU A;  1KA8 A;  1TC3 C;  4CCN A;  4G7H F;  2WAQ N;  2BZT A;  3BG3 A;  2RRE A;  1MDM B;  4LG0 A;  1LQ1 A;  2P7C B;  2LRE A;  1A31 A;  2OPT A;  3ZGK A;  3KP6 A;  3DU6 A;  1TL8 A;  2MC4 A;  2VT3 A;  1GLN A;  1I50 J;  3ZN0 A;  2KFD A;  3CCJ I;  3CCQ I;  1OCC H;  2X85 A;  2CQQ A;  3G71 I;  4NC8 A;  4XKV A;  2QEX I;  1ETW A;  5IYD J;  3K1M A;  2FXA A;  2P5L C;  2ZXH A;  2W82 A;  3RI4 A;  1S9H A;  2DK5 A;  3OS0 A;  4BE2 A;  1E17 A;  1NG6 A;  3K4B A;  2D45 A;  3JRD A;  4Z6Y A;  3S3M A;  4A12 A;  4FHT A;  3KP3 A;  1OQY A;  1T95 A;  3D0S A;  1R1V A;  1WPK A;  1BW5 A;  3GTM J;  5KVR A;  5TJJ A;  2OQR A;  2PEX A;  1U5T C;  5GAE J;  1LDK B;  1P92 A;  2CW8 A;  2A68 F;  4QPQ A;  2QGU A;  3HJE A;  4A3C J;  2DA6 A;  2QBY B;  3BG5 A;  1S3J A;  2L9S A;  2M2E A;  1TWH J;  4L5E A;  4RAG A;  1RUO A;  1ETV A;  1KQ0 A;  3WE2 A;  5GAG J;  4LIT A;  2DFF A;  2CQK A;  4OU0 A;  1FEX A;  2CUZ A;  1K6Y A;  3SHF A;  5LD2 C;  2M9H A;  1ORK A;  2KPM A;  2XAH A;  1AOY A;  5LGT A;  1B72 A;  1HC8 A;  4XRS A;  1UG2 A;  3I5U A;  3DKY A;  3GLX A;  2WTE A;  1BN5 A;  1OR7 A;  2X6W A;  4QSH A;  5DM6 F;  1FMV A;  1YIT I;  1MBF A;  2CH0 A;  3BP8 A;  4I02 A;  3BJA A;  3RKY A;  3L9F A;  2VQC A;  4H4K C;  2STW A;  3DEE A;  2EZL A;  3K9T A;  5D4S A;  3HOX J;  5DCF A;  3PSF A;  2OJE D;  3FXM A;  4P55 A;  3JTH A;  1QU3 A;  3P5J A;  2W7N A;  2DW4 A;  1FWZ A;  5JHU A;  1ETO A;  4HSR A;  2MAB A;  2HPM A;  2E36 A;  1YOV B;  2VBY A;  1TQM A;  3K4M A;  4S0H B;  3PNY A;  4DZP A;  5GTH C;  2QF7 A;  2KLO A;  2VQL A;  2VKD A;  3RPU D;  3BR2 A;  1FYK A;  4YII A;  5J47 A;  4BS9 A;  4OMZ A;  3FHN A;  3V8K A;  1BR1 A;  4BXX J;  2L54 A;  3OYE A;  1D8K A;  2W4S A;  1JXS A;  2XRO A;  5EZH A;  3JRE A;  1ETX A;  3OY9 A;  3KP2 A;  4GDF A;  2FBI A;  3CP8 A;  1TW3 A;  4A6D A;  4D9J A;  1KGS A;  4WXH A;  1FY7 A;  3OOP A;  2BW3 A;  2BYV E;  3HC7 A;  3ZPL A;  2K3F A;  2LY2 A;  2NNY A;  2ZME A;  4HF2 A;  3NWT A;  4O6J A;  4DGW B;  4CUG A;  2L2O A;  4DYR A;  1YI2 I;  1YS7 A;  3HPH A;  2F2E A;  1WJF A;  3F8N A;  2IA1 A;  4R8H A;  2BY1 A;  1GXQ A;  3KEQ A;  2NVY J;  3HGG A;  4UUS B;  1LEB A;  3ASO H;  1A6I A;  4IHV A;  2VJ5 A;  1BC7 C;  1XTA A;  2O9L A;  4E70 A;  2PJR A;  2GOX B;  2MLK A;  2V7F A;  4G7O F;  2JJ7 A;  2R4G A;  1OYI A;  5CVU A;  4HNT A;  1FNN A;  2ISZ A;  1E0E A;  2V9V A;  3BJ6 A;  5B5E C;  2HQ5 A;  3L7W A;  4DNC A;  2P8T A;  1YW9 A;  1ZHF A;  3LAJ A;  1Y1W J;  1P4A A;  5F27 A;  2CU7 A;  2HGC A;  5K5R A;  2VPL A;  2VBZ A;  2EJR A;  2HQA A;  3REO A;  3OYH A;  1T08 B;  3KP7 A;  1K4T A;  1O4X A;  2IP2 A;  3K4K A;  3OIO A;  2NRA C;  3CCY A;  4HG2 A;  2JQ7 A;  1OYW A;  1RI7 A;  4L9T A;  4RGX A;  5EGO A;  3FXO A;  1HOM A;  3FXQ A;  2M3A A;  5D5V B;  4IJA A;  3CJR B;  1IDY A;  3DF8 A;  3HZJ A;  5LGU A;  4CH7 A;  3ZQG A;  1S29 A;  2CJJ A;  3K7A J;  4EM2 A;  1QVU A;  5J1U A;  2FU4 A;  5DS9 A;  2VXD A;  2HFH A;  4P1W A;  1GHC A;  4J01 A;  3O2P E;  4GFB A;  4U7D A;  2VN2 A;  3SDB A;  3C2B A;  2A3S A;  2M0M A;  4V19 K;  2JSP A;  4HAM A;  4E4H A;  4M71 A;  1ZG1 A;  5LHG A;  1ZR4 A;  4KIC A;  4AWX B;  1JI8 A;  3WTT C;  3H3Z A;  1OFC X;  2QKL B;  1FYM A;  4HV6 A;  4PJM A;  3L2Q A;  5IP9 J;  3EUH C;  5EDN A;  2IW5 A;  2M1B A;  4IO9 F;  4AIJ A;  1DUX C;  1RET A;  3SZP A;  4ZYG A;  5KK1 A;  2HYG D;  3I0T A;  2COB A;  2ECC A;  5E1Z B;  2RAE A;  3JAM Z;  1A6Q A;  4XLE A;  2E1M C;  5JLX A;  5IP6 A;  3CMM A;  3LL7 A;  1R4M B;  3VPR A;  3TED A;  4D5C A;  2QLZ A;  1MMA A;  5ED4 A;  3WTW C;  3Q5F A;  2FNP A;  3BZK A;  2M87 A;  2W00 A;  4EAT A;  1YE9 A;  3BZC A;  2MA3 A;  3A01 B;  1D5Y A;  1Z91 A;  3EUK L;  4C30 A;  1X1B A;  3DTK A;  4XSX F;  3VSK A;  2VBX A;  2JPB A;  1JGG A;  2FOW A;  1Z7U A;  3S32 A;  1P4X A;  3BR6 A;  1I39 A;  5FD5 A;  2EV0 A;  2QBY A;  3DPL C;  3OYB A;  3MCZ A;  3CME I;  3FIW A;  1SC7 A;  1HKS A;  1Y8Q B;  4HX8 A;  4IPA A;  5E18 F;  3G6E I;  3HG9 A;  4ASN A;  2OCE A;  2FBK A;  2LRD A;  1FTT A;  4Q5S F;  3ZXS A;  2DPU A;  3OIQ A;  4XLA A;  2OUM A;  2VOD A;  1RR8 C;  2H09 A;  4BY1 J;  1R7J A;  3W6V A;  5KNL A;  1I6H J;  4BXU A;  3LAP A;  3OYD A;  2BXZ A;  2Y0M A;  2L3D A;  3M07 A;  5FRM A;  5LLQ A;  4HST A;  1VQ4 I;  4YEL A;  2HI3 A;  3OOU A;  1B72 B;  2WY7 Q;  4FIS A;  5E3M A;  3CMA I;  5E79 C;  4ZYA A;  1SD4 A;  2G7U A;  2DFE A;  4ENJ A;  3HRU A;  3RKX A;  4RS8 A;  1MJ9 A;  1O7L A;  3E6M A;  2WAF A;  3CLQ A;  3RPU A;  1SEU A;  3S16 J;  2FQ4 A;  3FXR A;  4V2F A;  1WHU A;  2DJN A;  3CDL A;  4JK1 X;  5TIS C;  3HXL A;  4CZZ A;  4MIM A;  2CV1 A;  1I5Z A;  5K5Q A;  1T33 A;  4CIC A;  3FM3 A;  2Y9Y A;  4C3H J;  1G3W A;  5B3S H;  1FJL A;  2LF7 A;  1YJW I;  1T0F A;  1LB2 A;  4A69 C;  4KNY A;  3VYS B;  2FE3 A;  4N4N B;  1FP1 D;  2CQ7 A;  4DW6 A;  3DXJ F;  1R00 A;  2EIL H;  5LGN A;  3OL4 A;  2MD5 A;  3G1M A;  3QOP A;  5FO5 A;  4IKF A;  3S8P A;  2F6C A;  4G6T B;  4C9Y A;  2E1N A;  3K70 D;  3H36 A;  1DPU A;  2FQ3 A;  4OMY A;  4XRS G;  1ZRC A;  4HYE A;  2H6C A;  2MGQ A;  1U3E M;  1YIO A;  4G94 A;  2R5Y B;  1YRN A;  3GF2 A;  1K83 J;  3CF5 F;  2ZNZ A;  4WCG A;  2NVX J;  1OCO H;  4HNV A;  5EEG A;  3GFI A;  2JA7 J;  3NQO A;  1J59 A;  4G6D A;  5ILS A;  4F3Q A;  1T2K A;  2QQB A;  1HKQ A;  5TRD A;  5M3F J;  3GW2 A;  1NK2 P;  3PQK A;  3RKW A;  1A5J A;  4NDL A;  1QQI A;  5J6X A;  4A0Y A;  4DBR A;  4LLG F;  5J8C A;  1UAA A;  2ZJ2 A;  1E3P A;  2X0L A;  3WTS C;  2UXN A;  5HDK A;  1IW7 F;  4PFO A;  4IRI A;  3H5A A;  3ESW B;  1R1U A;  4C3J J;  5JHF A;  2BY2 A;  1IUY A;  3CQZ J;  3DEU A;  4E7I A;  4CHU A;  3S2W A;  3TOB A;  2JSC A;  5FGM A;  2JRM A;  4IL6 C;  3E0J B;  2XVC A;  2X48 A;  4I0A A;  3KLO A;  1ZK8 A;  3K2Z A;  2V9K A;  3JRB A;  2R7V A;  2DN0 A;  1VI0 A;  3BPX A;  3F0C A;  1QHH D;  5HDG A;  1IXC A;  1B6A A;  4L9J A;  2LKS A;  4DIQ A;  5KAF C;  1SD7 A;  2HYJ A;  3BJO A;  4XIC A;  4GCV A;  2JRT A;  1V55 H;  3RIR A;  3QOD A;  3H3V K;  3LSR A;  1ZTR A;  2XGC A;  3AL0 B;  4CO8 A;  3HKZ A;  5IYB J;  2DBB A;  2X6X A;  1ZAO A;  1U5T B;  3LOC A;  4EVI A;  2JA2 A;  2V1D A;  3BR5 A;  2NXN B;  3HUG B;  4EV0 A;  4IHX A;  4QTR A;  4I01 A;  2M8G X;  3FXJ A;  3F3X A;  2E19 A;  4IOA F;  4RGS A;  2IBD A;  3S14 J;  2DK8 A;  2WAQ A;  3T8T A;  3C3W A;  1I3A A;  1D0X A;  2L9V A;  3GO5 A;  1Y6I A;  4B43 A;  3D1N I;  1XS9 A;  3HUG A;  1MJA A;  3ZOB A;  1VQP I;  1W0U A;  2ADU A;  5F0H A;  2HTS A;  3OMY A;  2L7F P;  4JQF A;  4XRF A;  5C44 J;  1ETK A;  4GYG A;  2VXZ A;  2O61 A;  4ESJ A;  1V5G A;  1MND A;  4ZZL A;  1L0O C;  4DBQ A;  2P4W A;  5FJ8 J;  3KZY A;  1PP7 U;  5DEQ A;  3DWL E;  2BEO A;  2PN6 A;  4RB1 A;  2XKP A;  5BPI A;  3TKY A;  2GQQ A;  2E1M B;  1U9N A;  4JX5 A;  2IVM A;  4M3B A;  2FNA A;  4HF0 A;  2E7X A;  3GZ5 A;  2DT6 A;  3LFU A;  3G73 A;  3V7S A;  1I6X A;  3JAM K;  3HOU J;  2NVU B;  3SFZ A;  4MO7 A;  2KJC A;  1AA7 A;  2NOJ B;  4BHB A;  2MFZ A;  2VL8 A;  3H3U A;  5GTI C;  2HVQ A;  5FRO A;  3GUD A;  4L9V A;  3TP0 A;  2NYX A;  4F7Z A;  3D5L A;  2CWE A;  3S17 J;  3C7J A;  4XLN F;  2Z3Y A;  3SYT A;  3N05 A;  1XC5 A;  3PO3 J;  1MGT A;  4LLL A;  4KT6 A;  3CCR I;  3X2Q H;  3AG3 H;  4GYI A;  1T38 A;  2NNN A;  5IYC J;  5E8I A;  2F4I A;  1W1W E;  4K2E A;  3M4O J;  1MDM A;  4WX9 A;  2HXO A;  4P9U A;  2BHZ A;  3TBI A;  3PIP F;  3NWS A;  4AYB A;  3KP4 A;  1JUS A;  1HST A;  2OF7 A;  5HLH A;  2FJ1 A;  5H6R A;  2WAD A;  3L2R A;  4EMS A;  1BW6 A;  1SD6 A;  1MMD A;  4EJU A;  4KJZ A;  3T5X A;  1WFX A;  1ONV A;  2KDO A;  1FX7 A;  2VON A;  4UXN A;  3VYU B;  2GAU A;  1QPI A;  2DOD A;  3WTY C;  3JRA A;  2HZT A;  3ZCO A;  1EV7 A;  3OV8 A;  4KA4 A;  3GYH X;  3U21 A;  3JCU C;  2PLY A;  1WH5 A;  4OAY A;  3GTO J;  1TQI A;  4ENM A;  4ZYD A;  4MFE A;  4RDU A;  4U0W A;  2A6E F;  3VYT B;  5LEK A;  4D7N A;  3HSF A;  4M9X A;  3C2H A;  4CCO A;  4JBA A;  2E1C A;  2DFH A;  5E1W A;  5IT9 K;  3AG4 H;  1WJC A;  2H27 A;  1RES A;  1FBS A;  1UST A;  1TT5 B;  1FOK A;  4I98 B;  2AQE A;  3JRH A;  2EIK H;  4ENK A;  3I4M J;  2L4M A;  4M3F A;  4E7K A;  1K78 B;  1DGR M;  3ZRG A;  3VYR B;  1Z3X A;  3B6C A;  3IL2 A;  3QAH A;  3HOT A;  1D5V A;  2GIZ A;  2VJI A;  3A2K A;  1F43 A;  2VKH A;  3U1K A;  1OCR H;  1CQT A;  3IKV A;  3DV8 A;  4CYC B;  2BGC A;  4L9N A;  3PJR A;  3QU3 A;  4A3D J;  2EIM H;  1MNE A;  2XSJ C;  1QHG A;  5FKK A;  1BOB A;  2ACJ A;  1B9M A;  4OAZ A;  2H1L A;  2R5Y A;  3OYJ A;  3DQV C;  2VJJ A;  1JHH A;  4BJ5 C;  2LY9 A;  3P9I A;  5E17 F;  1H0M A;  4AIH A;  5GP9 A;  4I2O A;  5C4X J;  2Y31 A;  1GVD A;  2CUJ A;  1R71 A;  2R7Z J;  2Z33 A;  4FE4 A;  1XGM A;  3AFH A;  4HPQ A;  1ETQ A;  3E1S A;  2R7T A;  4HNU A;  1S6L A;  3GTG J;  4HW0 A;  5EYR A;  3WU1 B;  1UJ8 A;  3MKZ A;  4RA2 A;  4P9F A;  2KZV A;  1A04 A;  1MBG A;  4PJN A;  2QUF A;  3CDH A;  2F5F A;  2IA0 A;  3C2G A;  4IX7 A;  5GAH J;  4RAF A;  1EKE A;  2XGD A;  4AC0 A;  3OSG A;  5B1A H;  2MSY A;  4EM1 A;  2JVH A;  3FX3 A;  1EH6 A;  4A0Z A;  3LA7 A;  2X1C A;  5L3B A;  2DDA A;  5CQG A;  3V8L A;  4YIR X;  1XN7 A;  3CCE I;  2IS6 A;  3PFI A;  2L5Q A;  3FM5 A;  4B8X A;  2LDU A;  2E2I J;  1IG7 A;  2IGO A;  1TBX A;  4M6V A;  3OSF A;  4IEJ A;  4C2U A;  1GVJ A;  3JW4 A;  2ZME B;  2H8W A;  4O3M A;  4XM3 A;  2X1E A;  5F64 A;  1BI2 A;  3SJM A;  1RUN A;  1E2X A;  3HPG A;  2R7W A;  5TGT A;  3B73 A;  1WCM J;  3ECO A;  1MSE C;  2JWT A;  2XDV A;  3J81 K;  4OIO F;  2DFI A;  2CS3 A;  3A0B C;  4PK4 A;  4S05 A;  4NHJ A;  2KIU A;  3OYI A;  2RC4 A;  2R7F A;  3LST A;  3S1M J;  2XHK A;  5IOZ A;  2PI0 A;  4PCQ A;  2LP0 A;  4I09 A;  1LUJ B;  3F8B A;  1XPX A;  2VIX A;  4M72 A;  2FD5 A;  2P5K A;  2W25 A;  4KN4 X;  3VDX A;  1T56 A;  3IRR A;  1LNW A;  3RTR A;  2MG4 A;  2E5Z A;  2HWV A;  2W24 A;  2JZY A;  4MTE A;  4XNF A;  3D5S C;  3HEF A;  2JA8 J;  4A93 J;  4B3A A;  4IRH A;  1L3L A;  1S7E A;  3ZQQ A;  3KET A;  3DKW A;  1XDU A;  2M7A A;  4NUB A;  1YW7 A;  4C2T A;  3Q9V A;  3RSN A;  3VSL A;  1IN5 A;  2DA1 A;  4D0P A;  4IHW A;  3JRI A;  4HZF A;  4BJT A;  1R9T J;  1DGW Y;  3DEW A;  2NS8 A;  4WWC A;  3O8G A;  3ZQI A;  2UXX A;  1TNT A;  2FA5 A;  3K4N A;  4CA0 A;  3QYE A;  4B48 A;  1YYV A;  3GXO A;  2EH3 A;  1Q1H A;  5EEH A;  3SZT A;  3L09 A;  1KZH A;  2VLA A;  4I99 C;  1TWF J;  3ONQ A;  3MEX A;  3PFY A;  4II2 A;  1I1S A;  3IKT A;  2V4J C;  2R7S A;  5E1X A;  1F9N A;  4DJA A;  2EFO A;  3RJP A;  2V6E A;  3FF5 A;  5CVJ A;  1OMI A;  3T1B A;  3IAM 2;  4U7B A;  2ZME C;  3LQQ A;  2BXY A;  4HLX A;  1ZYR F;  3CLO A;  1BJZ A;  2COM A;  4AVP A;  3SQN A;  1QZZ A;  2Y2Z A;  1GV2 A;  1P4W A;  3GFJ A;  1UB9 A;  4BDZ A;  1V4R A;  3BQZ A;  5J4V A;  3BG7 A;  2O6G E;  1FLI A;  4PJJ A;  5DCM B;  5F0F A;  3IV5 A;  1Y56 A;  1VQN I;  3K10 A;  1UHM A;  1S7A A;  2BE5 F;  4GRI A;  5J1R A;  4A3I J;  2QYO A;  4ZZD A;  1B8I A;  3MN2 A;  4NBQ A;  1IRG A;  1FIP A;  2K7L A;  2HQR A;  2TCT A;  3AKZ A;  5CPR B;  4IVN A;  5E3O A;  3A03 A;  3N97 A;  1GUU A;  2YR2 A;  2O03 A;  2DMP A;  4C2M J;  2R7X A;  2RQP A;  1K79 A;  1ENH A;  4A3G J;  4ZDO A;  3F8M A;  4IQ4 A;  1VF9 A;  4PJ0 C;  2KKO A;  3S93 A;  4LD5 A;  3QU6 A;  1J7K A;  2XB0 X;  5JVT A;  2BVL A;  2AQF A;  2EWN A;  5CJ9 A;  3HDD A;  2M5W A;  4MQ9 F;  1WH7 A;  3I9V 2;  5KCM A;  4LK1 F;  1K7A A;  3UKG A;  2KQR A;  4AUX A;  5M3M J;  3COA C;  1LVK A;  2D1H A;  3F8C A;  2E34 A;  3EYY A;  3H9Q A;  4M3D A;  2CG4 A;  4B09 A;  1V5E A;  3TO7 A;  2XRL A;  3S1R J;  1G3T A;  1P9Q C;  3BR1 A;  3TQN A;  2VT2 A;  3SFI A;  2R7U A;  2P81 A;  3OL3 A;  3OYM A;  4KFC A;  3DKX A;  1OCT C;  2FUG 2;  2BHY A;  1IXS B;  3MD2 A;  3ROU A;  2GIV A;  2PMZ A;  1RIO H;  3I4P A;  1XSV A;  3WG9 A;  2K27 A;  3FKI J;  4XMY A;  3BR0 A;  1RRJ A;  1B9N A;  2AXL A;  3JSP A;  2ZXJ A;  2Y0S A;  4BJ6 C;  2CGP A;  3GZ6 A;  4XN0 A;  1USS A;  4IHY A;  1GV5 A;  4CZC A;  2ZJQ F;  3EET A;  2B0L A;  4UVA A;  4OIN F;  1PUF B;  3U9G A;  2KIS A;  4MFD A;  3BTI A;  3E6B A;  2IXS A;  1JTY A;  3HIF A;  3FMQ A;  4B4C A;  2ESN A;  1GXP A;  5F0C A;  2VE9 A;  3CCS I;  4J19 A;  2F5C A;  4PUS A;  4I76 A;  5L3C A;  4MEX F;  2UV1 A;  1X1C A;  2O0Y A;  2TRT A;  4BXF A;  2QA4 I;  5EGO B;  1MZB A;  4XK4 A;  2WWY A;  1Z7L A;  2FSW A;  3ZMU A;  2DT5 A;  4RB2 C;  1X2M A;  1XB4 A;  2CSO A;  3BC8 A;  2Z9O A;  1ERD A;  1QZE A;  2M4K A;  1FOY A;  4ESB A;  2C6Y A;  2QSH X;  3A02 A;  5K5O A;  3AAF A;  2XKO A;  4M3G A;  4A3J J;  1D3Y A;  2P0W A;  5BOX A;  1W7P A;  3PNT A;  3VOE A;  3JRF A;  3IWZ A;  1FC3 A;  3BRO A;  2PFB A;  4UB8 C;  4Y15 A;  1XCV A;  1RC9 A;  4QLC U;  4CSW A;  2RKH A;  4R1H A;  3FK7 A;  2OCC H;  2PMZ N;  1ZQ3 P;  2K9N A;  4F52 A;  3S15 J;  1Y39 A;  4UY8 I;  3W2A A;  2CV0 A;  3K1P A;  3R60 A;  5FLX Z;  1D1B A;  4IRG A;  5J40 A;  1DU0 A;  1FT9 A;  2GWR A;  5ICE A;  5IT9 Z;  2P7V B;  4P5O A;  6PAX A;  1QRY A;  2BBY A;  3DBR B;  4XRM A;  4A3B J;  3RQ4 A;  1HW1 A;  5CLS A;  2ZNY A;  2VJ4 A;  4P96 A;  3ZR8 X;  3KYC B;  1MBE A;  2QM3 A;  1D1C A;  3DLL F;  2ZSI B;  1W5T A;  1WI3 A;  2LLK A;  1JJ8 C;  1Y1V J;  3HRS A;  1TWG J;  1R5G A;  1IO2 A;  1P2F A;  4LMY A;  2WV0 A;  5LFA A;  1TZL A;  3HM5 A;  2X1D A;  1K6O A;  2K40 A;  2XRN A;  3KEY A;  4OWR B;  2NOG A;  3TGN A;  4IHT A;  2XAQ A;  1HW2 A;  1D0Z A;  3MKL A;  4KMU X;  1S72 I;  1BC8 C;  4HEA 2;  4D7M A;  1PP8 F;  1HDD C;  1KYZ A;  3FMR A;  3WHC A;  4MLO A;  2LG4 A;  2DLL A;  3H9J A;  2DA5 A;  1ZAR A;  3LSH A;  3O8H A;  3HGY A;  4D5F A;  2BY3 A;  4XQF A;  3M8E A;  3H5N A;  5J3L A;  4PGG A;  1VFC A;  1O57 A;  1UMQ A;  1Z1D A;  5HS8 A;  4QPO A;  1O3R A;  3GBG A;  5L3D A;  3MVP A;  5IPA A;  4A3E J;  1MJB A;  5E8G A;  4U88 A;  1J75 A;  2HOS A;  1LEA A;  3LQR A;  2LBF B;  3R4K A;  1U5T A;  5DUK A;  5H6Q A;  4LOC A;  2X6Y A;  2ELH A;  2LH9 A;  3CMY A;  4EJO A;  3KYL A;  4HF1 A;  4UNO A;  3GEZ A;  4M3E A;  1IV6 A;  3MAJ A;  4KIF A;  1AKH B;  5E3N A;  3E5Q A;  1H88 C;  2V1X A;  3HHH A;  5DD8 A;  1LDD A;  4FE7 A;  2LOO A;  5L3E A;  5JLW A;  3FZV A;  2O7O A;  2DJI A;  2KL4 A;  4W1U A;  1AKH A;  1HLV A;  1NK3 P;  2VB6 A;  5BS6 A;  1IRZ A;  3K4C A;  2X51 A;  2ELJ A;  4Z2Y A;  5CYV A;  1QPM A;  2BW3 B;  2JN6 A;  3J80 K;  2K4J A;  2R93 J;  4XBF A;  3FKJ A;  4F55 A;  2RDP A;  1U78 A;  4UV8 A;  2ID6 A;  3DBH B;  2HXI A;  1Z9C A;  3CCM I;  3V7C A;  3ISP A;  4IZZ A;  3IRQ A;  2QQA A;  2GA2 A;  1FBQ A;  2RGV A;  1IN7 A;  3VFZ A;  5D6E A;  2IPQ X;  2CV2 A;  3WGH A;  2UZK A;  2ZBK A;  4RB3 C;  4BEH B;  1F36 A;  3GLL A;  2OC6 A;  3L2W A;  4G8X A;  1TTY A;  5FKO A;  1LVA A;  1J0R A;  1VTN C;  4BBS J;  1GDT A;  4Y7N J;  2Z1D A;  4XL9 A;  2OA4 A;  1BL0 A;  5HLT A;  1ZRD A;  4MGR A;  5HS7 A;  1FSH A;  2QQ9 A;  2CW0 F;  1H9G A;  1V5F A;  1FPQ A;  2GZW A;  3LFK A;  4UHT A;  4M74 A;  2QZ8 A;  3V7R A;  1Y0N A;  4BQO A;  2R5Z A;  2PJP A;  1VQM I;  3WOD F;  1EF4 A;  1VND A;  2HZD A;  1LFP A;  1N75 A;  3I4N J;  3R61 A;  1ON2 A;  2KT0 A;  3F22 A;  4BKX A;  3J7A O;  2M0C A;  3PL8 A;  4PJL A;  1XMK A;  2DO7 A;  3IAS 2;  3RYR A;  5BPD A;  2E71 A;  3EPZ A;  5D5X B;  4U0Y A;  1LE8 B;  1JKO C;  2LNB A;  4G7Z F;  2LBF A;  3M8F A;  1CGP A;  2DA4 A;  3KPH A;  3GFL A;  2RNG A;  4ESF A;  1X3U A;  1BR2 A;  2DQR A;  2MW8 A;  3HHG A;  3ZQH A;  1FYL A;  3BTJ A;  1ZRF A;  2LMD A;  3OR1 C;  4Y4R A;  4A3F J;  3MZ8 A;  2PBI A;  3GWZ A;  4YG2 F;  5EF6 A;  2OV7 A;  4EQQ A;  1XMA A;  3ZP5 A;  2KMU A;  3G1L A;  4BE1 A;  1O7F A;  4UUV A;  3JRC A;  2LK2 A;  5DUI A;  2XF6 A;  1RPW A;  1HW5 A;  2JA5 J;  1TWC J;  2E5N A;  1I27 A;  2DMN A;  2L7M P;  4BDY A;  1OR7 C;  4YFX F;  2DXI A;  3TDZ C;  2WA0 A;  2K9Q A;  2K5C A;  3QP6 A;  1UCR A;  2AHQ A;  4JOM A;  1DP3 A;  1BI1 A;  4RMN A;  2WB1 N;  2XV4 S;  3W3C A;  2L02 A;  2RQQ A;  3GTJ J;  5K7H A;  4A3K J;  3KZZ A;  2Q0O A;  3OYF A;  5LRS A;  3QPL A;  1DPR A;  2OD5 A;  3BWG A;  3D5R C;  4UB6 C;  2D5V A;  2GXG A;  1MMN A;  3IUO A;  1ZG3 A;  5LBQ A;  2DI3 A;  3LWF A;  3E7L A;  1Z0X A;  5J4Y A;  1K61 A;  2R7R A;  4Q4Z F;  3AL0 C;  1TLH B;  5HS9 A;  5CQE A;  3S3N A;  1VQ6 I;  3CD6 I;  1YS6 A;  4MQV A;  4RGU A;  4BYY A;  3QYB A;  1IDZ A;  1YO5 C;  5FD6 A;  2FEZ A;  2R3S A;  1IV8 A;  1XG1 A;  1GT0 C;  4S04 A;  1MBH A;  2KHM A;  4C3I J;  4RAY A;  2Q2E B;  2AS5 F;  2VI6 A;  3H0D A;  2A69 F;  1ZGJ A;  2P6S A;  3ZQL A;  3LA2 A;  4M6X A;  5HLG A;  1M1E B;  2F48 A;  4JX6 A;  4LLN A;  3KIO A;  2KP6 A;  1T8I A;  2OBP A;  5B1B H;  3BLY A;  3GTQ J;  1R5H A;  1WJE A;  3BY6 A;  4UVB A;  1Y8R B;  2IGN A;  2K86 A;  2O3F A;  2DA7 A;  4LB6 B;  3WG7 H;  3BCA A;  2EZH A;  3HB9 A;  2L7K A;  2WV1 A;  3QPS A;  3WU0 A;  1KU7 A;  3F72 A;  3M1C A;  5DD4 A;  1G4D A;  1IXR C;  4U0V A;  1X3W B;  1BI3 A;  2KRF A;  3ZMV A;  3CCV I;  2VBW A;  4L18 B;  3BTL A;  1ZEL A;  5D8L B;  4BH9 A;  4GGG A;  1R22 A;  3CUQ A;  3T8R A;  2ESH A;  2A61 A;  1TWA J;  3K2A A;  2HDW A;  3RCO A;  1SAN A;  3CUO A;  3I3L A;  5DV5 A;  4ZTF A;  2YX7 A;  3UR3 C;  1IAW A;  2QQ8 A;  2EV5 A;  1CF7 B;  2Z5U A;  1SVO A;  1QGP A;  3KZI C;  3O3K A;  2UWM A;  2CW7 A;  3CP2 A;  5LHH A;  5D5W B;  4FCY A;  3U1D A;  3R0J A;  3L00 A;  2LF8 A;  3BT9 A;  4PFP A;  1SFU A;  5F1R A;  2HOT A;  2EFQ A;  1REP C;  1YJN I;  4BUP A;  2MYS A;  3W2V A;  4L0Z B;  1R36 A;  5CVV A;  3I53 A;  4ABZ A;  3L1P A;  1WJD A;  1ODD A;  4CYD A;  4M73 A;  5JVG F;  2W1O A;  3OIP A;  5F08 A;  2GXA A;  2DOA A;  3IWF A;  2GLO A;  4ENN A;  4LB5 A;  2HKX A;  2IJL A;  3DBL B;  2XF5 A;  3CC2 I;  1HQC A;  2J5P A;  4XKC A;  3MWM A;  1I3Q J;  3E6C C;  1O3T A;  4ZH4 F;  2RN7 A;  1Z3Y A;  4WF2 A;  4NB5 A;  3WHB A;  1X19 A;  4EJV A;  3N4M A;  3RZO J;  2Y0S N;  1DQU A;  1QZY A;  2ZC2 A;  2V6C A;  1HKT A;  3TO6 A;  9ANT A;  5LRR A;  5C3E J;  1PYV A;  3OYN A;  4E7H A;  4DYC A;  3CCL I;  5J8F A;  4AM3 A;  2QSG X;  4RB0 A;  3HBL A;  3P9K A;  4AVZ A;  1O3S A;  2K85 A;  1ZG5 A;  2E35 A;  2GBY A;  3CF2 A;  2YX4 A;  4RLQ A;  4BNC A;  2E2J J;  1QNT A;  2CMP A;  5FRN A;  3CJT B;  3LMM A;  2CQN A;  1UG0 A;  4RLF A;  4ZDL A;  3M3Y J;  3FMS A;  1OJL A;  1MMS A;  2NVT J;  5F04 A;  2PJR B;  3RQI A;  2QVO A;  3K69 A;  3FXL A;  4NQW A;  2YU9 J;  2VE8 A;  2XPU A;  4RM2 A;  1QO0 D;  3B02 A;  4CCM A;  1XSX A;  3QPH A;  4XOT A;  4BBR J;  1XSD A;  4BQA A;  3F9K A;  3QOE A;  1JUP A;  4YIF A;  2AO9 A;  3HYI A;  1R23 A;  3FBI B;  2I5U A;  1S7O A;  3M7G A;  4OOI A;  1IRF A;  3U2R A;  2F5E A;  2A5W A;  4BL0 B;  3P9C A;  1VQ9 I;  1JT0 A;  5FKN A;  2HU9 A;  2M34 A;  3JTG A;  1V3F A;  3E97 A;  1U8B A;  1BM9 A;  1JKP C;  2E7W A;  1B8I B;  1B1B A;  3HRM A;  5D8K B;  3MKW B;  2TDX A;  3MQ0 A;  2XAJ A;  1YG2 A;  1N25 A;  5IOY A;  3ABK H;  1O3Q A;  2VQG A;  1Z67 A;  4EJT A;  2FOK A;  3KYD B;  2PX9 A;  2H94 A;  4Y52 J;  5IP7 J;  2GA1 A;  2EFW A;  4A3M J;  2JA6 J;  2LR8 A;  1K78 A;  1HXD A;  3EUH A;  2ZJR F;  2W48 A;  4LFU A;  1YX5 A;  2E60 A;  1RZ4 A;  5EJC A;  4KYW A;  3ELK A;  4CCL A;  2ZFW A;  1ZH5 A;  1MD0 A; 
#chains in the Genus database with same CATH homology
 1JGS A;  4HLY A;  3WTU C;  2XAS A;  1PDN C;  4AD9 A;  2LKP A;  4FT8 A;  5FB2 A;  3I59 B;  3ZN1 A;  4BHC A;  5FFX A;  1ZRE A;  5AIP A;  3V4G A;  4H0E A;  1ZN2 A;  4BHP A;  3CO7 C;  3R6S A;  2M30 A;  2ZO4 A;  3C1D A;  4M6Y A;  2STT A;  1WQ2 A;  4A0X A;  4MTD A;  1F4K A;  1OPC A;  1R58 A;  1C0W A;  3C18 A;  5DYM A;  1XCB A;  1IZ1 A;  2MH2 A;  1WKM A;  5ERI A;  4XSZ F;  2A5Y B;  1TNS A;  3TDU C;  2XGX A;  3ULQ B;  2W84 A;  1I1G A;  1P6R A;  1CF7 A;  1EH8 A;  4Y17 A;  4WXD A;  2JTV A;  4ETS A;  1T6S A;  2D2W A;  3BDD A;  1JHF A;  4UVC A;  2FBH A;  4HDV A;  1ZGA A;  5LEJ A;  1BI0 A;  3RPQ A;  2L4A A;  2PG4 A;  4EGZ A;  2V79 A;  3QPT A;  3L2C A;  1T39 A;  1Y0U A;  3J80 Z;  3F8F A;  5H20 A;  2VC1 A;  1DP7 P;  2P6T A;  3I64 A;  2DU9 A;  1F5T A;  4L5I A;  1W7P D;  2ZCW A;  4PZJ A;  1DDN A;  3EYI A;  4GO1 A;  4O5V A;  1ULY A;  1UFM A;  3QP5 A;  4GXO A;  3I59 A;  4MNU A;  3E3V A;  4KIB A;  3E5U A;  2GXB A;  1S8N A;  3WTX C;  1EH7 A;  4MEY F;  4OIQ F;  2RNJ A;  5IT3 A;  3DP7 A;  5FFZ A;  3E5X A;  2XIG A;  3F6O A;  3GFM A;  2NAZ A;  1IF1 A;  4N9I A;  4ZYE A;  1MKM A;  2EA4 A;  4KIG A;  3M1E A;  4G9Y A;  5E20 A;  5HVQ C;  2EK5 A;  4M9Z A;  4HV5 A;  4EJW A;  3I58 A;  1G3Y A;  4XLP F;  1G6N A;  1NHA A;  3FXU A;  4HX4 A;  2JT1 A;  2CO5 A;  4LJZ F;  5CVI A;  3GX4 X;  4FX0 A;  2Q8K A;  3WGG A;  4N9H A;  1U8R A;  4LGW A;  2M45 A;  3M9A A;  4CXF A;  1QBJ A;  4A6E A;  2D1V A;  2HYF A;  3K1N A;  4KDP A;  1H9T A;  2M8E A;  4BAY A;  3V8J A;  1J5Y A;  5ICC A;  3ZMT A;  5ICF A;  3FWE A;  4G6Q A;  4LK0 F;  5JR3 A;  2V1U A;  2A07 F;  3F6V A;  5HLI A;  3P7N A;  4CGZ A;  3Q9S A;  3HTS B;  2MBF A;  2CFX A;  3TOA A;  2XAG A;  1HSJ A;  3KE2 A;  1YFH A;  3I71 A;  3KCC A;  1ZLK A;  2DTR A;  3RYP A;  3IHU A;  1IN6 A;  2HR3 A;  5HDN A;  1SAX A;  3ZMS A;  2PMH A;  4I7H A;  2O8X A;  4HQE A;  2IRF G;  2ETH A;  2XAF A;  3HRT A;  1PUE E;  1TQP A;  2EFP A;  5DDG A;  3KFW X;  2OZ6 A;  5D6F A;  1HBX G;  3MZH A;  2KIF A;  2J5O A;  2HOE A;  2KJB A;  1OYY A;  3KP5 A;  1RNL A;  4HBL A;  4DQ2 A;  4IHS A;  3CJN A;  2KIM A;  4L5J A;  4EM0 B;  1XGO A;  3DPT A;  2W57 A;  1J9I A;  3RDI A;  3PQJ A;  2HTJ A;  1SFX A;  1STZ A;  3W6K B;  3CUQ B;  4YFK F;  2IA2 A;  1B59 A;  4ON0 A;  2A6H F;  2Y75 A;  1WRJ A;  3I54 A;  2K02 A;  1BJA A;  1T98 A;  4R79 A;  4RAZ A;  1XD7 A;  4A5M A;  4HX7 A;  1ZLJ A;  5D4R A;  3BPV A;  1XGS A;  5CVR A;  4A5N A;  3O6B B;  4HQM A;  5A2Q K;  2EFN A;  4PGH A;  4QWQ A;  3E6D A;  3WE3 A;  1FZP B;  1JE8 A;  3T0Y A;  3HOS A;  2OQG A;  1G3S A;  4TV7 A;  2FMY A;  3KLN A;  1YQA A;  1KYW A;  4PDK A;  2G9W A;  3DFG A;  3ZMD A;  4YFN F;  2YU3 A;  5DCM A;  3TO9 A;  5ILV A;  1U2W A;  5LHI A;  4OIP F;  1Z05 A;  2R7D A;  2FML A;  4WK8 F;  1SFE A;  3MFK A;  2LSO A;  2OAZ A;  3ECH A;  1YTY A;  4IF4 A;  1WSU A;  3FHZ A;  2DPD A;  1B4A A;  4WXC A;  3VB2 A;  5HOO A;  4MHG A;  1J2X A;  1BOA A;  1KQ8 A;  1LDJ A;  2MH9 A;  1IN4 A;  5AON A;  3J81 Z;  1BBY A;  2PQ8 A;  3QRF F;  2W85 A;  2EV6 A;  2EA2 A;  2VOP A;  2P5V A;  3W6J B;  4KMF A;  3BZ6 A;  1KQ9 A;  1BIA A;  3H92 A;  4HA8 A;  1WI9 A;  3EDP A;  2FRH A;  2Z99 A;  3CUQ C;  3R0A A;  1YW8 A;  2BV6 A;  4FX4 A;  2HDC A;  3VOD A;  1W7P B;  1SMT A;  2OU2 A;  3NEU A;  3G3Z A;  5D5U B;  4KT5 C;  1D8J A;  2L01 A;  4IXA A;  3KEO A;  2PMU A;  3SXY A;  1FP2 A;  2CYY A;  3HTU A;  4RGR A;  3K0L A;  4OIR F;  2QWW A;  2Q2E A;  4Y13 A;  1FSE A;  5L3F A;  1W4M A;  2OZU A;  1ON1 A;  1Z6R A;  3CTA A;  3WTZ A;  1FBU A;  2H6B A;  2YSR A;  5L3G A;  3WTV C;  2G7H A;  2MC3 A;  1U6G A;  1YLF A;  1SMY F;  1IN8 A;  2K4B A;  5BQT A;  2HS5 A;  2DAO A;  5K1Y A;  3ZQ7 A;  4EGY A;  1KU3 A;  3HSE A;  4HDU A;  3ABU A;  2XUB A;  4UV9 A;  1R1T A;  1KU9 A;  1WWX A;  4KN7 X;  2VC0 A;  2HQN A;  3BOQ A;  5JFR A;  4I0B A;  3ERE D;  1XGN A;  4L0Y B;  3ABT A;  1XDS A;  2ZKZ A;  3HSR A;  2HKO A;  3MZY A;  1TW2 A;  4CDG A;  5JI6 A;  1KU2 A;  2MLG A;  1UHW A;  2F5D A;  2NS0 A;  2ISY A;  1SD5 A;  3IC7 A;  4HOB A;  4ZYH A;  5FLX K;  2QEN A;  5A2Q Z;  3ZMZ A;  2FF4 A;  1OKR A;  2EB7 A;  3F21 A;  3JSO A;  2Y48 A;  3NRV A;  4M9S A;  2X4H A;  1AWC A;  3VEP A;  3ML6 A;  2HEO A;  1BIB A;  4KUM A;  4AIK A;  4Q48 A;  2IT0 A;  2RV8 A;  5AIQ A;  4N0B A;  5F6F A;  3F23 A;  3EQL F;  3WGI A;  3LA3 A;  1F1Z A;  3CO6 C;  4A2U A;  2JPC A;  5BMZ A;  4LG0 B;  2YPR A;  3GVA A;  5ICG A;  1W5S A;  1Z6T A;  2WC2 A;  1LJ9 A;  2VOO A;  4Q47 A;  2DQL A;  2RVC A;  5ILU A;  1KA8 A;  4G7H F;  1MDM B;  4LG0 A;  1LQ1 A;  2P7C B;  3KP6 A;  2VT3 A;  3ZN0 A;  3K1M A;  2FXA A;  2P5L C;  3RI4 A;  2DK5 A;  1E17 A;  2D45 A;  4A12 A;  4FHT A;  3KP3 A;  3D0S A;  1R1V A;  5KVR A;  5TJJ A;  2OQR A;  2PEX A;  1U5T C;  1LDK B;  1P92 A;  2A68 F;  2QBY B;  1S3J A;  1RUO A;  1KQ0 A;  3WE2 A;  2CQK A;  4OU0 A;  3SHF A;  2XAH A;  1AOY A;  5LGT A;  3I5U A;  2WTE A;  1BN5 A;  1OR7 A;  3GLX A;  3BP8 A;  4I02 A;  3BJA A;  3RKY A;  3L9F A;  2STW A;  3K9T A;  5D4S A;  5DCF A;  4P55 A;  3JTH A;  2DW4 A;  1FWZ A;  5JHU A;  2VBY A;  1TQM A;  1FYK A;  4YII A;  4OMZ A;  3V8K A;  2L54 A;  1D8K A;  1JXS A;  2XRO A;  3KP2 A;  2FBI A;  1TW3 A;  4A6D A;  1KGS A;  4WXH A;  1FY7 A;  3OOP A;  2BYV E;  3ZPL A;  2NNY A;  2ZME A;  4HF2 A;  4O6J A;  1YS7 A;  2F2E A;  3F8N A;  2IA1 A;  4R8H A;  1GXQ A;  3KEQ A;  1LEB A;  1BC7 C;  4E70 A;  2MLK A;  4G7O F;  1OYI A;  5CVU A;  1FNN A;  2ISZ A;  2V9V A;  3BJ6 A;  3L7W A;  4DNC A;  2P8T A;  1YW9 A;  1ZHF A;  3LAJ A;  1P4A A;  2HGC A;  5K5R A;  2VBZ A;  2EJR A;  3REO A;  3KP7 A;  2IP2 A;  2NRA C;  1OYW A;  1RI7 A;  4L9T A;  4RGX A;  3FXQ A;  5D5V B;  4IJA A;  3DF8 A;  5LGU A;  1S29 A;  4EM2 A;  2FU4 A;  2HFH A;  1GHC A;  3O2P E;  4U7D A;  2VN2 A;  2A3S A;  4HAM A;  4M71 A;  1ZG1 A;  5LHG A;  4KIC A;  4AWX B;  3WTT C;  3H3Z A;  1FYM A;  4HV6 A;  1DUX C;  2IW5 A;  2M1B A;  4AIJ A;  3SZP A;  4ZYG A;  5KK1 A;  2HYG D;  3I0T A;  5E1Z B;  3JAM Z;  2QLZ A;  5ED4 A;  3WTW C;  3Q5F A;  2FNP A;  2M87 A;  2MA3 A;  1Z91 A;  4XSX F;  2VBX A;  2JPB A;  1Z7U A;  1P4X A;  5FD5 A;  2EV0 A;  2QBY A;  3DPL C;  3MCZ A;  1HKS A;  4HX8 A;  4IPA A;  5E18 F;  4ASN A;  2FBK A;  4Q5S F;  2DPU A;  2VOD A;  2H09 A;  1R7J A;  4BXU A;  3LAP A;  2Y0M A;  2L3D A;  5LLQ A;  1SD4 A;  2G7U A;  4ENJ A;  3HRU A;  3RKX A;  4RS8 A;  1MJ9 A;  1O7L A;  3E6M A;  3RPU A;  3FXR A;  4JK1 X;  4CZZ A;  1I5Z A;  5K5Q A;  4CIC A;  3FM3 A;  1G3W A;  2LF7 A;  1T0F A;  1LB2 A;  4KNY A;  2FE3 A;  1FP1 D;  3DXJ F;  1R00 A;  5LGN A;  3QOP A;  2MD5 A;  5FO5 A;  2E1N A;  1DPU A;  2FQ3 A;  4OMY A;  1ZRC A;  4HYE A;  2H6C A;  1U3E M;  1YIO A;  4G94 A;  3GF2 A;  2ZNZ A;  4WCG A;  5EEG A;  3GFI A;  3NQO A;  1J59 A;  4G6D A;  5ILS A;  1T2K A;  2QQB A;  1HKQ A;  5TRD A;  3GW2 A;  3PQK A;  3RKW A;  1QQI A;  5J6X A;  4A0Y A;  4LLG F;  5J8C A;  2ZJ2 A;  2X0L A;  3WTS C;  2UXN A;  5HDK A;  1IW7 F;  4IRI A;  1R1U A;  1IUY A;  3DEU A;  4CHU A;  3S2W A;  3TOB A;  2JSC A;  5FGM A;  2XVC A;  4I0A A;  3KLO A;  3K2Z A;  3BPX A;  5HDG A;  1IXC A;  1B6A A;  4L9J A;  1SD7 A;  3BJO A;  4GCV A;  2JRT A;  3RIR A;  4CO8 A;  2DBB A;  1ZAO A;  1U5T B;  4EVI A;  2V1D A;  4EV0 A;  4I01 A;  3F3X A;  4RGS A;  2DK8 A;  3T8T A;  3C3W A;  3GO5 A;  3HUG A;  1MJA A;  2ADU A;  2HTS A;  4JQF A;  4XRF A;  4GYG A;  2VXZ A;  2O61 A;  4ESJ A;  4ZZL A;  1L0O C;  2P4W A;  3KZY A;  1PP7 U;  5DEQ A;  2BEO A;  2PN6 A;  4RB1 A;  2XKP A;  5BPI A;  3TKY A;  2GQQ A;  2IVM A;  2FNA A;  4HF0 A;  2E7X A;  3GZ5 A;  3G73 A;  3V7S A;  1I6X A;  3JAM K;  3SFZ A;  2KJC A;  4BHB A;  3H3U A;  3GUD A;  4L9V A;  2NYX A;  4F7Z A;  3D5L A;  2CWE A;  3C7J A;  4XLN F;  2Z3Y A;  1MGT A;  4LLL A;  4GYI A;  1T38 A;  2NNN A;  5E8I A;  4K2E A;  1MDM A;  4WX9 A;  4P9U A;  3KP4 A;  1HST A;  5HLH A;  5H6R A;  4EMS A;  1SD6 A;  4EJU A;  3T5X A;  1ONV A;  1FX7 A;  2VON A;  4UXN A;  2GAU A;  3WTY C;  2HZT A;  1EV7 A;  3OV8 A;  4KA4 A;  3GYH X;  2PLY A;  4ENM A;  1TQI A;  4ZYD A;  4U0W A;  2A6E F;  5LEK A;  3HSF A;  4M9X A;  4JBA A;  2E1C A;  5E1W A;  5IT9 K;  2H27 A;  1UST A;  1FBS A;  1FOK A;  4I98 B;  4ENK A;  2L4M A;  1K78 B;  3IL2 A;  3QAH A;  3HOT A;  1D5V A;  3IKV A;  3DV8 A;  2BGC A;  4L9N A;  3QU3 A;  2ACJ A;  1B9M A;  3DQV C;  1JHH A;  3P9I A;  5E17 F;  1H0M A;  4AIH A;  4I2O A;  2Z33 A;  1XGM A;  1S6L A;  4HW0 A;  3WU1 B;  4P9F A;  1A04 A;  2QUF A;  3CDH A;  2F5F A;  2IA0 A;  4EM1 A;  3FX3 A;  1EH6 A;  4A0Z A;  3LA7 A;  5L3B A;  3V8L A;  1XN7 A;  3PFI A;  3FM5 A;  4B8X A;  2LDU A;  1TBX A;  1GVJ A;  3JW4 A;  2ZME B;  4O3M A;  5F64 A;  1BI2 A;  1RUN A;  1E2X A;  3B73 A;  3ECO A;  3J81 K;  4OIO F;  2DFI A;  4S05 A;  4NHJ A;  2KIU A;  2RC4 A;  2R7F A;  3LST A;  2XHK A;  2PI0 A;  4PCQ A;  4I09 A;  3F8B A;  4M72 A;  2P5K A;  2W25 A;  4KN4 X;  3IRR A;  1LNW A;  3RTR A;  2HWV A;  2W24 A;  2JZY A;  4MTE A;  4IRH A;  1L3L A;  3KET A;  3DKW A;  1XDU A;  1YW7 A;  3Q9V A;  1IN5 A;  4D0P A;  4HZF A;  4WWC A;  2UXX A;  1TNT A;  2FA5 A;  1YYV A;  3GXO A;  1Q1H A;  5EEH A;  3SZT A;  3L09 A;  3MEX A;  1I1S A;  3IKT A;  5E1X A;  1F9N A;  2EFO A;  3RJP A;  3FF5 A;  5CVJ A;  1OMI A;  3T1B A;  4U7B A;  3LQQ A;  4HLX A;  1ZYR F;  3CLO A;  2COM A;  4AVP A;  3SQN A;  1QZZ A;  1P4W A;  3GFJ A;  1UB9 A;  1V4R A;  2O6G E;  1FLI A;  5DCM B;  1UHM A;  1S7A A;  2BE5 F;  2QYO A;  4ZZD A;  1IRG A;  2K7L A;  2HQR A;  4IVN A;  3N97 A;  2YR2 A;  2O03 A;  2RQP A;  1K79 A;  3F8M A;  2KKO A;  4LD5 A;  3QU6 A;  1J7K A;  5JVT A;  2EWN A;  5CJ9 A;  2M5W A;  4MQ9 F;  1K7A A;  4LK1 F;  3COA C;  3F8C A;  2D1H A;  3EYY A;  2CG4 A;  4B09 A;  3TO7 A;  1G3T A;  3TQN A;  2VT2 A;  4KFC A;  1IXS B;  3ROU A;  2GIV A;  1RIO H;  3I4P A;  1XSV A;  3WG9 A;  2K27 A;  1B9N A;  2AXL A;  3JSP A;  2ZXJ A;  2CGP A;  3GZ6 A;  1USS A;  3EET A;  2B0L A;  4UVA A;  4OIN F;  3U9G A;  3E6B A;  3HIF A;  3FMQ A;  2ESN A;  1GXP A;  2VE9 A;  2F5C A;  5L3C A;  4MEX F;  2O0Y A;  1MZB A;  2WWY A;  2FSW A;  3ZMU A;  4RB2 C;  2DT5 A;  1XB4 A;  2CSO A;  2Z9O A;  4ESB A;  2C6Y A;  5K5O A;  3AAF A;  2XKO A;  1D3Y A;  5BOX A;  1W7P A;  3VOE A;  3IWZ A;  1FC3 A;  3BRO A;  2PFB A;  4Y15 A;  1XCV A;  4QLC U;  2RKH A;  4R1H A;  3K1P A;  3R60 A;  5FLX Z;  4IRG A;  1FT9 A;  2GWR A;  5ICE A;  5IT9 Z;  2P7V B;  4P5O A;  6PAX A;  2BBY A;  1HW1 A;  5CLS A;  2ZNY A;  4P96 A;  2QM3 A;  1W5T A;  3HRS A;  1R5G A;  1P2F A;  4LMY A;  2WV0 A;  1K6O A;  2XRN A;  3TGN A;  4IHT A;  2XAQ A;  1HW2 A;  4KMU X;  1BC8 C;  1PP8 F;  1KYZ A;  3FMR A;  2DLL A;  1ZAR A;  3M8E A;  4PGG A;  1O57 A;  1Z1D A;  5HS8 A;  1O3R A;  5L3D A;  1MJB A;  5E8G A;  4U88 A;  1J75 A;  1LEA A;  3LQR A;  3R4K A;  1U5T A;  5DUK A;  5H6Q A;  2ELH A;  4EJO A;  4HF1 A;  4UNO A;  3GEZ A;  3MAJ A;  4KIF A;  3E5Q A;  2V1X A;  3HHH A;  5DD8 A;  1LDD A;  5L3E A;  3FZV A;  5BS6 A;  4Z2Y A;  5CYV A;  1QPM A;  3J80 K;  2K4J A;  4XBF A;  2RDP A;  1U78 A;  4UV8 A;  1Z9C A;  3V7C A;  3ISP A;  3IRQ A;  2QQA A;  2GA2 A;  1FBQ A;  2RGV A;  1IN7 A;  3VFZ A;  5D6E A;  2IPQ X;  3WGH A;  2UZK A;  2ZBK A;  4RB3 C;  4G8X A;  1TTY A;  1LVA A;  1J0R A;  1VTN C;  2OA4 A;  1ZRD A;  4MGR A;  5HS7 A;  1FSH A;  2QQ9 A;  2CW0 F;  1H9G A;  1FPQ A;  2GZW A;  3LFK A;  4UHT A;  4M74 A;  2QZ8 A;  3V7R A;  2PJP A;  3WOD F;  3R61 A;  1ON2 A;  3F22 A;  3J7A O;  1XMK A;  2DO7 A;  3RYR A;  5BPD A;  4U0Y A;  5D5X B;  2LNB A;  4G7Z F;  3M8F A;  1CGP A;  3GFL A;  4ESF A;  1X3U A;  2DQR A;  3HHG A;  1FYL A;  1ZRF A;  2PBI A;  3GWZ A;  4YG2 F;  3ZP5 A;  4EQQ A;  1XMA A;  1O7F A;  4UUV A;  5DUI A;  1HW5 A;  1I27 A;  4YFX F;  3TDZ C;  3QP6 A;  1UCR A;  1BI1 A;  2XV4 S;  2L02 A;  3KZZ A;  2Q0O A;  5LRS A;  1DPR A;  2OD5 A;  3BWG A;  2GXG A;  1ZG3 A;  5LBQ A;  2DI3 A;  3LWF A;  4Q4Z F;  1TLH B;  5HS9 A;  1YS6 A;  4MQV A;  4RGU A;  4BYY A;  1YO5 C;  5FD6 A;  2FEZ A;  2R3S A;  4S04 A;  4RAY A;  2AS5 F;  2A69 F;  1ZGJ A;  2P6S A;  3LA2 A;  4M6X A;  5HLG A;  4LLN A;  2OBP A;  1R5H A;  4UVB A;  3BY6 A;  2K86 A;  2O3F A;  4LB6 B;  3WU0 A;  1KU7 A;  3F72 A;  5DD4 A;  1G4D A;  1IXR C;  4U0V A;  1BI3 A;  2KRF A;  3ZMV A;  2VBW A;  4L18 B;  5D8L B;  4BH9 A;  4GGG A;  1R22 A;  3CUQ A;  3T8R A;  2ESH A;  2A61 A;  3CUO A;  5DV5 A;  2YX7 A;  1IAW A;  2EV5 A;  1CF7 B;  2Z5U A;  1QGP A;  3O3K A;  2UWM A;  5LHH A;  5D5W B;  3U1D A;  3R0J A;  3L00 A;  2LF8 A;  1SFU A;  5F1R A;  2EFQ A;  1REP C;  4L0Z B;  1R36 A;  5CVV A;  3I53 A;  1ODD A;  4CYD A;  4M73 A;  3IWF A;  4LB5 A;  4ENN A;  2HKX A;  2IJL A;  1HQC A;  2J5P A;  3MWM A;  3E6C C;  1O3T A;  4ZH4 F;  2RN7 A;  4WF2 A;  4NB5 A;  4EJV A;  3N4M A;  1QZY A;  1HKT A;  2V6C A;  3TO6 A;  5LRR A;  5J8F A;  4RB0 A;  1O3S A;  3P9K A;  1ZG5 A;  2YX4 A;  4BNC A;  1QNT A;  3FMS A;  2QVO A;  3K69 A;  4NQW A;  2VE8 A;  1QO0 D;  3B02 A;  1XSX A;  3QPH A;  1XSD A;  4BQA A;  4YIF A;  3HYI A;  1R23 A;  1S7O A;  3M7G A;  4OOI A;  1IRF A;  3U2R A;  2F5E A;  3P9C A;  3JTG A;  1V3F A;  3E97 A;  1BM9 A;  2E7W A;  1B1B A;  3HRM A;  5D8K B;  2TDX A;  3MQ0 A;  2XAJ A;  1YG2 A;  1O3Q A;  4EJT A;  2FOK A;  2H94 A;  2EFW A;  2GA1 A;  1K78 A;  1HXD A;  3EUH A;  4LFU A;  1RZ4 A;  4KYW A;  3ELK A;  2ZFW A;  1ZH5 A;  1MD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...