3F7ZA

X-ray co-crystal structure of glycogen synthase kinase 3beta in complex with an inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
350
structure length
339
Chain Sequence
LSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogen synthase kinase-3 beta
publication title Design, synthesis and structure-activity relationships of 1,3,4-oxadiazole derivatives as novel inhibitors of glycogen synthase kinase-3beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 339
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3f7zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3f7zA01
5LVNA 4CFUA 4EH4A 2E9OA 4O38A 1WBVA 2DWBA 2PMNX 3CE3A 3R2BA 4FKPA 4J98A 1JLUE 2J7TA 4G34A 3NVKI 3MGYA 4O27B 3V8TA 1BUHA 3A8XA 3P86A 5AV1A 4ARKA 4RMZA 5AFVA 3B2TA 3LFAA 2WIPA 3KRWA 5AIKA 5L8JA 4A9RA 4MCVA 2QODA 2YLFA 2ZJWA 1O6KA 5AX3A 1OI9A 2YDIA 2BVAA 4FKOA 3FKOA 2F2UA 4E7WA 1YXTA 2OO8X 1ZWSA 2VNYA 4Y73A 2R3OA 4EH9A 2VO3A 4UMTA 3LW0A 2RF9A 4IM0A 5E9EA 3C7QA 4JAIA 5BVWA 3VRYA 3W1FA 4AGWA 1EH4A 1ERKA 4AZVA 2VTLA 4G3EA 2BFYA 3PJCA 3KXMA 2V7AA 5FBOA 3TNPC 3CKXA 4BY9E 4NFMA 4BDFA 5L2WA 4UV0A 3WIKA 3FXZA 5L8LA 2R5TA 1H0WA 1XQZA 3QQGA 4FKVA 4TYGA 4CFXA 4D28A 4XBRA 1OKWA 3RCDA 3ZO4A 4R78A 3UP7A 1KUTA 4QMOA 3DAKA 4FKWA 4IC7A 1SVHA 4LQMA 5L6WL 5IEVA 5JFWA 2BR1A 1UA2A 4IHPA 1Y8GA 2YM6A 5E8UA 4MKCA 5G1XA 3UO4A 2PVFA 4ZTHA 3ZRLA 4EOKA 4PMPA 4OTGA 4L00A 4JQ8A 4FZ6A 4NCTC 3B2WA 1FVVA 2R3GA 4DF3A 2GPHA 3PE1A 3NUNA 3ORMA 3ALNA 4WOVA 3C4EA 4C62A 4CCUA 3EQRA 3OUNB 3RAHA 3V5LA 4ANBA 4G2FA 3JYAA 4AE9A 4IW0A 1S9IA 4MBIA 1A06A 3R73A 3KMUA 4FSMA 5IQHA 4M68A 2UUEA 2BDJA 3F3WA 3LCSA 3LCOA 4PNKA 3KRRA 2PMLX 4BB4A 2A0CX 4AA4A 1GIIA 2XM8A 2IZTA 3EFJA 3KN6A 4I0SA 3UVRA 5H3QA 4JDJA 3TACA 3MI9A 5EDQA 3HL7A 1AGWA 4HJOA 4HZSA 3TZ9A 3C4ZA 3ORLA 1BX6A 5I9YA 4D9UA 4A9TA 4HYHA 3U87A 3AD4A 3JXWA 5M44A 2VX3A 3CD3A 2ZM1A 1FMOE 4J8NA 1QPDA 4DGOA 1XH9A 3MN3A 3GU6A 1OPJA 3I79A 4XLVA 4YLLA 2WOTA 3LM0A 3MFTA 4L67A 5AJQA 1FMKA 5D41A 3O17A 5C9CA 3VS3A 2VRXA 2JDSA 2WTWA 4IDVA 5KZIA 2Y4PA 1SVEA 2ITPA 3NRMA 4F0GA 2W17A 3NUSA 4IVDA 3Q9XA 4U7ZA 1FGKA 2X81A 4ENXA 4PTEA 5HVKA 3RGFA 2W1FA 2J6MA 4YZMA 2YM5A 4X21A 5K3YA 5J9YA 4QTDA 2YM7A 2WAJA 4Y72A 3Q4TA 5AV2A 4K6ZA 2HELA 3R1YA 3A7FA 4PMMA 4BKJA 3TEIA 4D4SA 2WTIA 2GNGA 3W32A 4ZSAA 3IPHA 3Q32A 3DNDA 3CY2A 1FPUA 2H6DA 5JGAA 1J7LA 2I0YA 3Q60A 4UZDA 4CYJA 2EXEA 3WIGA 1URWA 4HVHA 3RALA 3P4KA 2OIBA 3QUEA 3UG2A 3WZKA 4I5MA 5HO7A 4EH3A 3GOKA 4E8AA 2Q0BA 3MH1A 5K9IA 4U8ZA 4J96A 1J91A 3LFDA 5HVYA 3RPRA 5HORA 5BUJA 5EYMA 4IB0A 2QLUA 4QMLA 3L9PA 1YI6A 5CEMA 3FUPA 4QO9A 4Y83A 4ZIMA 5LVPA 1KWPA 4E3CA 3EQFA 3UO5A 5GZ8A 5CZHA 5AP6A 4FTCA 1OKYA 4XRJA 4P5QA 4O81A 2XA4A 4UZHA 4DH5A 3UVQA 3TNWA 5J79A 3D2KA 4OLIA 2VTSA 3UOKA 4CSVA 4FTMA 3S1HA 4FODA 4QQ5A 4W8EA 4YJOA 5FWKK 3ZO1A 2REIA 3I5ZA 3ZFMA 1PXIA 1SYKA 3AG9A 4FKLA 3FMLA 1DI9A 3R7IA 3R8PA 4F1TA 5A9UA 5HE0A 4BBEA 1OGUA 5C4KA 4ZS0A 2ETKA 5AADA 1ZXEA 4G3FA 3NNVA 1PJKA 5C1QB 5ICPA 3IW5A 1ZRZA 2XNOA 3KA0A 1HCLA 5IU2A 5M4UA 1MRVA 2XJ1A 1BYGA 5LMKA 4ZLZA 3IDBA 2HZ0A 3TN8A 4NM5A 3VUTA 4OTWA 3QQUA 4V04A 3H9FA 2JIIA 4ZY6A 5CWZA 2EVAA 4EKKA 4ZTNA 3G6GA 4GK4A 4NYEA 3DFAA 4QYEA 4R3RA 1ZYJA 3E3PA 3QTSA 3K5UA 4MX9A 1APME 4EOIA 2IZSA 1PMEA 5LOHA 4JVGA 3TKIA 4AP7A 2XNGA 3D0EA 1U5QA 4IADA 5IDNA 4GT5A 2WQBA 4FIGA 3QAME 1J7UA 2NP8A 3A7GA 3GB2A 4P7EA 2IW8A 4WA9A 1PF8A 3BHTA 2WOUA 3UQGA 3ZXTA 5HHWA 4AGCA 5A54A 3FDNA 3LXNA 4FYNA 4LUDA 2CHLA 4U79A 2QQ7A 3QTXA 4W4YA 3MVMA 5E1SA 3E8CA 4C38A 4FBXA 5KMMA 3ID6C 2WELA 2Y0AA 3FI2A 4UMRA 3GFEA 2BRHA 3BYSA 5EM7A 2FGIA 3EWHA 5AP5A 2VTRA 4J1RA 3TKUA 3MYGA 5AP7A 2X9FA 5IKWA 2AYPA 4ID7A 1TQIA 4FV3A 4MK0A 2WMBA 3V6RA 3W8QA 4DLJA 5AEPA 3MBLA 3D5UA 2QOOA 3TWJA 4AA5A 2VUWA 3AC8A 5JRSA 5AUYA 4BCMA 3FBVA 5EM6A 2C0TA 4YTCA 2EXMA 2FSMX 3A4PA 3UOLA 5L6OA 1NY3A 2HW7A 3GU4A 2P0CA 2XCKA 3BELA 4FSUA 4I6QA 4EZ5A 2ITTA 4AN9A 4UXQA 4C59A 4C4HA 1Q8WA 1WVXA 4BIEA 4AFJA 4ASDA 4X3JA 4LOOA 3BPRA 4EH5A 1YXXA 3FLWA 2CNUA 4ACDA 3IGOA 5IF1A 1ZYLA 1RDQE 1XHAA 3OW3A 4FG9A 4L3LA 5AIRA 4S31A 5KCVA 3DXQA 2GS2A 4RIYA 3ZYAA 1H08A 2CKQA 4Y5QA 3PSBA 3OS3A 3PY1A 4XCUA 3NUUA 3Q5IA 3NYOA 3LFSA 3U4UA 3DB8A 3W8LA 4D1SA 5FTQA 2W0JA 3U55A 3II5A 3NIZA 3O51A 1HCKA 4QP7A 3ORTA 3KMMA 3PIXA 4HCTA 3HRFA 5FLFA 4M67A 3DBQA 2W06A 5KKRB 4TWNA 5FTOA 2PZYA 4HOKA 3PPJA 4ASXA 4C4IA 5JN2A 4D2VA 4X2GA 4YC8A 5DT3A 2HXLA 3FQEA 4HCVA 4AW1A 1OUYA 2X9EA 3ZO2A 2XBAA 4IAZA 4O7SA 4QMUA 3FQSA 3FYKX 3FXXA 3DJ6A 4HZRA 5HICA 4AA0A 3ORNA 3RAIA 3CBLA 4RA5A 1TQPA 2LGCA 3VQUA 3W16A 2VX1A 3ITZA 4GT4A 1GZ8A 3BGZA 3RPSA 4TXCA 3V5JA 5A6NA 2DYLA 3HMPA 1Z57A 2G1TA 3D9VA 3KGAA 3LFFA 3QZGA 5EW9A 4OTHA 3QTZA 2C3LA 3DKGA 4OTIA 3ET7A 4M3QA 5CF5A 1BLXA 4V0GA 3UQFA 5BYZA 4A4XA 5HU9A 3I1AA 2VZ6A 4EUUA 4FTRA 4IB5A 4L7FA 4RJ5A 2IZRA 3GNIB 5FP6A 3FI3A 2XK6A 4EQCA 5HX8A 4UALA 4LG4A 5LVOA 1YI4A 3KB7A 3QRJA 4MWIA 4RX7A 3NAXA 4TN6A 4XMOA 5I5ZA 5KMLA 4HGSA 1JSUA 1WBNA 3TIYA 3SG8A 5EQEA 1OIUA 3G90X 1JSVA 1ATPE 4ZLOA 3FHRA 3OBGA 4YJSA 5E8VA 4ACMA 4E73A 2FH9A 4K77A 2WMAA 2XJ2A 3DGKA 1QMZA 2C3IB 4AXAA 4D5HA 5FUTA 2I40A 2WZJA 1B6CB 2VV9A 4S2ZA 4ZSLA 3F3UA 3LCTA 4UBAA 4UWCA 2OF2A 5HO8A 4BCIA 4NM7A 1XKKA 2X7FA 3BGQA 3DFCB 1XO2B 2VTMA 3BBTB 4X2NA 3ZUTA 4FEWA 2OK1A 4PDYA 3MY1A 2H34A 3S3IA 5J1VA 4IZAA 4JBQA 5HCYA 4IWOA 3RK5A 4F1OA 2CCIA 4L68A 2J0LA 4OAVB 2OGVA 4IQ6A 3QRKA 3Q04A 4NM3A 2CJMA 3HLLA 4QP6A 4F70A 4LGDA 1BL6A 5LVMA 3LE6A 2I7QA 4GFGA 4E6AA 5AV0A 1OL7A 3IOPA 4MBLA 4OAUC 4MXXA 2A2AA 3SXSA 2XK9A 1CTPE 3FL5A 4FICA 5CU3A 3JY9A 2ZV2A 4PY1A 4F9YA 5BVEA 4GIHA 5LWNA 3R8ZA 4C33A 3MH0A 3MDYA 3GP0A 4BBFA 4O22A 4XH6A 3BLQA 5IQCA 4KKEA 3OY1A 3PXRA 2CCHA 2CMWA 5T68A 5C01A 2X4FA 2ZM3A 1LUFA 3EB0A 4NZWB 2ERZE 2EB3A 2OJGA 3EH9A 5CZIA 2YDJA 4K11A 3BRBA 2XJ0A 2VO0A 5DPVA 5I3OA 4P5ZA 3C51A 4U5JA 2WQNA 4KKHA 3VUMA 3FYJX 4DEIA 5M51A 1YQJA 2QG5A 5CT7A 4IVAA 3WYYA 3R7OA 5CU0A 4R1YA 4TRLA 4AS0A 3N4UA 4DA5A 3HV3A 5DWRA 4FKRA 3I5NA 5CI6A 4C0TA 2R7IA 3V8SA 4G6NA 2VTAA 2XIKA 1M2RA 2YIQA 2BCJA 1WBOA 3ZDUA 3VWAA 4HW7A 5LJJA 2EB2A 3GI3A 3Q2MA 4J95A 3RTPA 1Q8UA 4N70A 4EH6A 4CYIA 3R28A 4ENYA 2R3NA 3KCKA 3OZ6A 4TYHA 2BRGA 4DCEA 4JT3A 2F2CB 2V0DA 2W1EA 4FSNA 4KSPA 2PZPA 3QCQA 4O0TA 4RJ7A 5I9UA 1KE5A 4O7WA 4MF1A 4EOSA 3EQDA 2PVYA 3VHKA 4XG9A 2C5OA 4G5PA 3IW8A 3GC9A 5KHWA 2ETMA 1XH4A 2QO9A 2WTKC 3PZEA 5JZNA 4DAWA 3GBZA 2B52A 3BLHA 1ZYDA 3LIJA 4AT5A 2I0VA 1O9UA 4NJ3A 4APCA 4ANSA 2E9UA 4B9DA 2VGOA 4E5AX 1OECA 2P4IA 2W1CA 2JC6A 1RJBA 2RFDA 3FMEA 2JDVA 3N9XA 2BAQA 2Y7JA 4RG0A 3SW7A 3VNTA 3BYUA 4FG8A 2CGUA 3AC2A 2PUNA 2HWPA 4EH8A 5CVHA 3ZU7A 4EOQA 3TV7A 4G31A 4RLLA 3H9RA 4AOTA 4XV9A 1NW1A 2GQRA 5AUXA 3LMHA 4EOPA 2UW7A 4R77A 3ZEPA 1Q8TA 3MVLA 3ZLSA 3OOMA 3NUPA 2C30A 4KIKA 3E5AA 3HAVA 4B7TA 5DT0A 3LCDA 3POOA 3FMKA 3Q3BA 2UW0A 3E62A 5EI8A 2PUUA 2XK8A 1OL1A 3CD8A 4U44A 5E4HA 4CV9A 2VO7A 1MUOA 4QPSA 5EW8A 4ZEGA 2WQMA 3TTIA 4ALUA 5HBJA 2YDKA 3KXNA 4I1ZA 2ITVA 2VTTA 4XS2A 4HCUA 5AM7A 2WU7A 4QTAA 5FRIA 5H2UA 3FJQE 4RWIA 2RSVA 4EK3A 4XG7A 1MP8A 2UVZA 3F66A 1U46A 4FZDB 4WNOA 5H8EA 3LLAA 2XNMA 4TYJA 3HV4A 4QD6A 2HK5A 2H96A 2Z7LA 4WHZA 4BGQA 1ZY5A 4DITA 5FTGA 3EN9A 4IC8A 1JAMA 4D4YA 1PYXA 1KOAA 3FXWA 3VW6A 4E26A 4ALWA 3IOKA 3GT8A 4WUAA 2HWOA 4PDOA 4C4EA 3CQEA 4IZ5A 4QMQA 2G2HA 3ZM4A 3SG9A 1WBTA 1U54B 2B9FA 3NAYA 2ITUA 4FV9A 1YHSA 2HCKA 1P4FA 3EKKA 2IG7A 3O71A 2PMIA 4FSZA 3W10A 4DG0E 3MB6A 4GW8A 3DLSA 5IA2A 5IH6A 2GCDA 3QC9A 4XG8A 2Z7RA 1GIHA 4NW6A 4YPSA 1JPAA 4U43A 1VYZA 2BDWA 4Z55A 1PMNA 4JR7A 4FVQA 5IA4A 3PVGA 4FF8A 1YOLA 2NRUA 5GJDA 5HLPA 5HCXA 4XG2A 3KXGA 4XEYA 4JXFA 3P79A 3WI6A 3E92A 5HTBA 1O6LA 3G9NA 3QRTA 4O2ZA 4I0TA 4FT3A 4BTFA 4KNBA 1M52A 4G1WA 1M7NA 4RRVA 2JFLA 4MH7A 3NZ0A 4WNMA 2WFYA 3QA0A 5DHJA 3FPMA 4GFMA 4O84A 1I44A 5FGKA 4D2TA 2VTNA 2UW4A 5CAVA 2ZV8A 4F0FA 5I9XA 5J7BA 5M4FA 3FV8A 4RVTA 5ANDA 4QP2A 2QNJA 4YBKA 2G2FA 4WT6A 4ZAUA 3IG7A 4FL2A 1X8BA 3QZIA 3ZCLA 3MY5A 2X8IA 5HG7A 4L7SA 4OW8A 5IQAA 3ERKA 1DAYA 3OWPA 3DDQA 4G17A 5ITAA 3BKBA 4ANOA 4IB1A 3AGMA 4I6FA 2Y8OA 4IAKA 4BBMA 4RSSA 1OL2A 2G9XA 3KN5A 4A06A 1SZMA 2W1ZA 4BYIA 3TXOA 4YHFA 2ONLC 4H1JA 1Y6BA 5L2QA 4H3PA 4YHJA 4EORA 3JY0A 1SM2A 3HMOA 1UU7A 5CASA 1YOJA 4H1MA 2Z60A 4AW5A 2IPXA 2WTKB 4U6RA 2QONA 4Y46A 4O91A 2QHNA 5IA5A 4O2PA 2BPMA 3AD6A 3BWJA 3DZOA 1H8FA 5CSPA 4FI1A 1W7HA 2OG8A 3R1NA 3HGKA 3QWJA 4KKGA 4YLJA 3KVWA 5TT7A 4EEVA 4S30A 4FL3A 2GS7A 4CZUA 2I0EA 4G6LA 4GK3A 3LMGA 4R1VA 1H26A 4CGAA 5K5NA 4U9AA 5CXHA 1AQ1A 1P2AA 1Q99A 2QKWB 3M1SA 2C5NA 1K2PA 4M97A 2VWYA 3B8QA 3L8XA 4QMVA 5HG8A 2B4SB 2BILB 4ZJIA 4ZZNA 5A3XA 3P7AA 5J5SA 3OEFX 4FTOA 5DMZA 3QX4A 1IASA 3NMUF 5EH0A 3WF5A 2QHMA 3PFQA 4K0YA 4L8MA 4QQJA 5AX9A 4F09A 2W5BA 2OW3A 2G2IA 1ZMUA 3DBFA 3F5PA 4D4RA 3HV5A 4NK9A 4E4NA 2BIYA 5TOZA 2F7ZE 3MPMA 1WVWA 2IJMA 2BROA 3F6XA 5EKOA 5AR7A 3HA8A 3HV7A 2XK7A 4XUFA 3UVPA 2R3IA 2YM4A 3ZM9A 1W83A 3QBNA 4MNEB 3IECA 2KULA 5HD7A 3QTWA 4BDKA 3HYHA 4QMMA 2PZ5A 2GTNA 2XF0A 3COHA 1REJA 1UWHA 1Q41A 1SMHA 3LFBA 3ORXA 2PE1A 4O0WA 4TNDA 4XHKB 4D0XA 3EIDA 3JVSA 3CR0A 1CKPA 3UMWA 1IRKA 3EZRA 1H28A 4YZNA 2UVXA 3TNQB 4ZJVA 4NM0A 5J7HA 1V0BA 3ZFXA 5LVLA 3PPZA 3PWYA 1U5RA 4O7YA 3JVRA 2OF4A 3KC3A 1QPCA 4LRMA 5ETFA 3IDCA 4FT9A 4GYGA 3QFVA 4FC0A 4EHZA 3V6SA 2WU6A 4E93A 4FEQA 4J7BA 3D5WA 2QURA 2BIKB 4LI5A 4P4CA 3KU2A 3EQGA 2JKMA 3BU6A 3D7TA 3TCPA 3UJGA 3GENA 4AN2A 1PXOA 4P90A 5CAPA 1BKXA 2VWBA 1TQMA 4UYNA 3H0YA 4NU1A 4M15A 1R78A 5AWMA 4FOCA 4R3CA 1JKKA 2X6DA 4AUAA 2C5VA 3GGFA 5ETCA 4FGBA 5CVGA 1UVRA 4DH1A 3IO7A 2GHGA 3QLFA 3R8UA 3R9DA 5CF6A 3TG1A 4KBCA 4EOJA 1PHKA 3ULIA 3AC3A 3DB6A 4N57A 4RWKA 2QU6A 3EKNA 4G3CA 3W2PA 4KIQA 3BYMA 3WZDA 4BDHA 3LOKA 3TDWA 2I1MA 3D14A 3OG7A 4HNIA 4EHEA 3F2RA 5DGZA 5KHXA 5HKMA 4FSTA 4I5PA 4BFMA 2WTJA 2NNWB 2O64A 5A46A 4KS8A 3WF7A 4D1ZA 2E2BA 5D1JA 3KULA 3MH2A 3A8WA 3BZ3A 5DYJA 3DK7A 2J9MA 2AC3A 5J8IA 1URCA 3R7UA 4FGRA 4DEBA 3KY2A 5DT4A 1PKGA 4UY9A 4CFFA 3SRVA 1QPJA 4DN5A 1ZARA 2R3MA 3MFRA 5EM8A 4LMUA 4TYEA 3RKBA 2JDOA 4LRJA 3VJOA 4KWPA 3CLYA 3L8PA 3PG3A 2PPQA 4LV5A 4FSRA 4RFYA 3VS4A 4FIJA 2C6TA 2IVUA 4QMTA 5CEOA 1REKA 4W4WA 2OJJA 3QQKA 2SRCA 4V05A 4EL9A 5IH5A 5CLPA 3HMNA 3DV3A 5FXQA 4G9CA 2Q83A 4A7CA 2W9ZB 3FC1X 4W4VA 1GAGA 4BCQA 3W2QA 4E6QA 5G6VA 3R7YA 1W84A 3QXPA 4U45A 4JG7A 4JQ7A 5JQ5A 1OITA 2AUHA 4X3FC 4APPA 4IJ9A 4LL0A 5A4CA 2GFSA 3C0HA 4RIOA 1JNKA 3OROA 4LOQA 4JQEA 3WZUA 4CEGA 4L53A 3CEKA 4DH8A 4W4XA 5HO6A 2C47A 1UU3A 4G3DA 4ZTMA 3PRFA 3VAPA 5DR6A 4MYGA 3FSFA 4IVBA 3RBWA 2WEVA 3GXLA 4ITJA 5E8TA 2BKZA 4YBJA 5HTCA 3UQCA 1Q5KA 2J4ZA 2JBOA 2RL5A 4ASZA 5JT2A 4LOPA 3JUHA 3Q6WA 3EL7A 1J7IA 5FD2A 5C8NA 3FKNA 4AACA 3T9IA 2P2HA 3EN6A 3OVVA 4PF4A 4AU8A 1NA7A 3ZTXA 4YJNA 1PXJA 3HUCA 5E8YA 3KF4A 3F5XA 4ZS4A 4FNZA 1YW2A 2WB8A 2WTCA 3D2IA 4D2PA 2W1HA 3OXZA 2GNLA 2X8DA 4GV1A 4FSQA 3S00A 5CNNA 5BVNA 4CG8A 4CMUA 4Q2AA 2GHMA 4O0UA 2GNFA 4PMSA 3OXIA 4FR4A 3U4WA 3NNWA 1H07A 4W8DA 5TR6A 4AX8A 1Y57A 4D1XA 2J0KA 3TIZA 3H0ZA 3DJ5A 4IZ7A 4M84A 1YI3A 3LJ0A 3NWWA 3R63A 3R71A 4FKGA 5DOSA 3SX9A 1NVRA 3VUDA 3LJ1A 4RZVA 5IH4A 3P7BA 2VGPA 2X39A 3FLZA 4D2SA 3QQHA 3RNYA 1QL6A 3CC6A 3NSZA 4RJ6A 2PVRA 2C6OA 5BMMA 3BQCA 2PSQA 2C6KA 3JS2A 2GQSA 4R7BA 3RAWA 4ASEA 1A48A 2C0OA 3FZOA 2YLEA 1UV5A 3CGFA 4RPVA 2XZSA 4U3YA 5IPJA 4AN3A 2OXXA 2ZB0A 1LEWA 1GNGA 1Q3WA 2XB7A 4G3GA 3L9LA 3O0GA 3ZZWA 4FTNA 4QRCA 4CV8A 4IFCA 4RQKA 3RI1A 4ERWA 3BYVA 1ZOEA 3I81A 4BDDA 3NYNA 2OSCA 4H39A 2BDFA 2WTVA 3ZRKA 4S32A 2QU5A 4Q5EA 2IVVA 2XKFA 3EQPA 2W96B 1RE8A 3I6UA 4FT7A 4WKQA 1LR4A 3R7VA 1YXSA 3O23A 3O2MA 4A9UA 2QOBA 4XV2A 1F0QA 4C3PA 2V22A 3QD0A 3PE2A 4YZCA 4W9WA 3OTUA 3RMFA 4C35A 5AV3A 1W8CA 1Y91A 2RFNA 4IAYA 3I7CA 3AC4A 4NJDA 5EW3A 2F49A 4ONAA 3O96A 4FV0A 2XYNA 4D58A 4E6DA 5EI6A 4QOXA 5CEPA 1L3RE 3QD4A 2Z7QA 3TV4A 3D94A 2X0GA 3E8EA 3R9NA 4F9CA 4PPAA 4LFIA 3KK8A 2GTMA 4PDPA 4ANNA 3W2SA 4QP8A 3VBYA 5KUPA 5M55A 5BVDA 4QMWA 3QKLA 1UKIA 5JFSA 3RPOA 5CYIA 2I0HA 3QD3A 5CEKA 4MTAA 3ZUVA 5CAUA 1J1BA 5KBQA 3REPA 4YSMA 5TO8A 3GQIA 4MAOA 2CLXA 3LJ2A 4JR3A 3DAJA 4PRJA 4EH2A 4OBOA 3UIBA 1KV2A 4PX6A 3I7BA 3WYXA 3ENMA 3DA6A 4UWBA 5F94A 1OZ1A 5I3RA 3C4FA 1ZZ2A 3NYVA 2G15A 3IK3A 3G15A 2YIYA 4M0YA 5CQWA 5HQ0A 2O0UA 3R7EA 3PA4A 3QXOA 3L8SA 2YZAA 4KIPA 2W4KA 4X3FB 5HESA 1FVRA 4QYYA 3R8LA 3WF6A 4C61A 3TJCA 3ZMMA 3CTHA 3RM6A 4Y8DA 2QR8A 3KRXA 1MQ4A 4XNEA 3ZUUA 1M14A 3ENHA 3GUBA 5J95A 2PUPA 3ZLWA 4I4FA 3VQHA 4PTGA 4D55A 3ZLXA 3EHAA 4FL1A 4D5KA 4J71A 5E1EA 3DT1A 3R8VA 1PY5A 3R04A 3DAEA 2H8HA 4BWXA 3BE2A 2IO6A 2WGJA 4MXYA 2BRMA 2RFSA 2VTJA 4QYGA 5HD4A 4YHTA 4O7VA 1XBCA 5DIAA 3VUGA 2JGZA 3ELJA 3MVHA 5JZJA 4RJ3A 2PTKA 4FKQA 2YA9A 4LRKA 4UYAA 4JG8A 4RX9A 3ZEWA 4ACCA 1H00A 4IH8A 5D11A 3F7WA 2PL0A 4HVDA 3NGAA 2GNHA 5B2LA 3UP2A 4I5HA 5K4JA 5M4IA 3ZZEA 1OPKA 4EK8A 2XK3A 3C5IA 2HW6A 2BZHB 3SQQA 3Q9WA 3F82A 3O7LB 2PHKA 4GUEA 3CKWA 2XM9A 4EC9A 5M53A 2RIOA 4QTCA 1ZMVA 2OZAB 4NCTA 4OT5A 4QMZA 4FSWA 4D4VA 4DTKA 4IX3A 5LARA 4E4XA 4TKSA 4TWCA 5AV4A 5E90A 4DTAA 4K1BA 3KFAA 2QOQA 3ODZX 3OF0A 3T3VA 4ZMEA 2BZJA 4L6QA 4RIWB 5HNBA 1WAKA 1WZYA 3CPBA 5CAQA 3FMHA 3Q5ZA 3UYTA 2PE0A 5AP0A 3T9TA 2XVDA 3SDJA 2WEIA 4DFBA 4YMJA 4N6ZA 3FZRA 2VWUA 1G8SA 3TTJA 4XLIA 2C4GA 2WXVA 2FSTX 5FP5A 3COKA 5D7VA 3H3CA 4F9BA 2W5AA 3ORZA 3LFNA 3BYOA 3BEGA 5EHOA 2WMUA 3GOPA 4QQCA 3NW7A 4IIRA 4XG3A 5K4IA 4V01A 1SNXA 2WQOA 3Q9ZA 2XEYA 4OR5A 3TT0A 3NNXA 3QZFA 4YURA 5HX6A 4BCPA 1FBNA 2OLCA 3QL8A 3F5GA 4JOAA 5DEWA 3KK9A 3WZEA 3SOAA 3F3ZA 4GK2A 4I24A 4DYMA 3PXYA 4WIHA 2CN5A 5FG8A 3FI4A 3GCPA 5JFXA 5BVKA 3PJ8A 2EU9A 2R4BA 3I60A 4FKTA 4F7LA 4WG5A 3PY3A 3LFCA 2GNJA 5LMAA 3UGCA 1GY3A 4QPAA 5KMKA 2WMWA 2J0MB 2YITA 3LFQA 3A2CA 2OJIA 4OTRA 4QYFA 4CMOA 4CT2A 3CPCA 2CNQA 5CEIA 3K3JA 4IMYA 4YLKA 2BZKB 2W1DA 5CVFA 4O21A 3UZPA 5DA3A 3PA3A 3PSDA 3AT4A 3EOCA 4BCHA 4C7TA 3Q4ZA 5JK3A 2C3JA 1G3NA 5ACBC 4C2VA 4B0GA 3HECA 1SVGA 3MS9A 3DKFA 2NPQA 1A9UA 1Y8YA 2GQGA 3GCQA 2IVTA 2J5EA 3DXNA 5CXZA 3A99A 4FUXA 4EH7A 5CAOA 4CTBA 2CNVA 3AXWA 2ZMCA 3EQCA 3LZBA 1ZAOA 4FK6A 2XIRA 4XJ0A 4A9SA 4YJQA 3HKOA 1UNLA 5GJFA 1KOBA 5LWMA 1Q97A 2OKRA 5DRBA 2YZLA 3PXKA 2R3PA 4A07A 3R1QA 4FV4A 4L45A 3C0GA 4FKUA 5AP1A 4C36A 4CRSA 3TUCA 2JDTA 3BBWA 4M12A 5AUWA 5T3QA 2YHVA 5EKNA 3WF8A 1T46A 1R3CA 3CJFA 2R2PA 1J3HA 3G0FA 1YWRA 4IX6A 3N51A 4MEDA 3V01A 5B2KA 2IWIA 2XIZA 5E8SA 5AP2A 5C26A 1PXMA 3E8DA 1NVQA 2YIWA 3BWFA 3SXFA 4GH2A 4IACA 4NIFB 3ZS5A 4DFNA 3F9NA 2PUIA 3O7LD 4UXLA 1H27A 4CTCA 2RGPA 3PIYA 4FTTA 1KE6A 4I41A 4PDSA 3F88A 4FTLA 1R0PA 4BI2A 1YWNA 4Y95A 2BTRA 5DBXA 3ZRMA 5FBNC 2X2LA 3ORIA 5AP4A 4KD1A 3U6JA 3EN5A 3KEXA 4BKYA 4EBWA 4O7NA 4IVCA 4MQ1A 3AGLA 4JJRA 2UVYA 5FXRA 1XJDA 1JKLA 2QCSA 3K5VA 5AUUA 2WPAA 4U80A 5KMIA 5F1ZA 2QC6A 5A4QA 3DDPA 3PJ2A 3NDMA 2J5FA 3RZFA 3V5QA 2BZIB 5CENA 3W33A 4KSQA 4X0MA 4DT9A 4RA4A 3ACJA 3SAYA 3PWDA 4CCBA 3CSVA 3R6XA 1NT2A 3CY3A 5M07A 5IA3A 4G6OA 2YISA 3QYZA 3PVWA 4YZDA 2OJ9A 4YJTA 2V62A 4A4OA 2HIWA 5CS6A 4GG7A 1J1CA 2OWBA 4WUNA 2C3KA 2BMCA 3IW4A 3KREA 5FEEA 3O8PA 3SKCA 3QU0A 5AR5A 2XUUA 3GC0A 2Q0NA 4IBMA 5E91A 2YCSA 4FVRA 4EK6A 2YJRA 5FDPA 3VW8A 4R8QA 4TTHB 5EHLA 4II5A 5AR8A 2VU3A 4CFWA 3C9WA 4M69B 4AW2A 4WRSA 3ZXZA 4AAAA 5EQYA 3PLSA 5F9EA 4LL5A 3QF9A 2OXYA 3DCVA 3P08A 4X2JA 2OIDA 2YIRA 3ZLYA 2XNEA 4IAFA 3QTQA 4YNEA 3NX8A 3D5VA 5HU3A 1M2QA 3C4WA 1W82A 2CKPA 3SLSA 2QOIA 4TNBA 4HGEA 4BCKA 3HMMA 4H36A 4DG2E 2BAKA 4ZTSA 5I4NA 4FTKA 4M7IA 3KRLA 4AGDA 4C58A 4Z16A 3RNIA 5KZ0A 2CKOA 2OBJA 4LGHA 1OL6A 1BI7A 2BHEA 4GUBA 3HAMA 1STCE 4JBOA 4AT3A 3F5UA 3R9RA 2OU7A 3OTVA 3UOHA 3O50A 2WNTA 4JX3A 1PYEA 4O7TA 5HNGA 4FZAB 4GU6A 4O1PA 3FPQA 3M2WA 3OWLA 2W99B 1OPLA 4J97A 3BEAA 2OZOA 4UWYA 4ZSGA 4UMUA 2A27A 4JLCA 3SGCA 5L2SA 4R5YA 5CT0A 4KBAA 4PMTA 4MXOA 4DT8A 5CU2A 4NKAA 5J87A 2QOCA 2WD1A 2OIQA 3SVVA 2C6DA 1H01A 3OCBA 4UMQA 4YJUA 2ITQA 3O8UA 3UYSA 4BDAA 2YAKA 4GKHA 2C6MA 3OOGA 3DKCA 5M06A 4WBBB 1T45A 3MESA 3DU8A 2CN8A 3FMNA 3QKMA 4O6LA 3IKAA 3UMXA 4BZDA 3OCTA 5AAGA 2DUVA 4OUCA 4DGMA 3C13A 4Y5HA 3SA0A 4KBKA 5B2MA 4NUSA 3NYXA 3OW4A 4E4MA 3POZA 5LMBA 2HYYA 2HXQA 3CTQA 4ZSEA 3L9MA 4DFZE 5TF9A 4Q9SA 3U54A 3JPVA 2NO3A 4X6QC 4YUQA 3IGGA 2R64A 2FA2A 4JDIA 4PPCA 3QD2B 4AF3A 3FZSA 2ZDUA 2Z02A 4AZFA 4WD5A 3CQUA 1F3MC 1V1KA 4XG4A 1WFCA 1JKSA 3A7JA 2CGXA 4WG3A 3SC1A 1ND4A 3R2YA 4CKJA 3A7HA 3RCJA 4ZZOA 2GSFA 1Q24A 2I6LA 1JWHA 2BRNA 2B54A 3VULA 5I9WA 4ERKA 5IEYA 5CALA 2XEZA 2YAAA 3BU5A 5H8GA 5DI1A 3PRIA 3Q96A 4I22A 3KF7A 5J9LA 1P5EA 1TVOA 1UKHA 3GCVA 3VIDA 4E20A 4GJ3A 4EI4A 5J1WA 4IAAA 2QD9A 3Q4CA 2QG7A 5D9HA 1KE9A 3MH3A 5IG1A 1WBSA 2VX0A 5M09A 5KBRA 4W9XA 4LMNA 5BYLA 3TUDA 4TYIA 2VO6A 3QKKA 4O0XA 1V0OA 3VS5A 3N4VA 4JNWA 4Z9LA 5AR4A 3QCSA 3U6HA 1H4LA 5CSWA 3VUIA 3TDVA 3W55A 2JKOA 2LAVA 3UIUA 5HZNA 4BL1A 4GIIA 3P9JA 3VBXA 3DXPA 1O6YA 1OBGA 4I92A 2BAJA 1U54A 5HE1A 4E1ZA 3VO3A 5IA0A 3F7ZA 4WSYA 5EYCA 4EYJA 4ITHA 1CKIA 2CSNA 4BTJA 5E92A 4IB3A 4MXCA 4NEUA 4FA2A 5M08A 2F7XE 3LM5A 1H1RA 5GJGA 1IAJA 4TW9A 2W9FB 1Q4LA 2CLQA 4HNFA 2F57A 5KO1A 4ZP5A 3SV0A 3THBA 1BL7A 3OP5A 5BPYA 4JIKA 2OI4X 4QPMA 3BHHA 2V55A 1YRPA 2ITZA 2H9VA 4HYIA 3KXHA 5HBHA 5HVJA 2QO7A 1ZYSA 1PXLA 3EJ1A 3RINA 3SOCA 3VBTA 2PULA 4ZMFA 4RIXB 5J5TA 1OB3A 1E1XA 4FKIA 3CIKA 1OKVA 4GT3A 2QVSE 5E8XA 4CXAA 5HEZA 4FIIA 3O8TA 2ZDTA 4WNKA 3HMIA 3ZONA 4UN0C 3W2CA 4BI1A 4IFGA 4BKZA 1F5QA 3NUYA 4QQTA 3UZRA 4IE9A 2JEDA 1JOWB 4FKJA 4I4EA 3MPTA 2UZBA 1FINA 3MWUA 2W7XA 3WARA 4CMTA 1PXKA 4R7IA 2Z8CA 5DR2A 2Y4IC 5ANIA 3R01A 5AA8A 3PP1A 2JIVA 3D4QA 3VN9A 4CFMA 1LEZA 4FUYA 4I3ZA 3TM0A 1PXPA 3LXPA 3QYWA 4DGNA 3DZQA 4FIEA 5EDPA 4IAIA 2YM8A 2V5QA 3PP0A 3R02A 4UEUA 3VBVA 3OT3A 3TZ7A 4AE6A 4FTQA 4YU2A 2JIUA 4BN1A 4EK5A 3AQVA 3RM7A 4TT7A 4CRLA 5ETIA 4EKLA 4FIFA 3I0QA 1DAWA 4Q5HA 5EI2A 5AUZA 3G6HA 3DTWA 5DN3A 3ZDIA 5DNRA 3CQWA 3LQ8A 3MIAA 3AT2A 2XBJA 2ZOQA 5GIPE 4L52A 3BHYA 3G33A 2WQEA 4K9YA 4CLIA 1ZOHA 5C27A 3BV2A 1XH7A 5DRDA 4MWHA 3ORPA 4F63A 5HLWA 2IZUA 2XIXA 4U3ZA 2X1NA 3MTLA 4FK3A 4EOLA 3ZHPC 2X2KA 2VWZA 3MPAA 3HX4A 3OBJA 4UMPA 3UPXA 5IQIA 2VNWA 1HOWA 4L01A 2XK4A 4QP9A 4FSYA 4Z7HA 5M4CA 3WOWA 2B0QA 4JDHA 4ANQA 5CSVA 5CANA 3LKMA 1ZZLA 2ZYBA 5BNJA 4FV7A 2XKEA 4KRDA 1PRYA 4A4LA 2ITWA 3Q52A 4L42A 4GFOA 2AC5A 1K3AA 4JRVA 4IWQA 3V5PA 5HIBA 5HNIX 3UODA 2A19B 1CKJA 4EONA 4MNEA 5E8WA 5GZ9A 3PIZA 3LQ3A 3FLQA 4HPUE 3QTRA 3EQHA 2YACA 2R0UA 3ZOSA 4EJ7A 3PPKA 3RK7A 3DOGA 4DC2A 4GKIA 3FL4A 4FIHA 4CD0A 3HNGA 4C02A 5K0KA 2W1GA 1H24A 4H3QA 4F65A 2BHHA 5AA9A 4L44A 4CFNA 3BHUA 1M7QA 3EFWA 4FX3A 4FKSA 4QP4A 4ZTRA 4BF2A 4JG6A 4L3PA 1Q62A 4LV8A 4MXZA 4F7NA 3TNHA 4CZTA 5LMKC 3HUBA 3IW7A 5BVFA 3OY3A 1OVEA 5DE2A 5LCJA 3FZPA 4ITIA 4EJNA 1GZNA 4ANMA 1Q8ZA 3FLSA 4M66A 3FZTA 3BLRA 2PZIA 4HVIA 4BCNA 1YXUA 2YCRA 1B38A 1G8AA 4QMXA 4K18A 3UDBA 2QO2A 1R0EA 4FMQA 3PLAE 4GEOA 3MVJA 1XH8A 1OM1A 4QYHA 5LQFA 3QUDA 5GINE 2ZMDA 4CG9A 5E7RA 4EHGA 4FYOA 2ACXA 4KUJA 3G51A 3HRBA 4J53A 4USDA 4DEHA 2HAKA 3Q6UA 2PK9A 3AC1A 3F61A 2CPKE 4TY1A 1G5SA 3ZO3A 2FUMA 3DJ7A 4O0YA 3OUKA 3G5DA 2C68A 5EG3A 4F64A 1FGIA 5HE2A 4BWKA 2F4JA 4UX9A 5HOAA 2X4ZA 5T6KA 1U59A 1AD5A 2XNBA 3OEZA 1OIQA 4LGGA 3VS0A 1VZOA 4FT5A 1P14A 3PA5A 2F9GA 4K33A 2PVKA 1JVPP 3ZC5A 2CGWA 1P4OA 3AMAA 5EYKA 4JX7A 5C8MA 3T8OA 4DFLA 4YTFA 3MFSA 4DEAA 2J51A 3FMJA 3DQXA 2GU8A 2O5KA 3M11A 3R22A 3QQJA 4ZY5A 2OH0E 3QGWA 2WMVA 5CEQA 3P1AA 4DLIA 2GHLA 3I6WA 4FG7A 4DGGA 3UNKA 3KVXA 4C3FA 2Y4IB 3BV3A 3CJGA 3IW6A 4ZJJA 3TV6A 4IM2A 4ZY4A 4MF0A 3VHEA 2WMTA 1KE8A 3KMWA 4WG4A 1KE7A 5L2TA 4UB7A 4CNHA 4P2KA 3E3BX 4E5BA 3DBCA 3H30A 4U97A 4NSTA 2PVMA 5JH6A 2C6IA 2W5HA 2ONLA 2C5YA 5IQDA 2JAVA 4O96A 3GU8A 3ZSIA 2ETRA 1W0XC 4FTUA 3QCYA 5I9ZA 3AMBA 1QCFA 3EMGA 4F6UA 2W4JA 3D15A 4HYSA 4ZXTA 5KMOA 3MIYA 5CX9A 3QRUA 3ROCA 3DK3A 4XX9A 1JKTA 4MD7E 3UC3A 3VF8A 5BQ0A 3KQ7A 4O7ZA 4DTBA 3RZBA 4TWPA 3DY7A 3P0MA 4TPTA 4F4PA 1K9AA 4JI9A 4EQMA 4R5SA 4MD8E 3SW4A 3UIMA 3VVHA 4ZTQA 4BVUA 3P5KA 4YC6A 4F99A 3L1SA 3P23A 2VTHA 1DS5A 3LXLA 4RZWA 1RQQA 4MBJA 2E9PA 4QT1A 4ANLA 5CQUA 2WMSA 2XYUA 3OHTA 3OWJA 4XBUA 4X2KA 5HCZA 4DHFA 5JGDA 3WE8A 4AG8A 3E8NA 3VS6A 4N4SA 4OBQA 1Z9XA 1YDTE 3H10A 4BIBA 2BTSA 5GNKA 3UTOA 3MB7A 4ZZMA 3E93A 3TI1A 3LHJA 4E6CA 2ESMA 5CU4A 1H1WA 2QOFA 5AMNA 5HE3A 4CQGA 4KAOA 3C4XA 1VYWA 5H9BA 3ALOA 3V51A 1R39A 4R7HA 4AZSA 5AUTA 3RVGA 2CDZA 4L9IA 5M57A 3AOXA 4U41A 4MVFA 1GZOA 5DFPA 5AR2A 2GMXA 4RVMA 3SXRA 3ANRA 4EYMA 1QPEA 1JQHA 2ITNA 4DCAA 3COMA 5DR9A 3RWPA 3KCFA 3CTJA 2VWVA 3OD6X 3AT3A 5A6OA 5KKRC 2UZWE 3F3VA 3BX5A 4BZNA 5EHYA 2R3FA 3Q2JA 4XRLA 3FY0A 4M13A 3A7IA 1XR1A 4BWPA 3UZTA 3LFEA 3S4QA 3UO6A 3UIXA 4C8BA 2C1BA 4PQNA 4BZOA 2FYSA 3OT8A 5AP3A 4F6WA 3UOJA 3IDPA 3BIZA 3PY0A 1ZY4A 4RBLA 4DE4A 3WILA 5HG5A 3E63A 4BDBA 2HY0A 4OGRA 4OTDA 2YN8A 3C4CA 5TKDA 4MXAA 1H1PA 2WMXA 3KXZA 5EYDA 4XOYA 4PPBA 3DTCA 3RPVA 4BDGA 4AQCA 5CSXA 5IA1A 4NW5A 3CP9A 4USEA 4DEGA 4KA3A 4PWNA 5GHVA 4C4JA 4PP9A 2VN9A 3FEGA 5EOLA 4RC2A 5B0XA 1H0VA 1CSNA 3PZHA 4XP3A 2PYWA 2YFXA 3FMMA 4WSQA 3NVMB 5D12A 1LP4A 1UWJA 4HGLA 3R30A 4YSJA 2Z7SA 5F20A 1UU9A 2X8EA 3FSKA 3MTFA 3PDTA 1NVSA 4BC6A 3QUPA 4F7SA 4S34A 3R9OA 1OUKA 2JFMA 4OBPA 5EM5A 4X2FA 2C69A 2PZRA 4EUTA 4EC8A 2C5XA 4G16A 4AZEA 3OCSA 4TWOA 3FLYA 4I23A 4AFEA 3HP2A 4IEBA 3QC4A 1YOMA 3BU3A 4CT1A 4FTAA 4FEVA 4DH7A 1PMVA 3FE3A 1W98A 3MY0A 3G0EA 4H3BA 4XP0A 2PVHA 3R21A 4ZLYA 3Q9YA 3TKHA 5IUHA 2GS6A 2W1IA 3K2LA 4J52A 3L8VA 5IQBA 3CS9A 3HZTA 4RC4A 2C6EA 5C8KA 4Q9ZA 3R7GA 3FAAA 2B55A 5FXSA 3QQFA 3R1SA 2X7GA 3C1XA 3F2NA 5KX8A 3QQLA 4JIAA 3R83A 4BTKA 4RIYB 1GIJA 5DLSA 2R3KA 2ZB1A 3NCZA 4PL5A 4I93A 3FQHA 1MRUA 4RT7A 3COIA 2R3JA 3P78A 2QOHA 1I09A 3F3TA 2NRYA 3QHWA 4BYJA 4N6YA 3VRZA 4CVAA 3HP5A 2OFVA 5IQGA 1PXNA 2YEXA 4X3FA 2ITYA 2O65A 5FM3A 3FHIA 4FT0A 4R6VA 5L4QA 2YWVA 2ITXA 4IXPA 3UE4A 5HTIA 3PTGA 3ULZA 3IS5A 4RLKA 1DM2A 1OIRA 2VTOA 3ATSA 4O86A 4HYUA 4TL0A 3C50A 4ZSJA 5C03A 4C4GA 1H1SA 5FDXA 2FSLX 4RFMA 2UW8A 5HIEA 3W2OA 2PU8A 3BE9A 2FVDA 4FV8A 2VWXA 3ZBXA 4JDKA 3U9NA 5A4EA 4GS6A 2GNIA 2FO0A 2YCFA 2IW6A 4KIOA 4XG6A 3TUBA 2JD5A 4U81A 2BFXA 5IUGA 5ACKA 4EOOA 5JGBA 3W2RA 3JR1A 4QNYA 3NCGA 4FE2A 1M17A 1GJOA 1VEBA 4C34A 3T3UA 4F0IA 4PTCA 5DH3A 4HGTA 3B8RA 4CFVA 4V0GB 3C5UA 3WF9A 3UC4A 1RW8A 4FNYA 1YHVA 4MNFA 2JITA 2OZAA 4FV2A 4BGGA 1H25A 5HI2A 2W05A 4FTIA 4I6HA 4IANA 3A60A 1L8TA 1NXKA 4X6RA 4PP7A 5M56A 2ZV9A 1KSWA 3EFKA 2E9NA 1Q61A 4IWPA 4NT4A 4RIWA 1B39A 3UNZA 4B99A 3UPZA 1IG1A 2QOKA 3GC8A 4RC3A 3TJDA 4YZ9A 4DFYA 5L6PA 3N4TA 4LYNA 4RWLA 5F4NA 4I94A 4BTMA 2J90A 3NNUA 4C37A 1WVYA 3ROYA 2XKDA 2RG5A 3DPKA 3G9LX 3VS2A 4O7RA 2PE2A 3BQRA 4BICA 5ETAA 5LXMA 4YO6A 4FV1A 3KKVA 5EOBA 2EUFB 1YDSE 4DFUA 3MW1A 3WE4A 3AD5A 4O0RA 4BR3A 3LCKA 4JBVA 4JRNA 5IQFA 2G01A 3HVCA 4BCJA 2UV2A 4IM3A 4DEDA 3HV6A 4LUEA 3S0OA 3Q4UA 4I6BA 4Z7GA 3GCSA 4IJPA 2UZOA 1IAHA 4FZFB 5CU6A 4AW0A 4CKIA 2PVLA 2XRWA 3L9NA 2B9HA 3I0OA 2UZTA 2UZVA 4F6SA 4F9WA 1H1QA 2XMYA 2RG6A 4GVJA 4YO4A 4BRXA 1JBPE 4IDTA 2R3QA 5KNJA 3A61A 3DQWA 3ZSHA 3U8WA 4I0RA 4IX4A 4XOZA 2X6EA 5K5XA 3A4OX 4F9AA 1CM8A 1VJYA 1WMKA 2PY3A 3FY2A 4HVGA 4I21A 3NS9A 3FKLA 4QTBA 4CQEA 5FQDC 2JKQA 3VC4A 3MA6A 5L3AA 2GDOA 1FQ1B 1XBAA 5IDPA 2P2IA 3EFLA 1YKRA 2IVSA 4KRCA 4RVLA 3RP9A 3HA6A 4E4LA 4XYFA 1V0PA 3QTIA 5IISA 1OMWA 4EK4A 2C6LA 2YIXA 5KMNA 2YERA 3VS7A 1IA8A 4KS7A 3EN4A 3KRJA 2WMQA 2E9VA 4DBXA 4YC3A 2QKRA 3ACKA 3BGPA 4YJVA 3ORKA 5BX0A 3DBEA 5HLNA 1YDRE 1LPUA 2UZNA 4RGJA 4NL0A 4ORKA 3MFUA 2CGVA 1E9HA 2OICA 3AMYA 4RFZA 5FEDA 4AT4A 1Q3DA 3MA3A 3ZBFA 4MHAA 3E7OA 2WIHA 4YJRA 3M42A 3OFMA 3QX2A 3QCXA 4YZBA 4YTHA 4KB8A 5EDRA 2J50A 4TYHB 5CF8A 3V5WA 3NW5A 3SD0A 2UW5A 4IZYA 3PVUA 4TZRA 4GMYA 1CDKA 4WRGA 5HG9A 3BHVA 4D2WA 3F69A 5ANEA 3QALE 5CF4A 3TNIA 5L2IA 3QTUA 4NIFA 5DG5A 2V7OA 4M0ZA 5CNOA 1XH6A 5HBEA 3NPCA 4Z3VA 4GCJA 1FVTA 1ZLTA 2P33A 2ERKA 2OJFE 2KTYA 4M14A 4MD9E 3ETAA 2B53A 3PSCA 4PNIA 2VWIA 4WBOA 5F95A 3WBLA 2DS1A 1CMKE 5AAFA 4DH3A 2HZIA 4O0VA 4OTPA 4RWJA 3VBWA 2X7OA 3MV5A 2FSOX 5ANJA 3WZJA 2YABA 4F08A 3E87A 4N0SA 3ZH8A 4EWQA 4CLJA 3ZC6A 5JSMA 4U40A 4NTSA 3G2FA 4IWDA 3E64A 4DEEA 5A4TA 4H05A 2B9JA 1MQBA 1UU8A 1R1WA 1MRYA 3Q53A 5AAEA 5IMEA 4G9RA 5ANGA 4FTJA 4L3JA 4KIKB 2VD5A 4NWMA 4IX5A 2XNPA 4FV5A 4AOJA 3IONA 5CI7A 3AC5A 2OFUA 4FNWA 4KABA 5KMJA 3RPYA 4DINA 2JAMA 5CY3A 1OBDA 3TZMA 3MJ2A 5ANOA 3D7ZA 2R3RA 1IR3A 4E5WA 4YNOA 4KINA 3QRIA 3RHKA 2GFCA 3R0TA 5FM2A 3UG1A 4BDCA 4BHNA 4BDIA 1XWSA 3VF9A 3FC2A 4FVPA 5A14A 4BCGA 3BCEA 3OCGA 4GSBA 2YJSA 5DVRA 2B7AA 4BDEA 2EWAA 5JEBA 3PYYA 1WBWA 2P3GX 2QI8A 3OMVA 3D83A 2B1PA 4QNAA 4M69A 1XBBA 4NH1A 4YR8A 4YJPA 4D9TA 2XP2A 5E8ZA 5JMSA 3KL8A 3R9HA 2WTDA 4DG3E 2C1AA 2Z2WA 5BMSA 3FMDA 4EWHA 1M2PA 2XS0A 2ZM4A 2R3HA 3QZHA 4DGLC 3GVUA 2CKEA 2QOLA 2YWPA 1WCCA 3H9OA 2FB8A 3PG1A 5JQ8A 3NLBA 2VTQA 3FLNC 2QR7A 3LAUA 3PJ3A 4G5JA 4EZ3A 1BI8A 4C57A 5L8KA 2Y9QA 3E7VA 4OTFA 2OXDA 2BUJA 3LLTA 2UZUE 3RWQA 3U51A 3F2AA 3NIEA 3FZ1A 1E1VA 2X2MA 3ZFYA 3W18A 1ZOGA 4FZ7A 3ANQA 5D10A 4U42A 4XV3A 3CXWA 3DKOA 4FEUA 4D2RA 1YXVA 4ACHA 2VAGA 4QMYA 3DLZA 4LM5A 2WO6A 4FNXA 4DBNA 1YHWA 5AUVA 2ZAZA 2J0JA 3DBDA 4O6EA 2HZNA 5I9VA 2J0IA 4B6LA 3EQBA 3RHXA 4QP3A 2UW3A 4FEXA 2QLQA 3PVBA 5GZAA 4RJ4A 2RFEA 3PXQA 4GJ2A 3EL8A 4A9YA 3RK9A 5AR3A 4YP8A 3GU7A 4PV0A 2ZV7A 3GEQA 5EQPA 4CKRA 1SNUA 4H58A 5H8BA 3HRCA 2OH4A 3H4JA 2F7EE 3C0IA 2XIYA 3EZVA 4B8LA 4USFA 3NUXA 1YVJA 4O0SA 2R3LA 4JS8A 5CSHA 4FOBA 5IZFA 2O2UA 4RVKA 4U0IA 4YGAA 4YPDA 3RJCA 4B8MA 5BUIA 3PJ1A 4GL9A 4BDJA 2UW9A 1VR2A 4GG5A 3EYHA 4QMSA 4AOIA 2VWWA 4BCOA 4WO5A 2IN6A 2O63A 4I5CA 4M8TA 5IUIA 5KE0A 5EFQA 4K2RA 3DS6A 1TKIA 3R00A 4ZK5A 5I0BA 4GRBA 3K54A 1ZMWA 5D7AA 5BYYA 3GFWA 3LMIA 4L46A 3UBDA 3QA8A 4EZ7A 4R3PA 3VUKA 3NUAA 4ZOGA 3CCNA 2O8YA 2R9SA 1UNHA 3R8MA 4BIDA 4ZTLA 3D5XA 2ZVAA 3MSSA 1JSTA 2VTIA 4ACGA 3LXKA 4BHZA 3U6IA 3QWKA 1IA9A 4FV6A 1PKDA 5HGIA 4CZYB 4O82A 2PVJA 4DFXE 4BGHA 2Y6MA 4X7QA 4D0WA 5GIOE 1GOLA 2XRUA 2BKKA 1FOTA 3ATTA 3NW6A 4RX8A 5BVOA 3QGYA 1U4DA 2B9IA 3CGOA 3VJNA 4C4FA 3NR9A 4J8MA 4XP2A 1XH5A 3LVPA 2ITOA 4O7LA 4OT6A 3V5TA 5HIDA 3V8WA 3PUPA 1PMUA 2UZDA 3VBQA 3U9CA 4RJ8A 3LPBA 3GC7A 4EBVA 1KV1A 3K3IA 3OWKA 3V04A 5CTPA 5EK7A 4JL9A 2UZLA 2BALA 3E88A 4YTIA 1BMKA 3LQ5A 2YM3A 1ZYCA 3HDMA 4NKSA 4O83A 4OTQA 3S95A 3DK6A 4GYIA 2R0IA 4F7JA 2XNNA 4HPTE 4XV1A 4J99A 5JRQA 2WHBA 5JFVA 3UNJA 2A4LA 5LCKA 4EHVA 2W4OA 2HENA 2YCQA 4NTTA 2WKMA 2IW9A 2HOGA 3VUHA 4RIXA 3D7TB 5TE0A 3EQIA 5B7VA 2BRBA 3RAKA 4EOMA 3EYGA 4QP1A 4AWIA 4NFNA 3TL8A 5ANKA 3BI6A 3NEWA 2UZEA 3FI8A 4O1OA 4JAJA 2XKCA 1Z5MA 1DI8A 4MQ2A 1GZKA 2HY81 3SHEA 4JBPA 1S9JA 3S2PA 5IEXA 4PL4A 3QLGA 3PXZA 3OC1A 3HEGA 4K8AA 5FEQA 1WBPA 3ODYX 2P55A 3IQ7A 4C3RA 2PMOX 3GCUA 3KXXA 2O3PA 2DQ7X 4RX5A 3TZ8A 3PXFA 4RQVA 2A1AB 4B4LA 3OXTA 4Y85A 2Y6OA 4AZWA 4QMNA 5IMXA 4PUZA 3KULB 5A4LA 1OKZA 1OL5A 2XH5A 2XCHA 3HDNA 4QMPA 1PW2A 2RKUA 3A62A 4AZTA 5IQEA 2JDRA 3MJ1A 2EXCX 4GVAA 5C4LA 3GQLA 1IEPA 2JBPA 2JLDA 3FWQA 2JKKA 3QHRA 4L43A 2VTPA 3SRVB 3ZSGA 2C0IA 2J2IB 4BCFA 5JKGA 4BI0A 5DEYA 1UNGA 2WMRA 4WNPA 5K0XA 3P7CA 3V3VA 4ALVA 4C2WA 3DNEA 3I4BA 2UW6A 4PL3A 4QTEA 3EN7A 2PWLA 4I20A 3GU5A 4S33A 4AGUA 4HVSA 1Q8YA 5AM6A 4EQUA 1Y6AA 2PVNA 1YWVA 4GU9A 3VS1A 1OIYA 2HZ4A 2R7BA 5BUEA 4F1MA 5J9ZA
chains in the Genus database with same CATH superfamily
5LVNA 4CFUA 4EH4A 2E9OA 4O38A 1WBVA 2DWBA 2PMNX 3CE3A 3R2BA 4FKPA 4J98A 1JLUE 2J7TA 4G34A 3NVKI 3MGYA 4O27B 3V8TA 1BUHA 3A8XA 3P86A 5AV1A 4ARKA 4RMZA 5AFVA 3B2TA 3LFAA 2WIPA 3KRWA 5AIKA 5L8JA 4A9RA 4MCVA 2QODA 2YLFA 3P5JC 2ZJWA 1O6KA 5AX3A 1OI9A 2YDIA 2BVAA 4FKOA 3FKOA 2F2UA 4E7WA 1YXTA 2OO8X 1ZWSA 2VNYA 4Y73A 2R3OA 4EH9A 2VO3A 4UMTA 3LW0A 2RF9A 4IM0A 5E9EA 3C7QA 4JAIA 5BVWA 3VRYA 3W1FA 4AGWA 1EH4A 1ERKA 4AZVA 2VTLA 4G3EA 2BFYA 3PJCA 3KXMA 2V7AA 5FBOA 3TNPC 3CKXA 4BY9E 4NFMA 4BDFA 5L2WA 4UV0A 3WIKA 3FXZA 5L8LA 2R5TA 1H0WA 1XQZA 3QQGA 4FKVA 4TYGA 4CFXA 4D28A 4XBRA 1OKWA 4JMQA 3RCDA 3ZO4A 4R78A 3UP7A 1KUTA 3W0QA 4QMOA 3DAKA 4FKWA 4IC7A 1SVHA 4LQMA 5L6WL 5IEVA 5JFWA 2BR1A 1UA2A 4IHPA 1Y8GA 2YM6A 5E8UA 4MKCA 5G1XA 3UO4A 2PVFA 4ZTHA 3ZRLA 4EOKA 4PMPA 4OTGA 4L00A 4JQ8A 4FZ6A 4NCTC 3B2WA 1FVVA 2R3GA 4DF3A 2GPHA 3PE1A 3NUNA 3ORMA 3ALNA 4WOVA 3C4EA 4C62A 4CCUA 3EQRA 3OUNB 3RAHA 3V5LA 4ANBA 4G2FA 3JYAA 4AE9A 4IW0A 1S9IA 4MBIA 1A06A 3R73A 3KMUA 4FSMA 5IQHA 4M68A 2UUEA 2BDJA 3F3WA 3LCSA 3LCOA 4PNKA 3KRRA 2PMLX 4BB4A 2A0CX 4AA4A 1GIIA 2XM8A 2IZTA 3EFJA 3KN6A 4I0SA 3UVRA 5H3QA 4JDJA 3TACA 3MI9A 5EDQA 3HL7A 1AGWA 4HJOA 4HZSA 3TZ9A 3C4ZA 3ORLA 1BX6A 5I9YA 4D9UA 4A9TA 4HYHA 3U87A 3AD4A 3JXWA 5M44A 2VX3A 3CD3A 2XALA 2ZM1A 1FMOE 4J8NA 1QPDA 4DGOA 1XH9A 3MN3A 3GU6A 1OPJA 3I79A 4XLVA 4YLLA 2WOTA 3LM0A 3MFTA 4L67A 5AJQA 1FMKA 5D41A 4QDVA 3O17A 5C9CA 3VS3A 2VRXA 2JDSA 2WTWA 4IDVA 5KZIA 3BLAA 2Y4PA 1SVEA 2ITPA 3NRMA 4F0GA 2W17A 3NUSA 4IVDA 3Q9XA 4U7ZA 4AXCA 1FGKA 2X81A 4ENXA 4PTEA 5HVKA 3RGFA 2W1FA 2J6MA 4YZMA 2YM5A 4X21A 5K3YA 5J9YA 4QTDA 2YM7A 2WAJA 1TFFA 4Y72A 3Q4TA 5AV2A 4K6ZA 2HELA 3R1YA 3A7FA 4PMMA 4BKJA 3TEIA 4D4SA 2WTIA 2GNGA 3W32A 4ZSAA 3IPHA 3Q32A 3DNDA 3CY2A 4LV7A 1FPUA 2H6DA 5JGAA 1J7LA 2I0YA 3Q60A 4UZDA 4CYJA 2EXEA 3WIGA 1URWA 4HVHA 3RALA 3P4KA 2OIBA 3QUEA 3UG2A 3WZKA 4I5MA 5HO7A 3AKJA 4EH3A 3GOKA 4E8AA 2Q0BA 3MH1A 5K9IA 4U8ZA 4J96A 1J91A 3LFDA 5HVYA 3RPRA 5HORA 5BUJA 5EYMA 4IB0A 2QLUA 1G8JA 4QMLA 3L9PA 1YI6A 5CEMA 3FUPA 4QO9A 4Y83A 4ZIMA 5LVPA 1KWPA 4E3CA 3EQFA 3UO5A 5GZ8A 5CZHA 5AP6A 4FTCA 1OKYA 4XRJA 4P5QA 4O81A 2XA4A 4UZHA 4DH5A 3UVQA 3TNWA 5J79A 3D2KA 4OLIA 2VTSA 3UOKA 4CSVA 4FTMA 3S1HA 1W2DA 4FODA 4QQ5A 4W8EA 4YJOA 5FWKK 3ZO1A 2REIA 3I5ZA 3ZFMA 1PXIA 1SYKA 3AG9A 4FKLA 3FMLA 1DI9A 3R7IA 3R8PA 4F1TA 5A9UA 5HE0A 4BBEA 1OGUA 5C4KA 4ZS0A 2ETKA 5AADA 1ZXEA 4G3FA 3NNVA 1PJKA 5C1QB 5ICPA 3IW5A 1ZRZA 2XNOA 3KA0A 1HCLA 5IU2A 5M4UA 1MRVA 2XJ1A 1BYGA 5LMKA 4ZLZA 3IDBA 2HZ0A 3TN8A 4NM5A 3VUTA 4OTWA 3QQUA 4V04A 3H9FA 2JIIA 4ZY6A 5CWZA 2EVAA 4EKKA 4ZTNA 3G6GA 4GK4A 4NYEA 3DFAA 4QYEA 4R3RA 1ZYJA 3E3PA 3QTSA 3K5UA 4MX9A 1APME 4EOIA 2IZSA 1PMEA 5LOHA 4JVGA 3TKIA 4AP7A 2XNGA 3D0EA 1U5QA 4IADA 5IDNA 4GT5A 2WQBA 4FIGA 3QAME 1J7UA 3UDTA 2NP8A 3A7GA 3GB2A 4P7EA 2IW8A 4WA9A 1PF8A 3BHTA 2WOUA 3UQGA 3ZXTA 5HHWA 4AGCA 5A54A 3FDNA 3LXNA 4FYNA 4LUDA 2CHLA 4U79A 2QQ7A 3UDZA 3QTXA 4W4YA 3MVMA 5E1SA 3E8CA 4C38A 4FBXA 5KMMA 3ID6C 2WELA 2Y0AA 3FI2A 4UMRA 3GFEA 2BRHA 3BYSA 5EM7A 2FGIA 3EWHA 5AP5A 2VTRA 4J1RA 3TKUA 3MYGA 5AP7A 2X9FA 5IKWA 2AYPA 4ID7A 1TQIA 4FV3A 4MK0A 2WMBA 3V6RA 3W8QA 4DLJA 5AEPA 3MBLA 3D5UA 2QOOA 3TWJA 4AA5A 2VUWA 3AC8A 5JRSA 5AUYA 4BCMA 3FBVA 5EM6A 2C0TA 4YTCA 2EXMA 2FSMX 3A4PA 3UOLA 5L6OA 1NY3A 2HW7A 3GU4A 2P0CA 2XCKA 3BELA 4FSUA 4I6QA 4EZ5A 2ITTA 4AN9A 4UXQA 4C59A 4C4HA 1Q8WA 1WVXA 4BIEA 4AFJA 4ASDA 4X3JA 4LOOA 3BPRA 4EH5A 1YXXA 3FLWA 2CNUA 4ACDA 3IGOA 5IF1A 1ZYLA 1RDQE 1XHAA 3OW3A 4FG9A 4L3LA 5AIRA 4S31A 5KCVA 3DXQA 2GS2A 4RIYA 3ZYAA 1H08A 2CKQA 4Y5QA 3PSBA 3OS3A 3PY1A 4XCUA 3NUUA 3Q5IA 3NYOA 3LFSA 3U4UA 3DB8A 3W8LA 4QEBA 4D1SA 5FTQA 2W0JA 3U55A 3II5A 3NIZA 3O51A 1HCKA 4QP7A 3ORTA 3KMMA 3PIXA 4HCTA 3HRFA 3PFYA 5FLFA 4DHZA 4M67A 3DBQA 2W06A 5KKRB 4TWNA 5FTOA 2PZYA 4HOKA 3PPJA 4ASXA 4C4IA 5JN2A 4D2VA 4X2GA 4YC8A 5DT3A 2HXLA 3FQEA 4HCVA 4AW1A 1OUYA 2X9EA 3ZO2A 2XBAA 4IAZA 4O7SA 4QMUA 3FQSA 3FYKX 3FXXA 3DJ6A 4HZRA 5HICA 1XMLA 4AA0A 3ORNA 3RAIA 3CBLA 4RA5A 1TQPA 2LGCA 3VQUA 3W16A 2VX1A 3ITZA 4GT4A 1GZ8A 3BGZA 3RPSA 4TXCA 3V5JA 5A6NA 2DYLA 3HMPA 1Z57A 2G1TA 3D9VA 3KGAA 3LFFA 3QZGA 5EW9A 4OTHA 3QTZA 2C3LA 3DKGA 4OTIA 3ET7A 4M3QA 5CF5A 1BLXA 4V0GA 3UQFA 5BYZA 4A4XA 5HU9A 3I1AA 2VZ6A 4EUUA 4FTRA 4IB5A 4L7FA 4RJ5A 2IZRA 3GNIB 5FP6A 3FI3A 2XK6A 4EQCA 5HX8A 4UALA 4LG4A 5LVOA 1YI4A 3KB7A 3QRJA 4MWIA 4RX7A 3NAXA 4TN6A 4XMOA 5I5ZA 5KMLA 4HGSA 1JSUA 1WBNA 3TIYA 3SG8A 5EQEA 1OIUA 3G90X 1JSVA 1ATPE 4ZLOA 3FHRA 3OBGA 4YJSA 5E8VA 4ACMA 4E73A 2FH9A 4K77A 2WMAA 2XJ2A 3DGKA 1QMZA 2C3IB 4AXAA 4D5HA 5FUTA 2I40A 2WZJA 1B6CB 2VV9A 4S2ZA 4ZSLA 3F3UA 3LCTA 4UBAA 4UWCA 2OF2A 5HO8A 4BCIA 4NM7A 1XKKA 2X7FA 3BGQA 3DFCB 1XO2B 2VTMA 3BBTB 4X2NA 3ZUTA 4FEWA 2OK1A 4PDYA 3MY1A 2H34A 3S3IA 5J1VA 4IZAA 4JBQA 5HCYA 5BV3A 4IWOA 3RK5A 4F1OA 2CCIA 4L68A 2J0LA 4OAVB 2OGVA 4IQ6A 3QRKA 3Q04A 4NM3A 2CJMA 3HLLA 4QP6A 4F70A 4LGDA 3BL7A 1BL6A 5LVMA 3LE6A 2I7QA 4GFGA 4E6AA 5AV0A 1OL7A 3IOPA 4MBLA 4OAUC 4MXXA 2A2AA 3SXSA 2XK9A 1CTPE 3FL5A 4FICA 5CU3A 3JY9A 2ZV2A 4PY1A 4F9YA 5BVEA 4GIHA 5LWNA 3R8ZA 4C33A 3MH0A 3MDYA 3GP0A 4BBFA 4O22A 4XH6A 3BLQA 5IQCA 2XARA 4KKEA 3OY1A 3PXRA 2CCHA 2CMWA 5T68A 5C01A 2X4FA 2ZM3A 1LUFA 3EB0A 4NZWB 2ERZE 2EB3A 2OJGA 3EH9A 5CZIA 2YDJA 4K11A 3BRBA 2XJ0A 2VO0A 5DPVA 5I3OA 4P5ZA 3C51A 4U5JA 2WQNA 4KKHA 3VUMA 3FYJX 4DEIA 5M51A 1YQJA 2QG5A 5CT7A 4IVAA 3WYYA 3R7OA 5CU0A 4R1YA 4TRLA 4AS0A 3N4UA 4DA5A 3HV3A 5DWRA 4FKRA 3I5NA 5CI6A 4C0TA 2R7IA 3V8SA 4G6NA 2VTAA 2XIKA 1M2RA 2YIQA 2BCJA 1WBOA 3ZDUA 3VWAA 4HW7A 5LJJA 2EB2A 3GI3A 3Q2MA 4J95A 3RTPA 1Q8UA 4N70A 4EH6A 4CYIA 3R28A 4ENYA 2R3NA 3KCKA 3OZ6A 4TYHA 2BRGA 4DCEA 4JT3A 2F2CB 2V0DA 2W1EA 4FSNA 4KSPA 2PZPA 3QCQA 4O0TA 4RJ7A 5I9UA 1KE5A 4O7WA 4MF1A 4EOSA 3EQDA 2PVYA 3VHKA 4XG9A 2C5OA 4G5PA 3IW8A 3GC9A 5KHWA 2ETMA 1XH4A 2QO9A 2WTKC 3PZEA 5JZNA 4DAWA 3GBZA 2B52A 3BLHA 1ZYDA 3LIJA 4AT5A 2I0VA 1O9UA 4NJ3A 4APCA 4ANSA 2E9UA 4B9DA 2VGOA 4E5AX 1OECA 2P4IA 2W1CA 2JC6A 1RJBA 2RFDA 3FMEA 2JDVA 3N9XA 2BAQA 2Y7JA 4RG0A 3SW7A 3VNTA 3BYUA 4FG8A 2CGUA 3AC2A 2PUNA 2HWPA 4EH8A 5CVHA 3ZU7A 4EOQA 3TV7A 4G31A 4RLLA 3H9RA 4AOTA 4XV9A 1NW1A 2GQRA 5AUXA 3LMHA 4EOPA 2UW7A 4R77A 3ZEPA 1Q8TA 3MVLA 3ZLSA 3OOMA 3NUPA 2C30A 4KIKA 3E5AA 3HAVA 4B7TA 5DT0A 3LCDA 3POOA 3FMKA 3Q3BA 2UW0A 3E62A 5EI8A 2PUUA 2XK8A 1OL1A 3CD8A 4U44A 5E4HA 4CV9A 4BJJA 2VO7A 1MUOA 4QPSA 5EW8A 4ZEGA 2WQMA 3TTIA 4ALUA 5HBJA 2YDKA 3KXNA 4I1ZA 2ITVA 2VTTA 4XS2A 4HCUA 5AM7A 2WU7A 4QTAA 5FRIA 5H2UA 3FJQE 4RWIA 2RSVA 4EK3A 4XG7A 1MP8A 2UVZA 1VLRA 3F66A 1U46A 4FZDB 4WNOA 5H8EA 3LLAA 2XNMA 4TYJA 3HV4A 4QD6A 2HK5A 2H96A 2Z7LA 4WHZA 4BGQA 1ZY5A 4DITA 5FTGA 3EN9A 4IC8A 1JAMA 4D4YA 1PYXA 1KOAA 3FXWA 3VW6A 4E26A 4ALWA 3IOKA 3GT8A 4WUAA 2HWOA 4PDOA 4C4EA 3CQEA 4IZ5A 4QMQA 2G2HA 3ZM4A 3SG9A 1WBTA 1U54B 2B9FA 3NAYA 2ITUA 4FV9A 1YHSA 2HCKA 1P4FA 3EKKA 2IG7A 3O71A 2PMIA 4FSZA 3W10A 4DG0E 3MB6A 4GW8A 3DLSA 5IA2A 5IH6A 2GCDA 3QC9A 4XG8A 2Z7RA 1GIHA 4NW6A 4YPSA 1JPAA 4U43A 1VYZA 2BDWA 4Z55A 1PMNA 4JR7A 4FVQA 5IA4A 3PVGA 4FF8A 1YOLA 2NRUA 5GJDA 5HLPA 5HCXA 4XG2A 3KXGA 4XEYA 4JXFA 3P79A 3WI6A 3E92A 5HTBA 1O6LA 3G9NA 3QRTA 4O2ZA 4I0TA 4FT3A 4BTFA 4KNBA 1M52A 4G1WA 1M7NA 4RRVA 2JFLA 4MH7A 3NZ0A 4WNMA 2WFYA 3QA0A 5DHJA 3FPMA 4GFMA 4O84A 1I44A 5FGKA 4D2TA 2VTNA 2UW4A 5CAVA 2ZV8A 4F0FA 5I9XA 5J7BA 5M4FA 1G8KA 3FV8A 4RVTA 5ANDA 4QP2A 2QNJA 4YBKA 2G2FA 4WT6A 4ZAUA 3IG7A 4FL2A 1X8BA 3QZIA 3ZCLA 3MY5A 2X8IA 5HG7A 4L7SA 4OW8A 5IQAA 3ERKA 1DAYA 3OWPA 3DDQA 4G17A 5ITAA 3BKBA 1W2FA 4IB1A 4ANOA 3AGMA 4AQKA 4I6FA 2Y8OA 4IAKA 4BBMA 4RSSA 1OL2A 2G9XA 3KN5A 4A06A 1SZMA 2W1ZA 4BYIA 3TXOA 4YHFA 2ONLC 4H1JA 1Y6BA 5L2QA 4H3PA 4YHJA 4EORA 3JY0A 1SM2A 3HMOA 1UU7A 5CASA 1YOJA 4H1MA 2Z60A 4AW5A 2IPXA 2WTKB 4U6RA 2QONA 4Y46A 4O91A 2QHNA 5IA5A 4O2PA 2BPMA 3AD6A 3BWJA 3DZOA 1H8FA 5CSPA 4FI1A 1W7HA 2OG8A 3R1NA 3HGKA 3QWJA 4KKGA 4YLJA 3KVWA 5TT7A 4EEVA 4S30A 4FL3A 2GS7A 4CZUA 2I0EA 4G6LA 4GK3A 3LMGA 4R1VA 1H26A 4CGAA 5K5NA 4U9AA 5CXHA 1AQ1A 1P2AA 1Q99A 2QKWB 3M1SA 2C5NA 1K2PA 4M97A 2VWYA 3B8QA 3L8XA 4QMVA 5HG8A 2B4SB 2BILB 4ZJIA 4ZZNA 5A3XA 3P7AA 5J5SA 3OEFX 4FTOA 5DMZA 3QX4A 1IASA 3NMUF 5EH0A 3WF5A 2QHMA 3PFQA 4K0YA 4L8MA 4QQJA 5AX9A 4F09A 2W5BA 2OW3A 2G2IA 1ZMUA 3DBFA 3F5PA 4D4RA 3HV5A 4NK9A 4E4NA 4MUQA 2BIYA 5TOZA 2F7ZE 3MPMA 1WVWA 2IJMA 2BROA 3F6XA 5EKOA 5AR7A 3HA8A 3HV7A 2XK7A 4XUFA 3UVPA 2R3IA 2YM4A 3ZM9A 1W83A 3QBNA 4MNEB 3IECA 2KULA 5HD7A 3QTWA 4BDKA 3HYHA 4QMMA 2PZ5A 2GTNA 2XF0A 3COHA 1REJA 1UWHA 1Q41A 1SMHA 3LFBA 3ORXA 2PE1A 4O0WA 4TNDA 4XHKB 4D0XA 3EIDA 3JVSA 3CR0A 1CKPA 3UMWA 1IRKA 3EZRA 1H28A 4YZNA 2UVXA 3TNQB 4ZJVA 4NM0A 5J7HA 1V0BA 3ZFXA 5LVLA 3PPZA 3PWYA 1U5RA 4O7YA 3JVRA 2OF4A 3KC3A 1QPCA 4LRMA 5ETFA 3IDCA 4FT9A 4GYGA 3QFVA 4FC0A 4EHZA 3V6SA 2WU6A 4E93A 4FEQA 4J7BA 3D5WA 2QURA 2BIKB 4LI5A 4P4CA 3KU2A 3EQGA 2JKMA 3BU6A 3D7TA 3TCPA 3UJGA 3GENA 4AN2A 1PXOA 4P90A 5CAPA 1BKXA 2VWBA 1TQMA 4UYNA 3H0YA 4DHJA 4NU1A 4M15A 1R78A 5AWMA 4FOCA 4R3CA 1JKKA 2X6DA 4AUAA 2C5VA 3GGFA 5ETCA 4FGBA 5CVGA 1UVRA 4DH1A 3IO7A 2GHGA 3QLFA 3R8UA 3R9DA 4LDTA 5CF6A 3NFGB 3TG1A 4KBCA 4EOJA 1PHKA 3ULIA 3AC3A 3DB6A 4N57A 4RWKA 2QU6A 3EKNA 4G3CA 3W2PA 4KIQA 3BYMA 3WZDA 4BDHA 3LOKA 3TDWA 2I1MA 3D14A 3OG7A 4HNIA 4EHEA 3F2RA 5DGZA 5KHXA 5HKMA 4FSTA 4I5PA 4BFMA 2WTJA 2NNWB 2O64A 5A46A 4KS8A 3WF7A 4D1ZA 2E2BA 5D1JA 4O4FA 3KULA 3MH2A 3A8WA 3BZ3A 5DYJA 3DK7A 2J9MA 2AC3A 5J8IA 1URCA 3R7UA 4FGRA 4DEBA 3KY2A 5DT4A 1PKGA 4UY9A 4CFFA 3SRVA 1QPJA 4DN5A 1ZARA 2R3MA 3MFRA 5EM8A 4LMUA 4TYEA 3RKBA 2JDOA 4LRJA 3VJOA 4KWPA 3CLYA 3L8PA 3PG3A 2PPQA 4I6LA 4LV5A 4FSRA 4RFYA 3VS4A 4FIJA 2C6TA 2IVUA 4AXFA 4QMTA 5CEOA 1REKA 4W4WA 2OJJA 3QQKA 2SRCA 2AQXA 4V05A 4EL9A 5IH5A 5CLPA 3HMNA 3DV3A 5FXQA 4G9CA 2Q83A 4A7CA 2W9ZB 3FC1X 4W4VA 1GAGA 4BCQA 3W2QA 4E6QA 5G6VA 3R7YA 1W84A 3QXPA 4U45A 4JG7A 4JQ7A 5JQ5A 1OITA 2AUHA 4X3FC 4APPA 4IJ9A 4LL0A 5A4CA 2GFSA 3C0HA 4RIOA 1JNKA 3OROA 4LOQA 4JQEA 3WZUA 4CEGA 4L53A 3CEKA 4DH8A 4W4XA 5HO6A 2C47A 1UU3A 4G3DA 4ZTMA 3PRFA 3VAPA 5DR6A 4MYGA 3FSFA 4IVBA 3RBWA 2WEVA 3GXLA 4ITJA 5E8TA 2BKZA 4YBJA 5HTCA 3UQCA 1Q5KA 2J4ZA 2JBOA 2RL5A 4ASZA 5JT2A 4DDGA 4LOPA 3JUHA 3Q6WA 3EL7A 1J7IA 5FD2A 5C8NA 3FKNA 4AACA 3T9IA 2P2HA 3EN6A 3OVVA 4PF4A 4AU8A 1NA7A 3ZTXA 4YJNA 1PXJA 3HUCA 5E8YA 3KF4A 3F5XA 4ZS4A 4FNZA 1YW2A 2WB8A 2WTCA 3D2IA 4D2PA 2W1HA 3OXZA 2GNLA 2X8DA 4GV1A 4FSQA 3S00A 5CNNA 5BVNA 4CG8A 4CMUA 4Q2AA 2GHMA 4O0UA 2GNFA 4PMSA 3OXIA 4FR4A 3U4WA 3NNWA 1H07A 4W8DA 5TR6A 4AX8A 1Y57A 4D1XA 2J0KA 3TIZA 3H0ZA 3DJ5A 4IZ7A 4M84A 1YI3A 3LJ0A 3NWWA 3R63A 3R71A 4FKGA 5DOSA 3SX9A 1NVRA 3VUDA 3LJ1A 4RZVA 5IH4A 3P7BA 2VGPA 2X39A 3FLZA 4D2SA 3QQHA 3RNYA 1QL6A 3CC6A 3NSZA 4RJ6A 2PVRA 2C6OA 5BMMA 3BQCA 2PSQA 2C6KA 3JS2A 2GQSA 4R7BA 3RAWA 4ASEA 1A48A 2C0OA 3FZOA 2YLEA 1UV5A 3CGFA 4RPVA 2XZSA 4U3YA 5IPJA 4AN3A 2OXXA 2ZB0A 1LEWA 1GNGA 1Q3WA 2XB7A 4G3GA 3L9LA 3O0GA 3ZZWA 3ML1A 4FTNA 4QRCA 4CV8A 4IFCA 4RQKA 3RI1A 4ERWA 3BYVA 1ZOEA 3I81A 4BDDA 3NYNA 2OSCA 4H39A 2BDFA 2WTVA 3ZRKA 4S32A 2QU5A 4Q5EA 2IVVA 2XKFA 3EQPA 2W96B 1RE8A 3I6UA 4FT7A 4WKQA 1LR4A 3R7VA 1YXSA 3O23A 3O2MA 4A9UA 2QOBA 4XV2A 1F0QA 4C3PA 3W0MA 2V22A 3QD0A 3PE2A 4YZCA 4W9WA 3OTUA 3RMFA 4C35A 5AV3A 1W8CA 1Y91A 2RFNA 4IAYA 3I7CA 3AC4A 4NJDA 5EW3A 2F49A 4ONAA 2ZFYA 3O96A 4FV0A 2XYNA 4D58A 4E6DA 5EI6A 4QOXA 5CEPA 1L3RE 3QD4A 2Z7QA 3TV4A 3D94A 2X0GA 3E8EA 3R9NA 4F9CA 4PPAA 4LFIA 3KK8A 2GTMA 4PDPA 4ANNA 3W2SA 4QP8A 3VBYA 5KUPA 5M55A 5BVDA 4QMWA 3QKLA 1UKIA 5JFSA 4AXDA 3RPOA 5CYIA 2I0HA 3QD3A 5CEKA 4MTAA 3ZUVA 5CAUA 1J1BA 5KBQA 3BL9A 3REPA 4YSMA 5TO8A 3GQIA 4MAOA 2CLXA 3LJ2A 4JR3A 3DAJA 4PRJA 4EH2A 4OBOA 3UIBA 1KV2A 4PX6A 3I7BA 3WYXA 3ENMA 3DA6A 4UWBA 5F94A 1OZ1A 5I3RA 3C4FA 1ZZ2A 3NYVA 2G15A 3IK3A 3G15A 2YIYA 4M0YA 5CQWA 5HQ0A 2O0UA 3R7EA 3PA4A 3QXOA 3W0OA 3L8SA 2YZAA 4KIPA 2W4KA 4X3FB 5HESA 1FVRA 4QYYA 3R8LA 3WF6A 4C61A 3TJCA 3ZMMA 3CTHA 3RM6A 4Y8DA 2QR8A 3KRXA 1MQ4A 4XNEA 3ZUUA 1M14A 3ENHA 3GUBA 5J95A 2PUPA 3ZLWA 4I4FA 3VQHA 4PTGA 4D55A 3ZLXA 2AEGA 3EHAA 4FL1A 4D5KA 4J71A 5E1EA 3DT1A 3R8VA 1PY5A 3R04A 3DAEA 2H8HA 4BWXA 3BE2A 2IO6A 2WGJA 4MXYA 2BRMA 2RFSA 2VTJA 4QYGA 5HD4A 4YHTA 4O7VA 1XBCA 5DIAA 3VUGA 2JGZA 3ELJA 3MVHA 5JZJA 4RJ3A 2PTKA 4FKQA 2YA9A 4LRKA 4UYAA 4JG8A 4RX9A 3ZEWA 4ACCA 1H00A 4IH8A 5D11A 3F7WA 2PL0A 4HVDA 3NGAA 2GNHA 5B2LA 3UP2A 4I5HA 5K4JA 5M4IA 3ZZEA 1OPKA 4EK8A 2XK3A 3C5IA 2HW6A 2BZHB 3SQQA 3Q9WA 3F82A 3O7LB 2PHKA 4FRFA 3CKWA 2XM9A 4GUEA 4EC9A 5M53A 2RIOA 4QTCA 1ZMVA 2OZAB 4NCTA 4OT5A 4QMZA 4FSWA 4D4VA 4DTKA 4IX3A 5LARA 4E4XA 4TKSA 4TWCA 5AV4A 5E90A 4DTAA 4K1BA 3KFAA 3W0PA 2QOQA 3ODZX 3OF0A 3T3VA 4ZMEA 2BZJA 4L6QA 4RIWB 5HNBA 1WAKA 1WZYA 3CPBA 5CAQA 3FMHA 3Q5ZA 3UYTA 2PE0A 5AP0A 3T9TA 2XVDA 3SDJA 2WEIA 4DFBA 4YMJA 4N6ZA 3FZRA 2VWUA 1G8SA 3TTJA 4XLIA 2C4GA 2WXVA 2FSTX 5FP5A 3COKA 5D7VA 3H3CA 4F9BA 2W5AA 3ORZA 3LFNA 3BYOA 3BEGA 5EHOA 2WMUA 3GOPA 4QQCA 3NW7A 4IIRA 4XG3A 5K4IA 4V01A 1SNXA 2WQOA 3Q9ZA 2XEYA 4OR5A 3TT0A 3NNXA 3QZFA 4YURA 5HX6A 4BCPA 1FBNA 2OLCA 3QL8A 3F5GA 4JOAA 5DEWA 3KK9A 3WZEA 3SOAA 3F3ZA 4GK2A 4I24A 4DYMA 3PXYA 4WIHA 2CN5A 5FG8A 3FI4A 3GCPA 5JFXA 5BVKA 3PJ8A 2EU9A 2R4BA 3I60A 4FKTA 4F7LA 4WG5A 3PY3A 3LFCA 2GNJA 5LMAA 3UGCA 1GY3A 4QPAA 5KMKA 2WMWA 2J0MB 2YITA 3LFQA 3A2CA 2OJIA 4OTRA 4QYFA 4CMOA 4CT2A 3CPCA 2CNQA 5CEIA 3K3JA 4IMYA 4YLKA 2BZKB 2W1DA 5CVFA 4O21A 3UZPA 5DA3A 3PA3A 3PSDA 3AT4A 3EOCA 4BCHA 4C7TA 3Q4ZA 5JK3A 2C3JA 1G3NA 5ACBC 4C2VA 4B0GA 3HECA 1SVGA 3MS9A 3DKFA 2NPQA 1A9UA 1Y8YA 2GQGA 3GCQA 2IVTA 2J5EA 3DXNA 5CXZA 3A99A 4FUXA 4EH7A 5CAOA 4CTBA 2CNVA 3AXWA 2ZMCA 3EQCA 3LZBA 1ZAOA 4FK6A 2XIRA 4XJ0A 4A9SA 4YJQA 3HKOA 1UNLA 5GJFA 1KOBA 5LWMA 1Q97A