3F8AA

Crystal structure of the r132k:r111l:l121e:r59w mutant of cellular retinoic acid-binding protein type ii complexed with c15-aldehyde (a retinal analog) at 1.95 angstrom resolution.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
137
structure length
137
Chain Sequence
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVWTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELIETMTADDVVCTKVYVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing Wavelength Regulation with an Engineered Rhodopsin Mimic and a C15-Retinal Analogue
rcsb
molecule keywords Cellular retinoic acid-binding protein 2
molecule tags Transport protein
source organism Homo sapiens
total genus 32
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3f8aA00
2CM4A 2GJ5A 1S2PA 1YWAA 1GKAA 1LIBA 1T8VA 1KT4A 1SY1A 2Q9SA 3FR5A 4AZRA 1AQBA 1LPJA 2AT8X 3BY0A 4K19A 3IFBA 4YCEA 4TJZA 1A2DA 1ICMA 2ASNX 3FR2A 3FMZA 4BVMA 3ELXA 1OEJA 1KOIA 1QY2A 5F7GA 1OEKA 1A3YA 1X89A 5HCEC 3UEXA 3ZQ3A 1KZWA 2ANSA 2FT9A 1G85A 1QY1A 1OPBA 1QY0A 4MVLA 2IFBA 5LJKA 4Y0RA 3AKMA 1TOUA 2HYSA 4KIIA 1X8NA 2K62A 3F9DA 3BSZE 4ZHGA 5F1EA 4ZCBA 5HZ6A 3FLLA 2ALLX 2W2AA 5HBSA 4ORUA 2PY1A 1VYGA 3VG7A 1O1VA 4HFOA 5B27A 2HLVA 3IA8A 4ZHCA 4NNTA 2YG2A 1L6MA 1U17A 1X8UA 1HBQA 3NQ9A 4OS8A 1I05A 4EDEA 5HZ5A 2AT5X 5LJCA 2FTBA 4ZHHA 1QQSA 3FELA 4DQ4A 1A18A 1IIUA 1ACDA 4M6SA 4ES7A 2OVEA 3BU1A 1DC9A 2A0AA 2GC9A 5HAEA 5CE4A 3WBGA 3TGAA 1GM6A 3B2LA 5H9AA 1ZNHA 1EALA 1GT1A 3BLGA 1GXAA 4EEJA 1GT5A 1YUPA 2CZTA 2OZQA 3Q6LA 1KT3A 3HWDA 1ZRYA 4I9RA 5KHPA 3OJYC 5LKFA 1B56A 4BOEA 2DM5A 4QGXA 1R0UA 2LFOA 3FEPA 4N7CA 1I04A 3FR4A 2N93A 5AQ6A 3KQ0A 4HPCA 4IB6A 2XSTA 3CR6A 3JS1A 5C0NA 5EEEA 3CQRA 2HZQA 3AKNA 5IO7A 1OBQA 4ZHDA 1SXUA 2FS7A 2LBAA 2AT3X 1KZXA 1EW3A 1UZ2X 3HWGA 1EXSA 1TW4A 1YWDA 1GX8A 5LJGA 5BVSA 5BVTA 1IW2A 4HPAA 2F73A 2NNEA 3WJGA 1BRPA 3ELZA 2E4JA 5IO6A 3APVA 4NYRA 1NGLA 5H9NA 1HBPA 4XMFA 1O8VA 2O62A 1IKEA 1EIOA 1KT5A 2WEWA 4TKJA 3HWFA 5EZ2A 1FENA 1LIDA 1YP7A 3B2IA 5LJDA 3MVFA 4YDAA 2XKLA 3PEDA 1T0VA 4ZHFA 4OMWA 3TZSA 1E02A 1QFTA 1U0XA 2A2UA 1X8PA 3CBSA 1ZNLA 1CBRA 3KFIA 1O1UA 4ODDA 1QABE 2HZRA 2OFMX 3HWEA 4LKPA 4YMYA 1SY0A 3D96A 1LNMA 3UEUA 2RQ0A 3TGBA 4ZH9A 5D45A 1BSOA 1D3SA 3WJFA 4ZGUA 5EDCA 1DF3A 2A3FX 3FA7A 1QWDA 1DZPA 3HK1A 2CBSA 5FAZA 1CJ5A 4YFRA 1BLRA 3CWKA 2RCTA 3P6HA 1EQDA 2AKQA 2FR2A 4RUNA 1CBIA 5HZ8A 1LIFA 4R0BA 1FDQA 3CQNA 1B0OA 2MM3A 3VG4A 5BVQA 3CBCA 3DSZA 2NNDA 2QO6A 2RD7C 4PSQA 4D6BA 3PH5A 5D4AA 4IB9A 5F6BA 4NLIA 2L68A 1JZUA 1XKIA 1BBPA 4TQ2A 1OPAA 4IMNA 5HTDA 4GNWA 2JU7A 2Q4NA 1KQXA 3U9PC 4TNNA 4YBUA 4YDBA 5HZQA 4ORRA 1AVGI 4RUUA 3O2YA 1CBQA 3NR3A 1A57A 3F8AA 2AMMX 3QKGA 2JU3A 4D6AA 1UREA 4ORWA 1DZMA 4A60A 3VG6A 4AZQA 2WQ9A 2NP1A 4YGGA 1DZKA 2R56A 3FEKA 3D95A 2JOZA 4O9SA 1AELA 3FIQA 5F58A 3CMPA 1KXOA 4XMHA 2G7BA 4ORYA 5LJBA 2FLJA 1BEBA 1GKAB 1MDCA 4YGHA 1VYFA 4QYNA 1DFVA 3BDRA 2LB6A 1X71A 2FR3A 1NP4A 5H8TA 2JU8A 1X8OA 3WJBA 4IB7A 3VG2A 3P6DA 2Q2MA 3KFFA 3FA9A 4OS3A 4IAWA 4I3CA 2OVDA 4WBKA 3STMX 2KTDA 3T1DA 3GAQA 4ALBA 5LKEA 3B2JA 1BRQA 3WXQA 4A1HA 1ALBA 3BS2A 5KICA 1BJ7A 4BQUA 4Y0PA 2WQAE 2R73A 3FW4A 4TKHA 1E5PA 3WVMA 5HZ9A 1ICNA 1EPBA 4AZOA 1SY3A 1RLBE 1LKEA 3MBTA 2ACPX 5D47A 1GT4A 4Y0SA 5DPQA 2P8GA 1H91A 4IAXA 3KFGA 1GGLA 1G7NA 1LICA 4XMCA 1DV9A 1ZNGA 2WEXA 1PEEA 3L4RA 4ALOA 1MUPA 2X45A 3BX7A 2OVAA 1AB0A 4LZVA 3BRNA 2HMBA 4TKBA 5DG4A 2POAA 2OFRX 1BSYA 1ZNKA 4CK4A 5HA0A 2CBRA 4MVIA 3APWA 3DTQA 3EYCA 3PECA 1HMSA 3NX1A 4HPDA 3FW5A 1QG5A 4ORSA 2AT0X 3C77X 3PP6A 2NNQA 2FWVA 3APXA 4Y0QA 4YCHA 4I3BA 3EBKA 1JV4A 1PM1X 3KZAA 3P6CA 4EFGA 1CBSA 1KT6A 1FTPA 4NNSA 4NYQA 2HNXA 4GKCA 4QZUA 1SXWA 2MO5A 4YH0A 1JJJA 3P6GA 4DQ3A 1YIVA 2JN3A 4XMDA 4QGWA 2LBVA 4YFQA 1LFOA 3VG3A 3NP1A 4AZMA 2L9CA 1JYJA 1TOWA 1ADLA 1MX7A 2AH7X 5FENA 1BWYA 5LJHA 3FA6A 2G78A 2RA6A 4ARHA 1HN2A 4WFVA 4NLJA 5K06A 3EBWA 4QGVA 3TGCA 1ERBA 1U18A 2FRSA 1SXYA 3U03A 1MX8A 1LIEA 1IKJA 4N7DA 4IMOA 2GTFX 1X8QA 2G79A 3NADA 3P6EA 5JR8A 1KGLA 1MVGA 4HPBA 1IFBA 4I3DA 3UEWA 1HMTA 4WFUA 1I06A 4GRJA 2QO4A 4AZNA 3U0DA 3NQ3A 1B8EA 3FA8A 1N0SA 1QFVA 1XCAA 3B2KA 1PMPA 4AW8A 5FFHA 4LKTA 4YBPA 2QO5A 1DZJA 4UU2A 4ZJ0A 3O19A 1G74A 2X46A 2CM9A 3NPOA 5L8IA 1B4MA 2L5PA 1FEMA 4OMXA 2W2BA 1OBUA 1TXLA 2L67A 3I17A 5HWZA 1OEEA 2Q39A 3BU9A 1E00A 5EDBA 3SAOA 3STKA 3I0AA 4QAEA 1GX9A 3PH6A 3B2HA 1YWCA 3BX8A 3P6FA 3JSQA 1SY2A 1KQWA 4M7MA 4UU3A 2MJIA 5EPQA 4OS0A 1ML7A 4QYPA 1PBOA 3S26A 5D8JA 1KT7A 3G7XA 5F6ZA 1IFCA 3ZUIA 4A8ZA 3EMMA 4MVKA 1OBPA 2FS6A 1FELA 1S7DA 4ZR2A 2WWPA 1SA8A 2A2GA 3C76X 1BSQA 1I4UA 1CRBA 2WR6A 4IBAA 1YWBA 4EXZA 4YKOA 1TVQA 2QM9A 1HQPA 3RSWA 1HMRA 1JYDA 4AYHA 5B29A 4GNYA 2K23A 4ORXA 1P6PA 2Q2PA 5H9KA 3APUA 1YP6A 3RZYA 5HCCC 4GH7A 1VPRA 2W2FA 2RCQA 1G5WA 4GETA 2CZUA 4YFPA 4I9SA 1LF7A 4LZUA 4ZH6A 4QZTA 5D48A 2WUTA 5H9LA 1FE3A 4NP1A 3D97A 4AZPA 3STNA 5L8NA 1SXXA 2EU7X 3TF6A 2ACOA 4GE1A 2R74A 1ZNDA 2KT4B 2WSJA 3NX2A 1ZNEA 2A13A 4XMGA 4XMEA 3C78X 3EM0A 1E06A 2QOSC 3PPTA 1S44A 5IO5A 5LJEA 3UEVA 3VG5A 4A1YA 3FENA 4ZFXA 5HA1A 5HTEA 5HCDC 1BM5A 3K3LA 5L8OA 1EUOA 3WJEA 3KFHA 1Z24A 2AT6X 2BLGA 1ERXA 2LKKA 4YGZA 1EPAA 2AL0X 4YKMA 1EIIA 3ZUOA 1NP1A 3WJCA 1JBHA 4TLJA 1JJXA 1T68X 1GT3A 3O22A 5EEDA 3WJDA 5KIDA 4IB8A 1D2UA 1RBPA
chains in the Genus database with same CATH superfamily
1SWBA 2CM4A 2GJ5A 1S2PA 1YWAA 1GKAA 1LIBA 1WBIA 1T8VA 4ZGFA 1KT4A 1SY1A 2Q9SA 4GK9A 3FR5A 4AZRA 1AQBA 1LPJA 2AT8X 2GTLM 3BY0A 2OY5O 4COTA 4K19A 2FGSA 3IFBA 2FKGA 4YCEA 4GJVA 4BX5B 4TJZA 1RSTB 3WZPA 1SMPI 1A2DA 1ICMA 2ASNX 2PI3O 3FR2A 2VFCA 4NV8A 3FMZA 4IRWA 3ZW0B 3RE5A 4BVMA 3ELXA 1OEJA 1KOIA 3E3CA 1QY2A 5F7GA 1OEKA 1A3YA 1X89A 3PQSA 1I9HA 5HCEC 3UEXA 3ZQ3A 4EKVA 1KZWA 2ANSA 2FT9A 4O4OA 1N7YA 1G85A 1QY1A 2X34A 3ZZVA 1GX3A 1OPBA 1QY0A 1VWKB 4MVLA 2IFBA 5K67A 5LJKA 1E2TA 4Y0RA 3AKMA 1TOUA 2HYSA 4KIIA 1X8NA 2K62A 3F9DA 3BSZE 4ZHGA 5F1EA 4GZVA 2F01A 4ZCBA 5HZ6A 1SRFA 3FLLA 2ALLX 2W2AA 5HBSA 2G5LA 4BX6A 4ORUA 2PY1A 4BBOA 1SWFA 1VYGA 3VG7A 1O1VA 1Y52X 4HFOA 5B27A 2HLVA 2VFBA 4CDFA 3IA8A 3MM0A 4NNTA 2YG2A 1L6MA 1U17A 1X8UA 2RTIB 4ZHCA 5FQ8E 5B2AO 1HBQA 3NQ9A 4OS8A 1I05A 2RTQB 4GUZA 3LHNA 1SRHA 1VWMB 1W5RA 2OY7A 3S5VA 3UEWA 2AT5X 4EDEA 2FTBA 4ZHHA 5HZ5A 1LELA 1QQSA 3FELA 5LJCA 1RSUB 4DQ4A 1A18A 1AVDA 1IIUA 1ACDA 2IZIA 4M6SA 3WOVA 4INNA 4ES7A 2OVEA 3BU1A 1DC9A 2A0AA 4MISA 4GJSA 5F2BA 2GC9A 2OYBO 2Z4IA 2RTMA 5CE4A 1JQPA 5HAEA 4WHIA 4O4SA 4JHQA 4FQBB 3WBGA 3TGAA 1SLGB 1SWDA 3ZW1B 4IABA 3RE6A 5FQ7E 1GM6A 3P02A 3B2LA 5H9AA 1KFFA 1VWOB 1ZNHA 1EALA 1GT1A 3BLGA 3LTWA 1GXAA 1SWEA 1SWOA 4CSBA 4EEJA 1GT5A 1YUPA 2CZTA 1SWKA 2OZQA 3Q6LA 1KT3A 3HWDA 4BX7B 4Z2VA 5K06A 1ZRYA 4I9RA 5KHPA 4KCAA 3OJYC 5LKFA 1B56A 3T2XA 4BOEA 2DM5A 4QGXA 1R0UA 2ZSCA 2GH7A 1RXJA 2LFOA 3FEPA 1IJ8A 4N7CA 1I04A 3FR4A 1Y0GA 2N93A 1SREA 4U8UM 5AQ6A 3KQ0A 1HXLA 1W6FA 4FBVA 2JMBA 3OE3A 4U9CA 4NV7A 4JNJA 4HPCA 1JIWI 4IB6A 4O3WA 2IZEB 2XSTA 3CR6A 3JS1A 5C0NA 5EEEA 1AVEA 3CQRA 2HZQA 5K68A 1NQNA 2I5VO 3AKNA 5IO7A 1OBQA 4ZHDA 1SXUA 2FS7A 2LBAA 4CPFA 2AT3X 4OEMA 1KZXA 1EW3A 1UZ2X 3HWGA 1EXSA 1TW4A 3P24A 1YWDA 1GX8A 2JW1A 5LJGA 5BVSA 5BVTA 1IW2A 4HPAA 2F73A 2NNEA 3WJGA 3RDOA 1BRPA 3ELZA 3Q34A 2E4JA 5IO6A 3APVA 2OY8A 4NYRA 1NGLA 5H9NA 1HBPA 3ZW2A 2RTKA 4XMFA 3FIDA 1O8VA 2O62A 2RTHB 1Y9LA 2MWHA 1IKEA 2ZAIA 3RDSA 1EIOA 3ZWEA 1KT5A 2WEWA 4TKJA 3HWFA 5EZ2A 1FENA 3V8UA 1LIDA 1YP7A 2MHDA 3B2IA 4I6SA 5LJDA 2WPUA 3MVFA 1VWIB 4QQ1A 4YDAA 2XKLA 3PEDA 4NW4A 3WYQA 1N9MA 1T0VA 1UYNX 3JQOA 4CPHB 1VWEB 2IZGB 4ZHFA 4JO6A 4OMWA 1MOYA 2X56A 3TZSA 1E02A 5B5GA 4GD9A 1QFTA 3VHIA 1U0XA 2A2UA 1Y9TA 1X8PA 3CBSA 3RY1A 1ZNLA 1CBRA 3KFIA 3N91A 1O1UA 4ODDA 1QABE 2HZRA 2OFMX 3HWEA 4LKPA 4YMYA 3FYFA 1SY0A 3D96A 1LNMA 3RWXA 3UEUA 2RQ0A 5B10O 4ZH9A 3TGBA 5D45A 2BSZA 1BSOA 3UAQA 1D3SA 4BJ8A 3WJFA 4ZGUA 3VE2A 5EDCA 2KD2A 1DF3A 2A3FX 3FA7A 1QWDA 1DZPA 3HK1A 2CBSA 1SWTA 5FAZA 1CJ5A 1NC9A 4YFRA 1BLRA 3CWKA 2RCTA 3P6HA 2Y32A 4LQZA 3WZQA 1EQDA 2AKQA 2FR2A 4RUNA 3S60A 1SLEB 2RTLA 1CBIA 3SLTA 1LIFA 2RTPB 5B3MO 5HZ8A 4R0BA 1FDQA 3CQNA 1B0OA 2MM3A 3VG4A 5BVQA 1Y55X 2OL8O 2Y3FA 1I78A 1SWQA 3CBCA 3DSZA 4ML7B 2NNDA 2DJFA 2QO6A 2RD7C 4PSQA 4D6BA 3PH5A 5D4AA 4IB9A 5F6BA 4NLIA 2L68A 1JZUA 1JMZA 1XKIA 1BBPA 4TQ2A 1LUQA 2RTBB 1STRB 1OPAA 4IMNA 3RKGA 1SWHA 2BHVA 3CKGA 5HTDA 4GNWA 2JU7A 2Q4NA 1KQXA 1N4JA 3U9PC 2RTAA 4TNNA 4YBUA 4YDBA 5HZQA 4ORRA 1AVGI 4RUUA 3O2YA 1CBQA 1LCZA 3NR3A 4Z6JA 3F8AA 2AMMX 3PDFA 2JU3A 3QKGA 4D6AA 1A57A 1UREA 2FKJA 4ORWA 1DZMA 1MK5A 3QQ2A 3VG6A 4A60A 4AZQA 2WQ9A 4EQAC 2NP1A 4YGGA 1DZKA 2R56A 3FEKA 3EW1A 2RTOB 3D95A 2JOZA 4O9SA 1AELA 1JJUA 3FIQA 1PTSA 2LA7A 5F58A 4GGZA 3CMPA 1KXOA 4XMHA 2G7BA 1OSPO 4ORYA 2C4IA 4YVBA 5LJBA 2FLJA 1BEBA 2C1SA 1GKAB 1MDCA 2KTSA 4YGHA 1VYFA 4CPIA 4QYNA 1DFVA 2Z4HA 2LB6A 1X71A 3BDRA 5CSEA 2FR3A 1SLDB 2I5ZO 1NP4A 1SWSA 2JU8A 1X8OA 5H8TA 4Z28A 2A8GA 3WJBA 4IB7A 3VG2A 3P6DA 2Q2MA 3KFFA 3S5XA 3FA9A 3SZJA 4OS3A 4IAWA 5CYBA 4I3CA 2OVDA 4WBKA 5AJCA 3STMX 3GE2A 4O3ZA 2KTDA 3T1DA 1LDOA 3T6FA 1SLFB 3GAQA 3TGCA 2RN4A 1SWJA 2FHLA 4ALBA 2OY1O 5LKEA 2GTLO 3B2JA 1BRQA 3HOLA 3WXQA 4A1HA 1ALBA 3BS2A 4FGIB 5KICA 1BJ7A 3X00A 4Y0PA 4BQUA 2WQAE 2R73A 3FW4A 4TKHA 1E5PA 5BYPA 3WVMA 5HZ9A 1HXZA 1ICNA 5IRUA 4MIRA 1EPBA 3RY2A 1JMXA 2RTCB 4AZOA 1SY3A 1RLBE 4BX6B 3WZOA 2BC3A 1LKEA 3MBTA 1VWLB 2ACPX 2X8SA 3AUMO 5D47A 1GT4A 4Y0SA 5DPQA 2P8GA 1H91A 4IAXA 3VHMA 3KFGA 1GGLA 1G7NA 1LICA 3D9WA 4XMCA 1DV9A 1ZNGA 1SWGA 1RXKA 2WEXA 4KC8A 1PEEA 3WZNA 3AEHA 3L4RA 4ALOA 1MUPA 2IZHB 2X45A 2X8FA 2C1QA 3BX7A 2OVAA 4GDAA 3F6ZB 1AB0A 1EI5A 4LZVA 3BRNA 2HMBA 2OF9A 4TKBA 1PBYA 5DG4A 2KW1A 2POAA 1VWRB 2OFRX 1BSYA 1ZNKA 4CK4A 5HA0A 2CBRA 4MVIA 3APWA 3DTQA 3EYCA 3PECA 3SLJA 4BX7A 4BX5A 4CDCA 1HMSA 4CDEA 4BCSA 4CDDA 3NX1A 4HPDA 3SZHA 3FW5A 1QG5A 4ORSA 3WYPA 3ZW0A 1LDQA 4GGTA 4B55A 5AEOA 2AT0X 4CPEA 3C77X 1SWUA 3PP6A 1LCWA 2FWVA 2NNQA 3APXA 4JGLA 4U8UN 4Y0QA 1KL3A 4YCHA 4I3BA 2RTDB 4C5PA 3EBKA 1JV4A 2BS5A 1PM1X 1SRJA 3ZI8A 3KZAA 3P6CA 4U3QA 2VDFA 1N43A 2QMIA 2X32A 4EFGA 1CBSA 1KT6A 1FTPA 4GGRA 4NNSA 4NYQA 2RTRB 2HNXA 4ID2A 3RDQA 1SWAA 3PQUA 4GKCA 4QZUA 2M4LA 1SXWA 1DF8A 2MO5A 2AF5A 4YH0A 1JJJA 1VWFB 3EC5A 1KL4A 2A5CA 3P6GA 4DQ3A 1YIVA 2JN3A 1SWCA 1VWPB 4XMDA 4QGWA 2LBVA 3NQKA 4YFQA 3VU1A 1LFOA 4U8UO 3NP1A 3VG3A 2L9CA 4AZMA 1JYJA 1TOWA 1ADLA 1MX7A 2F09A 2RTNB 2X4MA 4L3RA 2JGSA 2AH7X 3RBYA 5FENA 2HKDA 1BWYA 5LJHA 2ZAGA 3FA6A 2G78A 2RA6A 3HPEA 4ARHA 4BGFA 1HN2A 1RXHA 4WFVA 1W4TA 4NLJA 3EBWA 5CHKA 2IZAA 4QGVA 2QOMA 1ERBA 1U18A 2FRSA 1VWQB 1SXYA 3HOEA 3U03A 1VWGB 1MX8A 3VHHA 1LIEA 4U46A 1IKJA 1NQMA 2BT9A 4N7DA 4IMOA 2GTFX 1X8QA 2G79A 3KVNA 2RTEB 3NADA 3P6EA 4O3YA 3ZW1A 5JR8A 1KGLA 4KC7A 1MVGA 4FBOA 1IFBA 4HPBA 4I3DA 3RDMA 1HMTA 4WFUA 2OVSA 3RDUA 1I06A 1SWPA 4GRJA 2A5BA 4CV7A 2QO4A 4AZNA 3U0DA 3NQ3A 1B8EA 3FA8A 1N0SA 1QFVA 1XCAA 2X55A 1PMPA 3B2KA 3OBLA 4I95A 5FFHA 4AW8A 4LKTA 4Y59A 3SLOA 4YBPA 5L3YA 2QO5A 1DZJA 4UU2A 4ZJ0A 1VWAB 3T6LA 3O19A 1G74A 2X46A 3H3IA 2CM9A 1NDJA 3NPOA 4MVEA 5L8IA 4Z27A 5IRWA 1B4MA 3CKFA 2L5PA 2IZCB 1FEMA 5JD2A 4OMXA 2CAMA 2W2BA 4KT5A 3SZIA 1VYOA 1OBUA 1TXLA 2L67A 4DNEA 2GTLN 3I17A 5HWZA 3SOTA 1K24A 1OEEA 2Q39A 3BU9A 1E00A 5EDBA 1SWLA 3SAOA 3STKA 2IZBA 3I0AA 4QAEA 1GX9A 3PH6A 3B2HA 2IZLB 4GU8A 3D4RA 1YWCA 1VWJB 1K3BA 5IXGA 4OELA 1HY2A 4L1NA 1SWNA 3BX8A 3P6FA 3JSQA 1SY2A 4Z2PA 1KQWA 4M7MA 1STPA 4UU3A 4O4UA 2MJIA 5EPQA 4OS0A 1ML7A 4QYPA 1PBOA 3FDCA 4MEEA 3S26A 4O3XB 3EW2A 5D8JA 1NBXA 1VWBB 4ON1A 1KT7A 1Y53X 2DJGA 3G7XA 2G8CO 1VWHB 5F6ZA 1FJ1E 5AJBA 1KL5A 1LCVA 1IFCA 3ZUIA 4A8ZA 5IRAA 4CPHA 3EMMA 4MVKA 1OBPA 2FS6A 1FELA 2YMSA 1S7DA 4ZR2A 2WWPA 2QCBA 3VGWA 1SA8A 2A2GA 3C76X 2BS6A 2Y3EA 1BSQA 1I4UA 4KH8A 1CRBA 2OFAA 2OL6O 2WR6A 4IBAA 1YWBA 4DCBA 4EXZA 4YKOA 1TVQA 2QM9A 1HQPA 3OD9A 1UYOX 2RTFB 1HMRA 1JYDA 2IZFB 3RSWA 4GNYA 4AYHA 5B29A 2K23A 4ORXA 2IZDB 1P6PA 2Q2PA 3MG5A 2RTGB 5H9KA 3APUA 1YP6A 3RZYA 5HCCC 4GH7A 1VPRA 2W2FA 2RCQA 1G5WA 5FQ6E 2AVIA 3MX7A 4GETA 2CZUA 4YFPA 4I9SA 1LF7A 4LZUA 4FBRA 4GDZA 4QZTA 1WUBA 4I60A 5D48A 2WUTA 5H9LA 3NBXX 4ZH6A 2OF8A 5B11O 1VWCB 1FE3A 4NP1A 3D97A 4AZPA 3STNA 5L8NA 1SXXA 2EU7X 3TF6A 2ACOA 3RDXA 4PJ2A 4GE1A 3HTYA 4HWMA 1ZNDA 2KT4B 2R74A 2WSJA 3NX2A 1ZNEA 2A13A 4O4XA 3PK2A 4OKAA 4XMGA 4XMEA 1MM9A 2UZ2A 3C78X 1VWDB 4QNIA 4QRLA 3EM0A 1E06A 2QOSC 3PPTA 1S44A 5IO5A 3T2WA 2X8TA 5LJEA 3UEVA 3VG5A 4A1YA 3FENA 2OFBA 1SRGA 4ZFXA 5HA1A 3VPJE 4Z2OA 5HTEA 5HCDC 1BM5A 2IZKA 3K3LA 1RAVA 2UYWA 5L8OA 1EUOA 3WJEA 1SRIA 3KFHA 1Z24A 1N9YA 1MEPA 4O49A 2AT6X 1HQQA 2BLGA 1ERXA 2LKKA 1STSB 4YGZA 3VE1A 4Y5DA 1EPAA 2AL0X 1SWRA 4YKMA 2FHNX 2MF6A 1EIIA 3LV4A 3ZUOA 5B5FA 1NP1A 2IZJA 2RTJA 3WJCA 1JBHA 4TLJA 1JJXA 1T68X 1GT3A 1VWNB 2OL7A 3O22A 5EEDA 4IB8A 1D2UA 1RBPA 3WJDA 5KIDA
chains in the Genus database with same CATH topology
2CM4A 2GJ5A 1S2PA 1YWAA 1GKAA 1LIBA 4ZGFA 1T8VA 1KT4A 1SY1A 2Q9SA 4GK9A 3FR5A 4AZRA 1AQBA 1LPJA 2AT8X 2GTLM 3BY0A 4COTA 4K19A 3IFBA 4YCEA 4TJZA 1SMPI 1A2DA 1ICMA 2ASNX 3FR2A 3FMZA 3ZW0B 4BVMA 3ELXA 1OEJA 1KOIA 3E3CA 1QY2A 5F7GA 1OEKA 1A3YA 1X89A 3PQSA 5HCEC 3UEXA 3ZQ3A 1KZWA 2ANSA 2FT9A 4O4OA 1G85A 1QY1A 3ZZVA 1OPBA 1QY0A 4MVLA 2IFBA 5LJKA 4Y0RA 3AKMA 1TOUA 2HYSA 4KIIA 1X8NA 2K62A 3F9DA 3BSZE 4ZHGA 5F1EA 4GZVA 4ZCBA 5HZ6A 3FLLA 2ALLX 2W2AA 5HBSA 4ORUA 2PY1A 1VYGA 3VG7A 1O1VA 4HFOA 5B27A 2HLVA 3IA8A 4ZHCA 4NNTA 2YG2A 1L6MA 1U17A 1X8UA 5FQ8E 1HBQA 3NQ9A 4OS8A 1I05A 3LHNA 4EDEA 3S5VA 5HZ5A 2AT5X 5LJCA 2FTBA 4ZHHA 1QQSA 3FELA 4DQ4A 1A18A 1IIUA 1ACDA 4M6SA 3WOVA 4INNA 4ES7A 2OVEA 3BU1A 1DC9A 2A0AA 4MISA 2GC9A 5HAEA 2Z4IA 5CE4A 4WHIA 4O4SA 4FQBB 3WBGA 3TGAA 3ZW1B 4IABA 5FQ7E 1GM6A 3P02A 3B2LA 5H9AA 1ZNHA 1EALA 1GT1A 3BLGA 1GXAA 4CSBA 4EEJA 1GT5A 1YUPA 2CZTA 2OZQA 3Q6LA 1KT3A 3HWDA 1ZRYA 4I9RA 5KHPA 4KCAA 3OJYC 5LKFA 1B56A 4BOEA 2DM5A 4QGXA 1R0UA 2LFOA 3FEPA 4N7CA 1I04A 3FR4A 2N93A 4U8UM 5AQ6A 3KQ0A 4FBVA 2JMBA 3OE3A 4U9CA 4HPCA 1JIWI 4IB6A 4O3WA 2XSTA 3CR6A 3JS1A 5C0NA 5EEEA 3CQRA 2HZQA 3AKNA 5IO7A 1OBQA 4ZHDA 1SXUA 2FS7A 2LBAA 2AT3X 1KZXA 1EW3A 1UZ2X 3HWGA 1EXSA 1TW4A 3P24A 1YWDA 1GX8A 2JW1A 5LJGA 5BVSA 5BVTA 1IW2A 4HPAA 2F73A 2NNEA 3WJGA 1BRPA 3ELZA 2E4JA 5IO6A 3APVA 4NYRA 1NGLA 5H9NA 1HBPA 3ZW2A 4XMFA 1O8VA 2O62A 1Y9LA 2MWHA 1IKEA 2ZAIA 1EIOA 3ZWEA 1KT5A 2WEWA 4TKJA 3HWFA 5EZ2A 1FENA 3V8UA 1LIDA 1YP7A 2MHDA 3B2IA 4I6SA 5LJDA 3MVFA 4YDAA 4QQ1A 2XKLA 3PEDA 4NW4A 1T0VA 3JQOA 4ZHFA 4OMWA 3TZSA 1E02A 1QFTA 1U0XA 2A2UA 1Y9TA 1X8PA 3CBSA 1ZNLA 1CBRA 3KFIA 3N91A 1O1UA 4ODDA 1QABE 2HZRA 2OFMX 3HWEA 4LKPA 4YMYA 3FYFA 1SY0A 3D96A 1LNMA 3RWXA 3UEUA 2RQ0A 3TGBA 4ZH9A 5D45A 1BSOA 3UAQA 1D3SA 3WJFA 4ZGUA 3VE2A 5EDCA 2KD2A 1DF3A 2A3FX 3FA7A 1QWDA 1DZPA 3HK1A 2CBSA 5FAZA 1CJ5A 4YFRA 1BLRA 3CWKA 2RCTA 3P6HA 4LQZA 1EQDA 2AKQA 2FR2A 4RUNA 3S60A 1CBIA 5HZ8A 1LIFA 4R0BA 1FDQA 3CQNA 1B0OA 2MM3A 3VG4A 5BVQA 3CBCA 3DSZA 4ML7B 2NNDA 2QO6A 2RD7C 4PSQA 4D6BA 3PH5A 5D4AA 4IB9A 5F6BA 4NLIA 2L68A 1JZUA 1XKIA 1BBPA 4TQ2A 1OPAA 4IMNA 3RKGA 2BHVA 5HTDA 4GNWA 2JU7A 2Q4NA 1KQXA 3U9PC 4TNNA 4YBUA 4YDBA 5HZQA 4ORRA 1AVGI 4RUUA 3O2YA 1CBQA 3NR3A 1A57A 3F8AA 2AMMX 3QKGA 2JU3A 4D6AA 1UREA 4ORWA 1DZMA 4A60A 3VG6A 4AZQA 2WQ9A 4EQAC 2NP1A 4YGGA 1DZKA 2R56A 3FEKA 3D95A 2JOZA 4O9SA 1AELA 3FIQA 2LA7A 5F58A 3CMPA 1KXOA 4XMHA 2G7BA 4ORYA 5LJBA 2FLJA 1BEBA 1GKAB 1MDCA 2KTSA 4YGHA 1VYFA 4QYNA 1DFVA 2Z4HA 2LB6A 1X71A 3BDRA 2FR3A 1NP4A 5H8TA 2JU8A 1X8OA 3WJBA 4IB7A 3VG2A 3P6DA 2Q2MA 3KFFA 3S5XA 3FA9A 4OS3A 4IAWA 5CYBA 4I3CA 2OVDA 4WBKA 5AJCA 3STMX 3GE2A 4O3ZA 2KTDA 3T1DA 3GAQA 2RN4A 4ALBA 5LKEA 2GTLO 3B2JA 1BRQA 3HOLA 3WXQA 4A1HA 1ALBA 3BS2A 4FGIB 5KICA 1BJ7A 4BQUA 4Y0PA 5BYPA 2WQAE 2R73A 3FW4A 4TKHA 1E5PA 3WVMA 5HZ9A 1ICNA 4MIRA 1EPBA 4AZOA 1SY3A 1RLBE 1LKEA 3MBTA 2ACPX 2X8SA 5D47A 1GT4A 4Y0SA 5DPQA 2P8GA 1H91A 4IAXA 3KFGA 1GGLA 1G7NA 1LICA 4XMCA 1DV9A 1ZNGA 2WEXA 4KC8A 1PEEA 3L4RA 4ALOA 1MUPA 2X45A 2X8FA 3BX7A 2OVAA 3F6ZB 1AB0A 1EI5A 4LZVA 3BRNA 2HMBA 4TKBA 5DG4A 2KW1A 2POAA 2OFRX 1BSYA 1ZNKA 4CK4A 5HA0A 2CBRA 4MVIA 3APWA 3DTQA 3EYCA 3PECA 1HMSA 3NX1A 4HPDA 3FW5A 1QG5A 4ORSA 3ZW0A 5AEOA 2AT0X 3C77X 3PP6A 2NNQA 2FWVA 3APXA 4JGLA 4U8UN 4Y0QA 4YCHA 4I3BA 3EBKA 1JV4A 2BS5A 1PM1X 3ZI8A 3KZAA 3P6CA 4U3QA 2QMIA 4EFGA 1CBSA 1KT6A 1FTPA 4NNSA 4NYQA 2HNXA 4ID2A 3PQUA 4GKCA 4QZUA 2M4LA 1SXWA 2MO5A 4YH0A 1JJJA 3P6GA 4DQ3A 1YIVA 2JN3A 4XMDA 4QGWA 2LBVA 3NQKA 4YFQA 3VU1A 1LFOA 4U8UO 3NP1A 3VG3A 2L9CA 4AZMA 1JYJA 1TOWA 1ADLA 1MX7A 2F09A 2AH7X 5FENA 4L3RA 3RBYA 1BWYA 5LJHA 2ZAGA 3FA6A 2G78A 2RA6A 4ARHA 1HN2A 4WFVA 4NLJA 5K06A 3EBWA 4QGVA 3TGCA 1ERBA 1U18A 2FRSA 1SXYA 3HOEA 3U03A 1MX8A 1LIEA 1IKJA 2BT9A 4N7DA 4IMOA 2GTFX 1X8QA 2G79A 3NADA 3P6EA 3ZW1A 4O3YA 5JR8A 1KGLA 4KC7A 1MVGA 4FBOA 1IFBA 4HPBA 4I3DA 3UEWA 1HMTA 4WFUA 2OVSA 4CV7A 1I06A 4GRJA 2QO4A 4AZNA 3U0DA 3NQ3A 1B8EA 3FA8A 1N0SA 1QFVA 1XCAA 3B2KA 1PMPA 3OBLA 4I95A 4AW8A 5FFHA 4LKTA 4YBPA 2QO5A 1DZJA 4UU2A 4ZJ0A 3O19A 1G74A 2X46A 3H3IA 2CM9A 3NPOA 5L8IA 4MVEA 1B4MA 2L5PA 1FEMA 4OMXA 2W2BA 4KT5A 1OBUA 1TXLA 2L67A 2GTLN 3I17A 5HWZA 3SOTA 1OEEA 2Q39A 3BU9A 1E00A 5EDBA 3SAOA 3STKA 3I0AA 4QAEA 1GX9A 3PH6A 3B2HA 4GU8A 3D4RA 1YWCA 4L1NA 3BX8A 3P6FA 3JSQA 1SY2A 1KQWA 4M7MA 4UU3A 4O4UA 2MJIA 5EPQA 4OS0A 1ML7A 4QYPA 1PBOA 3S26A 4O3XB 5D8JA 4ON1A 1KT7A 3G7XA 5F6ZA 5AJBA 1IFCA 3ZUIA 4A8ZA 3EMMA 4MVKA 1OBPA 2FS6A 1FELA 2YMSA 1S7DA 4ZR2A 2WWPA 1SA8A 2A2GA 3C76X 2BS6A 1BSQA 1I4UA 4KH8A 1CRBA 2WR6A 4IBAA 1YWBA 4EXZA 4YKOA 1TVQA 2QM9A 1HQPA 3OD9A 3RSWA 1HMRA 1JYDA 4AYHA 5B29A 4GNYA 2K23A 4ORXA 1P6PA 2Q2PA 5H9KA 3APUA 1YP6A 3RZYA 5HCCC 4GH7A 1VPRA 2W2FA 2RCQA 1G5WA 5FQ6E 3MX7A 4GETA 2CZUA 4YFPA 4I9SA 1LF7A 4LZUA 4FBRA 4GDZA 4QZTA 4ZH6A 5D48A 2WUTA 5H9LA 3NBXX 1FE3A 4NP1A 3D97A 4AZPA 3STNA 5L8NA 1SXXA 2EU7X 3TF6A 2ACOA 4PJ2A 4GE1A 3HTYA 4HWMA 1ZNDA 2KT4B 2R74A 2WSJA 3NX2A 1ZNEA 2A13A 4O4XA 4XMGA 4XMEA 3C78X 4QNIA 4QRLA 3EM0A 1E06A 2QOSC 3PPTA 1S44A 5IO5A 2X8TA 5LJEA 3UEVA 3VG5A 4A1YA 3FENA 4ZFXA 5HA1A 3VPJE 5HTEA 5HCDC 1BM5A 3K3LA 5L8OA 1EUOA 3WJEA 3KFHA 1Z24A 4O49A 2AT6X 2BLGA 1ERXA 2LKKA 3VE1A 4YGZA 1EPAA 2AL0X 4YKMA 1EIIA 3LV4A 3ZUOA 1NP1A 3WJCA 1JBHA 4TLJA 1JJXA 1T68X 1GT3A 3O22A 5EEDA 3WJDA 5KIDA 4IB8A 1D2UA 1RBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CM4 A;  2GJ5 A;  1S2P A;  1YWA A;  1GKA A;  1LIB A;  1T8V A;  1KT4 A;  1SY1 A;  2Q9S A;  3FR5 A;  4AZR A;  1AQB A;  1LPJ A;  2AT8 X;  3BY0 A;  4K19 A;  3IFB A;  4YCE A;  4TJZ A;  1A2D A;  1ICM A;  2ASN X;  3FR2 A;  3FMZ A;  4BVM A;  3ELX A;  1OEJ A;  1KOI A;  1QY2 A;  5F7G A;  1OEK A;  1A3Y A;  1X89 A;  5HCE C;  3UEX A;  3ZQ3 A;  1KZW A;  2ANS A;  2FT9 A;  1G85 A;  1QY1 A;  1OPB A;  1QY0 A;  4MVL A;  2IFB A;  5LJK A;  4Y0R A;  3AKM A;  1TOU A;  2HYS A;  4KII A;  1X8N A;  2K62 A;  3F9D A;  3BSZ E;  4ZHG A;  5F1E A;  4ZCB A;  5HZ6 A;  3FLL A;  2ALL X;  2W2A A;  5HBS A;  4ORU A;  2PY1 A;  1VYG A;  3VG7 A;  1O1V A;  4HFO A;  5B27 A;  2HLV A;  3IA8 A;  4ZHC A;  4NNT A;  2YG2 A;  1L6M A;  1U17 A;  1X8U A;  1HBQ A;  3NQ9 A;  4OS8 A;  1I05 A;  4EDE A;  5HZ5 A;  2AT5 X;  5LJC A;  2FTB A;  4ZHH A;  1QQS A;  3FEL A;  4DQ4 A;  1A18 A;  1IIU A;  1ACD A;  4M6S A;  4ES7 A;  2OVE A;  3BU1 A;  1DC9 A;  2A0A A;  2GC9 A;  5HAE A;  5CE4 A;  3WBG A;  3TGA A;  1GM6 A;  3B2L A;  5H9A A;  1ZNH A;  1EAL A;  1GT1 A;  3BLG A;  1GXA A;  4EEJ A;  1GT5 A;  1YUP A;  2CZT A;  2OZQ A;  3Q6L A;  1KT3 A;  3HWD A;  1ZRY A;  4I9R A;  5KHP A;  3OJY C;  5LKF A;  1B56 A;  4BOE A;  2DM5 A;  4QGX A;  1R0U A;  2LFO A;  3FEP A;  4N7C A;  1I04 A;  3FR4 A;  2N93 A;  5AQ6 A;  3KQ0 A;  4HPC A;  4IB6 A;  2XST A;  3CR6 A;  3JS1 A;  5C0N A;  5EEE A;  3CQR A;  2HZQ A;  3AKN A;  5IO7 A;  1OBQ A;  4ZHD A;  1SXU A;  2FS7 A;  2LBA A;  2AT3 X;  1KZX A;  1EW3 A;  1UZ2 X;  3HWG A;  1EXS A;  1TW4 A;  1YWD A;  1GX8 A;  5LJG A;  5BVS A;  5BVT A;  1IW2 A;  4HPA A;  2F73 A;  2NNE A;  3WJG A;  1BRP A;  3ELZ A;  2E4J A;  5IO6 A;  3APV A;  4NYR A;  1NGL A;  5H9N A;  1HBP A;  4XMF A;  1O8V A;  2O62 A;  1IKE A;  1EIO A;  1KT5 A;  2WEW A;  4TKJ A;  3HWF A;  5EZ2 A;  1FEN A;  1LID A;  1YP7 A;  3B2I A;  5LJD A;  3MVF A;  4YDA A;  2XKL A;  3PED A;  1T0V A;  4ZHF A;  4OMW A;  3TZS A;  1E02 A;  1QFT A;  1U0X A;  2A2U A;  1X8P A;  3CBS A;  1ZNL A;  1CBR A;  3KFI A;  1O1U A;  4ODD A;  1QAB E;  2HZR A;  2OFM X;  3HWE A;  4LKP A;  4YMY A;  1SY0 A;  3D96 A;  1LNM A;  3UEU A;  2RQ0 A;  3TGB A;  4ZH9 A;  5D45 A;  1BSO A;  1D3S A;  3WJF A;  4ZGU A;  5EDC A;  1DF3 A;  2A3F X;  3FA7 A;  1QWD A;  1DZP A;  3HK1 A;  2CBS A;  5FAZ A;  1CJ5 A;  4YFR A;  1BLR A;  3CWK A;  2RCT A;  3P6H A;  1EQD A;  2AKQ A;  2FR2 A;  4RUN A;  1CBI A;  5HZ8 A;  1LIF A;  4R0B A;  1FDQ A;  3CQN A;  1B0O A;  2MM3 A;  3VG4 A;  5BVQ A;  3CBC A;  3DSZ A;  2NND A;  2QO6 A;  2RD7 C;  4PSQ A;  4D6B A;  3PH5 A;  5D4A A;  4IB9 A;  5F6B A;  4NLI A;  2L68 A;  1JZU A;  1XKI A;  1BBP A;  4TQ2 A;  1OPA A;  4IMN A;  5HTD A;  4GNW A;  2JU7 A;  2Q4N A;  1KQX A;  3U9P C;  4TNN A;  4YBU A;  4YDB A;  5HZQ A;  4ORR A;  1AVG I;  4RUU A;  3O2Y A;  1CBQ A;  3NR3 A;  1A57 A;  3F8A A;  2AMM X;  3QKG A;  2JU3 A;  4D6A A;  1URE A;  4ORW A;  1DZM A;  4A60 A;  3VG6 A;  4AZQ A;  2WQ9 A;  2NP1 A;  4YGG A;  1DZK A;  2R56 A;  3FEK A;  3D95 A;  2JOZ A;  4O9S A;  1AEL A;  3FIQ A;  5F58 A;  3CMP A;  1KXO A;  4XMH A;  2G7B A;  4ORY A;  5LJB A;  2FLJ A;  1BEB A;  1GKA B;  1MDC A;  4YGH A;  1VYF A;  4QYN A;  1DFV A;  3BDR A;  2LB6 A;  1X71 A;  2FR3 A;  1NP4 A;  5H8T A;  2JU8 A;  1X8O A;  3WJB A;  4IB7 A;  3VG2 A;  3P6D A;  2Q2M A;  3KFF A;  3FA9 A;  4OS3 A;  4IAW A;  4I3C A;  2OVD A;  4WBK A;  3STM X;  2KTD A;  3T1D A;  3GAQ A;  4ALB A;  5LKE A;  3B2J A;  1BRQ A;  3WXQ A;  4A1H A;  1ALB A;  3BS2 A;  5KIC A;  1BJ7 A;  4BQU A;  4Y0P A;  2WQA E;  2R73 A;  3FW4 A;  4TKH A;  1E5P A;  3WVM A;  5HZ9 A;  1ICN A;  1EPB A;  4AZO A;  1SY3 A;  1RLB E;  1LKE A;  3MBT A;  2ACP X;  5D47 A;  1GT4 A;  4Y0S A;  5DPQ A;  2P8G A;  1H91 A;  4IAX A;  3KFG A;  1GGL A;  1G7N A;  1LIC A;  4XMC A;  1DV9 A;  1ZNG A;  2WEX A;  1PEE A;  3L4R A;  4ALO A;  1MUP A;  2X45 A;  3BX7 A;  2OVA A;  1AB0 A;  4LZV A;  3BRN A;  2HMB A;  4TKB A;  5DG4 A;  2POA A;  2OFR X;  1BSY A;  1ZNK A;  4CK4 A;  5HA0 A;  2CBR A;  4MVI A;  3APW A;  3DTQ A;  3EYC A;  3PEC A;  1HMS A;  3NX1 A;  4HPD A;  3FW5 A;  1QG5 A;  4ORS A;  2AT0 X;  3C77 X;  3PP6 A;  2NNQ A;  2FWV A;  3APX A;  4Y0Q A;  4YCH A;  4I3B A;  3EBK A;  1JV4 A;  1PM1 X;  3KZA A;  3P6C A;  4EFG A;  1CBS A;  1KT6 A;  1FTP A;  4NNS A;  4NYQ A;  2HNX A;  4GKC A;  4QZU A;  1SXW A;  2MO5 A;  4YH0 A;  1JJJ A;  3P6G A;  4DQ3 A;  1YIV A;  2JN3 A;  4XMD A;  4QGW A;  2LBV A;  4YFQ A;  1LFO A;  3VG3 A;  3NP1 A;  4AZM A;  2L9C A;  1JYJ A;  1TOW A;  1ADL A;  1MX7 A;  2AH7 X;  5FEN A;  1BWY A;  5LJH A;  3FA6 A;  2G78 A;  2RA6 A;  4ARH A;  1HN2 A;  4WFV A;  4NLJ A;  5K06 A;  3EBW A;  4QGV A;  3TGC A;  1ERB A;  1U18 A;  2FRS A;  1SXY A;  3U03 A;  1MX8 A;  1LIE A;  1IKJ A;  4N7D A;  4IMO A;  2GTF X;  1X8Q A;  2G79 A;  3NAD A;  3P6E A;  5JR8 A;  1KGL A;  1MVG A;  4HPB A;  1IFB A;  4I3D A;  3UEW A;  1HMT A;  4WFU A;  1I06 A;  4GRJ A;  2QO4 A;  4AZN A;  3U0D A;  3NQ3 A;  1B8E A;  3FA8 A;  1N0S A;  1QFV A;  1XCA A;  3B2K A;  1PMP A;  4AW8 A;  5FFH A;  4LKT A;  4YBP A;  2QO5 A;  1DZJ A;  4UU2 A;  4ZJ0 A;  3O19 A;  1G74 A;  2X46 A;  2CM9 A;  3NPO A;  5L8I A;  1B4M A;  2L5P A;  1FEM A;  4OMX A;  2W2B A;  1OBU A;  1TXL A;  2L67 A;  3I17 A;  5HWZ A;  1OEE A;  2Q39 A;  3BU9 A;  1E00 A;  5EDB A;  3SAO A;  3STK A;  3I0A A;  4QAE A;  1GX9 A;  3PH6 A;  3B2H A;  1YWC A;  3BX8 A;  3P6F A;  3JSQ A;  1SY2 A;  1KQW A;  4M7M A;  4UU3 A;  2MJI A;  5EPQ A;  4OS0 A;  1ML7 A;  4QYP A;  1PBO A;  3S26 A;  5D8J A;  1KT7 A;  3G7X A;  5F6Z A;  1IFC A;  3ZUI A;  4A8Z A;  3EMM A;  4MVK A;  1OBP A;  2FS6 A;  1FEL A;  1S7D A;  4ZR2 A;  2WWP A;  1SA8 A;  2A2G A;  3C76 X;  1BSQ A;  1I4U A;  1CRB A;  2WR6 A;  4IBA A;  1YWB A;  4EXZ A;  4YKO A;  1TVQ A;  2QM9 A;  1HQP A;  3RSW A;  1HMR A;  1JYD A;  4AYH A;  5B29 A;  4GNY A;  2K23 A;  4ORX A;  1P6P A;  2Q2P A;  5H9K A;  3APU A;  1YP6 A;  3RZY A;  5HCC C;  4GH7 A;  1VPR A;  2W2F A;  2RCQ A;  1G5W A;  4GET A;  2CZU A;  4YFP A;  4I9S A;  1LF7 A;  4LZU A;  4ZH6 A;  4QZT A;  5D48 A;  2WUT A;  5H9L A;  1FE3 A;  4NP1 A;  3D97 A;  4AZP A;  3STN A;  5L8N A;  1SXX A;  2EU7 X;  3TF6 A;  2ACO A;  4GE1 A;  2R74 A;  1ZND A;  2KT4 B;  2WSJ A;  3NX2 A;  1ZNE A;  2A13 A;  4XMG A;  4XME A;  3C78 X;  3EM0 A;  1E06 A;  2QOS C;  3PPT A;  1S44 A;  5IO5 A;  5LJE A;  3UEV A;  3VG5 A;  4A1Y A;  3FEN A;  4ZFX A;  5HA1 A;  5HTE A;  5HCD C;  1BM5 A;  3K3L A;  5L8O A;  1EUO A;  3WJE A;  3KFH A;  1Z24 A;  2AT6 X;  2BLG A;  1ERX A;  2LKK A;  4YGZ A;  1EPA A;  2AL0 X;  4YKM A;  1EII A;  3ZUO A;  1NP1 A;  3WJC A;  1JBH A;  4TLJ A;  1JJX A;  1T68 X;  1GT3 A;  3O22 A;  5EED A;  3WJD A;  5KID A;  4IB8 A;  1D2U A;  1RBP A; 
#chains in the Genus database with same CATH topology
 1SWB A;  2CM4 A;  2GJ5 A;  1S2P A;  1YWA A;  1GKA A;  1LIB A;  1WBI A;  1T8V A;  4ZGF A;  1KT4 A;  1SY1 A;  2Q9S A;  4GK9 A;  3FR5 A;  4AZR A;  1AQB A;  1LPJ A;  2AT8 X;  2GTL M;  3BY0 A;  2OY5 O;  4COT A;  4K19 A;  2FGS A;  3IFB A;  2FKG A;  4YCE A;  4GJV A;  4BX5 B;  4TJZ A;  1RST B;  3WZP A;  1SMP I;  1A2D A;  1ICM A;  2ASN X;  2PI3 O;  3FR2 A;  2VFC A;  4NV8 A;  3FMZ A;  4IRW A;  3ZW0 B;  3RE5 A;  4BVM A;  3ELX A;  1OEJ A;  1KOI A;  3E3C A;  1QY2 A;  5F7G A;  1OEK A;  1A3Y A;  1X89 A;  3PQS A;  1I9H A;  5HCE C;  3UEX A;  3ZQ3 A;  4EKV A;  1KZW A;  2ANS A;  2FT9 A;  4O4O A;  1N7Y A;  1G85 A;  1QY1 A;  2X34 A;  3ZZV A;  1GX3 A;  1OPB A;  1QY0 A;  1VWK B;  4MVL A;  2IFB A;  5K67 A;  5LJK A;  1E2T A;  4Y0R A;  3AKM A;  1TOU A;  2HYS A;  4KII A;  1X8N A;  2K62 A;  3F9D A;  3BSZ E;  4ZHG A;  5F1E A;  4GZV A;  2F01 A;  4ZCB A;  5HZ6 A;  1SRF A;  3FLL A;  2ALL X;  2W2A A;  5HBS A;  2G5L A;  4BX6 A;  4ORU A;  2PY1 A;  4BBO A;  1SWF A;  1VYG A;  3VG7 A;  1O1V A;  1Y52 X;  4HFO A;  5B27 A;  2HLV A;  2VFB A;  4CDF A;  3IA8 A;  3MM0 A;  4NNT A;  2YG2 A;  1L6M A;  1U17 A;  1X8U A;  2RTI B;  4ZHC A;  5FQ8 E;  5B2A O;  1HBQ A;  3NQ9 A;  4OS8 A;  1I05 A;  2RTQ B;  4GUZ A;  3LHN A;  1SRH A;  1VWM B;  1W5R A;  2OY7 A;  3S5V A;  3UEW A;  2AT5 X;  4EDE A;  2FTB A;  4ZHH A;  5HZ5 A;  1LEL A;  1QQS A;  3FEL A;  5LJC A;  1RSU B;  4DQ4 A;  1A18 A;  1AVD A;  1IIU A;  1ACD A;  2IZI A;  4M6S A;  3WOV A;  4INN A;  4ES7 A;  2OVE A;  3BU1 A;  1DC9 A;  2A0A A;  4MIS A;  4GJS A;  5F2B A;  2GC9 A;  2OYB O;  2Z4I A;  2RTM A;  5CE4 A;  1JQP A;  5HAE A;  4WHI A;  4O4S A;  4JHQ A;  4FQB B;  3WBG A;  3TGA A;  1SLG B;  1SWD A;  3ZW1 B;  4IAB A;  3RE6 A;  5FQ7 E;  1GM6 A;  3P02 A;  3B2L A;  5H9A A;  1KFF A;  1VWO B;  1ZNH A;  1EAL A;  1GT1 A;  3BLG A;  3LTW A;  1GXA A;  1SWE A;  1SWO A;  4CSB A;  4EEJ A;  1GT5 A;  1YUP A;  2CZT A;  1SWK A;  2OZQ A;  3Q6L A;  1KT3 A;  3HWD A;  4BX7 B;  4Z2V A;  5K06 A;  1ZRY A;  4I9R A;  5KHP A;  4KCA A;  3OJY C;  5LKF A;  1B56 A;  3T2X A;  4BOE A;  2DM5 A;  4QGX A;  1R0U A;  2ZSC A;  2GH7 A;  1RXJ A;  2LFO A;  3FEP A;  1IJ8 A;  4N7C A;  1I04 A;  3FR4 A;  1Y0G A;  2N93 A;  1SRE A;  4U8U M;  5AQ6 A;  3KQ0 A;  1HXL A;  1W6F A;  4FBV A;  2JMB A;  3OE3 A;  4U9C A;  4NV7 A;  4JNJ A;  4HPC A;  1JIW I;  4IB6 A;  4O3W A;  2IZE B;  2XST A;  3CR6 A;  3JS1 A;  5C0N A;  5EEE A;  1AVE A;  3CQR A;  2HZQ A;  5K68 A;  1NQN A;  2I5V O;  3AKN A;  5IO7 A;  1OBQ A;  4ZHD A;  1SXU A;  2FS7 A;  2LBA A;  4CPF A;  2AT3 X;  4OEM A;  1KZX A;  1EW3 A;  1UZ2 X;  3HWG A;  1EXS A;  1TW4 A;  3P24 A;  1YWD A;  1GX8 A;  2JW1 A;  5LJG A;  5BVS A;  5BVT A;  1IW2 A;  4HPA A;  2F73 A;  2NNE A;  3WJG A;  3RDO A;  1BRP A;  3ELZ A;  3Q34 A;  2E4J A;  5IO6 A;  3APV A;  2OY8 A;  4NYR A;  1NGL A;  5H9N A;  1HBP A;  3ZW2 A;  2RTK A;  4XMF A;  3FID A;  1O8V A;  2O62 A;  2RTH B;  1Y9L A;  2MWH A;  1IKE A;  2ZAI A;  3RDS A;  1EIO A;  3ZWE A;  1KT5 A;  2WEW A;  4TKJ A;  3HWF A;  5EZ2 A;  1FEN A;  3V8U A;  1LID A;  1YP7 A;  2MHD A;  3B2I A;  4I6S A;  5LJD A;  2WPU A;  3MVF A;  1VWI B;  4QQ1 A;  4YDA A;  2XKL A;  3PED A;  4NW4 A;  3WYQ A;  1N9M A;  1T0V A;  1UYN X;  3JQO A;  4CPH B;  1VWE B;  2IZG B;  4ZHF A;  4JO6 A;  4OMW A;  1MOY A;  2X56 A;  3TZS A;  1E02 A;  5B5G A;  4GD9 A;  1QFT A;  3VHI A;  1U0X A;  2A2U A;  1Y9T A;  1X8P A;  3CBS A;  3RY1 A;  1ZNL A;  1CBR A;  3KFI A;  3N91 A;  1O1U A;  4ODD A;  1QAB E;  2HZR A;  2OFM X;  3HWE A;  4LKP A;  4YMY A;  3FYF A;  1SY0 A;  3D96 A;  1LNM A;  3RWX A;  3UEU A;  2RQ0 A;  5B10 O;  4ZH9 A;  3TGB A;  5D45 A;  2BSZ A;  1BSO A;  3UAQ A;  1D3S A;  4BJ8 A;  3WJF A;  4ZGU A;  3VE2 A;  5EDC A;  2KD2 A;  1DF3 A;  2A3F X;  3FA7 A;  1QWD A;  1DZP A;  3HK1 A;  2CBS A;  1SWT A;  5FAZ A;  1CJ5 A;  1NC9 A;  4YFR A;  1BLR A;  3CWK A;  2RCT A;  3P6H A;  2Y32 A;  4LQZ A;  3WZQ A;  1EQD A;  2AKQ A;  2FR2 A;  4RUN A;  3S60 A;  1SLE B;  2RTL A;  1CBI A;  3SLT A;  1LIF A;  2RTP B;  5B3M O;  5HZ8 A;  4R0B A;  1FDQ A;  3CQN A;  1B0O A;  2MM3 A;  3VG4 A;  5BVQ A;  1Y55 X;  2OL8 O;  2Y3F A;  1I78 A;  1SWQ A;  3CBC A;  3DSZ A;  4ML7 B;  2NND A;  2DJF A;  2QO6 A;  2RD7 C;  4PSQ A;  4D6B A;  3PH5 A;  5D4A A;  4IB9 A;  5F6B A;  4NLI A;  2L68 A;  1JZU A;  1JMZ A;  1XKI A;  1BBP A;  4TQ2 A;  1LUQ A;  2RTB B;  1STR B;  1OPA A;  4IMN A;  3RKG A;  1SWH A;  2BHV A;  3CKG A;  5HTD A;  4GNW A;  2JU7 A;  2Q4N A;  1KQX A;  1N4J A;  3U9P C;  2RTA A;  4TNN A;  4YBU A;  4YDB A;  5HZQ A;  4ORR A;  1AVG I;  4RUU A;  3O2Y A;  1CBQ A;  1LCZ A;  3NR3 A;  4Z6J A;  3F8A A;  2AMM X;  3PDF A;  2JU3 A;  3QKG A;  4D6A A;  1A57 A;  1URE A;  2FKJ A;  4ORW A;  1DZM A;  1MK5 A;  3QQ2 A;  3VG6 A;  4A60 A;  4AZQ A;  2WQ9 A;  4EQA C;  2NP1 A;  4YGG A;  1DZK A;  2R56 A;  3FEK A;  3EW1 A;  2RTO B;  3D95 A;  2JOZ A;  4O9S A;  1AEL A;  1JJU A;  3FIQ A;  1PTS A;  2LA7 A;  5F58 A;  4GGZ A;  3CMP A;  1KXO A;  4XMH A;  2G7B A;  1OSP O;  4ORY A;  2C4I A;  4YVB A;  5LJB A;  2FLJ A;  1BEB A;  2C1S A;  1GKA B;  1MDC A;  2KTS A;  4YGH A;  1VYF A;  4CPI A;  4QYN A;  1DFV A;  2Z4H A;  2LB6 A;  1X71 A;  3BDR A;  5CSE A;  2FR3 A;  1SLD B;  2I5Z O;  1NP4 A;  1SWS A;  2JU8 A;  1X8O A;  5H8T A;  4Z28 A;  2A8G A;  3WJB A;  4IB7 A;  3VG2 A;  3P6D A;  2Q2M A;  3KFF A;  3S5X A;  3FA9 A;  3SZJ A;  4OS3 A;  4IAW A;  5CYB A;  4I3C A;  2OVD A;  4WBK A;  5AJC A;  3STM X;  3GE2 A;  4O3Z A;  2KTD A;  3T1D A;  1LDO A;  3T6F A;  1SLF B;  3GAQ A;  3TGC A;  2RN4 A;  1SWJ A;  2FHL A;  4ALB A;  2OY1 O;  5LKE A;  2GTL O;  3B2J A;  1BRQ A;  3HOL A;  3WXQ A;  4A1H A;  1ALB A;  3BS2 A;  4FGI B;  5KIC A;  1BJ7 A;  3X00 A;  4Y0P A;  4BQU A;  2WQA E;  2R73 A;  3FW4 A;  4TKH A;  1E5P A;  5BYP A;  3WVM A;  5HZ9 A;  1HXZ A;  1ICN A;  5IRU A;  4MIR A;  1EPB A;  3RY2 A;  1JMX A;  2RTC B;  4AZO A;  1SY3 A;  1RLB E;  4BX6 B;  3WZO A;  2BC3 A;  1LKE A;  3MBT A;  1VWL B;  2ACP X;  2X8S A;  3AUM O;  5D47 A;  1GT4 A;  4Y0S A;  5DPQ A;  2P8G A;  1H91 A;  4IAX A;  3VHM A;  3KFG A;  1GGL A;  1G7N A;  1LIC A;  3D9W A;  4XMC A;  1DV9 A;  1ZNG A;  1SWG A;  1RXK A;  2WEX A;  4KC8 A;  1PEE A;  3WZN A;  3AEH A;  3L4R A;  4ALO A;  1MUP A;  2IZH B;  2X45 A;  2X8F A;  2C1Q A;  3BX7 A;  2OVA A;  4GDA A;  3F6Z B;  1AB0 A;  1EI5 A;  4LZV A;  3BRN A;  2HMB A;  2OF9 A;  4TKB A;  1PBY A;  5DG4 A;  2KW1 A;  2POA A;  1VWR B;  2OFR X;  1BSY A;  1ZNK A;  4CK4 A;  5HA0 A;  2CBR A;  4MVI A;  3APW A;  3DTQ A;  3EYC A;  3PEC A;  3SLJ A;  4BX7 A;  4BX5 A;  4CDC A;  1HMS A;  4CDE A;  4BCS A;  4CDD A;  3NX1 A;  4HPD A;  3SZH A;  3FW5 A;  1QG5 A;  4ORS A;  3WYP A;  3ZW0 A;  1LDQ A;  4GGT A;  4B55 A;  5AEO A;  2AT0 X;  4CPE A;  3C77 X;  1SWU A;  3PP6 A;  1LCW A;  2FWV A;  2NNQ A;  3APX A;  4JGL A;  4U8U N;  4Y0Q A;  1KL3 A;  4YCH A;  4I3B A;  2RTD B;  4C5P A;  3EBK A;  1JV4 A;  2BS5 A;  1PM1 X;  1SRJ A;  3ZI8 A;  3KZA A;  3P6C A;  4U3Q A;  2VDF A;  1N43 A;  2QMI A;  2X32 A;  4EFG A;  1CBS A;  1KT6 A;  1FTP A;  4GGR A;  4NNS A;  4NYQ A;  2RTR B;  2HNX A;  4ID2 A;  3RDQ A;  1SWA A;  3PQU A;  4GKC A;  4QZU A;  2M4L A;  1SXW A;  1DF8 A;  2MO5 A;  2AF5 A;  4YH0 A;  1JJJ A;  1VWF B;  3EC5 A;  1KL4 A;  2A5C A;  3P6G A;  4DQ3 A;  1YIV A;  2JN3 A;  1SWC A;  1VWP B;  4XMD A;  4QGW A;  2LBV A;  3NQK A;  4YFQ A;  3VU1 A;  1LFO A;  4U8U O;  3NP1 A;  3VG3 A;  2L9C A;  4AZM A;  1JYJ A;  1TOW A;  1ADL A;  1MX7 A;  2F09 A;  2RTN B;  2X4M A;  4L3R A;  2JGS A;  2AH7 X;  3RBY A;  5FEN A;  2HKD A;  1BWY A;  5LJH A;  2ZAG A;  3FA6 A;  2G78 A;  2RA6 A;  3HPE A;  4ARH A;  4BGF A;  1HN2 A;  1RXH A;  4WFV A;  1W4T A;  4NLJ A;  3EBW A;  5CHK A;  2IZA A;  4QGV A;  2QOM A;  1ERB A;  1U18 A;  2FRS A;  1VWQ B;  1SXY A;  3HOE A;  3U03 A;  1VWG B;  1MX8 A;  3VHH A;  1LIE A;  4U46 A;  1IKJ A;  1NQM A;  2BT9 A;  4N7D A;  4IMO A;  2GTF X;  1X8Q A;  2G79 A;  3KVN A;  2RTE B;  3NAD A;  3P6E A;  4O3Y A;  3ZW1 A;  5JR8 A;  1KGL A;  4KC7 A;  1MVG A;  4FBO A;  1IFB A;  4HPB A;  4I3D A;  3RDM A;  1HMT A;  4WFU A;  2OVS A;  3RDU A;  1I06 A;  1SWP A;  4GRJ A;  2A5B A;  4CV7 A;  2QO4 A;  4AZN A;  3U0D A;  3NQ3 A;  1B8E A;  3FA8 A;  1N0S A;  1QFV A;  1XCA A;  2X55 A;  1PMP A;  3B2K A;  3OBL A;  4I95 A;  5FFH A;  4AW8 A;  4LKT A;  4Y59 A;  3SLO A;  4YBP A;  5L3Y A;  2QO5 A;  1DZJ A;  4UU2 A;  4ZJ0 A;  1VWA B;  3T6L A;  3O19 A;  1G74 A;  2X46 A;  3H3I A;  2CM9 A;  1NDJ A;  3NPO A;  4MVE A;  5L8I A;  4Z27 A;  5IRW A;  1B4M A;  3CKF A;  2L5P A;  2IZC B;  1FEM A;  5JD2 A;  4OMX A;  2CAM A;  2W2B A;  4KT5 A;  3SZI A;  1VYO A;  1OBU A;  1TXL A;  2L67 A;  4DNE A;  2GTL N;  3I17 A;  5HWZ A;  3SOT A;  1K24 A;  1OEE A;  2Q39 A;  3BU9 A;  1E00 A;  5EDB A;  1SWL A;  3SAO A;  3STK A;  2IZB A;  3I0A A;  4QAE A;  1GX9 A;  3PH6 A;  3B2H A;  2IZL B;  4GU8 A;  3D4R A;  1YWC A;  1VWJ B;  1K3B A;  5IXG A;  4OEL A;  1HY2 A;  4L1N A;  1SWN A;  3BX8 A;  3P6F A;  3JSQ A;  1SY2 A;  4Z2P A;  1KQW A;  4M7M A;  1STP A;  4UU3 A;  4O4U A;  2MJI A;  5EPQ A;  4OS0 A;  1ML7 A;  4QYP A;  1PBO A;  3FDC A;  4MEE A;  3S26 A;  4O3X B;  3EW2 A;  5D8J A;  1NBX A;  1VWB B;  4ON1 A;  1KT7 A;  1Y53 X;  2DJG A;  3G7X A;  2G8C O;  1VWH B;  5F6Z A;  1FJ1 E;  5AJB A;  1KL5 A;  1LCV A;  1IFC A;  3ZUI A;  4A8Z A;  5IRA A;  4CPH A;  3EMM A;  4MVK A;  1OBP A;  2FS6 A;  1FEL A;  2YMS A;  1S7D A;  4ZR2 A;  2WWP A;  2QCB A;  3VGW A;  1SA8 A;  2A2G A;  3C76 X;  2BS6 A;  2Y3E A;  1BSQ A;  1I4U A;  4KH8 A;  1CRB A;  2OFA A;  2OL6 O;  2WR6 A;  4IBA A;  1YWB A;  4DCB A;  4EXZ A;  4YKO A;  1TVQ A;  2QM9 A;  1HQP A;  3OD9 A;  1UYO X;  2RTF B;  1HMR A;  1JYD A;  2IZF B;  3RSW A;  4GNY A;  4AYH A;  5B29 A;  2K23 A;  4ORX A;  2IZD B;  1P6P A;  2Q2P A;  3MG5 A;  2RTG B;  5H9K A;  3APU A;  1YP6 A;  3RZY A;  5HCC C;  4GH7 A;  1VPR A;  2W2F A;  2RCQ A;  1G5W A;  5FQ6 E;  2AVI A;  3MX7 A;  4GET A;  2CZU A;  4YFP A;  4I9S A;  1LF7 A;  4LZU A;  4FBR A;  4GDZ A;  4QZT A;  1WUB A;  4I60 A;  5D48 A;  2WUT A;  5H9L A;  3NBX X;  4ZH6 A;  2OF8 A;  5B11 O;  1VWC B;  1FE3 A;  4NP1 A;  3D97 A;  4AZP A;  3STN A;  5L8N A;  1SXX A;  2EU7 X;  3TF6 A;  2ACO A;  3RDX A;  4PJ2 A;  4GE1 A;  3HTY A;  4HWM A;  1ZND A;  2KT4 B;  2R74 A;  2WSJ A;  3NX2 A;  1ZNE A;  2A13 A;  4O4X A;  3PK2 A;  4OKA A;  4XMG A;  4XME A;  1MM9 A;  2UZ2 A;  3C78 X;  1VWD B;  4QNI A;  4QRL A;  3EM0 A;  1E06 A;  2QOS C;  3PPT A;  1S44 A;  5IO5 A;  3T2W A;  2X8T A;  5LJE A;  3UEV A;  3VG5 A;  4A1Y A;  3FEN A;  2OFB A;  1SRG A;  4ZFX A;  5HA1 A;  3VPJ E;  4Z2O A;  5HTE A;  5HCD C;  1BM5 A;  2IZK A;  3K3L A;  1RAV A;  2UYW A;  5L8O A;  1EUO A;  3WJE A;  1SRI A;  3KFH A;  1Z24 A;  1N9Y A;  1MEP A;  4O49 A;  2AT6 X;  1HQQ A;  2BLG A;  1ERX A;  2LKK A;  1STS B;  4YGZ A;  3VE1 A;  4Y5D A;  1EPA A;  2AL0 X;  1SWR A;  4YKM A;  2FHN X;  2MF6 A;  1EII A;  3LV4 A;  3ZUO A;  5B5F A;  1NP1 A;  2IZJ A;  2RTJ A;  3WJC A;  1JBH A;  4TLJ A;  1JJX A;  1T68 X;  1GT3 A;  1VWN B;  2OL7 A;  3O22 A;  5EED A;  4IB8 A;  1D2U A;  1RBP A;  3WJD A;  5KID A; 
#chains in the Genus database with same CATH homology
 2CM4 A;  2GJ5 A;  1S2P A;  1YWA A;  1GKA A;  1LIB A;  4ZGF A;  1T8V A;  1KT4 A;  1SY1 A;  2Q9S A;  4GK9 A;  3FR5 A;  4AZR A;  1AQB A;  1LPJ A;  2AT8 X;  2GTL M;  3BY0 A;  4COT A;  4K19 A;  3IFB A;  4YCE A;  4TJZ A;  1SMP I;  1A2D A;  1ICM A;  2ASN X;  3FR2 A;  3FMZ A;  3ZW0 B;  4BVM A;  3ELX A;  1OEJ A;  1KOI A;  3E3C A;  1QY2 A;  5F7G A;  1OEK A;  1A3Y A;  1X89 A;  3PQS A;  5HCE C;  3UEX A;  3ZQ3 A;  1KZW A;  2ANS A;  2FT9 A;  4O4O A;  1G85 A;  1QY1 A;  3ZZV A;  1OPB A;  1QY0 A;  4MVL A;  2IFB A;  5LJK A;  4Y0R A;  3AKM A;  1TOU A;  2HYS A;  4KII A;  1X8N A;  2K62 A;  3F9D A;  3BSZ E;  4ZHG A;  5F1E A;  4GZV A;  4ZCB A;  5HZ6 A;  3FLL A;  2ALL X;  2W2A A;  5HBS A;  4ORU A;  2PY1 A;  1VYG A;  3VG7 A;  1O1V A;  4HFO A;  5B27 A;  2HLV A;  3IA8 A;  4ZHC A;  4NNT A;  2YG2 A;  1L6M A;  1U17 A;  1X8U A;  5FQ8 E;  1HBQ A;  3NQ9 A;  4OS8 A;  1I05 A;  3LHN A;  4EDE A;  3S5V A;  5HZ5 A;  2AT5 X;  5LJC A;  2FTB A;  4ZHH A;  1QQS A;  3FEL A;  4DQ4 A;  1A18 A;  1IIU A;  1ACD A;  4M6S A;  3WOV A;  4INN A;  4ES7 A;  2OVE A;  3BU1 A;  1DC9 A;  2A0A A;  4MIS A;  2GC9 A;  5HAE A;  2Z4I A;  5CE4 A;  4WHI A;  4O4S A;  4FQB B;  3WBG A;  3TGA A;  3ZW1 B;  4IAB A;  5FQ7 E;  1GM6 A;  3P02 A;  3B2L A;  5H9A A;  1ZNH A;  1EAL A;  1GT1 A;  3BLG A;  1GXA A;  4CSB A;  4EEJ A;  1GT5 A;  1YUP A;  2CZT A;  2OZQ A;  3Q6L A;  1KT3 A;  3HWD A;  1ZRY A;  4I9R A;  5KHP A;  4KCA A;  3OJY C;  5LKF A;  1B56 A;  4BOE A;  2DM5 A;  4QGX A;  1R0U A;  2LFO A;  3FEP A;  4N7C A;  1I04 A;  3FR4 A;  2N93 A;  4U8U M;  5AQ6 A;  3KQ0 A;  4FBV A;  2JMB A;  3OE3 A;  4U9C A;  4HPC A;  1JIW I;  4IB6 A;  4O3W A;  2XST A;  3CR6 A;  3JS1 A;  5C0N A;  5EEE A;  3CQR A;  2HZQ A;  3AKN A;  5IO7 A;  1OBQ A;  4ZHD A;  1SXU A;  2FS7 A;  2LBA A;  2AT3 X;  1KZX A;  1EW3 A;  1UZ2 X;  3HWG A;  1EXS A;  1TW4 A;  3P24 A;  1YWD A;  1GX8 A;  2JW1 A;  5LJG A;  5BVS A;  5BVT A;  1IW2 A;  4HPA A;  2F73 A;  2NNE A;  3WJG A;  1BRP A;  3ELZ A;  2E4J A;  5IO6 A;  3APV A;  4NYR A;  1NGL A;  5H9N A;  1HBP A;  3ZW2 A;  4XMF A;  1O8V A;  2O62 A;  1Y9L A;  2MWH A;  1IKE A;  2ZAI A;  1EIO A;  3ZWE A;  1KT5 A;  2WEW A;  4TKJ A;  3HWF A;  5EZ2 A;  1FEN A;  3V8U A;  1LID A;  1YP7 A;  2MHD A;  3B2I A;  4I6S A;  5LJD A;  3MVF A;  4YDA A;  4QQ1 A;  2XKL A;  3PED A;  4NW4 A;  1T0V A;  3JQO A;  4ZHF A;  4OMW A;  3TZS A;  1E02 A;  1QFT A;  1U0X A;  2A2U A;  1Y9T A;  1X8P A;  3CBS A;  1ZNL A;  1CBR A;  3KFI A;  3N91 A;  1O1U A;  4ODD A;  1QAB E;  2HZR A;  2OFM X;  3HWE A;  4LKP A;  4YMY A;  3FYF A;  1SY0 A;  3D96 A;  1LNM A;  3RWX A;  3UEU A;  2RQ0 A;  3TGB A;  4ZH9 A;  5D45 A;  1BSO A;  3UAQ A;  1D3S A;  3WJF A;  4ZGU A;  3VE2 A;  5EDC A;  2KD2 A;  1DF3 A;  2A3F X;  3FA7 A;  1QWD A;  1DZP A;  3HK1 A;  2CBS A;  5FAZ A;  1CJ5 A;  4YFR A;  1BLR A;  3CWK A;  2RCT A;  3P6H A;  4LQZ A;  1EQD A;  2AKQ A;  2FR2 A;  4RUN A;  3S60 A;  1CBI A;  5HZ8 A;  1LIF A;  4R0B A;  1FDQ A;  3CQN A;  1B0O A;  2MM3 A;  3VG4 A;  5BVQ A;  3CBC A;  3DSZ A;  4ML7 B;  2NND A;  2QO6 A;  2RD7 C;  4PSQ A;  4D6B A;  3PH5 A;  5D4A A;  4IB9 A;  5F6B A;  4NLI A;  2L68 A;  1JZU A;  1XKI A;  1BBP A;  4TQ2 A;  1OPA A;  4IMN A;  3RKG A;  2BHV A;  5HTD A;  4GNW A;  2JU7 A;  2Q4N A;  1KQX A;  3U9P C;  4TNN A;  4YBU A;  4YDB A;  5HZQ A;  4ORR A;  1AVG I;  4RUU A;  3O2Y A;  1CBQ A;  3NR3 A;  1A57 A;  3F8A A;  2AMM X;  3QKG A;  2JU3 A;  4D6A A;  1URE A;  4ORW A;  1DZM A;  4A60 A;  3VG6 A;  4AZQ A;  2WQ9 A;  4EQA C;  2NP1 A;  4YGG A;  1DZK A;  2R56 A;  3FEK A;  3D95 A;  2JOZ A;  4O9S A;  1AEL A;  3FIQ A;  2LA7 A;  5F58 A;  3CMP A;  1KXO A;  4XMH A;  2G7B A;  4ORY A;  5LJB A;  2FLJ A;  1BEB A;  1GKA B;  1MDC A;  2KTS A;  4YGH A;  1VYF A;  4QYN A;  1DFV A;  2Z4H A;  2LB6 A;  1X71 A;  3BDR A;  2FR3 A;  1NP4 A;  5H8T A;  2JU8 A;  1X8O A;  3WJB A;  4IB7 A;  3VG2 A;  3P6D A;  2Q2M A;  3KFF A;  3S5X A;  3FA9 A;  4OS3 A;  4IAW A;  5CYB A;  4I3C A;  2OVD A;  4WBK A;  5AJC A;  3STM X;  3GE2 A;  4O3Z A;  2KTD A;  3T1D A;  3GAQ A;  2RN4 A;  4ALB A;  5LKE A;  2GTL O;  3B2J A;  1BRQ A;  3HOL A;  3WXQ A;  4A1H A;  1ALB A;  3BS2 A;  4FGI B;  5KIC A;  1BJ7 A;  4BQU A;  4Y0P A;  5BYP A;  2WQA E;  2R73 A;  3FW4 A;  4TKH A;  1E5P A;  3WVM A;  5HZ9 A;  1ICN A;  4MIR A;  1EPB A;  4AZO A;  1SY3 A;  1RLB E;  1LKE A;  3MBT A;  2ACP X;  2X8S A;  5D47 A;  1GT4 A;  4Y0S A;  5DPQ A;  2P8G A;  1H91 A;  4IAX A;  3KFG A;  1GGL A;  1G7N A;  1LIC A;  4XMC A;  1DV9 A;  1ZNG A;  2WEX A;  4KC8 A;  1PEE A;  3L4R A;  4ALO A;  1MUP A;  2X45 A;  2X8F A;  3BX7 A;  2OVA A;  3F6Z B;  1AB0 A;  1EI5 A;  4LZV A;  3BRN A;  2HMB A;  4TKB A;  5DG4 A;  2KW1 A;  2POA A;  2OFR X;  1BSY A;  1ZNK A;  4CK4 A;  5HA0 A;  2CBR A;  4MVI A;  3APW A;  3DTQ A;  3EYC A;  3PEC A;  1HMS A;  3NX1 A;  4HPD A;  3FW5 A;  1QG5 A;  4ORS A;  3ZW0 A;  5AEO A;  2AT0 X;  3C77 X;  3PP6 A;  2NNQ A;  2FWV A;  3APX A;  4JGL A;  4U8U N;  4Y0Q A;  4YCH A;  4I3B A;  3EBK A;  1JV4 A;  2BS5 A;  1PM1 X;  3ZI8 A;  3KZA A;  3P6C A;  4U3Q A;  2QMI A;  4EFG A;  1CBS A;  1KT6 A;  1FTP A;  4NNS A;  4NYQ A;  2HNX A;  4ID2 A;  3PQU A;  4GKC A;  4QZU A;  2M4L A;  1SXW A;  2MO5 A;  4YH0 A;  1JJJ A;  3P6G A;  4DQ3 A;  1YIV A;  2JN3 A;  4XMD A;  4QGW A;  2LBV A;  3NQK A;  4YFQ A;  3VU1 A;  1LFO A;  4U8U O;  3NP1 A;  3VG3 A;  2L9C A;  4AZM A;  1JYJ A;  1TOW A;  1ADL A;  1MX7 A;  2F09 A;  2AH7 X;  5FEN A;  4L3R A;  3RBY A;  1BWY A;  5LJH A;  2ZAG A;  3FA6 A;  2G78 A;  2RA6 A;  4ARH A;  1HN2 A;  4WFV A;  4NLJ A;  5K06 A;  3EBW A;  4QGV A;  3TGC A;  1ERB A;  1U18 A;  2FRS A;  1SXY A;  3HOE A;  3U03 A;  1MX8 A;  1LIE A;  1IKJ A;  2BT9 A;  4N7D A;  4IMO A;  2GTF X;  1X8Q A;  2G79 A;  3NAD A;  3P6E A;  3ZW1 A;  4O3Y A;  5JR8 A;  1KGL A;  4KC7 A;  1MVG A;  4FBO A;  1IFB A;  4HPB A;  4I3D A;  3UEW A;  1HMT A;  4WFU A;  2OVS A;  4CV7 A;  1I06 A;  4GRJ A;  2QO4 A;  4AZN A;  3U0D A;  3NQ3 A;  1B8E A;  3FA8 A;  1N0S A;  1QFV A;  1XCA A;  3B2K A;  1PMP A;  3OBL A;  4I95 A;  4AW8 A;  5FFH A;  4LKT A;  4YBP A;  2QO5 A;  1DZJ A;  4UU2 A;  4ZJ0 A;  3O19 A;  1G74 A;  2X46 A;  3H3I A;  2CM9 A;  3NPO A;  5L8I A;  4MVE A;  1B4M A;  2L5P A;  1FEM A;  4OMX A;  2W2B A;  4KT5 A;  1OBU A;  1TXL A;  2L67 A;  2GTL N;  3I17 A;  5HWZ A;  3SOT A;  1OEE A;  2Q39 A;  3BU9 A;  1E00 A;  5EDB A;  3SAO A;  3STK A;  3I0A A;  4QAE A;  1GX9 A;  3PH6 A;  3B2H A;  4GU8 A;  3D4R A;  1YWC A;  4L1N A;  3BX8 A;  3P6F A;  3JSQ A;  1SY2 A;  1KQW A;  4M7M A;  4UU3 A;  4O4U A;  2MJI A;  5EPQ A;  4OS0 A;  1ML7 A;  4QYP A;  1PBO A;  3S26 A;  4O3X B;  5D8J A;  4ON1 A;  1KT7 A;  3G7X A;  5F6Z A;  5AJB A;  1IFC A;  3ZUI A;  4A8Z A;  3EMM A;  4MVK A;  1OBP A;  2FS6 A;  1FEL A;  2YMS A;  1S7D A;  4ZR2 A;  2WWP A;  1SA8 A;  2A2G A;  3C76 X;  2BS6 A;  1BSQ A;  1I4U A;  4KH8 A;  1CRB A;  2WR6 A;  4IBA A;  1YWB A;  4EXZ A;  4YKO A;  1TVQ A;  2QM9 A;  1HQP A;  3OD9 A;  3RSW A;  1HMR A;  1JYD A;  4AYH A;  5B29 A;  4GNY A;  2K23 A;  4ORX A;  1P6P A;  2Q2P A;  5H9K A;  3APU A;  1YP6 A;  3RZY A;  5HCC C;  4GH7 A;  1VPR A;  2W2F A;  2RCQ A;  1G5W A;  5FQ6 E;  3MX7 A;  4GET A;  2CZU A;  4YFP A;  4I9S A;  1LF7 A;  4LZU A;  4FBR A;  4GDZ A;  4QZT A;  4ZH6 A;  5D48 A;  2WUT A;  5H9L A;  3NBX X;  1FE3 A;  4NP1 A;  3D97 A;  4AZP A;  3STN A;  5L8N A;  1SXX A;  2EU7 X;  3TF6 A;  2ACO A;  4PJ2 A;  4GE1 A;  3HTY A;  4HWM A;  1ZND A;  2KT4 B;  2R74 A;  2WSJ A;  3NX2 A;  1ZNE A;  2A13 A;  4O4X A;  4XMG A;  4XME A;  3C78 X;  4QNI A;  4QRL A;  3EM0 A;  1E06 A;  2QOS C;  3PPT A;  1S44 A;  5IO5 A;  2X8T A;  5LJE A;  3UEV A;  3VG5 A;  4A1Y A;  3FEN A;  4ZFX A;  5HA1 A;  3VPJ E;  5HTE A;  5HCD C;  1BM5 A;  3K3L A;  5L8O A;  1EUO A;  3WJE A;  3KFH A;  1Z24 A;  4O49 A;  2AT6 X;  2BLG A;  1ERX A;  2LKK A;  3VE1 A;  4YGZ A;  1EPA A;  2AL0 X;  4YKM A;  1EII A;  3LV4 A;  3ZUO A;  1NP1 A;  3WJC A;  1JBH A;  4TLJ A;  1JJX A;  1T68 X;  1GT3 A;  3O22 A;  5EED A;  3WJD A;  5KID A;  4IB8 A;  1D2U A;  1RBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...