3F7ZA

X-ray co-crystal structure of glycogen synthase kinase 3beta in complex with an inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
350
structure length
339
Chain Sequence
b'LSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogen synthase kinase-3 beta
publication title Design, synthesis and structure-activity relationships of 1,3,4-oxadiazole derivatives as novel inhibitors of glycogen synthase kinase-3beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 339
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3f7zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3f7zA01
2X4FA 1GIJA 3AGMA 3NAYA 3VBTA 2OFUA 3BHYA 4FZ6A 3ELJA 4PP9A 4FTJA 4GG5A 4WG4A 1ZY5A 3R1SA 5CTPA 3FE3A 5CVFA 1H1QA 4PPCA 4ZK5A 3ZEWA 1GIIA 4BCFA 3BLHA 3OW3A 3V3VA 1YXVA 3UMWA 4LM5A 5EHYA 4NW6A 4AAAA 4CTCA 1NA7A 3PJ2A 1M7QA 4QYFA 1OUYA 3VUHA 3BGQA 4FIFA 3TZ7A 4XLIA 4EZ3A 5J1WA 5DE2A 3T3VA 4FSQA 2YISA 5IDPA 5DRDA 5GNKA 3FI3A 3SXSA 4BI2A 4S34A 4M69A 3ANQA 4OW8A 4Y8DA 2GNHA 4E6QA 3IGOA 3HLLA 4QTAA 2G1TA 5CAPA 2BZHB 3IW5A 3AXWA 2XIKA 3DAKA 5EYDA 1VYWA 3UQFA 4RFMA 4DTKA 4WRSA 4M15A 3FZPA 4YZDA 2YAAA 2HWPA 4C4GA 4AU8A 3VUMA 5HNBA 4CKRA 3P0MA 5H8EA 5IEVA 5JMSA 3PE1A 2BHHA 3QFVA 2A19B 2X9EA 4X3FA 3QQKA 5FTQA 1M2QA 2JAMA 4AA4A 3QXPA 3VS3A 3VS7A 4FC0A 2YLEA 5DEWA 4AT3A 3IW4A 4EOJA 3R1YA 3RGFA 3MH3A 3CSVA 3W32A 3FI2A 3F5XA 4BYJA 4F6SA 4PMPA 2IW6A 4JR3A 1H01A 3PPJA 5DWRA 3W33A 3QHRA 2WHBA 5KZIA 4FV0A 4IACA 4TTHB 2CGVA 1RE8A 1PW2A 4IFGA 2F9GA 4OTWA 4XG3A 4CXAA 5TE0A 5F1ZA 5EYCA 4O38A 5LARA 4F65A 5FTGA 3W16A 3QZFA 2WB8A 4WRGA 4IVCA 3CQWA 3OS3A 3EQHA 4EK3A 2FVDA 1OPKA 1S9JA 5DMZA 1JSUA 1O6KA 2XK9A 3C4ZA 1OZ1A 2WU7A 2XJ0A 5AUTA 4JL9A 5HX6A 1YXUA 4G6LA 4BB4A 4KAOA 4CMUA 5IKWA 4XH6A 5J7HA 3O8PA 4BCHA 1CKIA 3EFWA 4O7YA 4FSZA 4FVQA 1DS5A 2FGIA 4JS8A 4MK0A 4G16A 5J1VA 2ITTA 5FBNC 2CKEA 2R3NA 5AM6A 4ACDA 4UWBA 5KBRA 3KXXA 4XYFA 4O0WA 3ZHPC 5IQAA 4XS2A 2JLDA 5KMJA 3PSBA 3RNIA 3BEAA 5FRIA 3WOWA 4EKKA 3SRVB 1VEBA 5JK3A 3IQ7A 4CQGA 1ND4A 2XJ1A 5L2SA 3UE4A 1H1SA 2E9PA 3HRFA 5JQ5A 4D4SA 2QOCA 4BL1A 2GHGA 3VO3A 4O0VA 4MHAA 1DAYA 1WBTA 1F0QA 3DQXA 3PJ1A 4G3FA 4E5BA 2NRYA 4O81A 3GGFA 4FT5A 2GNLA 4JIKA 4E73A 5DFPA 3OT8A 2EXMA 2HYYA 3UJGA 4F08A 1V0PA 2RIOA 1REKA 4I5CA 4JRVA 4KRCA 4EJ7A 5H3QA 4RIXB 1OKYA 3ZFYA 1MRYA 4I4EA 2ZMDA 2O3PA 4DTBA 1ZWSA 4LGHA 3ENHA 4I1ZA 1WBWA 2UW9A 4R6VA 3VW8A 1GAGA 4YC3A 4D1XA 4KUJA 3PXFA 1GZNA 4CKIA 4U79A 1XQZA 4O7ZA 2FSTX 1WFCA 2PUIA 4NYEA 4DYMA 4FV1A 3SC1A 5D1JA 4ZTMA 4YTHA 5T68A 3UOHA 1XWSA 5AP1A 4K18A 3BU5A 4ZIMA 4AZTA 3IDCA 5GIPE 5FM2A 2OJFE 2VAGA 3EQGA 3NYVA 4D4YA 4UMRA 1JKSA 4FV7A 5I9YA 1Y6BA 3HMMA 4R7HA 3VUIA 4OTIA 4O7NA 4FVRA 2YEXA 4TY1A 5IMXA 4AGUA 2ZV8A 1Y8GA 2JBOA 2VU3A 3FY2A 4G2FA 3E63A 4BTKA 5IF1A 3HL7A 4GRBA 4R77A 4TWOA 3KULA 2QCSA 2A27A 2Z2WA 3QF9A 5JZNA 3RALA 2I1MA 3OCBA 3N9XA 5I9ZA 2ZB1A 4X21A 5CU3A 4F9CA 4Z16A 1BMKA 5LOHA 4DH8A 4BY9E 2GS7A 4OUCA 3EQIA 2AC3A 5HCYA 1YHWA 3SA0A 1PMVA 2I0VA 4R5SA 1UV5A 1YRPA 2C6IA 4C33A 2RG5A 3DQWA 3FZ1A 4J8NA 4M67A 3MN3A 3G0EA 3LFBA 4MXXA 4RX9A 2Z7LA 3ZMMA 4GU9A 3ZSIA 2EWAA 4YJNA 4HZRA 2UW4A 4MCVA 2W05A 3DNEA 3KRJA 4IX4A 4GV1A 4LV5A 4EH6A 4L8MA 2XNMA 3PY1A 5CSHA 2WAJA 3BI6A 4XG4A 3FL5A 4AE6A 5LVMA 4JQ7A 4JT3A 5LMBA 3UG1A 4KBKA 3S2PA 3U55A 2X8IA 3FJQE 1SVHA 4AZFA 3O96A 2OIDA 3PA4A 1APME 4J96A 4NM3A 3VUDA 3O51A 3L9NA 4HGTA 2BROA 3CCNA 3S0OA 1XH6A 3A99A 3KCKA 4I4FA 2ONLA 3CR0A 3C9WA 5AJQA 4BCMA 1DI9A 4CT1A 3WZJA 4GJ2A 3EN7A 2AYPA 3GOKA 3LQ5A 2R3OA 4EOQA 3AC2A 3W2OA 1LEWA 5DR9A 5AUYA 5IUIA 3ZU7A 4YJVA 4AFEA 4EZ5A 4IM3A 4R1YA 2F49A 3REPA 4C61A 1U5RA 2ETMA 3KK8A 3ZO3A 5BUEA 4PNIA 2GFCA 4BFMA 4ANBA 4I6HA 1SM2A 4EOKA 5HE3A 2HXQA 2WTVA 4DEIA 4ZTQA 3NVKI 4H05A 3DCVA 5K4JA 1IA9A 4MNEA 4TYJA 4OTPA 3F2RA 4HGEA 3I1AA 4O7RA 4OTRA 4WKQA 2WMUA 1Q41A 4GS6A 1H25A 4IH8A 2J9MA 2CGXA 3SQQA 1YWNA 4RRVA 4EH9A 2WMVA 3OC1A 3E3PA 2UZLA 5A54A 4GG7A 2YLFA 3G9LX 2C0OA 3QTIA 1ERKA 1GNGA 4L52A 3VS0A 4H39A 2ZM3A 4RPVA 4F9AA 2O64A 2OGVA 4XEYA 1TKIA 2YDKA 3EL8A 3H4JA 5BVNA 3C50A 4HZSA 2R3RA 3IDPA 3OW4A 4ENYA 3D5UA 3HRCA 2OZAB 3MIAA 4FICA 2UZUE 1Q8UA 2C47A 4JXFA 4QMNA 3QD3A 2VTIA 5CVGA 4WG5A 1DM2A 3FBVA 4OTGA 4C58A 5H8BA 4XV2A 3ZLXA 5C8KA 5HU3A 3NNWA 3QGYA 4O7SA 3RK5A 3ZLYA 3FMDA 1F3MC 2FYSA 5IMEA 4MBLA 2NO3A 1XO2B 3L8XA 5LXMA 3LJ1A 4BDGA 1UVRA 2XKEA 3MA3A 4E93A 5L4QA 4D2RA 5HO7A 1LEZA 4R8QA 2WMXA 4FTIA 2ETRA 5IISA 4ORKA 2P3GX 3RK7A 2H96A 5EKOA 3EQBA 3NSZA 5IQHA 4CFVA 3C7QA 2YM6A 4ZS0A 4DN5A 4PPAA 4E7WA 4UY9A 2I40A 2VWBA 2JDSA 1Q8WA 4BDIA 1MP8A 1KV1A 2FO0A 4E4XA 3DDQA 1PXJA 4FIGA 3COHA 1IASA 1Q62A 5FP5A 1PXKA 4NEUA 3BYMA 3DV3A 2X0GA 3WZUA 4KRDA 5JN2A 5L3AA 5CEQA 4E4LA 4EHZA 3NUSA 3DKFA 1ZYSA 2WTKC 4TN6A 4GK3A 3A2CA 4WT6A 4BBFA 2ZDTA 4CMOA 3U6JA 2O0UA 4GSBA 2ZOQA 5TOZA 4L45A 5AEPA 3EMGA 2J6MA 4B99A 5GZ8A 4HVIA 4FEUA 3SW7A 4RX8A 1LUFA 3V04A 4YZMA 3GFEA 3ZZEA 4EH4A 3QWKA 4G17A 3S4QA 4FTOA 1OIYA 2VZ6A 5CANA 2OXYA 4BWPA 3BZ3A 3R9RA 3ZTXA 5IA3A 4RWLA 2O65A 3LFDA 4JRNA 4JDKA 3MPAA 4KIQA 2WMTA 2R3KA 1LP4A 4AP7A 2RG6A 3DB8A 3E88A 3QXOA 4NIFA 5HVJA 1UNHA 4LMUA 3SDJA 2RFEA 4D9TA 1OBGA 4WD5A 2CKPA 2YCRA 3QRIA 4FGBA 4EKLA 1XH7A 1KE8A 3GC8A 3RBWA 4FKIA 5M4UA 2G2IA 1U54A 2YJRA 3EYGA 4F6WA 1JVPP 2XK6A 3DBFA 3LXNA 4HNIA 2UZDA 3FC2A 2PMLX 4EOPA 3V01A 1P4FA 4CV9A 1RQQA 4G31A 2PY3A 4FEWA 5GJFA 4MF1A 3GEQA 5BVKA 4DFYA 3A8WA 4O1PA 3GUBA 2VX0A 3ORZA 3ID6C 4B9DA 1QMZA 1UU9A 3QCSA 3DPKA 3FL4A 3KVWA 5DR2A 2W1IA 3K5UA 4IWPA 2QVSE 4OT6A 1YOMA 3WE4A 3HVCA 4GVAA 2YM4A 4UWCA 4CFUA 3R2YA 2ZDUA 5HIDA 4FZ7A 3QA8A 4GT4A 4GEOA 1MUOA 4NTTA 1EH4A 3BELA 5KCVA 1BX6A 2Y4IC 4DLIA 2GHMA 3NUUA 3QKMA 3VBWA 4D0XA 3UPZA 2X6EA 5JZJA 1PYEA 4L3PA 3EHAA 4LFIA 4U80A 4ACHA 5CF8A 2OJIA 2VWIA 3R9OA 5HEZA 3KQ7A 3RWQA 4U40A 3UG2A 4G9CA 2XM8A 4AE9A 3PYYA 2UW6A 3V6RA 3CGFA 2VNWA 2YABA 3UNZA 3R8PA 3K3IA 3UP7A 5HQ0A 3LCSA 2IW9A 4AG8A 5BX0A 5BVEA 1YXXA 5GZ9A 4HCTA 2DYLA 2EVAA 2F57A 2PZYA 5E8XA 4KA3A 3TT0A 2BDWA 3KXHA 1H00A 3PTGA 1OI9A 1B38A 4O2ZA 5CVHA 4DGNA 5HLNA 5LVNA 3R0TA 4FIHA 5ANIA 1F5QA 3E7OA 1OKZA 3L1SA 4U0IA 3VF9A 2Z7QA 4CRLA 4BF2A 4CTBA 1G8SA 2QOQA 4GT3A 3HDNA 4EI4A 3TNIA 4QT1A 3SAYA 3A7HA 4IWQA 1G3NA 3OCTA 3MVLA 5HNIX 2IVUA 5CSXA 3WF5A 3SW4A 2BUJA 1OB3A 4R7IA 3LKMA 3DA6A 4L7SA 4MD8E 2KTYA 3ET7A 2UVZA 5ANDA 4DFXE 2ITZA 3L9MA 5CAQA 5CLPA 3OWPA 3Q4CA 4BHNA 3CY2A 4FSRA 2GTNA 4QQCA 5L8LA 4GK2A 5FWKK 3FV8A 5A3XA 1WVWA 2OF4A 1JQHA 3UNJA 2JC6A 3QQHA 4AN3A 1YOJA 3OBGA 4C3RA 3M11A 4QP9A 3QL8A 5EM5A 5DA3A 1V0BA 3KB7A 4ZLYA 5HCXA 4DT8A 3MS9A 3IW6A 5AWMA 4AZVA 4WUAA 4XG7A 3HDMA 4D55A 4BDHA 5JGDA 5M09A 4D28A 3F3WA 3TV4A 1JKLA 1K2PA 3BWJA 4LOOA 3DTWA 3GCVA 4FSYA 1H1WA 5E8UA 4PY1A 2BALA 3DBEA 3R8LA 1JSVA 2PZ5A 4JI9A 3ZRKA 4C0TA 1W98A 4EHGA 3UNKA 3LFSA 2IPXA 2BTRA 5IQGA 4C35A 3KGAA 3VULA 1R1WA 4HGSA 3ZDUA 3ZZWA 4AACA 2PVMA 4OBPA 4EBWA 1BI7A 2VWWA 3ITZA 1J1CA 1SMHA 5E8WA 4H1MA 5HGIA 4TT7A 1ZYLA 2VGOA 5AUXA 4BBEA 3GQLA 4ZJJA 4TXCA 4UYNA 4AA0A 4RQVA 1P14A 1YVJA 5IA2A 3Q5ZA 5CEMA 1AD5A 3C13A 5GINE 3OG7A 2ZM1A 4JX7A 3VS1A 3FI8A 1OMWA 2WEVA 3U87A 4PTEA 5B7VA 4ZY6A 4J95A 3KXMA 4M0YA 3BE9A 1Q99A 4WNKA 2B9HA 2QOFA 3O7LB 3OWKA 5D7AA 2ZB0A 4RIWA 4EH5A 4ID7A 3V5PA 3VBVA 4CKJA 3HMNA 2WTDA 3RPYA 3C51A 3FHIA 5L2QA 4BYIA 3F3UA 3WIKA 3RI1A 4ERWA 4I0RA 5GZAA 3TKHA 4FTKA 1ZYDA 2YWVA 4HOKA 2W9FB 4JG6A 4ACGA 2A0CX 5HI2A 2HY81 4D5KA 3ODZX 2PL0A 3EN9A 3RAIA 3R8VA 3RZBA 3AT4A 3LCTA 4IM2A 4K9YA 4NWMA 2F2UA 4NT4A 4C59A 3V5LA 3LM0A 5IQCA 1V1KA 2XMYA 4AS0A 3UTOA 4AZEA 2Y8OA 2VO0A 4QMUA 2QOHA 4YBJA 2B53A 4YNOA 1PMUA 1YHSA 4JAJA 2UZEA 3QTZA 4QMMA 1W83A 3RNYA 4G3CA 4GVJA 4IC8A 2XNNA 3OWLA 2GNJA 3CPCA 3UOJA 4JAIA 3A4PA 5JQ8A 3BCEA 3RK9A 3C4CA 3NW7A 1XR1A 3I7CA 4ANMA 4DA5A 3R7GA 5IDNA 3DFAA 3QKKA 2ITQA 4U41A 1UA2A 2H6DA 3JUHA 5J95A 3SKCA 1KE5A 3TIZA 4DGGA 5L2TA 3DNDA 5K5XA 5CNNA 5I9UA 3NMUF 2YIYA 4G6OA 3NUPA 4GMYA 4XOZA 4AFJA 2WTWA 2XIZA 4FEXA 3FZOA 4RVMA 2I0EA 1H27A 3R1QA 2BZKB 4F9YA 3R00A 2XIYA 5CF6A 3KN6A 3H9RA 4AF3A 4BDBA 1BI8A 4E3CA 4UB7A 3ZS5A 4FEQA 2W4KA 5HD4A 4XP3A 3D83A 3FMMA 4R1VA 4HYHA 4DGMA 4EWHA 5DEYA 4DFNA 3EKKA 3KCFA 3HMIA 4N0SA 4DH3A 1YDSE 2EXCX 3ACKA 1M52A 3E7VA 3QQLA 4MD7E 5EQPA 3LQ3A 5HE2A 5BVWA 4WOVA 5L8JA 3ZSGA 2VO7A 4K33A 4QTDA 3SX9A 2HOGA 2BIYA 4RIYB 1JLUE 2R64A 3ENMA 4EK6A 2CCHA 3P78A 3GENA 2VWZA 4QP1A 1IEPA 3IECA 4CLJA 1HOWA 5HTIA 3I5NA 3NUXA 2GMXA 4CT2A 3UIUA 2WEIA 1H4LA 2F7ZE 1FPUA 2CKOA 4CGAA 3H9FA 5J87A 1YKRA 4G34A 4YC8A 5CAVA 2B7AA 2B55A 4BDJA 3TXOA 4AW0A 2V22A 3OTVA 1IG1A 3VJOA 5AMNA 3G0FA 4IDTA 5E1SA 3W2PA 5E8YA 3COKA 2C5VA 4NCTC 2J5FA 4IAKA 4XCUA 3WE8A 3ZDIA 2G9XA 3DBCA 4RIOA 2DS1A 4XUFA 4UMUA 1W7HA 2W9ZB 3G15A 4FX3A 4BIEA 3R8MA 3E8EA 1QPJA 5I0BA 4LUDA 4O7VA 4WUNA 4RLKA 2YITA 3P1AA 5JFSA 3QU0A 3NS9A 1FVVA 4I94A 3C0IA 1YI4A 3OBJA 3PE2A 1E1VA 3ZC6A 3R7UA 4CG8A 3OCGA 3U6IA 4JVGA 4RX5A 4FV2A 4YHTA 5CU2A 3BQRA 4N6ZA 2W1GA 2GFSA 4BDKA 4C38A 4MAOA 4HVHA 2P2IA 5AV2A 2QOBA 2X81A 4KKGA 2C4GA 5ANKA 1OL5A 2GTMA 3HP5A 2HZNA 2F2CB 4HGLA 5DYJA 3VAPA 5E91A 5LCKA 3KL8A 3W2SA 4WNPA 2W1CA 3VVHA 5ANJA 2J0LA 2VO3A 2XB7A 3BLRA 4TWPA 2R7BA 1XH9A 2VGPA 4ONAA 4O1OA 1UKHA 4I41A 3W2RA 1PF8A 3O23A 3VS5A 4CQEA 5E1EA 2BZIB 3OMVA 4GK4A 4OTHA 5IPJA 3IOPA 2VD5A 3KY2A 3PXQA 4K8AA 5HVYA 3FMEA 3UYSA 1QPEA 1YHVA 4F7NA 3UO4A 5AV3A 2C1AA 3ERKA 5L2IA 3DK6A 2GPHA 2QG5A 2W1EA 2X2LA 2PVFA 2IWIA 1PRYA 3EQPA 2XS0A 3NIZA 3R30A 4QMSA 2RL5A 3AD4A 3KXZA 4DHFA 3QALE 4PL5A 1JAMA 2E9NA 3M42A 3S3IA 3UDBA 2YZLA 3QKLA 5CQWA 1OL7A 4QMOA 2QO7A 5HBEA 3QC4A 4Y46A 3UGCA 1I09A 3HP2A 3U54A 3RCDA 3EN6A 4HYSA 3BLQA 5AR8A 4H3QA 1ZY4A 4ZZNA 5A4TA 4G9RA 3TZMA 4DH1A 4K11A 4YHFA 3UMXA 2H34A 1H28A 3E8DA 3PIYA 4PDYA 4U45A 5C26A 3PRFA 2PZIA 4X2KA 3F3VA 4ASZA 4ZLZA 4EORA 4PDOA 5IQEA 4UMQA 5LMAA 4PTCA 1Q8YA 2V0DA 3BRBA 4O22A 5AUVA 1CM8A 5HG5A 4QTBA 3UOLA 3OEZA 5H8GA 4ERKA 2CNUA 3G9NA 5TR6A 2C6EA 4M3QA 4PWNA 3BEGA 1YXSA 3BQCA 1GZ8A 4NJDA 2I7QA 5ITAA 5AFVA 3UO6A 3FC1X 2B0QA 4FG8A 3E64A 3QCYA 1WAKA 2A4LA 4DFBA 4YJQA 3KXGA 3HRBA 3QBNA 4I23A 3GQIA 5AADA 3TN8A 1YWVA 2NRUA 3FZSA 2WIHA 2YCSA 4WNOA 4DC2A 1PXNA 1Q8ZA 2BRGA 5AUZA 4E1ZA 5JSMA 2WTIA 2OIBA 5FTOA 4JJRA 4FKUA 5BUIA 5BMSA 2R3JA 5H9BA 3VS4A 4BWXA 2XK7A 4TYIA 5CEIA 3RPOA 1ZOGA 2F7EE 4LUEA 4NCTA 4EH3A 5GIOE 2WOTA 4IB0A 2X7OA 4KNBA 1RJBA 4QMWA 4RJ5A 3VWAA 4QMPA 4F0IA 3WF6A 3GU6A 4O6LA 3R9DA 5DH3A 3CTJA 3LOKA 5EW9A 3NR9A 1H08A 4FNYA 4EWQA 1Q24A 4D4RA 4D2VA 3FMLA 2AUHA 2PVRA 1M2PA 3I79A 3VBXA 5KHWA 4AW5A 5M55A 2BCJA 3JS2A 3DTCA 4FSWA 3MH2A 4IADA 4IVBA 5HHWA 3FI4A 3MFUA 1DAWA 4I6QA 2C6OA 3P7BA 1CDKA 2ITUA 3QTRA 2CPKE 2YERA 2ITVA 2R3PA 4YHJA 5BQ0A 3KREA 4FSNA 4JBOA 4F7LA 2B9JA 2AC5A 1KSWA 2O2UA 3MJ1A 3QTWA 4ACMA 4JBPA 2XRUA 1GJOA 2X39A 4OAVB 4Q5EA 4IAZA 2UW8A 3AMBA 4YLLA 4HVSA 5CX9A 3D5WA 4AW2A 3U4WA 4ASEA 5ETFA 3R7VA 1QCFA 1Q8TA 4FT7A 5LWNA 1WZYA 4U6RA 1H0VA 4FUXA 4NKSA 2JD5A 1Z5MA 1WBNA 4YP8A 4OAUC 4QOXA 3A60A 1KV2A 2OFVA 2ERKA 3OP5A 4K2RA 5KX8A 3LCOA 2NP8A 4GFOA 4RZVA 3LAUA 3KU2A 3NYXA 3JVRA 4KIKA 4J99A 4BCIA 2F4JA 2R7IA 3G33A 3C5UA 3SHEA 1G8AA 3FLZA 4M7IA 2XKDA 4IX3A 3ANRA 3ORKA 2VTHA 3R6XA 5HG7A 3RAHA 1REJA 5C1QB 2YWPA 4OTDA 2Y4PA 4I0SA 5CWZA 5CF5A 3LJ2A 3V8TA 2C30A 2HENA 1URWA 2EB2A 2UZVA 3F82A 1NT2A 5BUJA 1FVRA 5A46A 4O0TA 5JGBA 4KKEA 2JIIA 4Q9ZA 1OIRA 2QOIA 2YIRA 3UC3A 3QTSA 4GYIA 5LWMA 3HAVA 4F63A 2XK8A 4E26A 5K9IA 2OJ9A 2VWXA 3H0YA 1UU7A 2YM5A 4J1RA 4PDSA 5G6VA 3SXRA 3TKUA 4H36A 4FTQA 3ZXTA 2YCQA 4RLLA 4V04A 3DT1A 4FKGA 2PMOX 4L6QA 4M0ZA 5HO6A 4IXPA 3Q6UA 4ALUA 3QLGA 4G3DA 4AOJA 2WTCA 3AT2A 4FI1A 3ORLA 2XRWA 4EYJA 2HZ4A 2LAVA 4R3RA 3EJ1A 4DEBA 4TYHB 4AX8A 3D5XA 4QP3A 3PVUA 2WOUA 5D9HA 3R7OA 2WGJA 3OCSA 2X1NA 4DEHA 3NGAA 1PKGA 3V5TA 4LGGA 4YJSA 5KMKA 2R3GA 5M08A 3FKLA 3D7TB 1UNGA 2Z7SA 3KMUA 4IAFA 2IN6A 1ATPE 1IRKA 3MBLA 2ZAZA 4NJ3A 1DI8A 1W84A 4FTRA 2W4JA 4FTMA 4TYGA 4FOCA 4X2JA 1WMKA 3LW0A 3VNTA 1Y91A 2PMIA 3QUPA 1UKIA 4JQ8A 1R3CA 3ZO2A 4AGCA 4EHEA 2R3FA 2XKCA 4I21A 3CPBA 1GOLA 3M2WA 3QGWA 5E8ZA 4NU1A 2HW6A 1RW8A 2Y6MA 1U59A 2VTAA 2VTRA 4CVAA 4HNFA 4X6RA 1ZMWA 2HZIA 4B0GA 2UZWE 4XNEA 2WIPA 5A4QA 4OTFA 2PUNA 4IAYA 4JQEA 4CRSA 3LQ8A 4S31A 3BPRA 3EZRA 2P4IA 3QC9A 3NYOA 5I3RA 3HKOA 3LFFA 3ULZA 3E92A 3NW6A 3F7ZA 3Q2JA 4AOIA 3FMHA 3U4UA 2CCIA 2OICA 5DN3A 3ORNA 1FMOE 4DAWA 4EK8A 1Q97A 4XRJA 1QPCA 4RJ7A 2XCKA 3R7IA 2C6DA 4F99A 4FL2A 5I9XA 4FKRA 3DXNA 1ZZ2A 2OH4A 3B2TA 3Q6WA 3ZLWA 3GT8A 5CZIA 3TJCA 2PUUA 1FMKA 4XP0A 4BVUA 2P2HA 3VF8A 4F1MA 3KK9A 5JFVA 2GU8A 1H24A 5CY3A 3ZSHA 2G01A 3EOCA 4ZSEA 3LFQA 4C34A 2PE0A 4AXAA 3ULIA 3BKBA 3OY3A 4UV0A 3A61A 4WHZA 4QPAA 5HBHA 4RJ8A 2Y6OA 4EOMA 5LJJA 3IONA 3OOMA 4Y72A 1ZAOA 4KB8A 3MTLA 4QMXA 4V0GB 3PRIA 3SLSA 3MSSA 2WMRA 2VN9A 4EONA 1J91A 3R02A 5DI1A 3ZXZA 2WNTA 3LCKA 2NNWB 3UZRA 1BYGA 3IDBA 3ORTA 2XIRA 4XJ0A 4JDHA 3PLAE 4BGGA 2GQSA 5HNGA 4U5JA 4DEEA 5CEOA 2RGPA 2BKKA 2PZRA 4WO5A 2WU6A 5FEEA 5LVOA 3KFAA 2E9OA 4BGQA 4IC7A 4CZTA 2QC6A 5E8SA 5HD7A 2PYWA 3LLTA 3P7CA 1ZMVA 2VTJA 2YIXA 4EOIA 3H0ZA 5F4NA 3ZRMA 4FE2A 5CQUA 2C5NA 5J9YA 5KNJA 2BILB 2XNOA 3A7IA 4O2PA 4PQNA 3EQCA 4K6ZA 3QRUA 5EOLA 5DR6A 3P9JA 4NM0A 4OLIA 4PP7A 1XBBA 4FF8A 4G1WA 4FTCA 3OF0A 4YJUA 1TQPA 1J3HA 2O63A 2CGUA 3Q4ZA 4BDDA 5KUPA 4ZY4A 2ZV2A 4QTCA 1Y6AA 3COMA 4MXYA 4GH2A 2R3IA 4YJPA 4N6YA 1R0EA 3OT3A 4U42A 1Z57A 3OXTA 5T6KA 2HELA 3PFQA 4DEDA 3GCQA 2HIWA 2WFYA 4AT5A 4BKZA 3CQUA 4MWIA 3ZM4A 5JGAA 2QQ7A 2XCHA 2JITA 5M4IA 4O0RA 4EYMA 2WZJA 3FMKA 4NZWB 4A9TA 4C8BA 3JY9A 4CFMA 5M4CA 4BR3A 3KMWA 3I4BA 4C4HA 4D0WA 1IAJA 4ZS4A 3R2BA 2VTLA 1OECA 2WD1A 3OROA 2HW7A 4FSTA 4FV8A 4JNWA 5HLPA 4U8ZA 3HMOA 3R73A 4NM5A 3UO5A 2V62A 3PG3A 3SRVA 4FKVA 2X8EA 5ETAA 4CFXA 2IZSA 2ITYA 1J7IA 3QZHA 2JIVA 2UW0A 4B8MA 1X8BA 3Q4UA 3C4FA 3QZIA 4C4FA 3AC3A 4PRJA 3VIDA 4O7LA 3H9OA 3TEIA 5LVLA 3ACJA 5ETCA 3W2QA 3QTXA 3PZEA 3A7FA 2QKWB 4LQMA 5CI6A 3R1NA 4YTCA 4RVLA 2WO6A 1XH4A 3MFSA 5JRSA 4F1OA 3LPBA 5ETIA 2C5YA 4D9UA 2XP2A 3AQVA 3NUNA 4KSQA 3TNQB 5M07A 3DY7A 4IB1A 4MWHA 4UMTA 2W1FA 4L9IA 4BZOA 4D2SA 5CU0A 3CY3A 5IG1A 3L8SA 2JFLA 3ZEPA 3BYUA 5L6PA 2C1BA 5LVPA 4I6FA 4M12A 3QX4A 3NRMA 3DZOA 3HA8A 1PY5A 1M17A 4ZTHA 4Y85A 1ZYJA 3UQGA 4H3PA 5KKRB 2H9VA 2W4OA 4P2KA 3NZ0A 2YACA 4IMYA 3MV5A 5TKDA 2JAVA 3FPQA 2VTTA 4F6UA 3I0OA 4ANSA 4BKYA 5L6OA 3P79A 3UP2A 3ZC5A 3OOGA 5EQYA 3QAME 4O6EA 1UU3A 3VUGA 4K1BA 3II5A 5M57A 4EL9A 1OVEA 2VV9A 3RMFA 3HMPA 4IFCA 1PHKA 1H0WA 1H8FA 2VWUA 4K77A 3PVGA 5C27A 3V5JA 2IVTA 4CSVA 4QTEA 3DDPA 3SG9A 4YPSA 2ITWA 3I60A 4MXAA 4PMMA 3VQHA 1Z9XA 2R9SA 4EK5A 1IAHA 4BCPA 4ITHA 5CU6A 3D94A 3SVVA 5ANOA 2X2KA 5AP4A 4O82A 4G5JA 5CEKA 2QLQA 3CQEA 4DEGA 4FTLA 4IVAA 4X7QA 4CZUA 3MPTA 4RC2A 5EW3A 3KF7A 3P4KA 4I22A 1URCA 2G15A 2YN8A 3BX5A 3DK3A 2OI4X 4H3BA 4KKHA 2IG7A 4O86A 3Q9XA 4YU2A 2ZV7A 2ACXA 2BDJA 4WIHA 4PPBA 2PZPA 2OG8A 5EM6A 3VBQA 5L6WL 3FXXA 2OXDA 3OFMA 2IZTA 4ZTLA 4IDVA 2PVJA 3BU6A 2B52A 3GBZA 3HGKA 3EYHA 2IZRA 3ZLSA 2WMQA 4YZCA 4I92A 2C5OA 3D9VA 4YSJA 5AAEA 3GOPA 2BKZA 3NNVA 4RZWA 3ORIA 5DVRA 2YHVA 5E4HA 4EEVA 2OIQA 4QPMA 4HPUE 3CBLA 3SGCA 2JDTA 1OL1A 2X8DA 4CFWA 1O6YA 3QCQA 4FKWA 4ZXTA 4X6QC 2Z60A 4LL0A 4BCJA 5HOAA 1PMEA 2QR8A 2R4BA 2VO6A 4IQ6A 5B0XA 2J50A 5I5ZA 1H1PA 5CI7A 3MVHA 4RT7A 4F4PA 3MYGA 5EDRA 4G3GA 3TUDA 3E3BX 4DE4A 4FVPA 4EQMA 5IA0A 3GU5A 4RWIA 2J0IA 5AV4A 4CFFA 2C0IA 1KWPA 5CF4A 5CXHA 5CT0A 1P4OA 3MGYA 5FXQA 4XOYA 3OY1A 4FL1A 2VTQA 2QOLA 2OWBA 1ZXEA 3HECA 3F3ZA 4RJ4A 3UZTA 2V7OA 2R3QA 1ZYCA 3LFNA 5CNOA 4XRLA 4W4VA 3BYSA 4DFUA 1B39A 3O0GA 1O9UA 4QPSA 3PPZA 2W5AA 4E4MA 2OBJA 4FTTA 4EHVA 2OXXA 4YZBA 5C4LA 5M44A 4E8AA 2WELA 4FR4A 3B8QA 2YDIA 3L8VA 4R3CA 4PL3A 1KE7A 4EH2A 3D2KA 1S9IA 5B2LA 3AD5A 2OZAA 4FMQA 4CCBA 4CEGA 4Y95A 2P0CA 3QZGA 4IWDA 5DBXA 4HW7A 4OBQA 4M69B 5K0XA 3UVRA 5JRQA 4LMNA 3EIDA 3KEXA 3Q32A 2ITOA 1OKVA 2YZAA 3BHHA 1AQ1A 4AUAA 3WF8A 3GU4A 3AGLA 3WBLA 1JBPE 4BTFA 1H1RA 3HNGA 4TL0A 3EFKA 1ZRZA 3U9NA 3VUTA 4XG8A 5AX9A 2HAKA 3EQRA 3GC7A 4A4OA 1CTPE 3WI6A 2OJGA 4JOAA 4PDPA 4IB3A 5EW8A 4BKJA 4KBCA 1W0XC 4XLVA 4B4LA 5EI6A 4FL3A 4E4NA 5JFXA 3U8WA 2W1ZA 3IK3A 1I44A 5F95A 4X3FB 4UYAA 4L68A 3RM6A 4Z7HA 4XG9A 2W96B 4A9RA 2IW8A 3LLAA 3MVJA 3ZBXA 4BZNA 3G6GA 2BAQA 4CD0A 2BFXA 4HYUA 1YDRE 3BYOA 5CS6A 3LMGA 4FKJA 4YSMA 5FP6A 1JWHA 1P5EA 2RSVA 3LMIA 5M4FA 5IQDA 4EBVA 2XNBA 3POOA 5BVDA 4FV5A 3D7ZA 3T8OA 4TPTA 2OW3A 4YLJA 3FY0A 5DLSA 2WMAA 1OBDA 3PLSA 3WIGA 1KOBA 4FTNA 3BGZA 2HWOA 2XK3A 3R7YA 4UZDA 2WXVA 5K3YA 3ZOSA 1FOTA 3MY1A 3W10A 2V5QA 2VTNA 4XHKB 5DPVA 4AQCA 4EZ7A 3HV6A 4BI1A 1R0PA 3F7WA 3KRLA 4LL5A 4ZZMA 4C4JA 5E8TA 3EN5A 4KABA 1ZZLA 2RFNA 3NUYA 3H10A 3GCSA 4RC3A 4LRJA 4W9WA 3ZBFA 5HTCA 3F5PA 2HK5A 2HZ0A 3WYXA 4BCNA 4DF3A 3A7JA 1XKKA 3QCXA 5EQEA 4D5HA 4R5YA 4EJNA 5AR7A 3EN4A 3HV7A 3OEFX 3RAKA 4J97A 3U9CA 3FMNA 4UALA 3MIYA 2G2HA 4O91A 5IUGA 5AP5A 3E62A 1MQ4A 2E2BA 4GCJA 5FLFA 3COIA 3TIYA 4TYEA 5L2WA 5L8KA 4DCAA 4JR7A 3RJCA 5A9UA 5IH4A 2BAJA 3CE3A 4A4LA 5F20A 1OL6A 4TNBA 1U4DA 2Y0AA 4IBMA 4MNFA 3O8UA 5M56A 3PZHA 5FBOA 4JIAA 2PTKA 4ZMFA 3PP1A 3BBWA 3G90X 3NWWA 2QNJA 3POZA 4F0FA 5AP6A 3E5AA 2QLUA 4I93A 4CNHA 3C5IA 5D7VA 3QWJA 4Z7GA 5HO8A 3FKOA 2RF9A 4S33A 1FINA 4A9YA 5TF9A 2QO9A 2QR7A 3D14A 1WBVA 3F2NA 3UZPA 2GDOA 3R63A 2BHEA 5EYKA 4YTIA 1T45A 3RKBA 5B2KA 4EH7A 3R9NA 4FZDB 3OXIA 4MH7A 4FV6A 4DT9A 1YDTE 4RFZA 1GIHA 4GKHA 2BVAA 2G2FA 2QODA 3CLYA 2C68A 3GFWA 5DHJA 2XEYA 4IANA 3TTIA 4BCOA 4RC4A 4ZSAA 5J9ZA 4AZWA 5KMMA 2QO2A 3FMJA 3SG8A 2R5TA 4CG9A 4S2ZA 4QQ5A 2QI8A 4QNYA 3UQCA 5KBQA 2GCDA 4IZYA 2PVYA 2OK1A 5A14A 5JH6A 3TDVA 2J0KA 5KMOA 2BFYA 3P08A 4EH8A 4M68A 3FXZA 3SXFA 3DU8A 4FK6A 2C69A 2UUEA 5KZ0A 4PL4A 5LCJA 4JBVA 4LRMA 3KULB 1SZMA 3NW5A 4D4VA 5G1XA 3FUPA 1PKDA 4Y73A 5I4NA 2C6TA 2PUPA 4TKSA 2BAKA 3PY0A 2W7XA 1OPJA 4I5MA 4FKSA 3D4QA 3UIBA 4AZSA 4QMLA 4LV8A 3WARA 5AIRA 3AC5A 3F88A 4FT9A 3U6HA 2QOKA 1XHAA 2B4SB 2Y9QA 4HCVA 3NX8A 3RPSA 4BCQA 3VJNA 2EB3A 3LMHA 3DS6A 2CJMA 5T3QA 3BIZA 3AG9A 4KIPA 3DLSA 4X2FA 2XBJA 4A06A 1YW2A 4P5QA 2UVXA 4USEA 5H2UA 3VS2A 4BCKA 4FGRA 3MJ2A 1LPUA 3Q2MA 2B54A 5ACBC 2C3IB 2ZM4A 4S32A 2DUVA 4KD1A 4DG3E 3OD6X 4NH1A 5IQBA 4DGOA 1WBOA 2E9VA 3HUBA 4NSTA 4RA5A 2YCFA 3N4UA 3WZKA 4JLCA 4DGLC 3Q60A 4NFMA 3DK7A 4UX9A 4XBUA 2ZYBA 2GS2A 4TW9A 1OIQA 2J4ZA 2J0JA 3PA5A 4F7JA 3ZO4A 4U97A 3QQGA 1J7UA 5AP0A 4IZAA 2XNGA 5AIKA 4JBQA 4GFMA 4Y83A 4IE9A 3TZ8A 4BWKA 2PSQA 3PXKA 4DBNA 4WNMA 2VX1A 3EH9A 5K0KA 4ZY5A 1OPLA 2X2MA 5J8IA 3KF4A 3MY5A 3I5ZA 1OM1A 5DG5A 3GI3A 4FV3A 2OJJA 4R7BA 4CYIA 3W2CA 3TNHA 4Q5HA 3DJ5A 4EC9A 3AC4A 4MXCA 4ARKA 5AA8A 2LGCA 4JG7A 3R28A 3RPVA 3LXLA 4MX9A 3GCUA 3NUAA 2XBAA 4F1TA 2PVKA 2OZOA 4OBOA 2CDZA 5M53A 3L8PA 1Q61A 2JEDA 5CXZA 4IB5A 4ALWA 3OVVA 5GJGA 4BICA 5C8NA 5KHXA 2YJSA 4YPDA 2C0TA 2X6DA 3QA0A 1J7LA 2R0IA 4MNEB 1KOAA 4L67A 1SVEA 3QQJA 3QTQA 4GYGA 3K2LA 4PX6A 2EUFB 4QMYA 4XV3A 3ZUUA 4S30A 2X4ZA 3I7BA 1FVTA 2IVVA 2PULA 5ANGA 3MH0A 1BL6A 3PSDA 3F2AA 5FG8A 5IA5A 5BYYA 3BGPA 5CEPA 3MW1A 4G6NA 4BHZA 3FZTA 5EI2A 5C01A 4D2PA 2FSMX 2C5XA 3IKAA 4I0TA 5AP7A 3RTPA 5AA9A 4FEVA 4RFYA 4Z55A 4CFNA 1JKTA 4C7TA 4KS8A 3TM0A 1PXLA 3QD4A 2YM3A 2ZV9A 3PJ8A 4LOQA 4FYNA 2CNQA 3PJCA 4C02A 4N4SA 2GQRA 3N4VA 3LZBA 3MESA 5CASA 4F70A 2W99B 5CYIA 1RDQE 5CU4A 4I20A 4RQKA 3TI1A 3LXPA 4KIOA 4WBBB 4ASDA 1ZLTA 2CN5A 3T9TA 4GUBA 4AWIA 3WF7A 4BTMA 1HCKA 2QKRA 4IX5A 4YGAA 4FKOA 4UBAA 2H8HA 3O8TA 4IHPA 1YQJA 4TWCA 4ANQA 5HESA 4IWOA 4E20A 3UVPA 3V6SA 1PMNA 1YI6A 5I9VA 2C6LA 1VJYA 1A48A 3ATSA 4QD6A 3SD0A 5HORA 3ZM9A 3TTJA 1YOLA 4YZNA 2ESMA 2QHNA 5JFWA 4WSYA 3Q9YA 5KMNA 2EXEA 4A4XA 2OO8X 4J53A 3VC4A 4YR8A 4EOOA 5AV0A 4GIHA 4IEBA 5DIAA 5CALA 2ONLC 4ZEGA 3V8WA 2V7AA 3OZ6A 4XMOA 4GIIA 3QD0A 5HIBA 2ITNA 3UODA 3BU3A 3PDTA 3KN5A 3O71A 4O84A 5FEQA 2XJ2A 2PVNA 3SOAA 4FT0A 5EKNA 1UWJA 3OXZA 4EK4A 3CXWA 4FKLA 4RX7A 3NLBA 4L7FA 2HY0A 5AV1A 3QUDA 3PIZA 3T3UA 1E9HA 1VZOA 3D5VA 5J7BA 5EM8A 3CD8A 3ZYAA 4BTJA 1OIUA 5IEXA 2GS6A 5J5TA 2XNEA 3AT3A 3LCDA 1G5SA 4YUQA 5FDPA 4DH7A 3FLWA 4IVDA 3LJ0A 4F7SA 4R3PA 3DZQA 2BRBA 5C4KA 2J0MB 4ZZOA 2CLQA 5DT3A 1W8CA 1FGIA 4M66A 5BYZA 3RINA 3R21A 4RSSA 4F64A 5ACKA 1FBNA 3HV3A 2R3LA 1UU8A 4FK3A 4NIFB 4RIYA 3UBDA 3UVQA 2O5KA 2QURA 1WBSA 2YM8A 1UNLA 1WVXA 3N51A 4PMSA 1NW1A 3AMAA 3MDYA 1GZOA 2HCKA 3CGOA 4USDA 4WG3A 3C1XA 3CD3A 5IA1A 5K4IA 1NVRA 3V51A 1U54B 5E92A 3KVXA 3Q04A 3K3JA 2J51A 3VHKA 3WZEA 3UOKA 2C3LA 3DKOA 4I24A 2XKFA 4JDJA 1Q3DA 1UWHA 2GHLA 3FZRA 2QOOA 3GP0A 4DCEA 2CSNA 4C37A 4QMVA 4X2NA 4YURA 2DWBA 3FPMA 1B6CB 4FIJA 4ALVA 2QG7A 4J7BA 4PTGA 4XP2A 3W8QA 3UPXA 4C4EA 1ZOEA 4UEUA 3GNIB 3QRKA 2HXLA 4GUEA 4DFLA 4NK9A 4L00A 1FQ1B 4RVKA 4W8DA 3KRWA 4I5PA 5F9EA 5DGZA 4U81A 5E90A 2FSLX 4F0GA 4O83A 3NAXA 3RZFA 1JKKA 3JR1A 2IVSA 2XK4A 5KO1A 2PPQA 3CC6A 4U3YA 3EWHA 3F61A 3IOKA 4YO6A 1H07A 3PVWA 4BGHA 1XBAA 4YMJA 4QYEA 3HX4A 4AA5A 3F66A 4HPTE 4C62A 4QYGA 1M7NA 2WTJA 3TWJA 1P2AA 2RFDA 3EFJA 4IZ7A 4AN9A 2XA4A 4BIDA 3E8NA 3IS5A 5C03A 1R39A 4ZJIA 3QTUA 4IX6A 2QU6A 3Q53A 5HBJA 4CYJA 4CV8A 5HG8A 1YI3A 5HX8A 2UZBA 1E1XA 1JSTA 1U46A 2QD9A 3TV7A 3KA0A 4RG0A 3IPHA 4FTAA 4FV9A 1CSNA 4FNWA 4EOLA 2XH5A 3VHEA 5A4CA 4TWNA 5GHVA 4MD9E 3ORPA 2OF2A 2BZJA 2OSCA 2ZJWA 2W06A 3ORMA 5FD2A 3G2FA 5F94A 3NVMB 3R22A 1K3AA 4EOSA 1Q3WA 2CN8A 4LYNA 4M13A 5AP2A 3DBDA 2Q0NA 3DLZA 2I0YA 3ZH8A 4BBMA 4Y5QA 4C4IA 3R8ZA 4W9XA 2Z8CA 3BHTA 3OUNB 1M2RA 5HE0A 3DB6A 4IJ9A 4XX9A 5EOBA 1OGUA 2XZSA 1IR3A 2WTKB 4LGDA 3UIXA 2R2PA 3CJFA 4IZ5A 3TL8A 5CENA 4E6DA 2YIQA 4WBOA 3ZUVA 3G6HA 4QQTA 4ANNA 2PE2A 4YBKA 3HV5A 1PXOA 2I0HA 3KXNA 3ZFXA 1PXIA 3QUEA 3DJ6A 3ALOA 4RA4A 4G3EA 1SNUA 3RM7A 3A8XA 3W55A 3E87A 2XM9A 4X0MA 3AC8A 2UVYA 2PU8A 3R9HA 3VUKA 3R8UA 4FBXA 5BMMA 2JFMA 3LXKA 3JYAA 2QU5A 3PSCA 2UZOA 4RJ3A 3EKNA 4R78A 4BDEA 3BV3A 4IAAA 1SYKA 3BHVA 4LI5A 2E9UA 3HV4A 5IUHA 3G5DA 4O0YA 1PXPA 3PWDA 3H30A 5DNRA 5B2MA 2JIUA 3PA3A 2J90A 3LVPA 5HIEA 1WCCA 4MBIA 1OITA 1Y57A 3DJ7A 5EH0A 3C4WA 4J52A 4IJPA 1TQIA 4L43A 2C3JA 2JBPA 3DBQA 4FV4A 4AW1A 3W1FA 3CJGA 4BDAA 5AR2A 2RFSA 4L46A 3AMYA 4AGDA 2YA9A 2CGWA 1KE6A 2J7TA 4QYHA 4ENXA 2CNVA 3BWFA 5FXSA 3QQUA 3VRZA 4BI0A 5JT2A 2XEZA 4HVGA 3NCZA 4NKAA 5M51A 4RIWB 4AN2A 3DXQA 3G51A 4QYYA 3MFRA 5J9LA 3NCGA 4KWPA 2ITXA 3P23A 2GNFA 2WQNA 4HVDA 4AGWA 4F9WA 3FLNC 3ZCLA 4PUZA 4W4WA 4JG8A 3VS6A 3TZ9A 4BDCA 5CAUA 2R0UA 2Y4IB 4RVTA 4DINA 3WZDA 3FAAA 4UZHA 3BV2A 4RBLA 4YNEA 4CLIA 2PVHA 3FSKA 4E6AA 3C4EA 4IW0A 4DTAA 3DOGA 5AAGA 5FDXA 3GU8A 3KRRA 3ROCA 3P7AA 3WYYA 2UV2A 3FQSA 3RWPA 4TRLA 4DH5A 1FGKA 2EU9A 4YJOA 3NNUA 4UXLA 1BL7A 5IQIA 3TUBA 2PWLA 2WMBA 3FXWA 1TVOA 3HYHA 3PJ3A 5CZHA 3DXPA 1O6LA 4C2WA 4LG4A 3O7LD 4MXZA 4RIXA 2REIA 3JVSA 5CAOA 4QNAA 1H26A 2FB8A 2VWYA 3GCPA 4FYOA 4MF0A 4K0YA 3NYNA 4MKCA 4C3PA 4CZYB 4WSQA 3S00A 4KS7A 4N57A 4GKIA 4O0XA 4RJ6A 5CSPA 2C6KA 4O7TA 4FODA 4PF4A 3Q9WA 2WQBA 3ZO1A 3P86A 4E5AX 2GNGA 3JPVA 3FLSA 2UZNA 3CKXA 4MVFA 4ZSJA 2Q83A 2PK9A 3O2MA 3VW6A 2XVDA 1NXKA 2B9IA 3DGKA 3V5WA 1ZARA 2UW7A 3QRJA 4RGJA 4L3JA 5EDPA 4FSUA 3S95A 3TJDA 5EFQA 5BPYA 2RKUA 5EK7A 2FUMA 3H3CA 3IO7A 4APCA 4DFZE 5CT7A 4BZDA 3P5KA 4BCGA 4ANLA 4BRXA 2BRMA 4V05A 2JKOA 4TNDA 5HVKA 3LM5A 2VTPA 4QP8A 3GVUA 4BIBA 3MH1A 2QONA 2VNYA 3UIMA 5BVOA 4USFA 4GW8A 4P7EA 4XV9A 4YC6A 5C8MA 5HTBA 5KMIA 3PXZA 4U43A 4C3FA 2WPAA 2ERZE 4P4CA 3TG1A 4QMQA 3VRYA 3IG7A 3DKCA 2FA2A 4RMZA 4O0SA 3FKNA 4Z9LA 2BR1A 2W5HA 3DKGA 3L9PA 4UN0C 2IO6A 3L9LA 4OR5A 3BBTB 5EM7A 1CKJA 3MVMA 1SNXA 1WBPA 4DITA 4TYHA 2R3MA 4B7TA 2JKQA 3CTHA 3EQFA 5FUTA 3GXLA 3MPMA 4HYIA 4FZAB 5FXRA 5HZNA 3FLYA 2YDJA 3QLFA 4DLJA 2BRHA 4GFGA 4W4XA 2OH0E 5I3OA 3FEGA 4Q2AA 3C4XA 5DT0A 4ZTRA 3D7TA 2ITPA 2J2IB 3KMMA 5DRBA 2JKMA 3JY0A 4D1ZA 4PNKA 3PP0A 3KRXA 1TQMA 5GJDA 4Z3VA 3T9IA 5A4LA 4BDFA 2JDOA 4IAIA 2WKMA 3R71A 4M8TA 5IZFA 3PG1A 3QYZA 4QP7A 4FG7A 2VTOA 3TNWA 3Q5IA 4IIRA 3LIJA 4CMTA 3PY3A 2UW3A 1J1BA 3Q9ZA 3KKVA 3MFTA 4ZSLA 1NY3A 2B1PA 3QD2B 4O21A 5D10A 3ROYA 5AP3A 4L53A 1LR4A 3F6XA 2KULA 4DG0E 4X2GA 3FHRA 4EC8A 2OKRA 3WILA 2VX3A 4ZAUA 1XBCA 3ZFMA 3F9NA 4O0UA 3IW7A 4M14A 4MEDA 5M06A 5HE1A 3AOXA 1GY3A 5AUUA 4MQ1A 3UC4A 3NIEA 3ZUTA 4UWYA 4ZTNA 4FNZA 2WQEA 1KUTA 2CKQA 1VR2A 4PV0A 5EYMA 4XG6A 2W17A 1MRVA 2XIXA 4C36A 5BVFA 3U51A 5KKRC 1L8TA 3PWYA 4FSMA 4HJOA 2SRCA 5KE0A 4FKTA 4ZLOA 4QP2A 4A9SA 1GZKA 3F69A 3B2WA 4FT3A 3MB6A 3LFAA 4L42A 5AUWA 4NW5A 4RWKA 1M14A 4NFNA 3QHWA 3BE2A 3Q52A 2WMSA 4FA2A 3ETAA 2X7GA 5FM3A 4RWJA 3EL7A 3RPRA 4G5PA 1K9AA 5IH6A 4O27B 4V0GA 5ANEA 3S1HA 4NUSA 1R78A 5BYLA 3FSFA 2VTMA 3ZRLA 4MQ2A 5I9WA 4II5A 3CEKA 2VTSA 4FIIA 2ETKA 2GNIA 4JX3A 4NL0A 1A06A 3B8RA 4ZTSA 4EUUA 3SOCA 1IA8A 4J8MA 2UW5A 3THBA 2BRNA 1QPDA 3I0QA 4I5HA 2PE1A 1Q4LA 3TV6A 1WVYA 4V01A 3ZONA 1Y8YA 5EG3A 3DFCB 1V0OA 3ODYX 1YWRA 2FH9A 5DOSA 1PYXA 2OLCA 2FSOX 4MXOA 2A1AB 2VWVA 3D0EA 3K54A 3FQEA 3O17A 3C0HA 1T46A 3V8SA 4C2VA 1PXMA 5LMKC 4P90A 3TKIA 4A7CA 3VQUA 4A9UA 1JOWB 5J5SA 5IA4A 4ZP5A 5EHOA 2YAKA 4FOBA 5FGKA 4D58A 3E8CA 4TZRA 5IH5A 2BDFA 1XH5A 4Y5HA 1L3RE 3AD6A 3NEWA 1OUKA 4DBXA 3TCPA 2JDRA 3FLQA 1U5QA 2BIKB 4L44A 4ZJVA 1NVSA 1PJKA 2XNPA 3F5GA 3HUCA 3MWUA 4MBJA 3CP9A 4P5ZA 1JNKA 1Q5KA 5AAFA 3RCJA 3Q3BA 3QYWA 4QP6A 4E6CA 3RVGA 3D15A 4N70A 3RAWA 3QRTA 3KC3A 2QHMA 4FKPA 2YIWA 4EUTA 5EDQA 4YTFA 2PHKA 5LQFA 3N4TA 1AGWA 4ZSGA 3LFEA 2B9FA 3GC9A 2BTSA 3CS9A 4BC6A 4EQUA 3EQDA 1YXTA 3LFCA 4FIEA 4YZ9A 1CMKE 3GB2A 3FYKX 4H58A 2C3KA 3QQFA 2UZTA 4MTAA 4NM7A 2Q0BA 4ACCA 4GJ3A 4Q9SA 2XYUA 2Y7JA 5DT4A 4FKQA 5D41A 5AX3A 5HU9A 4FTUA 2C6MA 4M84A 3PPKA 4L3LA 5ICPA 4GL9A 3HAMA 4UXQA 4KSPA 3IW8A 4U44A 4U9AA 5HLWA 4MYGA 3EFLA 3QX2A 3K5VA 3OUKA 4WA9A 5AR4A 3F3TA 3CIKA 5IU2A 3RP9A 3AC1A 3R04A 3R7EA 2PVLA 3TUCA 5IQFA 4QRCA 2ZMCA 4FZFB 4I6BA 3PUPA 2GQGA 4LOPA 3FDNA 3V5QA 2V55A 4U7ZA 3VBYA 4YJRA 5A4EA 2BPMA 5TT7A 4L01A 1VYZA 4PMTA 2OU7A 2WMWA 3ALNA 4ITJA 4O96A 4KINA 3HEGA 4OGRA 5CSWA 5C9CA 3WF9A 3TNPC 5IEYA 4XBRA 4ASXA 5HICA 3FWQA 5EI8A 2Z02A 3MI9A 3O50A 3R83A 2CHLA 3W8LA 4B8LA 3ATTA 2I6LA 5AR3A 2WQOA 4I3ZA 5AR5A 2X7FA 3DAJA 4A07A 3A7GA 5HKMA 5E8VA 3R01A 5JEBA 2XF0A 3Q96A 5CSVA 3PIXA 4ITIA 2W1HA 1ZOHA 4W4YA 5HG9A 3NPCA 5A6OA 2XUUA 2A2AA 4YJTA 4APPA 4J71A 1BKXA 3M1SA 3I6UA 3A4OX 2O8YA 3JXWA 3OHTA 4JDIA 2IZUA 1XJDA 3MB7A 3BHUA 3LE6A 2R3HA 4KIKB 1SVGA 3SV0A 3VN9A 3Q4TA 4W8EA 4X3FC 4ANOA 2W0JA 3FYJX 4AT4A 4IM0A 5A6NA 3NNXA 4J98A 4D2TA 4DEAA 2F7XE 4FG9A 4NTSA 5D11A 2VUWA 4BN1A 4C57A 1CKPA 2CMWA 2YFXA 3HA6A 4YLKA 4QQJA 5E9EA 4F09A 4FNXA 1NVQA 4LRKA 4OTQA 1MRUA 4HCUA 1KE9A 1OKWA 4QMTA 2XYNA 2P55A 2Z7RA 2DQ7X 3BYVA 2BMCA 3RHKA 4CCUA 4YO4A 1ZMUA 2NPQA 2W5BA 3W18A 5FQDC 2JGZA 4GT5A 3PXYA 1OL2A 2ZVAA 4EQCA 3MTFA 3F5UA 3ORXA 5D12A 5KMLA 5LMKA 4QMZA 4QO9A 5AM7A 3MY0A 4D2WA 1XH8A 1STCE 2X9FA 3LHJA 4H1JA 3PXRA 3DAEA 4F9BA 4OT5A 3FQHA 1A9UA 4U3ZA 2YM7A 4QP4A 5HCZA 2IJMA 3CKWA 2VRXA 4ZOGA 5BNJA 3A62A 5J79A 3I6WA 3I81A 3TACA 4AOTA 2JKKA 5K5NA 5TO8A 2JDVA 1HCLA 3MA6A 2PMNX 4KBAA 5JKGA 4FUYA 1MQBA 3EB0A 4DG2E 3C0GA 4E5WA 4B6LA 3RHXA 2CLXA 1BUHA 2WQMA 3IGGA 1W82A 2J5EA 2GSFA 3OWJA 2W1DA 3EZVA 1BLXA 3OTUA 3PVBA 4GU6A 4XG2A 3GC0A 4UMPA 4O7WA 5EHLA 5FEDA 1QL6A 3D2IA 3E93A 5E7RA 3GU7A 3NDMA 4M97A 4D1SA 1JPAA 4XV1A 4X3JA 3HZTA 4ZMEA 3TDWA 3CTQA 2P33A 3UYTA
chains in the Genus database with same CATH superfamily
2X4FA 1GIJA 3AGMA 3NAYA 3VBTA 2OFUA 3BHYA 4FZ6A 3ELJA 4PP9A 4FTJA 4GG5A 4WG4A 1ZY5A 3R1SA 5CTPA 3FE3A 5CVFA 1H1QA 4PPCA 4ZK5A 3ZEWA 1GIIA 4BCFA 3BLHA 3OW3A 3V3VA 1YXVA 3UMWA 4LM5A 5EHYA 4NW6A 4AAAA 4CTCA 1NA7A 3PJ2A 1M7QA 4QYFA 1OUYA 3VUHA 3BGQA 4FIFA 3TZ7A 4XLIA 4EZ3A 5J1WA 5DE2A 3T3VA 4FSQA 2YISA 5IDPA 5DRDA 5GNKA 3FI3A 3SXSA 4BI2A 4S34A 4M69A 3ANQA 4OW8A 4Y8DA 2GNHA 4E6QA 3IGOA 3HLLA 4QTAA 2G1TA 5CAPA 2BZHB 3IW5A 3AXWA 2XIKA 3DAKA 5EYDA 1VYWA 3UQFA 4RFMA 4DTKA 4WRSA 4M15A 3FZPA 4YZDA 2YAAA 2HWPA 4C4GA 4AU8A 3VUMA 5HNBA 4CKRA 3P0MA 5H8EA 5IEVA 5JMSA 3PE1A 2BHHA 3QFVA 2A19B 2X9EA 4X3FA 3QQKA 5FTQA 1M2QA 2JAMA 4AA4A 3QXPA 3VS3A 3VS7A 4FC0A 2YLEA 5DEWA 4AT3A 3IW4A 4EOJA 3R1YA 3RGFA 3MH3A 3CSVA 3W32A 3FI2A 3F5XA 4BYJA 4F6SA 4PMPA 2IW6A 4JR3A 1H01A 3PPJA 5DWRA 3W33A 3QHRA 2WHBA 5KZIA 4FV0A 4IACA 4TTHB 2CGVA 1RE8A 1PW2A 4IFGA 2F9GA 4OTWA 4XG3A 4CXAA 5TE0A 5F1ZA 5EYCA 4O38A 5LARA 4F65A 5FTGA 3W16A 3QZFA 2WB8A 4WRGA 4IVCA 3TYKA 3CQWA 3OS3A 3EQHA 4EK3A 2FVDA 1OPKA 1S9JA 5DMZA 1JSUA 1O6KA 2XK9A 3C4ZA 1OZ1A 2WU7A 2XJ0A 5AUTA 4JL9A 5HX6A 1YXUA 4G6LA 4BB4A 4KAOA 4CMUA 5IKWA 4XH6A 5J7HA 3O8PA 4BCHA 1CKIA 3EFWA 4O7YA 4FSZA 4FVQA 1DS5A 2FGIA 4JS8A 4MK0A 4G16A 5J1VA 2ITTA 5FBNC 2CKEA 2R3NA 5AM6A 4ACDA 4UWBA 5KBRA 3KXXA 4XYFA 4O0WA 3ZHPC 5IQAA 4XS2A 2JLDA 5KMJA 3PSBA 3RNIA 3BEAA 5FRIA 3WOWA 4EKKA 3SRVB 1VEBA 5JK3A 3IQ7A 4CQGA 1ND4A 2XJ1A 5L2SA 3UE4A 1H1SA 2E9PA 3HRFA 5JQ5A 4D4SA 2QOCA 4BL1A 2GHGA 3VO3A 4O0VA 4MHAA 1DAYA 1WBTA 1F0QA 3DQXA 3PJ1A 4G3FA 4E5BA 2NRYA 4O81A 3GGFA 4FT5A 2GNLA 4JIKA 4E73A 5DFPA 3OT8A 2EXMA 2HYYA 3UJGA 4F08A 1V0PA 2RIOA 1REKA 4I5CA 4JRVA 4KRCA 4EJ7A 5H3QA 4RIXB 1OKYA 3ZFYA 1MRYA 4I4EA 3ML1A 2ZMDA 2O3PA 4DTBA 1ZWSA 4LGHA 3ENHA 4I1ZA 1WBWA 2UW9A 4R6VA 3VW8A 1GAGA 4YC3A 4D1XA 4KUJA 3PXFA 1GZNA 4CKIA 4U79A 1XQZA 4O7ZA 2FSTX 1WFCA 2PUIA 4NYEA 4DYMA 4FV1A 3SC1A 5D1JA 4ZTMA 4YTHA 5T68A 3UOHA 1XWSA 5AP1A 4K18A 3BU5A 4ZIMA 4AZTA 3IDCA 5GIPE 5FM2A 2OJFE 2VAGA 3EQGA 3NYVA 4D4YA 4UMRA 1JKSA 4FV7A 5I9YA 1Y6BA 3HMMA 4R7HA 3VUIA 4OTIA 4O7NA 4FVRA 1XMLA 2YEXA 4TY1A 5IMXA 4AGUA 2ZV8A 1Y8GA 2JBOA 2VU3A 3FY2A 4G2FA 3E63A 4BTKA 5IF1A 3HL7A 4GRBA 4R77A 4TWOA 3KULA 2QCSA 2A27A 2Z2WA 3QF9A 5JZNA 3RALA 2I1MA 3OCBA 3N9XA 5I9ZA 2ZB1A 4X21A 5CU3A 4F9CA 4Z16A 1BMKA 5LOHA 4DH8A 4BY9E 2GS7A 4OUCA 3EQIA 2AC3A 5HCYA 1YHWA 3SA0A 1PMVA 2I0VA 4R5SA 1UV5A 1YRPA 2C6IA 4C33A 2RG5A 3DQWA 3FZ1A 4J8NA 4M67A 3MN3A 3G0EA 3LFBA 4MXXA 4RX9A 2Z7LA 3ZMMA 4GU9A 3ZSIA 2EWAA 4YJNA 4HZRA 2UW4A 4MCVA 2W05A 3DNEA 3KRJA 4IX4A 4GV1A 4LV5A 4EH6A 4L8MA 2XNMA 3PY1A 5CSHA 2WAJA 3BI6A 4XG4A 3FL5A 4AE6A 5LVMA 4JQ7A 4JT3A 5LMBA 3UG1A 4KBKA 3S2PA 3U55A 2X8IA 3FJQE 1SVHA 4AZFA 3O96A 2OIDA 3PA4A 1APME 4J96A 4NM3A 3VUDA 3O51A 3L9NA 4HGTA 2BROA 3CCNA 3S0OA 1XH6A 3A99A 3KCKA 4I4FA 2ONLA 3CR0A 3C9WA 5AJQA 4BCMA 1DI9A 4CT1A 3WZJA 4GJ2A 3EN7A 2AYPA 3GOKA 3LQ5A 2R3OA 4EOQA 3AC2A 3W2OA 1LEWA 5DR9A 5AUYA 5IUIA 3ZU7A 4YJVA 4AFEA 4EZ5A 4IM3A 4R1YA 2F49A 3REPA 4C61A 1U5RA 2ETMA 3KK8A 3ZO3A 5BUEA 4PNIA 2GFCA 4BFMA 4ANBA 4I6HA 1SM2A 4EOKA 5HE3A 2HXQA 2WTVA 4DEIA 4ZTQA 3NVKI 4H05A 3DCVA 5K4JA 1IA9A 4MNEA 4TYJA 4OTPA 3F2RA 4HGEA 3I1AA 4O7RA 4OTRA 4WKQA 2WMUA 1Q41A 4GS6A 1H25A 4IH8A 2J9MA 2CGXA 3SQQA 1YWNA 4RRVA 4EH9A 2WMVA 3OC1A 3E3PA 2UZLA 5A54A 4GG7A 2YLFA 3G9LX 2C0OA 3QTIA 1ERKA 1GNGA 4L52A 3VS0A 4H39A 2ZM3A 4RPVA 4F9AA 2O64A 2OGVA 4XEYA 1TKIA 2YDKA 3EL8A 3H4JA 5BVNA 3C50A 4HZSA 2R3RA 3IDPA 3OW4A 4ENYA 3D5UA 3HRCA 1OGYA 2OZAB 3MIAA 4FICA 2UZUE 1Q8UA 2C47A 1W2CA 4JXFA 4QMNA 3QD3A 2VTIA 5CVGA 4WG5A 1DM2A 3FBVA 4OTGA 4C58A 5H8BA 4XV2A 3ZLXA 5C8KA 5HU3A 3NNWA 3QGYA 4O7SA 3RK5A 3ZLYA 3FMDA 2XALA 1F3MC 2FYSA 5IMEA 4MBLA 2NO3A 1XO2B 3L8XA 5LXMA 3LJ1A 4BDGA 1UVRA 2XKEA 3MA3A 4E93A 5L4QA 4D2RA 5HO7A 1LEZA 4R8QA 2WMXA 4FTIA 2ETRA 5IISA 4ORKA 2P3GX 3RK7A 2H96A 5EKOA 3EQBA 3NSZA 5IQHA 4CFVA 3C7QA 2YM6A 4ZS0A 4DN5A 4PPAA 4E7WA 4UY9A 2I40A 2VWBA 2JDSA 1Q8WA 4BDIA 1MP8A 1KV1A 2FO0A 4E4XA 3DDQA 1PXJA 4FIGA 3COHA 1IASA 1Q62A 5FP5A 1PXKA 4NEUA 3BYMA 3DV3A 2X0GA 3WZUA 4KRDA 5JN2A 5L3AA 5CEQA 4E4LA 4EHZA 3NUSA 3DKFA 1ZYSA 2WTKC 4TN6A 4GK3A 3A2CA 4WT6A 4BBFA 2ZDTA 4CMOA 3U6JA 2O0UA 4GSBA 2ZOQA 5TOZA 4L45A 5AEPA 3EMGA 2J6MA 4B99A 5GZ8A 4HVIA 4FEUA 3SW7A 4RX8A 1LUFA 3V04A 4YZMA 3GFEA 3ZZEA 4EH4A 3QWKA 4G17A 3S4QA 4FTOA 1OIYA 2VZ6A 5CANA 2OXYA 4BWPA 3BZ3A 3R9RA 1W2DA 3ZTXA 5IA3A 4RWLA 2O65A 3LFDA 4JRNA 4JDKA 3MPAA 4KIQA 2WMTA 2R3KA 1LP4A 4AP7A 2RG6A 3DB8A 3E88A 3QXOA 4NIFA 5HVJA 1UNHA 4LMUA 3SDJA 2RFEA 4D9TA 1OBGA 4WD5A 2CKPA 2YCRA 3QRIA 4FGBA 4EKLA 1XH7A 1KE8A 3GC8A 3RBWA 4FKIA 5M4UA 2G2IA 1U54A 2YJRA 3EYGA 4F6WA 4FRFA 1JVPP 2XK6A 3DBFA 3LXNA 4HNIA 2UZDA 3FC2A 2PMLX 4EOPA 3V01A 3UDZA 1P4FA 4CV9A 1RQQA 4G31A 2PY3A 4FEWA 5GJFA 4MF1A 3GEQA 5BVKA 4DFYA 3A8WA 3W0RA 2ZFYA 4O1PA 3GUBA 2VX0A 3ORZA 3ID6C 4B9DA 1QMZA 1UU9A 3QCSA 3DPKA 3FL4A 3KVWA 5DR2A 2W1IA 3K5UA 4IWPA 2QVSE 4OT6A 1YOMA 3WE4A 3HVCA 4GVAA 2YM4A 4UWCA 4CFUA 3R2YA 2ZDUA 5HIDA 4FZ7A 3QA8A 4GT4A 4GEOA 1MUOA 4NTTA 1EH4A 3BELA 5KCVA 1BX6A 2Y4IC 4DLIA 2GHMA 3NUUA 3QKMA 3VBWA 4D0XA 3UPZA 2X6EA 5JZJA 1PYEA 4L3PA 3EHAA 4LFIA 4U80A 4ACHA 5CF8A 2OJIA 2VWIA 3R9OA 5HEZA 3KQ7A 3RWQA 4U40A 3UG2A 4G9CA 2XM8A 4AE9A 3PYYA 2UW6A 3V6RA 3CGFA 2VNWA 2YABA 3UNZA 3R8PA 3K3IA 3UP7A 5HQ0A 3LCSA 2IW9A 4AG8A 5BX0A 5BVEA 1YXXA 5GZ9A 4HCTA 2DYLA 2EVAA 2F57A 2PZYA 5E8XA 4KA3A 3TT0A 2BDWA 3KXHA 1H00A 3PTGA 1OI9A 1B38A 4O2ZA 5CVHA 4DGNA 5HLNA 5LVNA 3R0TA 4FIHA 5ANIA 1F5QA 3E7OA 1OKZA 3L1SA 4U0IA 3VF9A 2Z7QA 4CRLA 4BF2A 4CTBA 1G8SA 2QOQA 4GT3A 3HDNA 4EI4A 3TNIA 4QT1A 3SAYA 3A7HA 4IWQA 1G3NA 3OCTA 3MVLA 5HNIX 2IVUA 5CSXA 3WF5A 3SW4A 5BV3A 2BUJA 1OB3A 4R7IA 3LKMA 3DA6A 4L7SA 4MD8E 2KTYA 3ET7A 2UVZA 5ANDA 4DFXE 2ITZA 3L9MA 5CAQA 5CLPA 3OWPA 3Q4CA 4BHNA 3CY2A 4FSRA 2GTNA 4QQCA 5L8LA 4GK2A 5FWKK 3FV8A 5A3XA 1WVWA 2OF4A 1JQHA 3UNJA 2JC6A 3QQHA 4AN3A 1YOJA 3OBGA 4C3RA 3M11A 4QP9A 3QL8A 5EM5A 5DA3A 1V0BA 3KB7A 4ZLYA 5HCXA 4DT8A 3NFGB 3MS9A 3IW6A 5AWMA 4AZVA 4AAYA 4WUAA 4XG7A 3HDMA 4D55A 4BDHA 5JGDA 5M09A 4D28A 3F3WA 3TV4A 1JKLA 1K2PA 3BWJA 4LOOA 3DTWA 3GCVA 4FSYA 1H1WA 5E8UA 4PY1A 2BALA 3DBEA 3R8LA 1JSVA 2PZ5A 4JI9A 3ZRKA 4C0TA 1W98A 4EHGA 3UNKA 3LFSA 2IPXA 2BTRA 5IQGA 4C35A 3KGAA 3VULA 1R1WA 4HGSA 3ZDUA 3ZZWA 4AACA 2PVMA 4OBPA 4EBWA 1BI7A 2VWWA 3ITZA 1J1CA 1SMHA 5E8WA 4H1MA 5HGIA 4TT7A 1ZYLA 2VGOA 5AUXA 4BBEA 3GQLA 4ZJJA 4TXCA 4UYNA 4AA0A 4RQVA 1P14A 1YVJA 5IA2A 3Q5ZA 5CEMA 1AD5A 3C13A 5GINE 3OG7A 2ZM1A 4JX7A 3VS1A 3FI8A 1OMWA 2WEVA 3U87A 4PTEA 5B7VA 4ZY6A 4J95A 3KXMA 4M0YA 3BE9A 1Q99A 4WNKA 2B9HA 2QOFA 3O7LB 3OWKA 5D7AA 2ZB0A 4RIWA 4EH5A 4ID7A 3V5PA 3VBVA 4CKJA 3HMNA 2WTDA 3RPYA 3C51A 3FHIA 5L2QA 4BYIA 3F3UA 3WIKA 3RI1A 4ERWA 4I0RA 5GZAA 3TKHA 4FTKA 1ZYDA 2YWVA 4HOKA 2W9FB 4JG6A 4ACGA 2A0CX 5HI2A 2HY81 4D5KA 3ODZX 2PL0A 3EN9A 3RAIA 3R8VA 3RZBA 3AT4A 3LCTA 4IM2A 4K9YA 4NWMA 2F2UA 4NT4A 4C59A 3V5LA 3LM0A 5IQCA 1V1KA 2XMYA 4AS0A 1G8KA 3UTOA 4AZEA 2Y8OA 2VO0A 4QMUA 2QOHA 4YBJA 2B53A 4YNOA 1PMUA 1YHSA 4JAJA 2UZEA 3QTZA 4QMMA 1W83A 3RNYA 4G3CA 4GVJA 4IC8A 2XNNA 3OWLA 2GNJA 3CPCA 3UOJA 4JAIA 3A4PA 5JQ8A 3BCEA 3RK9A 3C4CA 3NW7A 1XR1A 3I7CA 4ANMA 4DA5A 3R7GA 5IDNA 3DFAA 3QKKA 2ITQA 4U41A 1UA2A 2H6DA 3JUHA 5J95A 3SKCA 1KE5A 3TIZA 4DGGA 5L2TA 3DNDA 5K5XA 5CNNA 5I9UA 3NMUF 2YIYA 4G6OA 3NUPA 4GMYA 1G8JA 4XOZA 4AFJA 2WTWA 2XIZA 2XAOA 4FEXA 3FZOA 4RVMA 2I0EA 1H27A 3R1QA 2BZKB 4F9YA 3R00A 2XIYA 5CF6A 3KN6A 3H9RA 4AF3A 4BDBA 1BI8A 4E3CA 4UB7A 3ZS5A 4FEQA 2W4KA 5HD4A 4XP3A 3D83A 3FMMA 4R1VA 4HYHA 4DGMA 4EWHA 5DEYA 4DFNA 3EKKA 3KCFA 3HMIA 4N0SA 4DH3A 1YDSE 2EXCX 3ACKA 1M52A 3E7VA 3QQLA 4MD7E 5EQPA 3LQ3A 5HE2A 5BVWA 4WOVA 5L8JA 3ZSGA 2VO7A 4K33A 4QTDA 3SX9A 2HOGA 2BIYA 4RIYB 1JLUE 2R64A 3ENMA 4EK6A 2CCHA 3P78A 3GENA 2VWZA 4QP1A 1IEPA 3IECA 4CLJA 1HOWA 5HTIA 3I5NA 3NUXA 2GMXA 4CT2A 3UIUA 2WEIA 1H4LA 2F7ZE 1FPUA 2CKOA 4CGAA 3H9FA 5J87A 1YKRA 4G34A 4YC8A 5CAVA 2B7AA 2B55A 4BDJA 3TXOA 4AW0A 2V22A 3OTVA 1IG1A 3VJOA 5AMNA 3G0FA 4IDTA 5E1SA 3W2PA 5E8YA 3COKA 2C5VA 4NCTC 2J5FA 4IAKA 4XCUA 3WE8A 3ZDIA 2G9XA 3DBCA 4RIOA 2DS1A 4XUFA 4UMUA 1W7HA 2W9ZB 3G15A 4FX3A 4BIEA 3R8MA 3E8EA 1QPJA 5I0BA 4LUDA 4O7VA 4WUNA 4RLKA 2YITA 3TMOA 3P1AA 5JFSA 3QU0A 3NS9A 1FVVA 4I94A 3C0IA 1YI4A 3OBJA 3PE2A 1E1VA 3ZC6A 3R7UA 4CG8A 3OCGA 3U6IA 4JVGA 4RX5A 4FV2A 4YHTA 5CU2A 3BQRA 4N6ZA 2W1GA 2GFSA 4BDKA 4C38A 4MAOA 4HVHA 2P2IA 5AV2A 2QOBA 2X81A 4KKGA 2C4GA 5ANKA 1OL5A 2GTMA 3HP5A 2HZNA 2F2CB 4HGLA 5DYJA 3VAPA 5E91A 5LCKA 3KL8A 3W2SA 4WNPA 2W1CA 3VVHA 5ANJA 2J0LA 2VO3A 2XB7A 3BLRA 4TWPA 2R7BA 1XH9A 2VGPA 4ONAA 4O1OA 1UKHA 4I41A 3W2RA 1PF8A 3O23A 3VS5A 4CQEA 5E1EA 2BZIB 3OMVA 4GK4A 4OTHA 5IPJA 3IOPA 2VD5A 3KY2A 3PXQA 4K8AA 5HVYA 3FMEA 3UYSA 1QPEA 1YHVA 4F7NA 3UO4A 5AV3A 2XANA 2C1AA 3ERKA 5L2IA 3DK6A 2GPHA 2QG5A 2W1EA 2X2LA 2PVFA 2IWIA 1PRYA 3EQPA 2XS0A 3NIZA 3R30A 4QMSA 2RL5A 3AD4A 3KXZA 4DHFA 3QALE 4PL5A 1JAMA 2E9NA 3M42A 3S3IA 3UDBA 2YZLA 3QKLA 5CQWA 1OL7A 4QMOA 2QO7A 5HBEA 3QC4A 4Y46A 2X0QA 1I09A 3HP2A 3UGCA 3U54A 3RCDA 3EN6A 4HYSA 3BLQA 5AR8A 4H3QA 1ZY4A 4ZZNA 5A4TA 4G9RA 3TZMA 4DH1A 4K11A 4YHFA 3UMXA 2H34A 1H28A 3E8DA 3PIYA 4PDYA 4U45A 5C26A 3PRFA 2PZIA 4X2KA 3F3VA 4ASZA 4ZLZA 4EORA 4PDOA 5IQEA 4UMQA 5LMAA 4PTCA 1Q8YA 2V0DA 3BRBA 4O22A 5AUVA 1CM8A 5HG5A 4QTBA 3UOLA 3OEZA 5H8GA 4ERKA 2CNUA 3G9NA 5TR6A 2C6EA 4M3QA 4PWNA 3BEGA 1YXSA 3BQCA 1GZ8A 4NJDA 2I7QA 5ITAA 5AFVA 3UO6A 3FC1X 4O4BB 2B0QA 4FG8A 3E64A 3QCYA 1WAKA 2A4LA 4DFBA 4YJQA 3KXGA 3HRBA 3QBNA 4I23A 3GQIA 5AADA 3TN8A 1YWVA 2NRUA 3FZSA 2WIHA 2YCSA 4WNOA 4DC2A 1PXNA 1Q8ZA 2BRGA 5AUZA 4E1ZA 5JSMA 2WTIA 2OIBA 5FTOA 4JJRA 4FKUA 5BUIA 5BMSA 2R3JA 5H9BA 3VS4A 4BWXA 2XK7A 4TYIA 5CEIA 3RPOA 1ZOGA 2F7EE 4LUEA 4NCTA 4EH3A 5GIOE 2WOTA 4IB0A 2X7OA 4KNBA 1RJBA 4QMWA 4RJ5A 3VWAA 4QMPA 4F0IA 4I6LA 3WF6A 3GU6A 4O6LA 3R9DA 5DH3A 3CTJA 3LOKA 5EW9A 3NR9A 1H08A 4FNYA 4EWQA 1Q24A 4D4RA 4D2VA 3FMLA 2AUHA 2PVRA 1M2PA 3I79A 3VBXA 5KHWA 4AW5A 5M55A 2BCJA 3JS2A 3DTCA 4FSWA 3MH2A 4IADA 4IVBA 5HHWA 3FI4A 3MFUA 1DAWA 4I6QA 2C6OA 3P7BA 1CDKA 2ITUA 3QTRA 2AEGA 2CPKE 2YERA 2ITVA 2R3PA 4YHJA 5BQ0A 3KREA 4FSNA 4JBOA 4F7LA 2B9JA 2AC5A 1KSWA 2O2UA 3MJ1A 3QTWA 4ACMA 4JBPA 2XRUA 1GJOA 2X39A 4OAVB 4Q5EA 4IAZA 2UW8A 3AMBA 4YLLA 4HVSA 5CX9A 3D5WA 4AW2A 3U4WA 4ASEA 5ETFA 3R7VA 1QCFA 1Q8TA 4FT7A 5LWNA 1WZYA 4U6RA 1H0VA 4FUXA 4NKSA 2JD5A 1Z5MA 1WBNA 4YP8A 4OAUC 4QOXA 3A60A 1KV2A 2OFVA 2ERKA 3OP5A 4K2RA 5KX8A 3LCOA 2NP8A 4GFOA 4RZVA 3LAUA 3KU2A 3NYXA 3JVRA 4KIKA 4J99A 4BCIA 2F4JA 2R7IA 3G33A 3C5UA 3SHEA 1G8AA 3FLZA 4M7IA 2XKDA 4IX3A 3ANRA 3ORKA 2VTHA 3BL9A 3R6XA 5HG7A 3RAHA 1REJA 5C1QB 2YWPA 4OTDA 2Y4PA 4I0SA 5CWZA 5CF5A 3LJ2A 3V8TA 2C30A 2HENA 1URWA 2EB2A 2UZVA 3F82A 1NT2A 5BUJA 1FVRA 4F78A 5A46A 4O0TA 5JGBA 4KKEA 2JIIA 4Q9ZA 1OIRA 2QOIA 2YIRA 3UC3A 3QTSA 4GYIA 5LWMA 3HAVA 4F63A 2XK8A 4E26A 5K9IA 2OJ9A 2VWXA 3H0YA 1UU7A 2YM5A 4J1RA 4PDSA 5G6VA 3SXRA 3TKUA 4H36A 4FTQA 3ZXTA 2YCQA 4RLLA 4V04A 3DT1A 4FKGA 2PMOX 4L6QA 4M0ZA 5HO6A 4IXPA 3Q6UA 4ALUA 3QLGA 4G3DA 4AOJA 2WTCA 3AT2A 4FI1A 3ORLA 2XRWA 4EYJA 2HZ4A 2LAVA 4R3RA 3EJ1A 4DEBA 4TYHB 4AX8A 3D5XA 4QP3A 3PVUA 2WOUA 5D9HA 3R7OA 2WGJA 3OCSA 2X1NA 4DEHA 3NGAA 1PKGA 3V5TA 4LGGA 4YJSA 5KMKA 2R3GA 5M08A 3FKLA 3D7TB 1UNGA 2Z7SA 3KMUA 4IAFA 2IN6A 1ATPE 1IRKA 3MBLA 2ZAZA 4NJ3A 1DI8A 1W84A 4FTRA 2W4JA 4FTMA 4TYGA 1ST0A 4FOCA 4X2JA 1WMKA 3LW0A 3VNTA 1Y91A 2PMIA 3QUPA 1UKIA 4JQ8A 1R3CA 3ZO2A 4AGCA 4EHEA 2R3FA 2XKCA 4I21A 3CPBA 1GOLA 3M2WA 3QGWA 5E8ZA 4NU1A 2HW6A 1RW8A 2Y6MA 1U59A 2VTAA 1VLRA 2VTRA 4CVAA 4HNFA 4X6RA 1ZMWA 2HZIA 4B0GA 2UZWE 4XNEA 2WIPA 5A4QA 4OTFA 2PUNA 4IAYA 4JQEA 4BJJA 4CRSA 3LQ8A 4S31A 3BPRA 3EZRA 2P4IA 3QC9A 3NYOA 5I3RA 3HKOA 3LFFA 3ULZA 3E92A 3NW6A 3F7ZA 3Q2JA 4AOIA 3FMHA 3U4UA 2CCIA 2OICA 2X0PA 5DN3A 3ORNA 4O4CA 2IEWA 1FMOE 4DAWA 4EK8A 1Q97A 4XRJA 1QPCA 4RJ7A 2XCKA 3R7IA 2C6DA 4F99A 4FL2A 5I9XA 4FKRA 3DXNA 1ZZ2A 2OH4A 3B2TA 3Q6WA 3ZLWA 3GT8A 5CZIA 3TJCA 2PUUA 1FMKA 4XP0A 4BVUA 2P2HA 3VF8A 4F1MA 3KK9A 5JFVA 2GU8A 1H24A 5CY3A 3ZSHA 2G01A 3EOCA 4ZSEA 3LFQA 4C34A 2XAMA 2PE0A 4AXAA 3ULIA 3BKBA 3OY3A 4UV0A 3A61A 4WHZA 4QPAA 5HBHA 3AKKA 4RJ8A 2Y6OA 4EOMA 5LJJA 3IONA 3OOMA 4Y72A 1ZAOA 4KB8A 3MTLA 4QMXA 4V0GB 3PRIA 3SLSA 3MSSA 2WMRA 2VN9A 4EONA 1J91A 3R02A 5DI1A 3ZXZA 2WNTA 3LCKA 2NNWB 3UZRA 1BYGA 3IDBA 3ORTA 2XIRA 4XJ0A 4JDHA 3PLAE 4BGGA 2GQSA 5HNGA 4U5JA 4DEEA 5CEOA 2RGPA 2BKKA 2PZRA 4WO5A 2WU6A 5FEEA 5LVOA 3KFAA 2E9OA 4BGQA 4IC7A 4CZTA 2QC6A 5E8SA 5HD7A 2PYWA 3LLTA 3P7CA 1ZMVA 2VTJA 2YIXA 4EOIA 3H0ZA 5F4NA 3ZRMA 4FE2A 5CQUA 2C5NA 5J9YA 5KNJA 2BILB 2XNOA 3A7IA 4O2PA 4PQNA 3EQCA 4K6ZA 3QRUA 5EOLA 5DR6A 3P9JA 4NM0A 4OLIA 4PP7A 1XBBA 4FF8A 4G1WA 4FTCA 3OF0A 4YJUA 1TQPA 1J3HA 2O63A 2CGUA 3Q4ZA 4BDDA 5KUPA 4ZY4A 2ZV2A 4QTCA 1Y6AA 3COMA 4MXYA 4GH2A 2R3IA 4YJPA 4N6YA 1R0EA 3OT3A 4U42A 1Z57A 3OXTA 5T6KA 2HELA 3PFQA 4DEDA 3GCQA 2HIWA 2WFYA 4AT5A 4BKZA 3CQUA 4MWIA 3ZM4A 5JGAA 2QQ7A 2XCHA 2JITA 5M4IA 4O0RA 4EYMA 2WZJA 3FMKA 4NZWB 4A9TA 4C8BA 3JY9A 4CFMA 5M4CA 4BR3A 3KMWA 3I4BA 4C4HA 4D0WA 1IAJA 4ZS4A 3R2BA 2VTLA 1OECA 2WD1A 3OROA 2HW7A 4FSTA 4FV8A 4JNWA 5HLPA 4U8ZA 3HMOA 3R73A 4NM5A 3UO5A 2V62A 3PG3A 3SRVA 4FKVA 2X8EA 5ETAA 4CFXA 2IZSA 2ITYA 1J7IA 3QZHA 2JIVA 2UW0A 4B8MA 1X8BA 3Q4UA 3C4FA 3QZIA 4C4FA 3AC3A 4PRJA 3VIDA 4O7LA 3H9OA 3TEIA 5LVLA 3ACJA 5ETCA 3W2QA 3QTXA 3PZEA 3A7FA 2QKWB 4LQMA 5CI6A 3R1NA 4YTCA 4RVLA 2WO6A 1XH4A 3MFSA 5JRSA 4F1OA 3LPBA 5ETIA 2C5YA 4D9UA 2XP2A 3AQVA 3NUNA 4KSQA 3TNQB 5M07A 3DY7A 4IB1A 4MWHA 4UMTA 2W1FA 4L9IA 4BZOA 4D2SA 5CU0A 3CY3A 5IG1A 3L8SA 2JFLA 3ZEPA 3BYUA 5L6PA 2C1BA 5LVPA 4I6FA 4M12A 3QX4A 3NRMA 3DZOA 3HA8A 1PY5A 1M17A 4ZTHA 4Y85A