3F7ZA

X-ray co-crystal structure of glycogen synthase kinase 3beta in complex with an inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
350
structure length
339
Chain Sequence
LSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, synthesis and structure-activity relationships of 1,3,4-oxadiazole derivatives as novel inhibitors of glycogen synthase kinase-3beta.
pubmed doi rcsb
molecule keywords Glycogen synthase kinase-3 beta
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 339
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3f7zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3f7zA01
3LVPA 4IQ6A 2UVYA 1TVOA 3BYSA 2GTNA 2VTRA 1JOWB 3II5A 4NFNA 4AW2A 5LMBA 4BR3A 2C3JA 3QD2B 4R8QA 5D9HA 4R77A 4ZTSA 3LIJA 4BTJA 4JLCA 5I9XA 2WU7A 4R1VA 3RPYA 3ROYA 5IDPA 3D5UA 4UMUA 4HVDA 1PMUA 3C4CA 2WAJA 5CAPA 3DDPA 2JIIA 4I22A 4IC7A 5IF1A 1LEWA 4AFJA 5J79A 3OWKA 1FGKA 3S4QA 2X9FA 4D2PA 3O7LB 5B2MA 1UU3A 3NYOA 4QTCA 2ZMDA 4FVPA 4ASDA 5IH5A 5EHYA 5K5XA 3UO5A 3CTHA 4BYJA 4MXZA 2NRYA 4G9RA 3OT8A 3VS2A 4QYGA 3N4VA 3HDMA 4EC9A 2WOUA 3MPMA 4YNOA 4RZWA 4QTAA 4W4VA 3NW7A 3ZTXA 5IQFA 5EM6A 1URCA 1PXMA 4IB5A 5EKNA 3DK6A 4RFYA 5IG1A 3HV6A 4IWPA 3RPOA 3FI8A 3HNGA 4PTCA 4E4XA 1U5RA 5ANEA 2ETMA 4OBOA 5FGKA 4ANOA 4CLIA 1JKKA 4WG5A 5DWRA 4YZMA 4U45A 4GK2A 4C3PA 2CMWA 5EM5A 5FEQA 5M4FA 3FLNC 2QR8A 3QZFA 2IWIA 2PVKA 4FSRA 4BDEA 2R4BA 4AUAA 3MVLA 4GMYA 3MH3A 1PXLA 4PQNA 3WZUA 4EK6A 4EZ7A 4FC0A 4FBXA 1FMOE 4RJ8A 1JNKA 4OAVB 4CT1A 3IW6A 5HNBA 3FC1X 3ORKA 2R3MA 4MF1A 4A4OA 4C4FA 5CF4A 2ETKA 3WZKA 3OBJA 3H9FA 3O50A 3PFQA 4IVDA 2PZRA 3VUMA 1XWSA 2W1IA 4C59A 2PUNA 3QTZA 1KOAA 4MXCA 2KTYA 4NT4A 4O0YA 2J9MA 3EH9A 3HYHA 4QQCA 3UG1A 5C8KA 2VWUA 3W32A 2ZDTA 3UNKA 4ZSGA 4L9IA 3SXSA 1IASA 3FQHA 4F0IA 3C0GA 1FQ1B 3EHAA 3NZ0A 3SDJA 3P08A 3TNIA 5IEVA 4YLJA 5D7AA 4QP1A 1O6LA 2R3FA 3C51A 4G3GA 1M2QA 2YERA 3EQFA 4GFGA 3ACJA 3Q53A 1U46A 3OUKA 4CT2A 3EKNA 4F9CA 5JQ8A 5D7VA 2G2HA 4XJ0A 3OMVA 4YPSA 1W83A 4E5WA 2Y6MA 3RHKA 3EQIA 4L6QA 4K8AA 3FLSA 4R7IA 4CVAA 2BZIB 4QMZA 3NRMA 5AMNA 3IS5A 2F7ZE 3CR0A 4BRXA 2R3RA 1CKIA 2J90A 3BE9A 3GXLA 2GTMA 4JG8A 3UIBA 3NCZA 3A7FA 2W1ZA 4E4MA 2GCDA 3DV3A 1PY5A 4O91A 1H1QA 4GVAA 1HCKA 3HEGA 5B2KA 3FMNA 5KNJA 2W1HA 2ITQA 2PE2A 4BB4A 4MQ2A 3GC9A 4ZJVA 2YLFA 5DEWA 4EK3A 4B6LA 4DFUA 2A2AA 4BZNA 3D0EA 2IZSA 5LWMA 4RIYB 1NT2A 3SKCA 2EU9A 3KY2A 5CSXA 3MIYA 3OEZA 5FRIA 5A4LA 5IQDA 2RG6A 4FZFB 3Q5IA 4DEBA 2J5EA 5E1SA 1S9IA 3RM6A 5LMKC 4E6DA 1FVTA 1OVEA 3AMYA 5ANIA 5AUWA 2W05A 3VRZA 4R6VA 3PSCA 4RIOA 5DN3A 5H8EA 4AZTA 5CX9A 3ZSHA 4DE4A 5JQ5A 4GVJA 3NNWA 5AP2A 5KMMA 1YDTE 4IWQA 4G34A 4W8DA 3FY2A 4OBQA 3R8UA 4R5SA 1JWHA 3M1SA 1TQIA 3COMA 3H0ZA 1WAKA 3IOKA 4FKJA 4MNEA 4QTBA 4BI2A 5L2TA 2E9OA 1OL6A 3RK5A 2WQNA 4RVKA 5TOZA 3T3VA 5BVFA 1YDSE 2ESMA 4H36A 4IW0A 2AC5A 4C61A 5JFVA 3MTLA 3NUXA 1SYKA 3DTCA 3VIDA 2B4SB 4S30A 4YPDA 2RFEA 2J6MA 3MY1A 1K2PA 1SZMA 2E9VA 3FMDA 3QUDA 5FWKK 3DBFA 3AC8A 4A9TA 2OJGA 3M2WA 4ALUA 5I5ZA 5E8ZA 3VS6A 5AP1A 4L3PA 4X2FA 5A4EA 5LWNA 5D10A 3UIXA 4PPCA 1ZXEA 4O38A 3HRFA 2X4FA 2O2UA 3LFBA 5FLFA 2C5YA 4GYIA 3G9NA 4CKJA 5EYKA 4AGCA 1EH4A 2HENA 1FMKA 4O84A 2YACA 4FOBA 4EORA 2B54A 4IX4A 5E8TA 4G1WA 2UZLA 3ORLA 4A7CA 1Q61A 2BFYA 2XNMA 2OI4X 2XH5A 5CS6A 4O7VA 1OIYA 4L7FA 5ANDA 4D58A 2OJJA 5A3XA 3U55A 3OXTA 3JYAA 3FHRA 3O7LD 4J7BA 3A61A 2VTJA 3N9XA 4C37A 4EH6A 4TKSA 3RGFA 4GIHA 4F0GA 4JR3A 4FG8A 3DZOA 1UA2A 4WNKA 3DB8A 4QMQA 4N70A 2WTVA 4RLKA 5ACBC 3QKKA 3O8PA 3QLGA 1YDRE 4YHFA 3EQBA 2R0IA 5ETCA 4AOJA 4OT6A 4A4LA 4EZ3A 4ZTMA 5CSWA 1UU9A 4R3RA 2JDSA 1Q8UA 3FKOA 4TZRA 3SD0A 4U7ZA 2W06A 3KK8A 4FNZA 5HLWA 1JKSA 3U87A 3A7HA 4QMVA 2CGXA 4C4EA 4E5AX 2QR7A 1PXOA 2W96B 3FBVA 3JVRA 4U44A 5K4IA 3PP0A 3NGAA 2CKPA 4X6QC 2BAQA 4AF3A 1GJOA 2UW8A 4RT7A 3ZXZA 3U6IA 5LARA 4V0GA 5CQUA 2IW9A 3JVSA 3CQUA 4NCTA 4QP3A 4WOVA 1OBGA 5IA5A 1FBNA 5AV1A 3GP0A 4QD6A 4XP3A 4Z7GA 3QTUA 5TT7A 3IONA 4M66A 1ZOEA 4DITA 4E4NA 3WZJA 4TXCA 5AAFA 4APCA 4L42A 2XVDA 4EOOA 4IAFA 3GU6A 2BROA 2PUUA 3G6HA 4KIKB 4OTRA 1XR1A 3KN6A 4YJOA 3THBA 2J0JA 5BVOA 5BVDA 5IPJA 2J0LA 3FMEA 5CQWA 4CMOA 3OOMA 4FTJA 4Q5HA 2YM3A 2QO7A 3HDNA 4K6ZA 2P55A 3I60A 5HU9A 5I0BA 4GKHA 5EI6A 1UNLA 4U40A 4X3FA 2F57A 2YIRA 1P4FA 3NWWA 3MFUA 5JFSA 1KV1A 4FSMA 4I5CA 4Q9SA 4L7SA 4FTIA 4NL0A 2XRWA 4AAAA 3K54A 4F7LA 3W2OA 2DS1A 4TY1A 3Q4UA 2QOCA 3C4ZA 3I79A 4G2FA 1RJBA 4RC4A 5HCYA 1URWA 2UZWE 3DKCA 3A7IA 1OB3A 2QOQA 3NAXA 5AWMA 4RWKA 4BDFA 3G2FA 3ANQA 5HE3A 4FEUA 3G6GA 3UYSA 1KUTA 4H58A 4IZ7A 5BUIA 4JX7A 4EH4A 2C6LA 1XH7A 4F1OA 3MVMA 1BKXA 4RJ7A 3A4PA 2F9GA 3L8XA 3VS7A 1W8CA 4ENYA 1ERKA 4OTFA 3ZHPC 1Q4LA 2VTOA 4HNIA 4P2KA 3UQFA 2O3PA 3KEXA 2XBJA 5AUYA 3ZLXA 3D5XA 4TW9A 1M7QA 3R2YA 2HZNA 4RVMA 2GFCA 2GDOA 5DVRA 3C4EA 5BYYA 2VTIA 2BTRA 4H3PA 5CYIA 4MD9E 1F0QA 5AEPA 4P5ZA 3S95A 5TO8A 4HGTA 4EOJA 5LXMA 2O0UA 2CJMA 5KE0A 4OAUC 2CCHA 3I1AA 3HVCA 1PKDA 3GU7A 3LXKA 3LHJA 4FT3A 4ZK5A 4F4PA 4EI4A 3U6HA 1MQBA 1H0WA 2QO2A 4M3QA 4WUAA 3WIKA 2I0EA 4H05A 4ZAUA 3O71A 2C0IA 3LMGA 4TN6A 3PXRA 3VUHA 2UVXA 3O0GA 3Q6WA 3FLYA 1OL2A 3QQFA 2W9ZB 2XUUA 1IA9A 3HZTA 2Z60A 4PMSA 2HK5A 5HVKA 3WF7A 3ZCLA 4EOQA 2WTJA 3W8LA 5F20A 2OK1A 4FOCA 1I44A 5FQDC 5FEDA 4GIIA 4XEYA 3W33A 3I4BA 4B7TA 3PUPA 4YMJA 3SW7A 2XMYA 5CVGA 1ZRZA 3JXWA 3LCTA 3U9NA 3EN9A 3LPBA 2YZLA 3PXFA 3I7CA 2RG5A 1T46A 2XNNA 2BHHA 3G5DA 3PIZA 2QLUA 2PVRA 3CQWA 4IJPA 3LFAA 2XCKA 4AACA 4Y95A 1K9AA 3UYTA 1KE9A 4O0XA 3TNQB 5KBQA 4NM3A 3PDTA 5M08A 3ZO2A 3QZHA 3E3PA 3TUBA 4ACCA 4YR8A 3I0QA 4O7NA 5HIDA 3FLWA 5FG8A 2FSLX 5HI2A 1YQJA 2I1MA 4RGJA 4YP8A 4C3FA 3LFDA 3PWYA 3TACA 3MGYA 3RPSA 2QG7A 3Q9YA 1ZYDA 5AV2A 4AE9A 3TT0A 2YWPA 2XS0A 2R3NA 5D12A 3O8UA 3TNPC 1Z57A 3TUCA 2GU8A 4PPAA 3CE3A 3DBEA 4AXAA 2X2KA 4BCKA 3BE2A 1RDQE 3PPJA 4FTTA 4AWIA 2RFDA 2R3QA 5IQCA 3Q2MA 4I5HA 3NDMA 2WMAA 3BLHA 3BPRA 2I0HA 4RJ3A 3RPVA 4J8MA 3GB2A 3PIYA 5KMKA 1Q8ZA 4XBRA 1OKVA 3PRIA 2CKOA 4KS7A 3G33A 4KA3A 4F7NA 4UMPA 2QC6A 2ITYA 1S9JA 2PYWA 4O0WA 2X6DA 4IWDA 4ZSEA 4P5QA 5CU2A 3VS1A 3ORMA 1OITA 2B0QA 3RWQA 3R7GA 4RQVA 5A6NA 4JX3A 4K0YA 3MVJA 2C0TA 3EQCA 3ZU7A 3NIZA 3O96A 2H6DA 3QD0A 5IEXA 2X8DA 5HICA 5H8BA 3S00A 1NVRA 2FA2A 2HXQA 2UZTA 4FICA 3BLQA 3VAPA 3ZSIA 2PE0A 1OIRA 3V8SA 4GT5A 1O6YA 3MIAA 1UWHA 2WB8A 4D4RA 2X7FA 4TYIA 3PXYA 4GS6A 5AP0A 1PKGA 5FEEA 4E7WA 4O7WA 2JITA 4D2VA 5ICPA 3VUIA 3EN7A 4CSVA 3EOCA 5DYJA 3DS6A 5LCJA 1PRYA 1CM8A 2X81A 3AGMA 5AR4A 2QODA 3BHUA 4JQ7A 2ONLC 3DAJA 3MYGA 3NUYA 1LP4A 4DCEA 2VTSA 2VWIA 4IDVA 4RVTA 3NIEA 4G16A 4QP6A 2UZOA 4ERKA 2JGZA 4LGGA 4WG3A 3RAKA 3SVVA 4J1RA 3VQHA 4F1TA 3GU5A 5AP7A 1RE8A 2JKOA 4L68A 2OKRA 4PPBA 4U42A 3NNVA 5AR3A 2R3LA 4D2TA 4GRBA 4NFMA 1FOTA 3ZLYA 4DH7A 4YZ9A 5E8VA 3ZBFA 5EKOA 3UIMA 1DAWA 4MTAA 3Q9XA 4M69A 2JBPA 2V5QA 4D2SA 3FUPA 3A8WA 1PHKA 4TYJA 1H28A 4N4SA 3BYVA 5EW8A 2G01A 3R0TA 3VWAA 2GHLA 4C3RA 4FV6A 4EWQA 2PY3A 3F3TA 3ZUVA 2X2MA 3NCGA 4OT5A 4DC2A 3BRBA 3I7BA 3H9RA 3P7CA 4WBBB 4AA5A 4ALWA 5IQAA 4N6ZA 1NVSA 4LV8A 4JR7A 4AOIA 4BDHA 3OS3A 3R9HA 2OIBA 3E88A 1IAHA 5IZFA 3PPZA 1U54B 5DOSA 2EB2A 1ZOGA 3K2LA 4F6UA 1QPEA 2R2PA 4DF3A 1V0BA 3DJ7A 5IQHA 2A4LA 1MRVA 4GSBA 5GJGA 3SA0A 4F65A 3QXPA 4IADA 5M09A 2OZAB 4Z55A 1VEBA 3UTOA 4L8MA 2Q83A 1OM1A 4JXFA 3UZRA 4QYYA 5AIRA 2LGCA 2OF4A 3P79A 1MUOA 3DT1A 3EB0A 4QQJA 4JRNA 4D28A 5BMMA 5DEYA 4AN3A 2PPQA 3ZM9A 3LW0A 5L2QA 4I20A 2NNWB 5D1JA 2HW6A 4G9CA 4LMUA 4DEAA 1JQHA 5DR2A 3CPBA 4YJNA 4BIDA 3ANRA 3HMIA 4GU6A 5BX0A 1BYGA 4NK9A 1K3AA 2HZ4A 3IGGA 2BZJA 4I6HA 2H9VA 4ZJJA 4JDJA 3F3ZA 4RFMA 4B8MA 4CMTA 4RBLA 2X0GA 5CNNA 2R5TA 3QU0A 2X9EA 3D7TA 4DH1A 4IM2A 4M13A 3UZPA 4J95A 2BTSA 1H26A 2JIUA 5HLPA 2V7OA 3HA8A 3HX4A 3R7UA 3CXWA 5HESA 4BDBA 3R8PA 4TWNA 3CLYA 1OKYA 1R78A 3PLSA 4PP7A 1P14A 2C3KA 3QX4A 2H96A 1F3MC 3V5PA 4F6WA 2QD9A 4ZY6A 3TXOA 2JFMA 2ZJWA 4RFZA 4USDA 5BVEA 4AT4A 3ZONA 4PV0A 2XP2A 4FTQA 3BU5A 3QYZA 1OUYA 1YI6A 3COHA 4C7TA 3OW3A 4S34A 3OD6X 3U6JA 3UZTA 3DA6A 4FSUA 4NYEA 4BBFA 4A9UA 3QXOA 2DWBA 3W16A 4LM5A 1WBOA 1BLXA 2E9PA 3LCKA 4IVAA 4Y5HA 2QOOA 4FV3A 2BDJA 2G9XA 4BKZA 5HTIA 3Q3BA 3ALOA 2YEXA 4MCVA 4L3LA 4O6LA 3T9TA 3MH0A 3HKOA 4UZHA 2DQ7X 3C5UA 5E1EA 4DTBA 2V0DA 4E5BA 4O22A 3RM7A 5EG3A 4CTCA 2WTDA 4FEQA 2XYUA 3C1XA 3O8TA 5E92A 4AU8A 3AC4A 2QKRA 4EONA 3K3JA 5H3QA 4JIAA 3RCJA 3NNUA 2FSTX 4UYAA 1O6KA 5HE0A 2HAKA 4B4LA 5K4JA 3FYJX 4LQMA 1QCFA 2YABA 3FJQE 4XRJA 4BCJA 1YOMA 3OCGA 5EOLA 4IXPA 4C36A 5HLNA 4TWCA 1P2AA 2R3KA 4D5HA 1OECA 2PVJA 4D9TA 4I5MA 5DI1A 3PSBA 4L52A 4OTIA 5EYDA 1YWVA 4BL1A 3PA4A 1Q3DA 2VTQA 3CEKA 4J99A 3R7EA 3SC1A 3UNJA 5AR8A 5IH4A 4TNBA 4N0SA 4FTUA 4EQCA 3F7WA 4YLKA 2WD1A 2ZM4A 3BBTB 3TZMA 5LJJA 4JT3A 4UB7A 3ZSGA 3MY5A 5CU4A 4FTOA 4D0XA 3SG8A 2OJ9A 5HKMA 2HELA 4OTWA 2YM6A 3UGCA 2YAAA 3MA6A 2F49A 2OF2A 5L6OA 4BICA 1UNHA 2JBOA 4QT1A 4YZDA 3MW1A 3ZXTA 4FT9A 5K0XA 3HMOA 1OIUA 1M52A 5CALA 5DNRA 1U5QA 2HYYA 2CKEA 3TEIA 2IW8A 3FY0A 5CEMA 3BZ3A 2HY0A 3EN5A 2XK3A 2IZTA 1GOLA 3UVPA 4ASXA 3VVHA 2ZM3A 2WMWA 3IOPA 1H27A 4WNOA 2VAGA 2C3LA 3QC9A 3KXMA 3HMNA 1UU7A 5DG5A 4AA0A 5GIPE 2YCRA 3AC2A 3MSSA 2SRCA 3K3IA 3KRLA 4NZWB 4EBVA 5AUVA 4EYJA 2CNUA 4YTIA 3ZEWA 4U97A 1APME 2FSMX 4TYEA 2W4OA 3LFNA 5LMAA 4KSQA 3SOAA 2Y9QA 3R21A 2YAKA 3PZEA 4YLLA 4P7EA 3CTJA 5CU3A 5IA1A 4KABA 2ZV9A 3WILA 4DGOA 1LEZA 4K1BA 3E93A 4GW8A 5HX8A 5KHXA 4E20A 2ITUA 4QTEA 1NVQA 4NM0A 4M84A 3NUPA 2J51A 2G1TA 5FDXA 5L8LA 3GI3A 4OR5A 2V22A 4TTHB 2PWLA 4W8EA 4FTKA 2YISA 3KFAA 5HG5A 1ZLTA 4P90A 3IGOA 4X2GA 3LFEA 3BHTA 5LMKA 4NKSA 5A4QA 3FMMA 4DLIA 2V7AA 2W4KA 2XJ0A 4IAAA 2YA9A 3C4WA 5I9UA 1H0VA 4CFUA 3ZYAA 4IB1A 2C6EA 4EJNA 4ZTRA 4E26A 1OIQA 2XEYA 4NEUA 3W55A 3VQUA 2X1NA 4U9AA 2P33A 4IAZA 4ZSLA 5I3OA 2NO3A 2XIXA 1ZMVA 3L9LA 3TKUA 4CFVA 3V5LA 3DJ5A 5JK3A 4I94A 3KULA 4XP0A 1WBPA 5A46A 5FD2A 4EJ7A 3NYVA 2BAKA 3PXZA 1H25A 4RIWA 4ZLYA 1KSWA 1PXNA 5GJDA 3GENA 4WRGA 2OZOA 3B2TA 4HYHA 4J96A 4S31A 3P78A 3NAYA 2VTAA 3NLBA 5BVWA 3CBLA 4HNFA 5DPVA 4MWIA 2CSNA 1X8BA 3OHTA 2KULA 1W0XC 2FO0A 4AT5A 5JZJA 3DU8A 4RC3A 4XS2A 2FYSA 1A48A 1XH9A 2CHLA 3RKBA 4EOSA 3ORNA 1I09A 3RAWA 3DPKA 5L6PA 1OL7A 1OL1A 3VS5A 4AZWA 3DAKA 2Y4IB 3MBLA 4MD8E 4FKWA 3RK7A 3TKIA 4E1ZA 2W5BA 3TV7A 2VD5A 4YBKA 5HNIX 3MJ2A 3VW6A 3FKLA 3FYKX 4CV8A 4C4IA 3FAAA 4MK0A 2A0CX 4XH6A 4FKRA 4M67A 4EUTA 1PXJA 4AGDA 2YFXA 4HOKA 4EOLA 3ORTA 2BUJA 2YCQA 5A6OA 5JMSA 4QNAA 3SX9A 4FEWA 2HY81 2PVFA 3A2CA 3E3BX 3PYYA 4YC6A 1M14A 5HO8A 2AYPA 3CC6A 2JDOA 2F7EE 4BDJA 4DBNA 3TKHA 1R39A 2VO7A 4C57A 4MQ1A 4ONAA 4AP7A 3GQIA 5CASA 5HU3A 2C3IB 4KIOA 1ZARA 4GEOA 1HCLA 4UMRA 3HV7A 3QRJA 4D9UA 4YC3A 2ITNA 5AFVA 3BHYA 1PXIA 4KD1A 4NIFA 2IZUA 4W4XA 3QQGA 4JDKA 3W2QA 1DM2A 1JPAA 4F70A 2FH9A 3QCYA 5J9ZA 4IWOA 5FTQA 5IKWA 5T68A 1GIJA 4HGSA 3SW4A 3VS4A 3R30A 2AC3A 1Q8WA 4FV9A 4DYMA 1IRKA 3VBXA 3VO3A 3UP2A 4O21A 4KBAA 3RPRA 4DA5A 1W7HA 3IDCA 4E4LA 5AM6A 2OXDA 4OGRA 4M68A 5E8YA 3AMBA 2VO3A 4QOXA 2IN6A 3FPMA 4YZBA 4GV1A 3UQGA 4CFXA 3H10A 3F5GA 4MF0A 5BYZA 4DHFA 2WQBA 4JJRA 5BYLA 2UW9A 4AN2A 3PJ1A 4RJ6A 1KE8A 5H2UA 4FIJA 1IAJA 3D7ZA 4X0MA 3SRVA 3ZRLA 2AUHA 4OTPA 4AT3A 2C6MA 5DBXA 2F4JA 2UW0A 4M8TA 4GK3A 2YN8A 3ZDUA 4WHZA 3U4WA 1PYXA 2NRUA 4PY1A 3AT3A 4TPTA 3COKA 4DEIA 4YSMA 4FV1A 5ETIA 5HE2A 4O2ZA 4CEGA 4JBQA 3KN5A 4FUYA 2C6DA 4FTLA 3NX8A 1GZOA 4AZSA 2I7QA 3S2PA 5FUTA 4BTMA 3DBQA 4FTNA 3PY0A 5KMIA 3I6WA 2WHBA 3R01A 4YJUA 3SXRA 4UY9A 5CI7A 2DYLA 1W84A 1YOJA 3ZO4A 2XRUA 4IH8A 4NJ3A 4UXQA 2J0KA 4HGEA 1BMKA 4E6AA 3VN9A 3NMUF 4I0SA 1J1CA 4XOZA 2PZ5A 2WQEA 3MVHA 4XV2A 1YKRA 2JFLA 4FNYA 4ID7A 4J98A 4ACDA 4Z16A 4S2ZA 2PVHA 4F63A 2IVUA 2BIKB 3O2MA 3BV3A 4A4XA 3K5UA 4HCTA 3LMIA 2BRGA 2VWZA 4FL3A 5C01A 3D4QA 2GQRA 4K11A 5AIKA 4X6RA 4XNEA 5TKDA 4F7JA 3MH1A 2C68A 3LXNA 5J9LA 4MXYA 3HRCA 4ORKA 5HX6A 2JD5A 4BBMA 2IJMA 3V3VA 1WBNA 5E8SA 4D4SA 2XK8A 3DFAA 3VUGA 4QYFA 3E63A 4JBVA 5EHLA 5KZ0A 2IG7A 2R3IA 5KO1A 2BRBA 1ZMUA 4AE6A 4GT3A 2YCSA 2GNHA 4Y8DA 4EUUA 3A8XA 2B1PA 5CSVA 5AADA 4IIRA 4JDIA 2QOFA 3R73A 1Y8YA 4RX7A 1TQPA 1W82A 3QKLA 3ODYX 5FXQA 4OTQA 2P0CA 3AC5A 2Y4PA 2JDVA 2HZIA 2UZVA 4YO6A 3DXNA 4C4HA 5IQIA 5CAUA 2OG8A 2C6OA 3IPHA 3F6XA 5EM8A 3MPAA 4ACHA 4X2JA 2QNJA 2BFXA 3OF0A 4BDIA 4D0WA 3DY7A 3UPZA 3AD6A 4GJ2A 4RWJA 3ZLSA 4LOQA 2R3GA 1J91A 4FIEA 3B2WA 3R00A 5IQEA 1R3CA 3LQ8A 3I81A 2X6EA 5KBRA 5BUEA 3LE6A 4WRSA 4HCVA 1PMNA 2QOLA 5FM2A 4FSZA 4UYNA 2EUFB 3VJNA 4LMNA 4I4FA 3R2BA 4APPA 5J1VA 4O1OA 4EYMA 4QMLA 3KCFA 5HEZA 4XG4A 3ZZEA 5AA9A 1T45A 2QONA 3NUSA 3ORPA 3QWJA 3HP5A 2OJFE 3ROCA 2XNGA 4U79A 1Q8YA 2IVTA 2UW6A 2XNEA 3UO4A 1GIHA 3PJ8A 3C7QA 3TJCA 4BHNA 3R9RA 3RZBA 2VTHA 3U54A 4IC8A 4O2PA 4V04A 2LAVA 5HTCA 4DT9A 5J5SA 3BYOA 4FV2A 4J97A 4XG9A 3WARA 5JH6A 3ALNA 4FTCA 4DG2E 5HORA 1REJA 4UZDA 4BGHA 2XK4A 2YDKA 3MB7A 4K77A 4ZSJA 5FTGA 4FVQA 3MY0A 4ZTNA 3R7OA 1NY3A 3VS3A 1KE6A 2C1AA 3N51A 3RNIA 4D1XA 4DH8A 3KQ7A 2YM5A 4UBAA 1JSUA 4FV8A 3ZOSA 3SOCA 1H07A 4PDOA 1A9UA 2QU5A 1YWRA 4ZZOA 1F5QA 3CD3A 2B7AA 2W1DA 4M15A 4K18A 1BI8A 4WSQA 5EH0A 4F9WA 1ZYCA 4PMPA 3POZA 4EK4A 3GFEA 5L6WL 3BKBA 4BIEA 3CIKA 3FZTA 2QO9A 4DG0E 4XHKB 1LR4A 4PF4A 3OC1A 4V05A 4QP2A 3UJGA 5I9WA 4YUQA 4KRCA 3KK9A 3AT2A 3UOJA 2OXXA 3WBLA 4LL5A 4RIXB 3D5WA 3ACKA 4FKGA 2PVLA 4XV1A 5F94A 2XKDA 4PNKA 3R8LA 5C8NA 1V0OA 3FSFA 4DGLC 2X8IA 1BI7A 1YXVA 4XBUA 4YGAA 5AUUA 4F64A 3SGCA 3IDBA 5DMZA 5GNKA 5M51A 2XK6A 4TYHB 4X2NA 2JC6A 4MKCA 3NR9A 3Q9ZA 3RALA 3VJOA 1Q5KA 4CV9A 2PU8A 4EK8A 2X7GA 4QMXA 3DQXA 3KVWA 5CT0A 3W8QA 1YOLA 4I24A 4EH3A 4F08A 3W1FA 2IVSA 2QOIA 3RI1A 3D2IA 4ZZNA 2W1CA 4KUJA 3QTRA 3ZO3A 2ITWA 1G5SA 2BALA 2VGPA 4K33A 3Q52A 4J71A 4I4EA 4LRJA 4USEA 4UWCA 4EKLA 3GCQA 2PZIA 4QP7A 2ONLA 4BCQA 5CU0A 4R5YA 5CY3A 3DXQA 3Q2JA 1CMKE 4Q2AA 3HV4A 3HECA 3RVGA 3MI9A 4ZLZA 4RJ4A 2VX1A 4JL9A 3TWJA 4B99A 4MBLA 5B0XA 3BGZA 5C26A 5HVJA 3TZ9A 2CGUA 2B9IA 4KINA 3H4JA 4IMYA 4DFBA 3WZEA 1Q8TA 2GHMA 1IG1A 2GNFA 3D15A 3QCXA 3ENMA 5J9YA 5A4CA 2GQGA 2PMOX 4UMQA 1L8TA 1NXKA 4JQEA 1YI3A 2WEVA 3QGWA 1YXSA 2HWPA 4BCFA 4YSJA 3I5ZA 5AP4A 3QC4A 5HD4A 3OXZA 3E8EA 2YCFA 4QQ5A 3W2PA 2J50A 3F5PA 4EHEA 5JT2A 3AD4A 3QTSA 3D14A 3ZEPA 3WYYA 2WQMA 3E8NA 1XH6A 3F88A 3TDVA 4BI1A 2R3OA 3MWUA 3WF8A 4C38A 1VZOA 3MTFA 3QFVA 5CU6A 5CF6A 4II5A 2UW3A 4LUEA 3UE4A 1OL5A 3IO7A 5AX3A 1WBWA 3CGOA 4ZOGA 3F5UA 3FEGA 3F7ZA 3L8SA 4MVFA 4BFMA 1SVEA 2O64A 3BYUA 4GH2A 5CENA 4XG7A 4ANNA 1PXPA 4D5KA 4EQUA 2A19B 4I1ZA 2P2IA 2VTTA 5CLPA 1J7UA 3UMXA 3BWJA 3AQVA 5EHOA 4FKUA 3V51A 4PDYA 4AZVA 2XK9A 3QQUA 4F9YA 4WBOA 5HBJA 3V6RA 2F7XE 2I40A 4FIHA 5CEIA 1XKKA 4CQGA 3IW7A 3NS9A 2WO6A 4Y5QA 4QMPA 3PLAE 1JLUE 2RGPA 3JY9A 5KCVA 1AD5A 2V62A 3KC3A 4AZFA 5GHVA 3FQSA 2QKWB 3OT3A 4MBJA 5AUZA 1JKLA 1B38A 1VJYA 4CYIA 3IW5A 1P5EA 3GU4A 4ZY5A 3KF4A 1H1RA 1ZWSA 2YZAA 3NUNA 2JDRA 4QO9A 4G31A 3CTQA 3CGFA 3DQWA 4YZCA 1CKPA 3BIZA 4UX9A 1REKA 3L8VA 3SLSA 3T9IA 3FLQA 3RCDA 3WIGA 4AW0A 2PMNX 2BRNA 3GVUA 3ZM4A 5B7VA 2ZVAA 4LGHA 3RBWA 1H4LA 2X8EA 4XMOA 4YJTA 2QQ7A 1LPUA 2ITOA 2ZOQA 4JRVA 4E3CA 5JFXA 4CG8A 4D4YA 3MH2A 4JOAA 1VR2A 2WMUA 4FNXA 5LVOA 2GNGA 5EM7A 3FKNA 3GCUA 4EWHA 3PXKA 3R9OA 4CD0A 3NVKI 2GFSA 3JPVA 4KWPA 3MS9A 4C02A 4C33A 3NVMB 4J52A 4DINA 3DOGA 1Q97A 2O63A 4CRLA 5JGBA 3CS9A 2CCIA 3CY2A 3ZRKA 3BHVA 4E6CA 5BNJA 5AJQA 4UEUA 4BDAA 4BBEA 2PE1A 3TTJA 4PWNA 3IG7A 4X21A 1QPJA 5EYMA 4LV5A 2UUEA 3TN8A 4L45A 5CVFA 3R6XA 2O8YA 5IA3A 3HV3A 4FKPA 4L01A 5DT4A 3MESA 4NUSA 4Y46A 4O0TA 2JLDA 2ZM1A 3EL8A 4RIYA 4EC8A 3C5IA 3OWPA 4HVHA 4PL3A 5IQGA 5CEOA 3QX2A 5T6KA 4FSTA 3KCKA 1M2RA 4IVCA 2YM4A 3E64A 3IW4A 4W9XA 3NNXA 3OCTA 4MD7E 1OMWA 3TIZA 3S3IA 2FUMA 2OLCA 3F2RA 4QYHA 1IA8A 4FKVA 3ZFXA 3O51A 4XCUA 2WQOA 4MXXA 4RA5A 5DT0A 4A9SA 5BPYA 5M44A 4ANBA 4R3PA 3P0MA 3AMAA 1WBVA 1V1KA 3EWHA 3L8PA 4G6LA 5K5NA 3U4UA 2RFSA 3ZC6A 1M17A 5M53A 3R83A 4AZEA 4FYOA 4HPTE 5L8KA 5K3YA 2OXYA 3EQHA 2PVMA 4MNEB 4MWHA 3UBDA 1MRUA 3CJFA 4RC2A 2Z7SA 3PY1A 3KU2A 5T3QA 3R9DA 1PF8A 4BHZA 4AX8A 2CN8A 3DKFA 4ZIMA 2Z7LA 4IFCA 4BCMA 2VO6A 4XOYA 4IEBA 5EOBA 3VS0A 4NJDA 4HYSA 3WE8A 5E8WA 3IQ7A 3VF9A 5EI2A 3UG2A 1Y6AA 3PJCA 1OUKA 4CMUA 1VYWA 4F99A 3UQCA 3TV6A 4NKAA 4A9RA 4DH5A 5BVNA 2XK7A 2Y4IC 2J7TA 3EYGA 5B2LA 1CTPE 3FZPA 1NW1A 3UNZA 4LG4A 4LFIA 4V01A 4W9WA 4GFOA 5IISA 3OZ6A 4YTFA 3H9OA 4P4CA 3PG3A 4U80A 3D5VA 4DH3A 3PE2A 3NW6A 4RVLA 3ZS5A 5CZHA 2HOGA 4F9BA 2GHGA 5HTBA 3F2AA 2C5XA 2C1BA 4EH2A 2PUPA 3BQRA 5CF5A 2VTNA 3PVBA 3D9VA 2Y8OA 3Q04A 3P1AA 5L4QA 4HPUE 2HXLA 4QP4A 4EL9A 4RA4A 3QAME 4O0RA 3U9CA 3HP2A 1Y91A 3BEGA 3ZC5A 1ZMWA 5J95A 3V5QA 3A62A 5E4HA 2BVAA 2WELA 3N4UA 4O82A 3HLLA 3EKKA 2CGWA 4HZSA 4USFA 3PY3A 2QOBA 4RG0A 3V5TA 4QPMA 3UPXA 3UVRA 4N57A 2O65A 4G5JA 3GOPA 4DFXE 2HWOA 1RW8A 1Z5MA 4DGNA 4BGGA 5D11A 3PRFA 2PVNA 5FP5A 3HA6A 3SHEA 4AFEA 4GKIA 3R1NA 3GC7A 5E91A 3GCPA 4QMTA 4AQCA 4QMMA 4L43A 1LUFA 4FTAA 3UIUA 5L2WA 1YXXA 3DB6A 4FTRA 4V0GB 2HW7A 3LCOA 4EOIA 3LQ3A 2ITXA 5GZAA 5C4LA 2HIWA 3DFCB 4AS0A 2YIXA 5M4CA 4KKEA 5C9CA 1KE5A 2WMBA 4KSPA 3MPTA 5H8GA 3QL8A 3MDYA 4HJOA 5JKGA 4DBXA 4H1JA 4DLJA 3ULZA 4R7BA 5DGZA 4KIKA 5FM3A 2XNBA 1YW2A 4CFMA 2QOHA 2WKMA 4W4YA 4ANQA 5AUXA 1H1PA 3O17A 4XYFA 1KWPA 3KMUA 4ARKA 2JKMA 3DLSA 4PUZA 1DI8A 3OVVA 4NWMA 5FP6A 3QQLA 4NH1A 4XP2A 2PUIA 4ZTHA 4FV0A 3RMFA 2B55A 2ZV8A 1ZYLA 3EQPA 4U6RA 3IW8A 5LVLA 4CZYB 4GL9A 5IU2A 2CGVA 4X3FB 4Z3VA 4WNPA 4FL1A 4EH9A 3BU6A 4FKIA 5C1QB 5KKRB 2C6KA 5CEQA 4CNHA 4IB3A 3ZZWA 3OP5A 4IFGA 2CLQA 4BY9E 2FVDA 3R71A 1TQMA 3GC8A 4EOPA 3FHIA 4CFFA 3LJ1A 5L2SA 2BIYA 1OBDA 3PG1A 3E5AA 2W5HA 4FGBA 5AR5A 2XM9A 2UZUE 3PE1A 4YJPA 2YIQA 4DFNA 5M4IA 4O7ZA 2Y7JA 1DAYA 5E90A 1CSNA 3DDQA 4IM0A 3BWFA 4DFLA 2RKUA 3P7BA 3ENHA 2I0YA 4DEDA 1WVXA 2WNTA 4KNBA 5AP5A 4B8LA 5GIOE 4FI1A 4IZAA 4J8NA 5IA4A 1H01A 4YJRA 2PMLX 2YJRA 3R63A 4CZUA 3CPCA 3G9LX 3HUBA 4FSWA 2W5AA 2WFYA 4GT4A 4PL4A 5TF9A 4BDGA 4D1SA 2QU6A 5JRQA 3CD8A 3CQEA 1Q3WA 4WNMA 5AX9A 3GOKA 4G3EA 3P7AA 4BDKA 3QHRA 2VV9A 3C4XA 1SVGA 1YRPA 4G3CA 5CTPA 2RIOA 3GBZA 2Z2WA 5JRSA 1SNUA 2OH4A 4F9AA 3QD4A 2YJSA 3Q32A 3WE4A 1GAGA 3FMLA 4CFWA 4DEHA 4H3QA 4FF8A 3Q5ZA 3OUNB 4BWPA 3JR1A 4GK4A 5FBOA 3FXWA 5HO6A 5F1ZA 4DGMA 3R7YA 3EL7A 2XM8A 3RP9A 3LLTA 2PSQA 3T8OA 4LRMA 3ZBXA 3BEAA 4L53A 3EN4A 3Q4TA 2ZDUA 3QD3A 4O96A 2IZRA 3CP9A 4B9DA 3KREA 4KS8A 4MAOA 3FXXA 4AA4A 1GY3A 3KMWA 3TNWA 3A7GA 1R1WA 5DH3A 3ODZX 4XRLA 3S0OA 4XV9A 5CANA 3ZLWA 2ETRA 2CKQA 2O5KA 2I0VA 1H8FA 4ZS0A 3DBCA 1KV2A 2WMXA 4X3JA 3OTVA 3H3CA 3QZGA 3SQQA 3F3WA 4PMTA 2B53A 4X2KA 5IA2A 2ITPA 1WMKA 5I9YA 3VF8A 4Z9LA 4BF2A 2PVYA 4O7TA 3PA5A 4RWIA 4ZLOA 4YHJA 2IPXA 5I9ZA 5HE1A 3BCEA 1ZY5A 3ERKA 3F69A 2WIHA 4FL2A 4EHVA 3LCSA 2OU7A 4BTKA 3V5JA 4FUXA 4JQ8A 2BILB 4IX3A 1PW2A 2C5VA 3FSKA 2ZYBA 1YWNA 4RLLA 4XG8A 4KKGA 4QPAA 5ETFA 1J7LA 4C34A 4M12A 5EW9A 3R8VA 4BYIA 4EEVA 3HMMA 2ZB1A 3FI2A 3DNEA 3V04A 3CSVA 3UOKA 4DEEA 3QRIA 3QQKA 4GUEA 2EWAA 3TM0A 4D2RA 2BDFA 2BHEA 2GSFA 4QP9A 3FMKA 4GCJA 4CCBA 4WD5A 2XBAA 3WI6A 2CPKE 3QLFA 4FIIA 1J7IA 3G51A 3PJ3A 4NM7A 5CI6A 4D1ZA 3LOKA 3OW4A 3MA3A 4XG6A 2CN5A 5KHWA 5ETAA 5HO7A 1J1BA 3QF9A 4O6EA 2VX3A 4PTEA 4X7QA 3RINA 3VNTA 4HVSA 4MX9A 4Y85A 3ULIA 4K2RA 2BCJA 2ITVA 3PSDA 1ATPE 4ZEGA 4YU2A 1STCE 4AG8A 4S32A 4BKYA 1A06A 5KMLA 4IANA 5IH6A 3RHXA 3OWJA 4YJVA 4A9YA 3UO6A 3I5NA 4LL0A 4U0IA 1WBSA 2BMCA 5EW3A 4EH7A 3MJ1A 2YM8A 2CNQA 5ANOA 3FI4A 2ZAZA 3EYHA 2OWBA 4PDPA 5I4NA 2VWYA 3V6SA 3VBYA 3LLAA 3GEQA 5HG9A 3ATTA 4DG3E 2J4ZA 4FT5A 4H3BA 5HBHA 5L8JA 4HVGA 1VYZA 4CQEA 2BDWA 3PJ2A 1ZYJA 1JVPP 2OIDA 2QOKA 1YI4A 4DGGA 3HGKA 2OFVA 2HZ0A 4WT6A 3VUDA 3C13A 4IAIA 3IDPA 3ZUTA 3GNIB 3W2SA 4BDDA 5M07A 3TI1A 5AR7A 3BHHA 2X4ZA 2UZNA 4BIBA 4UV0A 4I5PA 3UDBA 5FXRA 3HAMA 3MN3A 1Q62A 3A4OX 4EHGA 1YXUA 4I23A 2PZYA 5DR6A 4ASEA 4O81A 4TT7A 5GJFA 2RF9A 2NP8A 1QL6A 3BBWA 2W1FA 1B39A 3EMGA 4IX6A 3PZHA 5C03A 4FKQA 3UMWA 4CRSA 4FODA 2R3JA 2WMSA 3BQCA 3NW5A 4O27B 5J5TA 2FGIA 1ZAOA 4ZMEA 3I0OA 4IBMA 4JIKA 1M2PA 4O86A 2WU6A 1SM2A 2EB3A 3PP1A 5CWZA 3F5XA 4DT8A 2VN9A 3BU3A 3ZRMA 5IMEA 4M69B 2H34A 5DIAA 3MFTA 1PMEA 2ZV7A 3NUUA 4R3CA 5CVHA 3RZFA 3WF6A 4G6NA 3P23A 5KZIA 5HCZA 4CYJA 3BELA 2WTIA 3C9WA 1WCCA 4DTKA 4ENXA 3DK3A 1FINA 1KE7A 1J3HA 2V55A 2VUWA 2G2FA 1OPKA 2XA4A 5ANKA 3O23A 4PX6A 5IMXA 3H30A 5AAGA 3FZSA 1AQ1A 5FDPA 4FKSA 3QKMA 1XH8A 1JAMA 2XIZA 2X39A 4BCNA 2R0UA 2C0OA 1UNGA 4QMWA 5DRBA 3E7OA 3QUPA 1DI9A 4ANSA 1U54A 3BX5A 5F95A 5FXSA 3G0FA 1FVRA 3QA8A 3ELJA 1W98A 5E8XA 4FV4A 4D2WA 3KKVA 5HVYA 2GS7A 2WGJA 2WZJA 1RQQA 4JI9A 3A7JA 2OZAA 4OBPA 1QMZA 4BC6A 3ZUUA 3PA3A 3HV5A 2F2UA 4L00A 1ZZ2A 4FK3A 3KXZA 1FGIA 4OW8A 5A14A 4C0TA 4EH8A 4ACMA 4NTTA 1E1VA 2R7IA 2Z02A 5CSPA 2Y6OA 5IUHA 4PMMA 5JSMA 4XG3A 1BL7A 2YWVA 3D2KA 3PVGA 4F09A 3QQHA 1H1SA 4PDSA 3MFSA 4FK6A 2VWXA 3EQGA 4IZ5A 3OOGA 3QCQA 3RAHA 3GC0A 2E9NA 2Y0AA 2OW3A 3W2RA 3R7VA 5F9EA 3G0EA 3WF9A 3ORIA 5J8IA 2GNLA 3V5WA 3P4KA 4BCPA 2ERZE 3KXNA 3DXPA 3VBWA 2YHVA 1XQZA 4A06A 4YURA 2QCSA 4IDTA 3COIA 4KAOA 5LCKA 3D7TB 4I41A 5ANJA 4LYNA 3HRBA 4ZP5A 4OTDA 3W18A 4BWKA 1XBBA 2GPHA 2QLQA 5LVNA 2UZDA 2BZHB 3LXLA 2GNIA 3OCBA 4UWBA 5HG8A 4C8BA 1O9UA 3DJ6A 2VTLA 4LI5A 4E73A 3DKGA 3EZVA 4IVBA 4QQTA 4ERWA 1H24A 4EHZA 1XHAA 1JBPE 4BCHA 2OIQA 5EK7A 1JSTA 3GU8A 3QZIA 3AC1A 4ASZA 4Y72A 4FV5A 4MHAA 4BCGA 3Q60A 5KMOA 2QURA 3GCSA 4QNYA 4JAJA 2GNJA 3OTUA 3EN6A 3WOWA 3NEWA 4A07A 4JG7A 1Y57A 3CY3A 3SG9A 3OEFX 4IX5A 5JZNA 5CEKA 4FZ6A 3V8TA 2VWBA 2IW6A 2VGOA 3TDWA 2YDIA 3E8CA 4F1MA 1H1WA 5CXZA 5M57A 1UKHA 5DLSA 4FZAB 4FT7A 2XF0A 4NSTA 4EBWA 5E7RA 4ALVA 4YHTA 4RPVA 2QVSE 1UKIA 1R0EA 1GNGA 4Q5EA 1FPUA 4AW5A 3LFFA 3KA0A 3ZFYA 5AV4A 4M0ZA 4FKLA 2P3GX 4IM3A 4O0SA 4IJ9A 2DUVA 4IAYA 1UV5A 3B8RA 5M06A 5A54A 1MP8A 4FNWA 2VWWA 5JFWA 2FSOX 3G15A 2ACXA 4I3ZA 2WMQA 3KXGA 3JUHA 4FKOA 5DFPA 5J87A 5L3AA 1XO2B 4LOPA 4QMOA 2VNWA 3QTQA 3AGLA 5M56A 2OH0E 3F2NA 3IK3A 4OTHA 2XEZA 3FZRA 4JG6A 4M14A 4L46A 4WSYA 1G3NA 2GS2A 2UW7A 5ITAA 4WG4A 4S33A 3OWLA 3B8QA 3HMPA 3RWPA 4FX3A 2YITA 3WZDA 3VC4A 3EQDA 4QMYA 2C47A 4XG2A 3R7IA 3TV4A 2VO0A 2A1AB 2R3PA 2JKKA 2XJ2A 3Q4CA 4U3ZA 2ZB0A 4CG9A 4RZVA 2W17A 2F2CB 3KXHA 4XX9A 2YIWA 3NSZA 3FWQA 4JAIA 4TL0A 2W99B 2XNOA 5CSHA 4L44A 3OROA 3PVUA 2J2IB 4LRKA 3S1HA 2PK9A 5GZ8A 3OY3A 4LGDA 3R8ZA 3FDNA 2XKEA 4KRDA 5HIEA 3PIXA 4I0RA 3HUCA 3C50A 4RRVA 4YNEA 5HNGA 5BMSA 1YXTA 2YIYA 4HVIA 3CKXA 2RFNA 4UALA 4FYNA 3GUBA 5LOHA 3BLRA 4IZYA 4CFNA 4LUDA 2B9FA 4O83A 4FG7A 3ZMMA 2Z7RA 1SMHA 3NPCA 1JKTA 5DHJA 4ZMFA 1HOWA 2RL5A 3OXIA 4L67A 3AXWA 4OLIA 1CKJA 1JSVA 1TKIA 1Q99A 2OJIA 4YBJA 5C8MA 1OGUA 4QMSA 4O7RA 2W1GA 1GZ8A 2VU3A 4QYEA 5GINE 2IVVA 4U43A 2ERKA 3HAVA 3EZRA 3JY0A 4IB0A 4J53A 5J7HA 4M7IA 3TG1A 2VNYA 4MXAA 1OPJA 2C6TA 3DBDA 5J1WA 1GZNA 2GQSA 4GUBA 2JAMA 2XYNA 1NA7A 4FT0A 2ITTA 3FZOA 4FSYA 3KXXA 2VTMA 3LQ5A 3Q4ZA 5GZ9A 2VZ6A 5CAQA 3KRXA 3MB6A 3LXPA 3QRUA 4HZRA 4YTHA 5DR9A 3LZBA 2BR1A 4QP8A 2WMVA 4RX8A 5D41A 4O7SA 2E9UA 1PXKA 1OPLA 3GFWA 2JIVA 1OI9A 1E9HA 1XH5A 2C6IA 3GQLA 4G17A 3IECA 4CGAA 4O1PA 2G15A 4CTBA 3Q9WA 3OY1A 4FZ7A 2VX0A 5KMNA 5AP6A 5CZIA 3KULB 3VW8A 3W2CA 2UV2A 4EZ5A 2C5OA 4GG5A 3E8DA 4JNWA 5JN2A 4ZTLA 3ATSA 2WTCA 4RIWB 2A27A 4FR4A 2B9JA 3KVXA 2PTKA 4CKIA 4NCTC 5HD7A 4CXAA 3GT8A 4BCIA 2EXMA 4KIQA 1ZY4A 4DFZE 4E93A 3QGYA 2JAVA 3M42A 4RSSA 2ZMCA 4I6FA 4FV7A 1P4OA 4BI0A 5ANGA 3FZ1A 3ORZA 5DT3A 4BZOA 4U41A 2VRXA 3KRWA 2WEIA 4ANLA 4PTGA 3VBTA 2EVAA 5JEBA 4MEDA 4NW6A 2OFUA 4HYUA 3DAEA 4FSNA 3G90X 4GYGA 3PPKA 3TUDA 3ET7A 4MYGA 3V8WA 5G6VA 4ZS4A 3QA0A 4WIHA 4K9YA 5F4NA 1IR3A 1CDKA 2WTKC 4WO5A 4BWXA 3ITZA 5M4UA 3I6UA 4QMUA 1H00A 3KRRA 5EI8A 3QUEA 2BPMA 3AC3A 2Z7QA 3VBVA 5CAOA 4X3FC 3EIDA 3ETAA 5K9IA 4Q9ZA 3UOLA 4GU9A 3AT4A 4ITIA 5KKRC 3F3UA 4I6BA 3TCPA 3UC3A 4TYGA 4DAWA 4EH5A 2OICA 2PZPA 5HBEA 4BDCA 4Y83A 3LCDA 3RAIA 3OFMA 3VHKA 4N6YA 4FE2A 4PP9A 5AUTA 4AGWA 4C4JA 2E2BA 3UP7A 3LM0A 3TL8A 2Q0BA 2EXEA 3CKWA 3VUKA 4MBIA 4HGLA 4XLVA 4HW7A 4H1MA 3ORXA 4NIFB 2CNVA 4FA2A 4FGRA 4Y73A 4TWPA 3VRYA 4KB8A 2H8HA 4IHPA 1Q24A 3RK9A 3EFLA 3QRKA 1MQ4A 1QPCA 1QPDA 2BZKB 2JEDA 3FI3A 3QTIA 2PMIA 2B9HA 4B0GA 3A60A 3L9PA 4ANMA 1Q41A 3EFJA 3BI6A 3DZQA 4GJ3A 2NPQA 2J5FA 2W4JA 3QTWA 4U8ZA 5AM7A 4AN9A 2R3HA 2OGVA 4FZDB 5C27A 4YJSA 4ZZMA 1YHWA 4KBKA 5HG7A 4DTAA 3QTXA 3VBQA 2X2LA 3M11A 3OBGA 5KUPA 5DRDA 2QHNA 3AG9A 1WBTA 2P2HA 4ZXTA 5TR6A 2OBJA 1Y6BA 4IE9A 2ITZA 4KIPA 4R78A 2W1EA 4CLJA 4GFMA 4U5JA 1PMVA 3LFQA 3LAUA 4M0YA 3SRVB 1UU8A 3L9MA 3R02A 4BCOA 4E6QA 5CEPA 3KF7A 4G3FA 3LFCA 3PTGA 3QHWA 4BTFA 3GCVA 2XZSA 5IUGA 4C2VA 3LJ0A 5HGIA 4EOMA 4TWOA 4RX9A 3V01A 1PYEA 4FEXA 4ZSAA 1DS5A 2B52A 5DA3A 4I21A 4DN5A 4F0FA 2C30A 3DTWA 1BX6A 2P4IA 3R8MA 2QI8A 2XKFA 3EQRA 4MNFA 3TIYA 3BYMA 2YM7A 3L1SA 1XH4A 3CJGA 1ZYSA 3R1QA 3SXFA 4D55A 4DEGA 4BN1A 4R1YA 3LJ2A 4R7HA 4D4VA 4WA9A 2XKCA 3C0IA 3PWDA 2W0JA 3OCSA 3BV2A 4YZNA 2WIPA 3WYXA 3Q96A 1E1XA 3H0YA 5IDNA 3FL4A 4C62A 3BGPA 3FE3A 4I93A 3R28A 4WKQA 5IA0A 2C69A 4FIGA 3DCVA 2GS6A 3FC2A 4O0VA 3VUTA 4F7SA 3E7VA 4O7LA 3JS2A 2FB8A 3P9JA 4OUCA 4CZTA 2YLEA 2BRMA 3QRTA 4RMZA 3P5KA 4I6QA 2RSVA 2WMTA 5CT7A 5IUIA 5KX8A 4KKHA 2CDZA 3QCSA 2I6LA 3R1SA 3F82A 1MRYA 5HQ0A 4FKTA 3EJ1A 4KBCA 4EQMA 2ZV2A 2C4GA 3R1YA 5LVPA 4RX5A 1GZKA 3TNHA 4FTMA 3F61A 4JBPA 5TE0A 2R64A 1U4DA 4JVGA 4DFYA 3DK7A 4WUNA 2VWVA 4FG9A 5EDQA 3UODA 4BKJA 4HYIA 5JGDA 3N4TA 4DCAA 1G8AA 3E62A 4BVUA 4JS8A 4XUFA 5EDPA 3ZDIA 2UVZA 5ACKA 3ZO1A 5AA8A 4CKRA 2UW5A 3AD5A 4IACA 5HOAA 2J0IA 3T3UA 3U8WA 4EKKA 1Y8GA 1AGWA 4NM5A 4YJQA 1YHVA 2PL0A 1UWJA 3R22A 4YC8A 4FEVA 5BUJA 3FV8A 3QBNA 4FMQA 4E8AA 1Z9XA 3MFRA 1G8SA 3PXQA 4FSQA 4I92A 5EQYA 2UW4A 2PULA 4BZDA 4U3YA 3F3VA 1H08A 2G2IA 3FLZA 4NW5A 3DNDA 3RNYA 2REIA 2PHKA 5AP3A 1YHSA 1KOBA 5H9BA 5HHWA 5IQBA 2UZEA 5C4KA 2YDJA 4ITJA 2BAJA 4W4WA 2UZBA 3LMHA 3FMHA 3A99A 5A9UA 4QRCA 3ID6C 3D83A 1XBCA 3D94A 3F66A 3LM5A 3P86A 3R04A 4O0UA 3AOXA 2QG5A 4C58A 2BKKA 3EFKA 1IEPA 5FTOA 2R7BA 2X7OA 1OZ1A 3K5VA 5EQPA 4TRLA 5EFQA 3LKMA 5HZNA 4NU1A 1BL6A 3KL8A 4O7YA 3WF5A 2BRHA 3HL7A 2WOTA 3C4FA 3UVQA 3W10A 3VHEA 2IO6A 2JKQA 2XIYA 3PVWA 4UMTA 3UC4A 5I3RA 4FVRA 1YVJA 4NTSA 3QQJA 5A4TA 3U51A 1PJKA 1ZZLA 5FBNC 1XBAA 2XNPA 4C35A 2W7XA 4G5PA 4UWYA 4BGQA 4MH7A 5K0KA 4ZTQA 3KB7A 3LFSA 2W9FB 2WTKB 3RTPA 1WVWA 4YTCA 1WZYA 1SNXA 3SV0A 4F6SA 5L2IA 3POOA 4RWLA 4UN0C 5J7BA 3CCNA 1FVVA 3NYXA 5CXHA 2XJ1A 5E9EA 4XLIA 5LQFA 2QHMA 3DLZA 5LVMA 2Z8CA 4EOKA 3MV5A 5KMJA 5AAEA 2OO8X 4JBOA 5AV3A 4M97A 2HCKA 4C2WA 1U59A 5AV0A 5CAVA 5G1XA 4CCUA 1R0PA 2XIRA 1V0PA 4PNIA 3DGKA 5BVKA 4RIXA 5EYCA 3QALE 4GG7A 5IEYA 3EFWA 3TJDA 3NYNA 3OG7A 4I0TA 4C4GA 5HIBA 5CF8A 2WMRA 3R9NA 3TZ8A 4H39A 3FQEA 2BKZA 4HCUA 4RJ5A 3RJCA 5BQ0A 4PL5A 4AGUA 4FIFA 4QMNA 1UVRA 4TYHA 2OSCA 2R9SA 4U81A 5CNOA 5DE2A 4RQKA 3UOHA 3FXZA 4UXLA 3F9NA 4JDHA 3VULA 3KMMA 5HCXA 5EQEA 4QTDA 5M55A 1M7NA 3E92A 3KRJA 4XV3A 2Q0NA 5EDRA 4AW1A 2EXCX 2VTPA 4TNDA 2GMXA 1B6CB 2XIKA 3GGFA 4MXOA 4IAKA 1BUHA 2XB7A 4ZJIA 3IKAA 3FL5A 3REPA 2C5NA 4AOTA 4QPSA 4EK5A 4ZY4A 1L3RE 2WXVA 4ACGA 3TTIA 1WVYA 2WPAA 3QWKA 4L3JA 1OKZA 5JGAA 4Z7HA 3L9NA 4G6OA 5I9VA 4G3DA 4OTGA 3FPQA 1GIIA 1ZOHA 4ITHA 3SAYA 1ND4A 2JDTA 4LOOA 3C0HA 2CLXA 1XJDA 2XCHA 3TZ7A 3KGAA 1WFCA 3NUAA 1OKWA 4YO4A 3QYWA 1SVHA 3FMJA 5E8UA 3Q6UA 2WTWA 2J0MB 4PRJA 3ZFMA 3ZH8A 3DKOA 3BGQA 5AR2A 3E87A
chains in the Genus database with same CATH superfamily
3LVPA 4IQ6A 2UVYA 1TVOA 3BYSA 2GTNA 2VTRA 1JOWB 3II5A 4NFNA 4AW2A 5LMBA 4BR3A 2C3JA 3QD2B 4R8QA 5D9HA 4R77A 4ZTSA 3LIJA 4BTJA 4JLCA 5I9XA 2WU7A 4R1VA 3RPYA 3ROYA 5IDPA 3D5UA 4UMUA 4HVDA 1PMUA 3C4CA 2WAJA 5CAPA 3DDPA 2JIIA 4I22A 4IC7A 5IF1A 1LEWA 4AFJA 5J79A 3OWKA 1FGKA 3S4QA 2X9FA 4D2PA 3O7LB 5B2MA 1UU3A 3NYOA 4QTCA 2ZMDA 4FVPA 4ASDA 5IH5A 5EHYA 5K5XA 3UO5A 3CTHA 4BYJA 4MXZA 2NRYA 4G9RA 3OT8A 3VS2A 4QYGA 3N4VA 3HDMA 4EC9A 2WOUA 3MPMA 4YNOA 4RZWA 4QTAA 4W4VA 3NW7A 3ZTXA 5IQFA 5EM6A 1URCA 1PXMA 4IB5A 5EKNA 3DK6A 4RFYA 5IG1A 3HV6A 4IWPA 3RPOA 3FI8A 1XMMA 3HNGA 4PTCA 4E4XA 1U5RA 5ANEA 2ETMA 4OBOA 5FGKA 4ANOA 4CLIA 1JKKA 4WG5A 5DWRA 4YZMA 4U45A 4GK2A 4C3PA 2CMWA 5EM5A 5FEQA 5M4FA 3FLNC 2QR8A 3QZFA 2IWIA 2PVKA 4FSRA 4BDEA 2R4BA 4AUAA 3MVLA 4GMYA 3MH3A 1PXLA 4PQNA 3WZUA 4EK6A 4EZ7A 4FC0A 4FBXA 1FMOE 4RJ8A 1JNKA 4OAVB 4CT1A 3IW6A 5HNBA 3FC1X 3ORKA 2R3MA 4MF1A 4A4OA 4C4FA 5CF4A 2ETKA 3WZKA 3OBJA 3H9FA 3O50A 3PFQA 4IVDA 2IEWA 2PZRA 1XWSA 2W1IA 3VUMA 4C59A 2PUNA 3QTZA 1KOAA 4MXCA 2KTYA 4NT4A 4O0YA 2J9MA 3EH9A 3HYHA 4QQCA 3UG1A 5C8KA 2VWUA 3W32A 2ZDTA 3UNKA 4ZSGA 4L9IA 3SXSA 1IASA 3FQHA 4F0IA 3C0GA 1FQ1B 3EHAA 3NZ0A 3SDJA 3P08A 3TNIA 5IEVA 4YLJA 5D7AA 4QP1A 1O6LA 2R3FA 3C51A 4G3GA 1M2QA 2YERA 3EQFA 4GFGA 3ACJA 3Q53A 1U46A 3OUKA 4CT2A 3EKNA 4F9CA 5JQ8A 5D7VA 2G2HA 4XJ0A 3OMVA 4YPSA 1W83A 4E5WA 2Y6MA 3RHKA 3EQIA 4L6QA 4K8AA 3FLSA 4R7IA 4CVAA 2BZIB 4QMZA 3NRMA 5AMNA 3IS5A 2F7ZE 3CR0A 4BRXA 2R3RA 1CKIA 2J90A 3BE9A 3GXLA 2GTMA 4JG8A 3UIBA 3NCZA 3A7FA 2W1ZA 4E4MA 2GCDA 3DV3A 1PY5A 4O91A 1H1QA 4GVAA 4DDIA 1HCKA 3HEGA 5B2KA 3FMNA 5KNJA 2W1HA 2ITQA 2PE2A 4BB4A 4MQ2A 3GC9A 4ZJVA 2YLFA 5DEWA 4EK3A 4B6LA 4DFUA 2A2AA 4BZNA 3D0EA 2IZSA 5LWMA 4RIYB 1NT2A 3SKCA 2EU9A 3KY2A 5CSXA 3MIYA 3OEZA 5FRIA 5A4LA 5IQDA 2RG6A 4FZFB 3Q5IA 4DEBA 2J5EA 5E1SA 1S9IA 3RM6A 5LMKC 4E6DA 1FVTA 1OVEA 3AMYA 5ANIA 5AUWA 2W05A 3VRZA 4R6VA 3PSCA 4RIOA 5DN3A 4QDVA 5H8EA 4AZTA 2XALA 4AQKA 5CX9A 3ZSHA 4DE4A 5JQ5A 4GVJA 3NNWA 5AP2A 5KMMA 1YDTE 4IWQA 4G34A 4W8DA 3FY2A 4OBQA 3R8UA 4R5SA 1JWHA 3M1SA 1TQIA 3COMA 3H0ZA 1WAKA 3IOKA 4FKJA 4MNEA 4QTBA 4BI2A 3AKKA 5L2TA 2E9OA 1OL6A 3RK5A 2WQNA 4RVKA 5TOZA 3T3VA 5BVFA 1YDSE 2ESMA 4H36A 4IW0A 2AC5A 4C61A 5JFVA 3MTLA 3NUXA 1SYKA 3DTCA 3VIDA 2B4SB 4S30A 4YPDA 2RFEA 2J6MA 3MY1A 1K2PA 1SZMA 2E9VA 3FMDA 3QUDA 5FWKK 3DBFA 3AC8A 4A9TA 2OJGA 3M2WA 4ALUA 5I5ZA 5E8ZA 3VS6A 5AP1A 4L3PA 4X2FA 5A4EA 5LWNA 5D10A 3UIXA 4PPCA 1ZXEA 4O38A 3HRFA 2X4FA 2O2UA 3LFBA 5FLFA 2C5YA 4GYIA 3G9NA 4CKJA 5EYKA 4AGCA 1EH4A 2HENA 1FMKA 4O84A 2YACA 4FOBA 4EORA 2B54A 4IX4A 5E8TA 4G1WA 2UZLA 3ORLA 4A7CA 1Q61A 2BFYA 2XNMA 2OI4X 2XH5A 5CS6A 4O7VA 1OIYA 4L7FA 5ANDA 4D58A 2OJJA 3UDTA 5A3XA 3U55A 3OXTA 3JYAA 3FHRA 3O7LD 4J7BA 3A61A 2VTJA 3N9XA 4C37A 4EH6A 4TKSA 3RGFA 4GIHA 4F0GA 4JR3A 4FG8A 3DZOA 1UA2A 4WNKA 3DB8A 4QMQA 4N70A 2WTVA 4O4FA 4RLKA 3QKKA 3O8PA 5ACBC 3QLGA 1YDRE 4YHFA 3EQBA 2R0IA 5ETCA 4AOJA 4OT6A 4A4LA 4EZ3A 4ZTMA 5CSWA 1UU9A 4R3RA 2JDSA 1Q8UA 3FKOA 4TZRA 3SD0A 4U7ZA 2W06A 3KK8A 4FNZA 5HLWA 1JKSA 3U87A 3A7HA 4QMVA 2CGXA 4C4EA 4E5AX 2QR7A 1PXOA 2W96B 3FBVA 3JVRA 4U44A 5K4IA 3PP0A 3NGAA 2CKPA 4X6QC 2BAQA 4AF3A 1GJOA 2UW8A 4RT7A 3ZXZA 3U6IA 5LARA 4V0GA 5CQUA 2IW9A 3JVSA 3CQUA 4NCTA 4QP3A 4WOVA 1OBGA 5IA5A 1FBNA 5AV1A 3GP0A 4QD6A 4XP3A 4Z7GA 3QTUA 4I6LA 4BJJA 5TT7A 3IONA 4M66A 1ZOEA 4DITA 4E4NA 3WZJA 4TXCA 5AAFA 4APCA 4L42A 2XVDA 4EOOA 4IAFA 3GU6A 2BROA 2PUUA 3G6HA 4KIKB 4OTRA 1W2FA 1XR1A 3KN6A 4YJOA 3THBA 2J0JA 5BVOA 5BVDA 5IPJA 2J0LA 3FMEA 5CQWA 4CMOA 3OOMA 4FTJA 4Q5HA 2YM3A 2QO7A 3HDNA 4K6ZA 2P55A 3I60A 5HU9A 5I0BA 4GKHA 5EI6A 1UNLA 4U40A 4X3FA 2F57A 1W2DA 2YIRA 1P4FA 3NWWA 3MFUA 5JFSA 1KV1A 4FSMA 4I5CA 4Q9SA 4L7SA 4FTIA 4NL0A 2XRWA 4AAAA 3K54A 4F7LA 3W2OA 2DS1A 4TY1A 3Q4UA 2QOCA 3C4ZA 3I79A 4G2FA 1RJBA 4RC4A 5HCYA 1URWA 2UZWE 3DKCA 3A7IA 1OB3A 2QOQA 3NAXA 5AWMA 4RWKA 4BDFA 3G2FA 3ANQA 5HE3A 4FEUA 3G6GA 3UYSA 1KUTA 4H58A 4IZ7A 5BUIA 4JX7A 4EH4A 2C6LA 1XH7A 4F1OA 3MVMA 1BKXA 4AXDA 4RJ7A 3A4PA 2F9GA 3L8XA 3VS7A 1W8CA 4ENYA 1ERKA 4OTFA 3ZHPC 1Q4LA 2VTOA 4HNIA 4P2KA 3UQFA 2O3PA 3KEXA 2XBJA 5AUYA 3ZLXA 3D5XA 4TW9A 1M7QA 3R2YA 2HZNA 4RVMA 2GFCA 2GDOA 5DVRA 3C4EA 5BYYA 2VTIA 2BTRA 4H3PA 5CYIA 4MD9E 1F0QA 5AEPA 4P5ZA 3S95A 5TO8A 4HGTA 4EOJA 5LXMA 2O0UA 2CJMA 5KE0A 4OAUC 2CCHA 3I1AA 3HVCA 1PKDA 3GU7A 3LXKA 3LHJA 4FT3A 4ZK5A 4F4PA 4EI4A 3U6HA 1MQBA 1H0WA 2QO2A 4M3QA 4WUAA 3WIKA 2I0EA 4H05A 4ZAUA 3O71A 2C0IA 3LMGA 4TN6A 3PXRA 3VUHA 2UVXA 3O0GA 3Q6WA 3FLYA 1OL2A 3QQFA 2W9ZB 2XUUA 1IA9A 3HZTA 2Z60A 4PMSA 2HK5A 5HVKA 3WF7A 3ZCLA 4EOQA 2WTJA 3W8LA 5F20A 2OK1A 4FOCA 1I44A 5FQDC 5FEDA 4GIIA 4XEYA 3W33A 3I4BA 4B7TA 3PUPA 4YMJA 3SW7A 2XMYA 5CVGA 1ZRZA 3JXWA 3LCTA 3U9NA 3EN9A 3LPBA 2YZLA 3PXFA 3I7CA 2RG5A 1T46A 2XNNA 2BHHA 3G5DA 3PIZA 2QLUA 2PVRA 3CQWA 4IJPA 3LFAA 2XCKA 4AACA 4Y95A 1K9AA 3UYTA 1KE9A 4O0XA 3TNQB 5KBQA 4NM3A 3PDTA 5M08A 3ZO2A 3QZHA 3E3PA 3TUBA 4ACCA 4YR8A 3I0QA 4O7NA 5HIDA 3FLWA 5FG8A 2FSLX 5HI2A 1YQJA 2I1MA 4RGJA 4YP8A 4C3FA 3LFDA 3PWYA 3TACA 3MGYA 3RPSA 2QG7A 3Q9YA 1ZYDA 5AV2A 4AE9A 3TT0A 2YWPA 2XS0A 2R3NA 5D12A 3O8UA 3TNPC 1Z57A 3TUCA 2GU8A 4PPAA 3CE3A 3DBEA 4AXAA 2X2KA 4BCKA 3BE2A 1RDQE 3PPJA 4FTTA 4AWIA 2RFDA 2R3QA 5IQCA 3Q2MA 4I5HA 3NDMA 2WMAA 3BLHA 3BPRA 2I0HA 4RJ3A 3RPVA 4J8MA 3GB2A 3PIYA 5KMKA 1Q8ZA 4XBRA 1OKVA 3PRIA 2CKOA 4KS7A 3G33A 4KA3A 4F7NA 4UMPA 2QC6A 2ITYA 1S9JA 2PYWA 4O0WA 2X6DA 4IWDA 4ZSEA 4P5QA 5CU2A 3VS1A 3ORMA 1OITA 2B0QA 3RWQA 3R7GA 4RQVA 5A6NA 4JX3A 4K0YA 3MVJA 2C0TA 3EQCA 3ZU7A 3NIZA 3O96A 2H6DA 3QD0A 5IEXA 2X8DA 5HICA 5H8BA 3S00A 1NVRA 2FA2A 2HXQA 2UZTA 4FICA 3BLQA 3VAPA 3ZSIA 2PE0A 1OIRA 3V8SA 4GT5A 1O6YA 3MIAA 1UWHA 2WB8A 4D4RA 2X7FA 4TYIA 3PXYA 4GS6A 5AP0A 1PKGA 5FEEA 4E7WA 4O7WA 2JITA 4D2VA 5ICPA 3VUIA 3EN7A 4CSVA 3EOCA 5DYJA 3DS6A 5LCJA 1PRYA 1CM8A 2X81A 3AGMA 5AR4A 2QODA 3BHUA 4JQ7A 2ONLC 3DAJA 3MYGA 3NUYA 1LP4A 4DCEA 2VTSA 2VWIA 4IDVA 4RVTA 4JMQA 3NIEA 4G16A 4QP6A 2UZOA 4ERKA 2JGZA 4LGGA 4WG3A 3RAKA 2AQXA 3SVVA 4J1RA 3VQHA 4F1TA 3GU5A 5AP7A 1RE8A 2JKOA 4L68A 2OKRA 4PPBA 4U42A 3NNVA 5AR3A 2R3LA 4D2TA 4GRBA 4NFMA 1FOTA 3ZLYA 4DH7A 4YZ9A 5E8VA 3ZBFA 5EKOA 3UIMA 1DAWA 4MTAA 3Q9XA 4M69A 2JBPA 2V5QA 4D2SA 3FUPA 3A8WA 1PHKA 4TYJA 1H28A 4N4SA 3W0RA 3BYVA 5EW8A 2G01A 3R0TA 3VWAA 2GHLA 4C3RA 4FV6A 4EWQA 2PY3A 3F3TA 3ZUVA 2X2MA 3NCGA 4OT5A 4DC2A 3BRBA 3I7BA 3H9RA 3P7CA 4WBBB 4AA5A 4ALWA 5IQAA 4N6ZA 1NVSA 4LV8A 4JR7A 4AOIA 4BDHA 3OS3A 3R9HA 2OIBA 3E88A 1IAHA 5IZFA 3KIOC 3PPZA 1U54B 5DOSA 2EB2A 1ZOGA 3K2LA 4F6UA 1QPEA 2R2PA 4DF3A 1V0BA 3DJ7A 5IQHA 2A4LA 1MRVA 4GSBA 5GJGA 3SA0A 4F65A 3QXPA 4IADA 5M09A 2OZAB 4Z55A 1VEBA 3UTOA 4L8MA 2Q83A 1OM1A 4JXFA 3UZRA 4QYYA 5AIRA 2LGCA 2OF4A 3P79A 1MUOA 3DT1A 3EB0A 4QQJA 4JRNA 4D28A 5BMMA 5DEYA 4AN3A 2PPQA 3ZM9A 3LW0A 5L2QA 4I20A 2NNWB 5D1JA 2HW6A 4G9CA 4LMUA 4FRFA 4DEAA 1JQHA 5DR2A 3CPBA 4YJNA 4BIDA 3ANRA 3HMIA 4GU6A 5BX0A 1BYGA 4NK9A 1K3AA 2HZ4A 3IGGA 2BZJA 4I6HA 2H9VA 4ZJJA 4JDJA 3F3ZA 4RFMA 4B8MA 4CMTA 4RBLA 2X0GA 5CNNA 2R5TA 3QU0A 2X9EA 3D7TA 4DH1A 4IM2A 4M13A 3UZPA 4J95A 2BTSA 1H26A 2JIUA 5HLPA 2V7OA 3HA8A 4O4CA 3HX4A 3R7UA 3CXWA 5HESA 4BDBA 3R8PA 4TWNA 3CLYA 1OKYA 1R78A 3PLSA 4PP7A 1P14A 2C3KA 3QX4A 2H96A 1F3MC 3V5PA 4F6WA 2QD9A 4ZY6A 3TXOA 2JFMA 2ZJWA 4RFZA 4USDA 5BVEA 4AT4A 3ZONA 4PV0A 2XP2A 4FTQA 3BU5A 3QYZA 1OUYA 1YI6A 3COHA 4C7TA 3OW3A 4S34A 3OD6X 3U6JA 3UZTA 3DA6A 4FSUA 4NYEA 4BBFA 4A9UA 3QXOA 2DWBA 3W16A 4LM5A 1WBOA 1BLXA 2E9PA 3LCKA 4IVAA 4Y5HA 2QOOA 4FV3A 2BDJA 2G9XA 4BKZA 5HTIA 3Q3BA 3ALOA 2YEXA 4MCVA 4L3LA 4O6LA 3T9TA 3MH0A 3HKOA 4UZHA 2DQ7X 3C5UA 5E1EA 4DTBA 2V0DA 4E5BA 4O22A 3RM7A 5EG3A 2XARA 4CTCA 2WTDA 4FEQA 2XYUA 3C1XA 3O8TA 5E92A 4AU8A 3BL7A 3AC4A 2QKRA 4EONA 3K3JA 5H3QA 4JIAA 3RCJA 3NNUA 2FSTX 4UYAA 1O6KA 5HE0A 2HAKA 4B4LA 5K4JA 3FYJX 4LQMA 1QCFA 2YABA 3FJQE 4XRJA 4BCJA 1YOMA 3OCGA 5EOLA 4IXPA 4C36A 5HLNA 4TWCA 1P2AA 2R3KA 4D5HA 1OECA 2PVJA 4D9TA 4I5MA 5DI1A 3PSBA 4L52A 4OTIA 5EYDA 1YWVA 4BL1A 3PA4A 1Q3DA 2VTQA 3CEKA 4J99A 3R7EA 3SC1A 1OGYA 3UNJA 5AR8A 5IH4A 4TNBA 4N0SA 4FTUA 4EQCA 3F7WA 4YLKA 2WD1A 2ZM4A 3BBTB 3TZMA 5LJJA 4JT3A 4UB7A 3ZSGA 3MY5A 5CU4A 4FTOA 4D0XA 3PFYA 3SG8A 2OJ9A 5HKMA 2HELA 4OTWA 2YM6A 3UGCA 2YAAA 3MA6A 2F49A 2OF2A 5L6OA 4BICA 1UNHA 2JBOA 4QT1A 4YZDA 3MW1A 3ZXTA 4FT9A 5K0XA 3HMOA 4MUQA 1OIUA 1M52A 5CALA 5DNRA 1U5QA 2HYYA 2CKEA 3TEIA 2IW8A 3FY0A 5CEMA 3BZ3A 2HY0A 3EN5A 2XK3A 2IZTA 1GOLA 3UVPA 4ASXA 3VVHA 2ZM3A 2WMWA 3IOPA 1H27A 4WNOA 2VAGA 2C3LA 3QC9A 3KXMA 3HMNA 1UU7A 5DG5A 4AA0A 5GIPE 2YCRA 3AC2A 3MSSA 2SRCA 3K3IA 3KRLA 4NZWB 4EBVA 5AUVA 4EYJA 2CNUA 4YTIA 3ZEWA 4U97A 3W0PA 1APME 2FSMX 4TYEA 2W4OA 3LFNA 5LMAA 4KSQA 3SOAA 2Y9QA 3R21A 2YAKA 3PZEA 4YLLA 4P7EA 3CTJA 5CU3A 5IA1A 4AXFA 4KABA 2ZV9A 3WILA 4DGOA 1LEZA 4K1BA 3E93A 4GW8A 5HX8A 5KHXA 4E20A 2ITUA 4QTEA 1NVQA 4NM0A 4M84A 3NUPA 2J51A 2G1TA 5FDXA 5L8LA 3GI3A 4OR5A 2V22A 4TTHB 2PWLA 4W8EA 4FTKA 2YISA 3KFAA 5HG5A 1ZLTA 4P90A 3IGOA 4X2GA 3LFEA 3BHTA 5LMKA 4NKSA 5A4QA 3FMMA 4DLIA 2V7AA 2W4KA 2XJ0A 4IAAA 2YA9A 3C4WA 5I9UA 1H0VA 4CFUA 3ZYAA 4IB1A 2C6EA 4EJNA 4ZTRA 4E26A 1OIQA 2XEYA 4NEUA 3W55A 3VQUA 2X1NA 4U9AA 2P33A 4IAZA 4ZSLA 5I3OA 2NO3A 2XIXA 1ZMVA 3L9LA 3TKUA 4CFVA 3V5LA 3DJ5A 5JK3A 4I94A 3KULA 4XP0A 1WBPA 5A46A 5FD2A 4EJ7A 3NYVA 2BAKA 3PXZA 1H25A 4RIWA 4ZLYA 1KSWA 1PXNA 5GJDA 3GENA 4WRGA 2OZOA 3B2TA 4HYHA 4J96A 4S31A 3P78A 3NAYA 2VTAA 3NLBA 5BVWA 3CBLA 4HNFA 5DPVA 4MWIA 2CSNA 1X8BA 3OHTA 2KULA 1W0XC 2FO0A 4AT5A 5JZJA 3DU8A 4RC3A 4XS2A 2FYSA 1A48A 1XH9A 2CHLA 3RKBA 4EOSA 3ORNA 1I09A 3RAWA 3DPKA 5L6PA 1OL7A 1OL1A 3VS5A 4AZWA 3DAKA 2Y4IB 3MBLA 4MD8E 4FKWA 3RK7A 3TKIA 4E1ZA 2W5BA 3TV7A 2VD5A 4YBKA 5HNIX 3MJ2A 3VW6A 3FKLA 3W0SA 3FYKX 4CV8A 4C4IA 3FAAA 4MK0A 2A0CX 4XH6A 4FKRA 4M67A 4EUTA 1PXJA 4AGDA 2YFXA 4HOKA 4EOLA 3ORTA 4DDGA 2BUJA 2YCQA 5A6OA 5JMSA 4QNAA 3SX9A 4FEWA 2HY81 2PVFA 3A2CA 3E3BX 3PYYA 4YC6A 1M14A 5HO8A 2AYPA 3CC6A 2JDOA 2F7EE 4BDJA 4DBNA 3TKHA 1R39A 2VO7A 4C57A 4MQ1A 4ONAA 4AP7A 3GQIA 5CASA 5HU3A 2C3IB 4KIOA 1ZARA 4GEOA 1HCLA 4UMRA 3HV7A 3QRJA 4D9UA 4YC3A 2ITNA 5AFVA 3BHYA 1PXIA 4KD1A 4NIFA 2IZUA 4W4XA 3QQGA 4JDKA 3W0QA 3W2QA 1DM2A 1JPAA 4F70A 2FH9A 3QCYA 5J9ZA 4IWOA 5FTQA 5IKWA 5T68A 1GIJA 4HGSA 3SW4A 3VS4A 3R30A 2AC3A 1Q8WA 4FV9A 4DYMA 1IRKA 3VBXA 3VO3A 3UP2A 4O21A 4KBAA 3RPRA 4DA5A 1W7HA 3IDCA 4E4LA 5AM6A 2OXDA 4OGRA 4M68A 5E8YA 3AMBA 2VO3A 4QOXA 2IN6A 3FPMA 4YZBA 4GV1A 3UQGA 4CFXA 3H10A 3F5GA 1G8KA 4MF0A 5BYZA 4DHFA 2WQBA 4JJRA 5BYLA 2UW9A 4AN2A 3PJ1A 4RJ6A 1KE8A 5H2UA 4FIJA 1IAJA 3D7ZA 4X0MA 3SRVA 3ZRLA 2AUHA 4OTPA 1W2CA 4AT3A 2C6MA 5DBXA 2F4JA 2UW0A 4M8TA 4GK3A 2YN8A 3ZDUA 4WHZA 3U4WA 1PYXA 2NRUA 4PY1A 3AT3A 4TPTA 3COKA 4DEIA 4YSMA 4FV1A 5ETIA 5HE2A 4O2ZA 4CEGA 4JBQA 3KN5A 4FUYA 2C6DA 4FTLA 3NX8A 1GZOA 4AZSA 2I7QA 3S2PA 5FUTA 4BTMA 3DBQA 4FTNA 3PY0A 5KMIA 3I6WA 2WHBA 3R01A 4YJUA 3SXRA 4UY9A 5CI7A 2DYLA 1W84A 1YOJA 3ZO4A 2XRUA 4IH8A 4NJ3A 4UXQA 2J0KA 4HGEA 1BMKA 4E6AA 3VN9A 3NMUF 4I0SA 1J1CA 4XOZA 2PZ5A 2WQEA 3MVHA 4XV2A 1YKRA 2JFLA 4FNYA 4ID7A 4J98A 4ACDA 4Z16A 4S2ZA 2PVHA 4F63A 2IVUA 2BIKB 3O2MA 3BV3A 4A4XA 3K5UA 4HCTA 3LMIA 2BRGA 2VWZA 4FL3A 5C01A 3D4QA 2GQRA 4K11A 5AIKA 4X6RA 4XNEA 5TKDA 4F7JA 3MH1A 2C68A 3LXNA 5J9LA 4MXYA 3HRCA 4ORKA 5HX6A 2JD5A 4BBMA 2IJMA 3V3VA 1WBNA 5E8SA 4D4SA 2XK8A 3DFAA 3VUGA 4QYFA 3E63A 4JBVA 5EHLA 5KZ0A 2IG7A 2R3IA 5KO1A 2BRBA 1ZMUA 4AE6A 4GT3A 2YCSA 2GNHA 4Y8DA 4EUUA 3A8XA 2B1PA 5CSVA 5AADA 4IIRA 4JDIA 2QOFA 3R73A 1Y8YA 4RX7A 1TQPA 1W82A 3QKLA 3ODYX 5FXQA 4OTQA 2P0CA 3AC5A 2Y4PA 2JDVA 2HZIA 2UZVA 4YO6A 3DXNA 4C4HA 5IQIA 5CAUA 2OG8A 2C6OA 3IPHA 3F6XA 5EM8A 3MPAA 4ACHA 4X2JA 2QNJA 2BFXA 3OF0A 4BDIA 4D0WA 3DY7A 3UPZA 3AD6A 4GJ2A 4RWJA 3ZLSA 4LOQA 2R3GA 1J91A 4FIEA 2ZFYA 3B2WA 4F78A 3R00A 5IQEA 1R3CA 3LQ8A 3I81A 2X6EA 5KBRA 5BUEA 3LE6A 4WRSA 4HCVA 1PMNA 2QOLA 5FM2A 4FSZA 4UYNA 2EUFB 3VJNA 4LMNA 4I4FA 3R2BA 4APPA 5J1VA 4O1OA 4EYMA 4QMLA 3KCFA 5HEZA 4XG4A 3ZZEA 5AA9A 1T45A 2QONA 3NUSA 3ORPA 3QWJA 3HP5A 2OJFE 3ROCA 2XNGA 4U79A 1Q8YA 2IVTA 2UW6A 2XNEA 3UO4A 1GIHA 3PJ8A 3C7QA 3TJCA 4BHNA 3R9RA 3RZBA 2VTHA 3U54A 4IC8A 4O2PA 4V04A 2LAVA 5HTCA 2XAOA 4DT9A 5J5SA 3BYOA 4FV2A 4J97A 4XG9A 3WARA 5JH6A 3ALNA 4FTCA 4DG2E 5HORA 1REJA 4UZDA 4BGHA 2XK4A 2YDKA 3MB7A 4K77A 4ZSJA 5FTGA 4FVQA 3MY0A 4ZTNA 3R7OA 1NY3A 3VS3A 1KE6A 2C1AA 3N51A 3RNIA 4D1XA 4DH8A 2NYAA 3KQ7A 2YM5A 4UBAA 1JSUA 4FV8A 3ZOSA 3SOCA 1H07A 4PDOA 1A9UA 2QU5A 1YWRA 4ZZOA 1F5QA 3CD3A 2B7AA 2W1DA 4M15A 4K18A 1BI8A 4WSQA 5EH0A 4F9WA 1ZYCA 4PMPA 3POZA 4EK4A 3GFEA 5L6WL 3BKBA 4BIEA 3CIKA 3FZTA 2QO9A 4DG0E 4XHKB 1LR4A 4PF4A 3OC1A 4V05A 4QP2A 3UJGA 5I9WA 4YUQA 4KRCA 3KK9A 3AT2A 3UOJA 2OXXA 3WBLA 4LL5A 4RIXB 3D5WA 3ACKA 4FKGA 2PVLA 4XV1A 5F94A 2XKDA 4PNKA 3R8LA 5C8NA 1V0OA 3FSFA 4DGLC 2X8IA 1BI7A 1YXVA 4XBUA 4YGAA 5AUUA 4F64A 3SGCA 3IDBA 5DMZA 5GNKA 5M51A 2XK6A 4TYHB 4X2NA 2JC6A 4MKCA 3NR9A 3Q9ZA 3RALA 3VJOA 1Q5KA 4CV9A 2PU8A 4EK8A 2X7GA 4QMXA 3DQXA 3KVWA 5CT0A 3W8QA 1YOLA 4I24A 4EH3A 4F08A 3W1FA 2IVSA 2QOIA 3RI1A 3D2IA 4ZZNA 2W1CA 4KUJA 3QTRA 3ZO3A 2ITWA 1G5SA 2BALA 2VGPA 4K33A 3Q52A 4J71A 4I4EA 4LRJA 4USEA 4UWCA 4EKLA 2XAMA 3GCQA 2PZIA 4QP7A 2ONLA 4BCQA 5CU0A 4R5YA 5CY3A 3DXQA 3Q2JA 1CMKE 4Q2AA 3HV4A 3HECA 3RVGA 3MI9A 4ZLZA 4RJ4A 2VX1A 4JL9A 3TWJA 4B99A 4MBLA 5B0XA 3BGZA 5C26A 5HVJA 3TZ9A 2CGUA 2B9IA 4KINA 3H4JA 4IMYA 4DFBA 3WZEA 1Q8TA 2GHMA 1IG1A 2GNFA 3D15A 3QCXA 3ENMA 5J9YA 5A4CA 2GQGA 2PMOX 4UMQA 1L8TA 1NXKA 4JQEA 4O4EA 1YI3A 2WEVA 3QGWA 1YXSA 2HWPA 4BCFA 4YSJA 3I5ZA 5AP4A 3QC4A 5HD4A 3OXZA 3E8EA 2YCFA 4QQ5A 3W2PA 2J50A 3F5PA 4EHEA 5JT2A 3AD4A 3QTSA 3D14A 3ZEPA 3WYYA 2WQMA 3E8NA 1XH6A 3F88A 3TDVA 4BI1A