3F8CA

Crystal structure of multidrug binding transcriptional regulator lmrr complexed with hoechst 33342
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
106
structure length
103
Chain Sequence
EIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDEGRRKYYRLTEIGHENMRLAFESWSRVDKIIENLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, PadR-like family
publication title Structure of the transcriptional regulator LmrR and its mechanism of multidrug recognition.
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris
molecule tags Transcription regulator
total genus 36
structure length 103
sequence length 106
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f8cA00
1FBSA 5BMZA 3QAHA 2K27A 3RKWA 5DCFA 3E5QA 2IJLA 2IT0A 3QPHA 4HQEA 4HW0A 2EFOA 2PLYA 1HSJA 3D5LA 5D6FA 1D8JA 4KIBA 1IN4A 3F8CA 5K5QA 5F64A 2G9WA 2OD5A 3GF2A 1OYIA 4M74A 1RZ4A 3RYPA 2P6TA 1XGMA 3ZMTA 1PP8F 2ZJ2A 5HDNA 1SFXA 1ON1A 4KMUX 4HQMA 1FPQA 1K7AA 1ZREA 1I1SA 3IL2A 1Z6TA 3SQNA 5HLIA 2DW4A 2ZCWA 1ZAOA 2A3SA 3FHZA 4GGGA 2KIMA 2EJRA 3L09A 3QU6A 4RB2C 1KU3A 2F5EA 3TOAA 3ZMDA 2A6HF 1LVAA 4XLPF 2JRTA 5CVVA 4KUMA 4MNUA 3RIRA 1ONVA 5ILVA 2RV8A 1B9NA 1IZ1A 4IJAA 2WTEA 3DPLC 4A0XA 4L9JA 3ML6A 1KYZA 4BH9A 3IRQA 3N97A 4BHBA 2QZ8A 5E18F 3E97A 3MZYA 3V7CA 4HLYA 1U78A 2X4HA 1R58A 4HV6A 1G3WA 3ZN0A 1U8RA 5HVQC 5A2QK 1TW2A 1T38A 5D5UB 5IT3A 3F6OA 3O2PE 3REOA 1ZGAA 3KLOA 4EJVA 5DV5A 1H0MA 1U5TC 1ODDA 2VOOA 4ASNA 5LLQA 3LAJA 3GLXA 4IPAA 3C7JA 1BI0A 5ICCA 4TV7A 3LQRA 4OU0A 1V4RA 3T8TA 3DQVC 4LG0A 1SAXA 4NB5A 1UCRA 5IT9Z 2PMUA 1R1UA 5CJ9A 1A04A 3FMQA 1BIAA 1ZHFA 3SFZA 4IRGA 5LHHA 4HYEA 4I7HA 3TKYA 4M73A 4OOIA 1I27A 4Y15A 3JAMZ 3ISPA 4HAMA 2XGXA 4M6XA 3TOBA 1MJ9A 2ESHA 2NRAC 1YW7A 3DF8A 3WTSC 1TNSA 2RNJA 2QENA 2HYFA 2E7WA 4WXDA 2J5PA 3IRRA 2OU2A 3J7AO 5HLGA 3SZTA 2V79A 1P92A 3DKWA 3IHUA 3KE2A 2QLZA 4HX8A 3M8FA 2EFWA 3BPVA 3KP2A 2A07F 2MC3A 1F5TA 3V8LA 1BJAA 1B1BA 4G9YA 3RI4A 2OAZA 3V8KA 3GFLA 5L3FA 4XSZF 5KK1A 3JSPA 4ZZLA 2YSRA 3DFGA 2FNPA 3TO9A 2XKOA 3MFKA 2QM3A 3T1BA 3MAJA 3P7NA 4LK1F 2CG4A 1XN7A 2FEZA 1OPCA 3I64A 1FNNA 1T0FA 2HTJA 2F5CA 1XSXA 5LEJA 3BY6A 4EMSA 1MZBA 2OZ6A 5L3EA 2MH9A 3B02A 2GXGA 1BBYA 3E5UA 4ZZDA 1BOAA 3LA2A 1Z6RA 1QBJA 5HDGA 1R23A 4OIPF 2A5YB 5E8IA 2HFHA 2DPUA 4YFNF 1WQ2A 4LB6B 5E20A 1FP1D 4HV5A 2XKPA 4HF2A 5HS8A 2CO5A 2DO7A 2CSOA 2V9VA 3WU0A 3I5UA 2O03A 5BPIA 3H3ZA 5E8GA 2K02A 4ENJA 2GA1A 3R0AA 2ZXJA 3AAFA 4O5VA 2DK5A 1QNTA 4ON0A 1CF7B 3HRSA 3VEPA 1XMAA 4ZYGA 4OIRF 3T0YA 2VBXA 3GFIA 4RB3C 4WCGA 5JR3A 3ZN1A 3BZ6A 3F8MA 1AWCA 1PP7U 4WX9A 3K0LA 4U0VA 4FX4A 3I71A 4LG0B 3KFWX 5FB2A 2COMA 2W84A 1S29A 3EYYA 1FZPB 4N9HA 1NHAA 2E7XA 4P5OA 5HS7A 1EH6A 2GWRA 1T39A 3ECHA 2FU4A 1ZRDA 2IPQX 1F1ZA 1UB9A 2JPCA 4PGGA 2ZO4A 2VBWA 1SD7A 3ZMSA 3KP5A 1YTYA 3TDUC 4RAYA 1SD6A 5LGUA 2EA4A 5D6EA 5AIPA 1RNLA 2W25A 2DQLA 1FX7A 3FXRA 2ISYA 5D4SA 1QO0D 4KT5C 4IVNA 3HOTA 3VOEA 2K86A 2L01A 3K69A 1FSHA 3U9GA 3WTUC 2EK5A 3IKTA 1IF1A 1YS7A 5H6RA 4JBAA 3G3ZA 4RAZA 2UXXA 4ENMA 4RGSA 3E6MA 3KETA 1XGNA 2HKXA 5LGTA 2LSOA 2NYXA 2H94A 2DPDA 1BI1A 1ZLKA 4WXHA 3HRUA 1HKTA 2BE5F 2B0LA 3KZYA 1D3YA 3M8EA 1TQMA 1HBXG 3G73A 1QZZA 1U3EM 1SMTA 3FM3A 3BP8A 1AOYA 4L5IA 3CDHA 3HSRA 4CGZA 2PQ8A 1G3TA 4U0WA 5K1YA 1WI9A 3SXYA 4YFXF 1ON2A 3QPTA 2QWWA 5ICFA 1UFMA 2ZFWA 4Y17A 1GHCA 1O3TA 2PI0A 3HYIA 3KP4A 3L00A 3LQQA 3RYRA 4MQ9F 2Y48A 3CUQB 4JQFA 1MD0A 5IT9K 2IP2A 3C3WA 1LEAA 4HA8A 1ZRFA 2C6YA 2LF7A 5E1WA 1PDNC 1O3RA 4MHGA 4L18B 2A6EF 4RGRA 3ZMZA 3TO6A 2YX7A 1IXCA 3JAMK 1UHMA 1XGOA 5LBQA 4PDKA 3L7WA 3COAC 2Z3YA 4EQQA 1FYKA 2IRFG 4EJUA 2IW5A 1CGPA 3LA7A 5F1RA 1YS6A 2XAFA 1Z1DA 1KQ8A 3GFJA 2FF4A 5ICEA 4L5JA 4ZYHA 2O0YA 2H09A 3S2WA 4IRIA 2VBYA 3FXUA 3M1EA 2WV0A 3U2RA 1JHHA 3F8FA 1BC8C 4CDGA 3TQNA 5FD5A 4RB1A 1V3FA 4HLXA 4R8HA 3R60A 2VONA 1YIOA 3BDDA 6PAXA 2RKHA 2VT2A 1KU9A 3GWZA 5H20A 1FOKA 4IRHA 3GVAA 5FLXZ 2OBPA 1O7LA 1KU7A 5LGNA 3DPTA 1T98A 2CQKA 1TQIA 1XGSA 4LLLA 2FE3A 2EA2A 2UXNA 2E1CA 2TDXA 2P5LC 4P9UA 4LLGF 1USTA 4CXFA 5AONA 2QBYB 5F6FA 4B8XA 2O61A 4KIFA 1QQIA 2A69F 1OMIA 4UNOA 1GVJA 3B73A 2BBYA 3E6CC 3HRTA 2FXAA 2G7UA 1JE8A 1CF7A 3ZMUA 4LB5A 5J8CA 2DQRA 1RIOH 5DDGA 5LRSA 4UVBA 1YFHA 1R00A 1XMKA 3K1PA 1FP2A 3WU1B 4CO8A 4EJWA 1B59A 3FM5A 4YIFA 5HOOA 2UZKA 4M9SA 3MEXA 4MTDA 4L0YB 2A68F 4F7ZA 4MQVA 4GYGA 4HBLA 5D4RA 3CLOA 5BOXA 2IA1A 3GXOA 2M30A 2NNYA 2L54A 1XDUA 1LJ9A 3HRMA 4CICA 3CUQC 3M9AA 3ABTA 2KJBA 1FYMA 2HQNA 4DNCA 5LRRA 3ZQ7A 1K78A 2YU3A 2PJPA 4QLCU 2K4JA 1FBQA 2ZNZA 5E1XA 3WGGA 2DBBA 3BOQA 3MQ0A 2EFPA 4LLNA 1KQ0A 2D2WA 2V6CA 3CJNA 1K79A 3E6BA 2Q0OA 1I5ZA 1YG2A 1KYWA 1B9MA 1KU2A 1XSVA 3QP5A 3I0TA 1ZRCA 3GUDA 2ACJA 4P55A 3SHFA 1O7FA 1ZN2A 1IN7A 2RN7A 2KKOA 4KMFA 3J80Z 3IWFA 2M45A 2OA4A 2QYOA 1G6NA 1R22A 2PBIA 4L0ZB 2FQ3A 3F3XA 2GQQA 2IVMA 5E1ZB 1FYLA 2J5OA 2BGCA 4AIHA 2D1HA 4R1HA 3I53A 5J6XA 3Q5FA 1IRGA 4IF4A 1R5GA 4UHTA 2HQRA 3R4KA 5CVJA 2RQPA 3VODA 3FX3A 3HSEA 3IKVA 4E70A 4OMZA 3GYHX 4Y13A 1S6LA 1EV7A 1WRJA 1HW1A 1L0OC 1G4DA 5CLSA 4I0AA 3BWGA 4NQWA 1SMYF 1FBUA 2W85A 2VC1A 2HS5A 4ZH4F 5KVRA 2W24A 3RKXA 1J59A 1XB4A 1Q1HA 3KEQA 4MTEA 4AVPA 4A6DA 4YG2F 1WWXA 1TTYA 1S7OA 1DUXC 1LB2A 3CUQA 5FD6A 3KLNA 1XD7A 2BEOA 5EEHA 4ETSA 4M9XA 5L3BA 4QWQA 3JTGA 4XBFA 1XCBA 4XRFA 1R36A 4OMYA 4I2OA 3NRVA 4GXOA 4ENKA 1F4KA 4G6DA 2X0LA 4PGHA 3OOPA 5ILSA 3LAPA 3H3UA 4U88A 1DP7P 4N9IA 4UV9A 2P7VB 2M8EA 1TQPA 3BJ6A 4KA4A 3O6BB 4JK1X 3R6SA 4S04A 1IN8A 2XASA 1YQAA 1DPUA 3V7SA 3KEOA 1PUEE 1XSDA 2MLKA 2KRFA 4HZFA 1G3YA 4WK8F 5FGMA 1BI2A 5JFRA 5L3DA 2MH2A 2NNNA 5D8KB 1P4AA 2STTA 2ADUA 1R1VA 2CYYA 3JTHA 3P9CA 4BNCA 1BIBA 4A2UA 1K78B 1U2WA 2Y0MA 3T8RA 4L9NA 5JVTA 3GZ5A 4KNYA 1GXQA 1TW3A 1FSEA 2LDUA 2EV6A 1RUOA 1EH7A 5FFZA 4YFKF 3BPXA 3KP3A 2QBYA 4IHSA 5E17F 1JXSA 2E1NA 5FLXK 2P5VA 1IAWA 4KN4X 1Z05A 2L3DA 4Q48A 1HKQA 3JSOA 4HX4A 2GIVA 1I1GA 2DAOA 3TDZC 4P9FA 1IXRC 5JHUA 5AIQA 1LDKB 2YPRA 3P9IA 4DQ2A 1LEBA 2XIGA 2FBIA 2VC0A 3E3VA 3K9TA 1HW2A 1IXSB 2AS5F 4ESBA 1STZA 1BM9A 4UUVA 3PFIA 4I02A 5H6QA 1RUNA 3IWZA 3I58A 4UVCA 1P6RA 2Z33A 2MLGA 2P6SA 3HHHA 1WSUA 4XSXF 5DUKA 1H9GA 3E6DA 3ZP5A 3ULQB 1HSTA 4G7ZF 2ISZA 3EUHA 3FF5A 3I59B 4G6QA 2CFXA 3FWEA 4ZYDA 3RPUA 4O6JA 2R7FA 2FMLA 3WG9A 1LNWA 3GW2A 4PZJA 1BC7C 4NHJA 2DLLA 2V1UA 1RI7A 1YLFA 5EEGA 1OR7A 4BHPA 1HQCA 4WWCA 1QPMA 3K1NA 3O3KA 2VOPA 5BS6A 3HTSB 2EV5A 4YIIA 4UV8A 2P7CB 1FC3A 4IXAA 4Z2YA 4HX7A 3C1DA 3BJOA 2L02A 4A5NA 3K2ZA 3HUGA 4KICA 4AIJA 2RC4A 1BN5A 2MD5A 4H0EA 1G3SA 5LHIA 4IHTA 3WODF 3F8BA 3J80K 3VFZA 4CZZA 4MEYF 4MEXF 3V8JA 3KZZA 3NQOA 4BXUA 2BV6A 1FY7A 2M5WA 1MJAA 3I4PA 3P9KA 3WE3A 2HEOA 3FZVA 4AIKA 2FNAA 2PG4A 4ESFA 5DCMA 4A0ZA 2ELHA 3QU3A 4GO1A 3GO5A 3FXQA 5LHGA 2FA5A 3V4GA 3TGNA 3H92A 4ZYEA 1R5HA 5TRDA 2VODA 4HDVA 4G8XA 2XROA 3GX4X 3T5XA 1IRFA 5HS9A 1O3QA 5DD4A 2EFQA 4OINF 5HDKA 4R79A 3DP7A 5FFXA 3F23A 2STWA 2DT5A 2UWMA 1Z9CA 3OV8A 3WTYC 1C0WA 4LMYA 4U0YA 3Q9VA 1TLHB 2PMHA 3WTTC 3KCCA 2XRNA 1TBXA 4HF0A 3J81K 3QRFF 1EH8A 3NEUA 4A6EA 4U7DA 2R3SA 3EETA 2HZTA 1B6AA 3PQKA 5K5OA 4BYYA 2RVCA 1ZG1A 1ZH5A 2L4MA 2ZKZA 2FRHA 4GCVA 1USSA 3W6KB 5K5RA 3C18A 2KJCA 4EVIA 3Q9SA 3HHGA 2QQAA 4I01A 4UVAA 3W6JB 1T6SA 2VT3A 2QQBA 3CO7C 1HXDA 4FT8A 4KFCA 1LDDA 4EM2A 5TJJA 4P96A 3LWFA 2VN2A 4ESJA 1JGSA 2FBHA 1W7PD 4ENNA 2JSCA 4EM0B 2FSWA 2Z5UA 3F6VA 1J0RA 3R0JA 1U6GA 3R61A 2V1DA 1YW8A 3GZ6A 1VTNC 2KIUA 1YO5C 4MGRA 2CW0F 1TNTA 2OQRA 3ERED 3MZHA 3F22A 4HF1A 5CVIA 3WTXC 4HOBA 3U1DA 3HOSA 1DDNA 1IN5A 3D0SA 5CVUA 1ULYA 2A61A 3VB2A 2RDPA 3RTRA 3F8NA 2XAQA 1OYWA 3DV8A 1D8KA 1ZGJA 2LNBA 4Q47A 3ZPLA 1J75A 4CHUA 2GXBA 3JW4A 4U7BA 3F21A 3HTUA 4L9VA 2ZMEA 4KDPA 2R7DA 2QVOA 1D5VA 1P2FA 2D1VA 2EFNA 2ESNA 3K1MA 4M9ZA 1HW5A 4XLNF 2P4WA 3WE2A 1XDSA 2O3FA 2Q8KA 3V7RA 4LJZF 1W7PA 2F5FA 2HDCA 4BAYA 3RDIA 2DI3A 1J7KA 3MWMA 3LSTA 4FX0A 4A0YA 4O3MA 1ZG3A 1UHWA 2MA3A 2CGPA 4HDUA 5L3CA 4EJOA 1Y0UA 1OKRA 4EV0A 1Z7UA 2LKPA 2Q2EA 4S05A 1MKMA 1MDMA 2IA2A 1JHFA 2XAGA 2M1BA 2HGCA 1SFUA 2AXLA 2FOKA 5DCMB 1L3LA 3I59A 4AWXB 2JPBA 2Y75A 4M6YA 2IA0A 3M7GA 5CVRA 1KQ9A 1OYYA 2QUFA 5D5XB 4LD5A 2QQ9A 2GA2A 2NAZA 3EQLF 3GFMA 3PQJA 4LGWA 1P4WA 1U5TA 4Q4ZF 2K7LA 3QOPA 2HKOA 5DUIA 2G7HA 5ERIA 1MGTA 3DEUA 3J81Z 1KGSA 2L4AA 1ZYRF 2W57A 2H6CA 2HR3A 2ETHA 2DFIA 4A12A 2KIFA 2JT1A 5A2QZ 2V1XA 3RKYA 2F5DA 2HTSA 1ZG5A 3WTZA 3LFKA 4AD9A 1IW7F 4GYIA 5J8FA 1R7JA 3EDPA 2Z99A 5ICGA 5DD8A 2FBKA 1W4MA 1S3JA 2GAUA 4EJTA 1W5TA 4LFUA 3WGIA 3L2CA 1SFEA 2XAHA 2PFBA 2YR2A 5D5WB 1BI3A 2YX4A 2WWYA 3WTVC 4B09A 1O3SA 5CYVA 4KYWA 2M87A 3FMSA 3TO7A 2EV0A 2HOEA 5JI6A 1K6OA 4OIQF 4UXNA 5BQTA 1ZARA 3IC7A 3RJPA 4G94A 5FO5A 4N0BA 2XHKA 3ECOA 4K2EA 4L9TA 4LK0F 4CYDA 3KP6A 3F72A 3N4MA 3CO6C 3WGHA 2RGVA 1J2XA 1QGPA 4PCQA 3QP6A 2FMYA 3HIFA 3ABUA 5BPDA 1FWZA 2JTVA 4I09A 1QZYA 1FT9A 3GEZA 1SD4A 3ROUA 2ZMEB 1F9NA 4BQAA 4KN7X 1YW9A 2DU9A 2P5KA 1H9TA 3HSFA 1E17A 4M72A 1HKSA 2D45A 4EM1A 1KA8A 3WTWC 2ZNYA 3ELKA 1E2XA 2JZYA 1W7PB 2OQGA 2BYVE 1W5SA 2VBZA 2HWVA 1GXPA 4Q5SF 1X3UA 1YYVA 1S7AA 1R1TA 1P4XA 1XCVA 5DYMA 3MCZA 1REPC 2O8XA 4WXCA 3KP7A 1ZLJA 4RGUA 4BHCA 2XAJA 4EGYA 2WC2A 2EB7A 3FMRA 2H6BA 5ED4A 5D8LB 3I54A 1B4AA 4RB0A 1S8NA 2DTRA 2DK8A 2PEXA 4EGZA 1MDMB 2CWEA 2LF8A 5DEQA 3RPQA 5ILUA 4D0PA 2H27A 1IN6A 1LDJA 1IUYA 2Z9OA 1T2KA 2VE9A 2OZUA 1J9IA 3CTAA 2F2EA 1SD5A 3SZPA 4RGXA 1Z91A 3ZMVA 4G7HF 1FLIA 3EYIA 3BJAA 3CUOA 4WF2A 2ZBKA 1U5TB 4I0BA 5HLHA 3E5XA 1LQ1A 1J5YA 2K4BA 2HYGD 4OIOF 2VXZA 2NS0A 2XUBA 4KIGA 2O6GE 3LA3A 4I98B 3DXJF 2XVCA 1MJBA 2XV4S 2P8TA 2GZWA 5LEKA 3BROA 2EWNA 3L9FA 1O57A 4A5MA 2VE8A 5D5VB 1I6XA 2PN6A 1WKMA 4G7OF 4M71A 5L3GA 2MBFA 1DPRA 4FHTA 4RS8A
chains in the Genus database with same CATH superfamily
1U0JA 1FBSA 5BMZA 1BJZA 2LRDA 2A05A 3QAHA 2K27A 4DYQA 4BACA 3RKWA 3OYEA 5DCFA 2R7TA 3E5QA 1X3ZB 2IJLA 2IT0A 3QPHA 2NVUB 4HQEA 2QSHX 2X6WA 4HW0A 2EFOA 5KCMA 2PLYA 1HSJA 3LOCA 3D5LA 3OIOA 3OYJA 5D6FA 2BW3B 3S1MJ 1D8JA 4KIBA 1IN4A 3F8CA 5K5QA 5F64A 3GZNB 2G9WA 5JHFA 2OD5A 3GF2A 1Y6IA 3PIPF 1OYIA 4M74A 1RZ4A 3RYPA 1Z3XA 4CYCA 2DOAA 2P6TA 4E7IA 2ZSHB 4LOCA 1XGMA 2XB0X 3ZMTA 1PP8F 1D1BA 2ZJ2A 5EJCA 5HDNA 1SFXA 1TWGJ 3GTQJ 1ON1A 1W5CC 4HQMA 4KMUX 1FPQA 2XDVA 1TWFJ 3CD6I 1K7AA 3BTJA 1ZREA 1MSFC 2ID6A 1I1SA 1W36D 3IL2A 1PUFA 2E2HJ 1Z6TA 2E5ZA 3SQNA 5HLIA 3JRDA 1JUMA 2BY0A 3P5JA 4A3EJ 2DT7B 1HF0A 4GFBA 2DW4A 1ORKA 2ZCWA 1ZAOA 3QQAA 3OYAA 3K70C 2A3SA 2ZMEC 2COBA 3FHZA 4GGGA 2KIMA 2EJRA 3L09A 4UY8I 3QU6A 4RB2C 3S17J 1KU3A 2F5EA 4XK4A 3TOAA 3ZMDA 3OYLA 2A6HF 1LVAA 1SVOA 1YE9A 2JRTA 4XLPF 5CVVA 3CP8A 4KUMA 4MNUA 1S5LC 2X6OA 3RIRA 4E7ZA 2IEKA 1ONVA 5ILVA 2RV8A 3J7ZI 4HSRA 1B9NA 1IZ1A 1TZLA 4IJAA 2L7MP 2WTEA 5J1UA 3DPLC 1ETOA 1HOMA 2Z2SB 4A0XA 2Y31A 1T08B 4RMNA 4B47A 4L9JA 3ML6A 1KYZA 1NG7A 1H88C 3LSPA 1SC7A 4BH9A 3HOYJ 3IRQA 3CCLI 1X4PA 3N97A 1X4OA 4MFDA 4BHBA 2QZ8A 5E18F 2LKSA 2MGQA 2JA2A 3E97A 3MZYA 4XNFA 5C4XJ 3V7CA 1BR1A 4HLYA 1U78A 2X4HA 4RAFA 2L9SA 2IS4A 1ZR4A 2MG4A 1VQOI 2M34A 1R58A 2HOTA 4HV6A 1EA3A 4BUPA 1SAUA 1G3WA 4G12A 3DEEA 3ZN0A 1U8RA 5HVQC 5A2QK 3OSFA 1TW2A 4XIDA 1T38A 4J00A 5D5UB 2KFDA 5IT3A 1X3WB 3F6OA 2JA5J 3O2PE 3REOA 1ZGAA 1Y1WJ 4D5CA 2BVLA 1E3OC 2XSJC 3KLOA 3BT9A 4EJVA 1X19A 4ANJA 5DV5A 1H0MA 1U5TC 2WAEA 1ODDA 2VOOA 3DLAA 4ASNA 5LLQA 2HDWA 2ZJPF 1JKPC 3LAJA 3GLXA 3CDLA 3WG7H 4IPAA 3C7JA 2KLOA 1BI0A 3QYEA 5EG0A 2MC4A 2NVYJ 5ICCA 3DTIA 4TV7A 2X85A 3OYFA 3LQRA 4OU0A 1V4RA 1WJCA 3T8TA 4XKWA 3DQVC 4LG0A 2P0WA 1SAXA 4DW6A 4NB5A 1UCRA 5IT9Z 2IGOA 2PMUA 1JGGA 2X6XA 2HU9A 1R1UA 5CJ9A 1A04A 3FMQA 3CMYA 1Z0XA 1BIAA 1ZHFA 3SFZA 4IRGA 1FEXA 5LHHA 3OY9A 1Y39A 2ELJA 3CC2I 4HYEA 4I7HA 1DGWY 4BGDA 3S2HJ 3TKYA 3LL7A 1YRNA 4M73A 4OOIA 1EF4A 2DT6A 4C3IJ 3M1CA 1I27A 4Y15A 5TISC 3DU6A 2GOMA 2X1EA 3JAMZ 1AKHB 4HNVA 5E3LA 2PJRA 3ISPA 3SEQA 2R7ZJ 4HAMA 2XGXA 5JVGF 5CQEA 1ZELA 4M6XA 5HNHA 3DTKA 3TOBA 1GV5A 1MJ9A 3A01A 1D5YA 3HOUJ 4RM3A 2OTLI 4RLQA 2ESHA 5K7FA 2NXNB 2NRAC 1YW7A 2M3AA 3DF8A 2DN0A 1V55H 1VZ0A 1D1CA 3WTSC 4CCJA 1TNSA 5JLWA 2RNJA 2QENA 2HYFA 2E7WA 4WXDA 4CCLA 1WJBA 4XONA 2J5PA 2VB6A 3IRRA 2OU2A 3J7AO 5HLGA 3SZTA 2V79A 4II3A 3ZQLA 1FIAA 1P92A 3DKWA 3S3MA 3IHUA 5B66C 3KE2A 2QLZA 4HX8A 3LSKA 3IAM2 3M8FA 2EFWA 1WI3A 4XLHA 3BPVA 5IY5H 2JA8J 3KP2A 1JJ6C 2A07F 3CQZJ 2MC3A 1F5TA 3BR0A 2OC6A 2LG4A 3GTLJ 3V8LA 4B43A 1BJAA 3M8JA 1B1BA 4ZTJA 4G9YA 2A5WA 2DFHA 3RI4A 2OAZA 3V8KA 3GFLA 5EYRA 1TWCJ 1T56A 5L3FA 5FRNA 4CYCB 4XSZF 5KK1A 2AQFA 4ZZLA 3JSPA 2YSRA 1OQYA 3BTLA 3F9KA 3KPHA 3DFGA 2FNPA 3TO9A 2L2OA 2XKOA 4W1UA 3MFKA 2QM3A 3T1BA 3MAJA 3P7NA 4LK1F 2CG4A 2GXAA 1PJRA 2OF7A 3NARA 1KZHA 1PUFB 4NC8A 1XN7A 2FEZA 1E3PA 3ZGKA 1OPCA 2K9NA 3PSFA 4E6KG 2K9QA 3I64A 4IQ4A 3I56I 1FNNA 1T0FA 1UZCA 2HTJA 2OCEA 2F5CA 4W97A 1XSXA 2QGUA 5LEJA 3V42A 3K4CA 2DDAA 1OCZH 4KJZA 3BY6A 4EMSA 1MZBA 4MO7A 2OTJI 3E7LA 2VPRA 3L2RA 2M4GA 1W1WE 2OZ6A 1XG1A 4Y4RA 2MH9A 3B02A 2GXGA 5L3EA 3ZQCA 1WJDA 1BBYA 3E5UA 4ZZDA 1BOAA 4YIRX 5EZGA 1T8IA 3LA2A 1YX5A 1Z6RA 1QBJA 5HDGA 2WB1A 1R23A 3G1LA 2A5YB 2X1DA 5E8IA 4OIPF 2HFHA 5E79C 4A69C 4YFNF 2DODA 1R71A 1WQ2A 2DPUA 4LB6B 5E20A 1FP1D 4HV5A 1LPQA 2XKPA 4HF2A 3OYCA 3DKYA 4B3XA 5HS8A 3OSGA 2CO5A 2V9VA 2CSOA 2DO7A 3WU0A 1LUJB 1V5EA 2O5RA 3I5UA 2O03A 1YHQI 4L5EA 1U9NA 5BPIA 3H3ZA 1I3QJ 3CESA 1X58A 1MBJA 5E8GA 3LSJA 5IYCJ 3H0GJ 3MKWB 3TP0A 4A3CJ 2K02A 4ENJA 2GA1A 1UELB 3PO3J 3KYDB 1OCCH 3I3LA 4EEFG 3R0AA 2ZXJA 3AAFA 1B72A 4ZYAA 4O5VA 2DK5A 1QNTA 2NOJB 2MYSA 4ON0A 2ICWG 2CW7A 1CF7B 2R92J 4FCYA 1HDPA 3TP3A 3HRSA 2E1MB 3VEPA 2DYSH 2M7AA 2QQ8A 2JA7J 5CPRB 5CQGA 1XMAA 1HDDC 3W2VA 1FOWA 4ZYGA 4OIRF 3FXJA 2VBXA 3T0YA 1FTTA 3GFIA 2CQNA 2K5CA 4C3HJ 4IHVA 3A4CA 4RB3C 2EIMH 1B8IA 4WCGA 2HQ5A 3HGYA 5JR3A 4F3QA 3ZN1A 3BZ6A 4NUBA 3F8MA 3AL0B 1YJ9I 1AWCA 1WJ5A 4A3MJ 2IS1A 5EG0B 4AUXA 1PP7U 2Y30A 5EDNA 1XPXA 5GAHJ 3J7AY 5GADJ 4WX9A 1UHSA 2BVMA 3K0LA 4U0VA 2XF7A 4FX4A 3I71A 4LG0B 2KZGA 1MIJA 4F92B 3KFWX 2BY2A 2CFOA 5FB2A 2COMA 2W84A 3SEZA 3SZGA 1S29A 2LLKA 3EYYA 3DU5A 3OS0A 2V26A 1FZPB 4N9HA 2XSDC 1NHAA 2E7XA 4P5OA 5HS7A 1EH6A 2GWRA 1WZ2A 1T39A 2WAQN 2V9KA 3ECHA 1WPKA 2FU4A 1ZRDA 2IPQX 1F1ZA 1UB9A 2JPCA 1I50J 2R7XA 4PGGA 2ZO4A 4LITA 2CRGA 2VBWA 2EH3A 1SD7A 3KP5A 4I99C 3ZMSA 1YRNB 1YTYA 3K4NA 3TDUC 4RAYA 1SD6A 3CZ6A 5LGUA 2EA4A 2PX9A 4HNUA 2PJRB 2YUSA 3K4LA 2VASA 5D6EA 5AIPA 5FLMJ 1RNLA 2W25A 4NC6A 4QPQA 2DQLA 3VYUB 3LSMA 1FX7A 3FXRA 2ISYA 5D4SA 1QO0D 1VQ4I 2CV1A 4KT5C 3A01B 1NH3A 3M07A 3HKZA 2WY7Q 3SDBA 2VXDA 4IVNA 3HOTA 3VOEA 2K86A 2M8GX 1SEUA 1MMSA 2E19A 2L01A 3FBIB 3K69A 1FSHA 2Y2ZA 3U9GA 2FQ4A 3RPUD 2EK5A 3WTUC 4AVZA 3IKTA 2VJ4A 4JX4A 1IF1A 1YS7A 1R4NB 2JSPA 3I9V2 5H6RA 3W2AA 2WB1N 4JBAA 3CCEI 3G3ZA 4RAZA 2UXXA 4ENMA 2HNHA 1ZGWA 4RGSA 3E6MA 3ZQIA 2CQQA 3KETA 2E60A 5IYDJ 1XGNA 2HKXA 5LGTA 2LSOA 2KIQA 3BG5A 2N8GA 3IAS2 2NYXA 1T95A 2NVQJ 3H35A 1V5GA 2H94A 2JVGA 1BI1A 2DPDA 1ZLKA 4WXHA 4XLAA 2K40A 3HRUA 1HKTA 2DMPA 1I39A 2BE5F 1GUUA 2B0LA 2CU7A 4XLCA 2DOEA 3KZYA 1D3YA 3L1PA 1E0EA 3M8EA 3BR3A 1E3HA 1TQMA 1HBXG 2RNGA 3G73A 1QZZA 1LKXA 1KONA 1NK2P 2R4GA 1U3EM 1SMTA 2E2IJ 1RETA 4IHYA 3FM3A 2LBFA 2B7EA 3BP8A 4V2FA 1AOYA 1MBKA 4L5IA 3CDHA 3HSRA 4CGZA 2PQ8A 3GTKJ 1G3TA 4U0WA 5K1YA 1WI9A 2FOWA 3SXYA 2LR8A 3IH2A 4RLFA 1JKRC 4YFXF 1ON2A 4B4CA 4DBRA 3BG7A 3QPTA 3DTEA 3ZR8X 1DU0A 1ETVA 4XRMA 3TMOA 4C2UA 3BR6A 1P7IA 2QWWA 1IGNA 5ICFA 1VFCA 4DOZA 1UFMA 2ZFWA 4Y17A 1GHCA 3A0HC 2TRTA 2WA0A 1RR7A 5GTIC 1O3TA 4C2MJ 4DIQA 2HYJA 1VQ8I 2VLAA 2PI0A 1UMQA 3HYIA 4C9YA 3KP4A 2W4SA 3L00A 3KYCB 3LQQA 4KISA 4V19K 3RYRA 3QYBA 4MQ9F 2Y48A 3CUQB 4FE4A 4JQFA 1MD0A 3BZKA 5IT9K 2IP2A 4NC7A 3C3WA 1JJ8C 2CUFA 1LEAA 1W36C 1F43A 4HA8A 3OYMA 1ZRFA 2BY3A 2C6YA 2E1MC 2LF7A 4N4NB 3K4BA 1RR8C 1JUPA 3W2WA 5E1WA 1PDNC 5DM6F 1O3RA 2OJED 4MHGA 4L18B 2F4MB 2A6EF 3HBLA 1FMVA 1UG2A 1YJNI 2NOGA 2G0EA 4RGRA 1A6IA 3ZMZA 3WHBA 3TO6A 2YX7A 1DGRM 1IXCA 2VQHA 3MN2A 1B72B 3JAMK 3FDYA 3DBHB 4Y3OA 1UHMA 1XGOA 1UJ8A 5LBQA 4PDKA 3L7WA 3COAC 2B63J 2Y9ZA 2KRHA 3AL0C 1MH4A 2Z3YA 1MBEA 2GBYA 5JLXA 2HVRA 4EQQA 4ZDPA 4LIVA 1FYKA 2IRFG 4BJ6C 4EJUA 4B1RA 2IW5A 2IGNA 4IQJA 1CGPA 3LA7A 1LE8A 1M1EB 1JUSA 4H4KC 3HC7A 5F1RA 1YS6A 2H8WA 2XAFA 1Z1DA 1KQ8A 2ID3A 2FF4A 3GFJA 5ICEA 3CCYA 4L5JA 2XGDA 4ZYHA 3OIQA 2O0YA 1HCRA 1B8IB 1IRXA 2H09A 4PJMA 3CCJI 2DA6A 3S2WA 2JN6A 4IRIA 1D1AA 2VBYA 3KZIC 3FXUA 3M1EA 2R5YA 2MSYA 4KITB 2Z16A 2WV0A 3U2RA 1JHHA 3F8FA 1BC8C 4E7LA 2HDDA 4CDGA 3AG3H 1UG0A 3B6CA 3TQNA 5FD5A 4BJ5C 4RB1A 1V3FA 4HLXA 4IOAF 4R8HA 5J4VA 2LD5A 3R60A 1FJLA 2VONA 1YIOA 3BDDA 6PAXA 4XN0A 1MNMC 4C30A 3ABMH 4E7KA 2RKHA 4ZDLA 2VT2A 2R7WA 1CQTA 1KU9A 3GWZA 2R7SA 2R7RA 3HPHA 5FRMA 3OYNA 1QA6A 5H20A 1FOKA 4IRHA 3AG2H 4AU7A 3GVAA 5FLXZ 1VQ5I 4BXFA 2OBPA 4D5FA 1YI2I 1O7LA 1KU7A 1EJ9A 5LGNA 3DPTA 1T98A 1Y0NA 5F27A 2CQKA 1TQIA 1XGSA 1MBGA 4LLLA 1X1DA 2FE3A 1VQNI 3ZQFA 3JREA 2VUMJ 2EA2A 4F93B 2UXNA 1F36A 2E1CA 1RPWA 1ZQ3P 2TDXA 2P5LC 3HL2A 4P9UA 3S1RJ 4LLGF 1USTA 4CXFA 5AONA 2CQ7A 2QBYB 5F6FA 1X1BA 2XB5A 1QU3A 4B8XA 2XF5A 1YJWI 2O61A 4KIFA 1QQIA 2ZB9A 4II2A 2A69F 3MKLA 4BEHA 1N75A 1IV8A 2XGEA 1OMIA 4FASD 4UNOA 2FUG2 4XKCA 1GVJA 3B73A 2BBYA 2V4JC 3E6CC 1POGA 2PMZA 3BR2A 3HRTA 2FXAA 3PNTA 3K7AJ 2G7UA 2EINH 3K2AA 1JE8A 1CF7A 3RQ4A 3ZMUA 4LB5A 2CH0A 3GTJJ 5J8CA 2DQRA 2LFBA 2V1NA 2VKDA 2I8DA 2E36A 5DDGA 2HVQA 2EZLA 5LRSA 4UVBA 2LP0A 2VQGA 1YFHA 1R00A 4CSWA 4CCOA 3S16J 1XMKA 3K1PA 1FP2A 3WU1B 4CO8A 4M3FA 4EJWA 4X0GA 3K4KA 1B59A 3FM5A 4OWRB 2DCEA 4YIFA 5HOOA 2UZKA 4M9SA 3MEXA 2LOOA 1X2NA 4X6AJ 4MTDA 1T0FC 3S14J 4GRIA 4L0YB 2A68F 4F7ZA 4MQVA 4DYCA 4GYGA 1BOBA 3IH3A 4HBLA 5D4RA 3CLOA 5BOXA 2IA1A 2LBFB 2QA4I 1FMWA 3GXOA 2M30A 3CF2A 2NNYA 2L54A 1DP3A 1H8AC 1XDUA 1LJ9A 3HRMA 3JRBA 4CICA 2NVTJ 1OFCX 3CUQC 3M9AA 3ABTA 3CJTB 3CJQB 3JRGA 2KJBA 3ZOBA 2F48A 1FYMA 2HQNA 2H8RA 1MW7A 4DNCA 1JTXA 3SJMA 5LRRA 4BE2A 1I3AA 5IOYA 3ZQ7A 1K78A 5DM7F 4XICA 2YU3A 4PJLA 4BKXA 4QLCU 2PJPA 2K4JA 1R5ID 1Z7LA 3L2UA 1FBQA 2ZNZA 5E1XA 3LNQA 3WGGA 4PFPA 2DBBA 3BOQA 2JUGA 2EFPA 3MQ0A 2CUEA 3H5RA 4LLNA 1KQ0A 1LFPA 2D2WA 2V6CA 1IDZA 3CJNA 1K79A 4DJAA 3E6BA 2Q0OA 3DLLF 2M9HA 1I5ZA 1SFKA 2OPTA 5FKOA 2MW8A 3DPUA 2DJIA 3W3CA 2HOSA 1YG2A 3VWBA 4IX7A 2LREA 1KYWA 1B9MA 1KU2A 1XSVA 1MNDA 1ZKGA 3QYFA 3BZCA 5F0FA 2KQRA 3QP5A 3HB9A 3FK7A 2LVSA 3I0TA 1ZRCA 4AIDA 4KT6A 1WH7A 3GUDA 2ACJA 4P55A 1VQMI 3VDXA 3SHFA 2CQXA 1O7FA 3JRAA 1IO2A 1FOYA 1ZN2A 2MD0A 1IN7A 2RN7A 2KKOA 4KMFA 3J80Z 3KEYA 1QVUA 3U21A 3IWFA 2R5ZA 2M45A 2OA4A 2QYOA 3J7YJ 1G6NA 5FROA 1R22A 3BR5A 2PBIA 4L0ZB 2FQ3A 2DA2A 3F3XA 3G6EI 2HPMA 2GQQA 1LE8B 5HODA 2IVMA 5DTDA 5E1ZB 4ZJZA 2LMDA 1FYLA 2XAUA 3TW7A 3S93A 2J5OA 2K3PA 2CMPA 3OIPA 3L2WA 3UR3C 2BGCA 4AIHA 2D1HA 4R1HA 3HOWJ 3I53A 5J6XA 5F1JA 3Q5FA 1IRGA 4IF4A 1R5GA 4UHTA 1HA8A 3S32A 2HQRA 3R4KA 5CVJA 3WU2C 2R5YB 2RQPA 3HM5A 3VODA 3FX3A 4AC0A 3HSEA 3IKVA 4E70A 2X6YA 4OMZA 4DGWB 1U9OA 2QKLB 1ERDA 4XLEA 3GYHX 4Y13A 1S6LA 1EV7A 1WRJA 3S3OA 1JI8A 2EZHA 1HW1A 2M0MA 1Y8RB 2DYRH 3QPSA 3Q0WA 2CUJA 3EUKL 4BDZA 5E3MA 1L0OC 1G4DA 3GTOJ 3PL8A 5CLSA 3FXOA 4I0AA 3BWGA 4NQWA 1SMYF 2IGKA 3WHCA 1FBUA 2W85A 4MIMA 2VC1A 2HS5A 4ZH4F 5KVRA 2W24A 4PUSA 3RKXA 1J59A 4ITVA 4NBQA 1XB4A 1Q1HA 3KEQA 4MTEA 3KYLA 2DOFA 2QSFX 2KP6A 1MNEA 4AVPA 4A6DA 4YG2F 4MLOA 1WWXA 1TTYA 2IGMA 3MKZA 1MSEC 3CMEI 1S7OA 1IRZA 1DUXC 3BR1A 1LB2A 1D0XA 3CUQA 2WY8Q 2BXYA 4LG3A 5FD6A 2R7OA 2ZJQF 2HI3A 3DWLE 3KLNA 2KRCA 1AHDP 2EIKH 1XD7A 2BEOA 5EEHA 4ETSA 4M9XA 5L3BA 4CH7A 4QWQA 4E7JA 3JTGA 2R0QC 4BEHB 4FTHA 1MBFA 4XBFA 1XCBA 5IYBJ 4XRFA 1R36A 3OR1C 4OMYA 1ITYA 2WAFA 1TWHJ 1Z77A 4I2OA 3NRVA 4GXOA 4ENKA 1F4KA 4DZJA 4G6DA 4XN3A 2X0LA 1Y56A 4PGHA 3OOPA 1RC9A 3LSGA 1QHGA 5ILSA 4I6ZA 3LAPA 3H3UA 4U88A 1A36A 1DP7P 2YU9J 1D0YA 5IP7J 4N9IA 4UV9A 1AU7A 2P7VB 4MFEA 2M8EA 1S9HA 2ME0A 2ZFUA 2LKXA 2AO9A 1TQPA 3BJ6A 4HRIA 4KA4A 3S15J 3O6BB 3HDDA 3AFHA 4JK1X 4P1WA 3R6SA 5GPAA 1DU6A 4S04A 1IN8A 2XASA 4M3GA 2L0KA 4FE7A 4XKVA 1YQAA 1K6YA 1DPUA 3ZXSA 3D1NI 3V7SA 2DFFA 3KEOA 3W6VA 1PUEE 1XSDA 2MLKA 2KRFA 4RBOA 4HZFA 3MMYB 1QPIA 1JKOC 5KHDA 1G3YA 1W0UA 2CUZA 4WK8F 2MFZA 1YOVB 2L7KA 4V2GA 5FGMA 1NK3P 2HZDA 1BI2A 1ETQA 5KAFC 3BC8A 5JFRA 1U8BA 5L3DA 3PNYA 2MH2A 2NNNA 5D8KB 3OYHA 3S8PA 1P4AA 2AHQA 2STTA 3N05A 2ADUA 1R1VA 1WH5A 2CYYA 2L5QA 3JTHA 5EF6A 3PIOF 2JQ7A 1X1CA 3M3YJ 3B6AA 3P9CA 3FXMA 4J01A 1IJWC 1VQKI 2Y69H 3IUOA 3TL4X 1BIBA 3UNGC 2D5VA 4BNCA 4HPQA 4A2UA 1U2WA 5B3SH 5J1YA 1K78B 2Y0MA 3T8RA 2M7BA 4L9NA 4IEJA 5JVTA 1WVRA 3GZ5A 5K7HA 4KNYA 1GXQA 1TW3A 4UUSA 1FSEA 1P7JA 2LDUA 4PJJA 4PSXA 2VKVA 2Z1DA 4M3DA 2KL4A 2L7ZA 2EV6A 3HOXJ 1RUOA 1EH7A 3H36A 5FFZA 2ZC2A 4YFKF 3BPXA 3F0CA 5M5XJ 3C2BA 3KP3A 2QBYA 1R4MB 4IHSA 3H9GA 1MMGA 3G71I 2CV0A 5F0CA 5E17F 1IG7A 1JXSA 3K4MA 2E1NA 5FLXK 4YEJA 3LSHA 2P5VA 1S7EA 1IAWA 1APLC 2KDZA 1MMAA 4KN4X 3CC4I 3ZQHA 3VSLA 3X2QH 1Z05A 2RQQA 2L3DA 4Q48A 5E3OA 1HKQA 3JSOA 4HX4A 2GIVA 4XRSG 1I1GA 4B44A 2DAOA 3TDZC 4P9FA 1IXRC 1EKEA 2DA1A 2XF6A 5AIQA 5JHUA 1QRYA 1LDKB 2YPRA 3P9IA 3VYRB 2R5ZB 2GIZA 3OOUA 5M3MJ 4JX6A 2DTZA 4FQGA 2ZXIA 3CLQA 2QKMB 1TC3C 4DQ2A 1LEBA 3G2BA 5EGOB 3OYIA 2XIGA 2FBIA 4GDFA 4C2TA 2VC0A 3Q0VA 1G2HA 3E3VA 3K9TA 1HW2A 4A3GJ 1IV6A 1IXSB 4XORA 2AS5F 1OLTA 4ESBA 2KMUA 1YX3A 1STZA 3ABKH 4BQNA 1BM9A 2FD5A 5GP9A 2DA5A 2VPLA 3VYTB 3H0DA 4UUVA 4XRSA 3PFIA 4I02A 1VQPI 5H6QA 2QEXI 1RUNA 3IWZA 3I58A 4RAGA 3H5NA 4UVCA 1P6RA 2DDBA 3RCOA 4Z6YA 3CCRI 3PFYA 2Z33A 2MLGA 2P6SA 3HHHA 1WSUA 3BTIA 4XSXF 2WBMA 5DUKA 4AYBA 1H9GA 3E6DA 3ZP5A 5BNGA 3ULQB 4ZTFA 1HSTA 1SVMA 4G7ZF 5C44J 2ISZA 3EUHA 3FF5A 2I10A 4NQWB 3G1OA 2MABA 3I59B 4A3JJ 1N25A 3PJRA 3QOEA 4G6QA 2CFXA 3FWEA 2ZSIB 4ZYDA 5LD2C 2VJ5A 3H5AA 1A6QA 2F5VA 1Y1VJ 3LFUA 4Y52J 3RPUA 4O6JA 3Q0UA 5IOZA 4UUTA 3ONQA 3OS2A 2R7FA 3O8HA 2FMLA 2VKEA 3QPLA 3BQYA 3DBRB 3WG9A 3RKQA 4IHWA 1LNWA 4QSHA 3GW2A 1BR4A 4BY7J 4A3LJ 4PZJA 2ELKA 1XTAA 1BC7C 4HG2A 4NHJA 2DLLA 2V1UA 1RI7A 2FX0A 2TCTA 1WJEA 3ZQGA 4JX5A 1YLFA 5EEGA 1OR7A 3JRIA 2LC2A 4BHPA 1HQCA 2E1OA 4A93J 4WWCA 1NG6A 2M4KA 3CP2A 1QPMA 1TWAJ 2HQAA 4D7NA 1A35A 1JT6A 3FK6A 3K1NA 4BL0B 3O3KA 1R9TJ 4BBSJ 2VOPA 5BS6A 4D9JA 1IC8A 1TL8A 3HTSB 3M4OJ 4XR6A 3NAUA 3CF5F 2KHMA 2EV5A 2W82A 4YIIA 4D7MA 4UV8A 4F91B 2P7CB 1FC3A 3JR9A 4U87A 2E2JJ 4IXAA 4Z2YA 1TT0A 4ABZA 4HX7A 3C1DA 3BJOA 2L02A 2XGCA 4QIWN 4A5NA 3BG3A 3K2ZA 3RQIA 3HUGA 3HJEA 4KICA 2V7FA 3CMMA 4AIJA 3HKZN 5LFAA 2RC4A 3CCMI 1BN5A 2MD5A 4J19A 1SFOJ 4H0EA 1ETKA 5J1RA 1BW5A 3BCBA 1HLVA 3S2DJ 1G3SA 4JYKA 5GAGJ 5LHIA 3SYTA 5GPCA 4IHTA 1R49A 1V54H 3WODF 3F8BA 5J3LA 3J80K 3VFZA 4CZZA 4MEYF 1J09A 4MEXF 3LMMA 3V8JA 3KZZA 2KT0A 3NQOA 4BXUA 2BV6A 1FY7A 2M5WA 1MJAA 3I4PA 3P9KA 3WE3A 2HEOA 3FZVA 4AIKA 2FNAA 4BU2A 2PG4A 3AG1H 1O4XA 5J4YA 2Q1ZB 2VIXA 4ESFA 3HG9A 5DCMA 4A0ZA 2R93J 4IZZA 2ELHA 3QU3A 4GO1A 3KIOA 5F08A 3GLLA 3GO5A 1GDTA 4G6TB 1NTCA 3FXQA 5LHGA 2FA5A 3V4GA 3TGNA 3H92A 4ZYEA 3C2HA 1R5HA 4RM2A 1BR2A 5TRDA 1S72I 4Y33A 2VODA 4HDVA 5F04A 4G8XA 5C3EJ 4UUSB 1QHHD 2XROA 4PK4A 3T5XA 4M3EA 3GX4X 1IRFA 2EIJH 4A3BJ 3ZQQA 5HS9A 1VF9A 1O3QA 4AYBN 1V5FA 5DD4A 1OJLA 2EFQA 3A0BC 3IP4B 4M3BA 4OINF 1MMNA 2OUMA 3L2VA 5HDKA 4R79A 1ETWA 3RSNA 1N78A 2IS6A 3DP7A 5FFXA 2ECCA 3F23A 1WFXA 4E7HA 4D1QA 2STWA 2DT5A 2H1KA 2UWMA 1Z9CA 1P9QC 4XL9A 2XPUA 2W48A 2UUZA 3OV8A 3WTYC 1C0WA 4LMYA 4U0YA 3Q9VA 3GTGJ 1TLHB 2PMHA 3WTTC 4CUGA 3TW6A 4IHXA 3K4JA 3KCCA 2XRNA 1TBXA 4HF0A 3J81K 3GTMJ 3QRFF 4IOCF 2VQLA 1EH8A 2LY2A 2VQCA 3NEUA 4A6EA 3JRCA 4U7DA 3VPRA 2R3SA 3EETA 2HZTA 1B6AA 4F55A 3PQKA 2F4IA 3H9JA 5K5OA 1Z67A 1Z3YA 1BA5A 4BYYA 3PM1A 1OCPA 1FOXA 2RVCA 3CMAI 1ZG1A 2L4MA 1ZH5A 2ZKZA 2JA6J 1ENHA 2GM4A 1X1PA 3FHNA 4PFOA 4XKBA 2FRHA 4M6VA 4GCVA 1USSA 2OCCH 2DMQA 3W6KB 4YELA 3C18A 5K5RA 2KJCA 4EVIA 3RZDJ 3MZ8A 3CDIA 2HPIA 3Q9SA 3K70D 3HHGA 2QQAA 2ZJRF 2XPVA 4I01A 4UVAA 4BJTA 1MBHA 3W6JB 1T6SA 1T33A 4B48A 2VT3A 2QQBA 1XX5A 1ACIA 2M0CA 3CO7C 3Q3SA 1MH3A 2LK2A 2X51A 1HXDA 1YITI 4FT8A 3FXLA 4KFCA 1WGXA 4ZC3A 1LDDA 4EM2A 5HNFA 5TJJA 2OV7A 4P96A 3HGGA 3L2QA 3LWFA 3S1QJ 2JJ7A 2VN2A 4ESJA 4CZCA 1JGSA 2FBHA 1W7PD 4YRVA 4ENNA 2JSCA 4EM0B 2JVHA 2FSWA 2Z5UA 2KZVA 3F6VA 1J0RA 3R0JA 1ETYA 1U6GA 3R61A 2BY1A 2H1LA 2V1DA 1RKWA 1YW8A 2A6TA 3GZ6A 1VTNC 2HXIA 2KIUA 3PSIA 2CW0F 3HZJA 4MGRA 5F0HA 1YO5C 1TNTA 2OQRA 3ERED 1WHUA 2HVSA 3MZHA 3F22A 4HF1A 1WCMJ 4IO9F 3FXKA 3DCFA 5CVIA 3WTXC 2JMWA 4HOBA 3U1DA 3DBLB 5IP6A 5TGTA 3HOSA 3BCAA 1DDNA 1IN5A 3D0SA 5CVUA 1ULYA 2A61A 3H9QA 4BE0A 3VB2A 4UB8C 3D5SC 2RDPA 5B5EC 3CCUI 3RTRA 3F8NA 4OAZA 2DXIA 4XOPA 1VI0A 2XAQA 1OYWA 3DV8A 1D8KA 1ZGJA 4BQOA 2LNBA 2QCOA 5KAIC 4Q47A 3ZPLA 2K85A 1J75A 2X48A 4X1EA 4CHUA 1G59A 1VQ9I 3JW4A 2GXBA 1PVEA 1BL0A 2DA7A 4U7BA 3BG6A 3F21A 3HTUA 2DA3A 3PO2J 2E34A 3OS1A 4L9VA 2ZMEA 2YS9A 2R7DA 3MD2A 2QVOA 4KDPA 1D5VA 1XS9A 3I55I 2CS3A 1P2FA 2D1VA 2EFNA 5IPAA 2ESNA 3K1MA 4M9ZA 1HW5A 4XLNF 2W1OA 2P4WA 3WE2A 2K9LA 1DQUA 1XDSA 2O3FA 5E3NA 2RAEA 1OCRH 4NDLA 2Q8KA 3V7RA 4LJZF 3HUGB 5EGOA 2I5UA 1W7PA 3OL3A 2F5FA 2HDCA 2VJIA 4IKFA 4BAYA 5GTHC 2ZXWH 5B1AH 3HXLA 3FBNB 3RDIA 4BXXJ 2DI3A 1RKTA 3OYGA 1J7KA 1Q1VA 2E5NA 3MWMA 5GAEJ 3LSTA 4QPOA 1H89C 4FX0A 2PMZN 4A0YA 3PUBA 2BHZA 4CCNA 1LFUP 3K10A 4O3MA 5FKNA 1RESA 1ZG3A 4A3FJ 2KPMA 2O6GE 1UHWA 2MA3A 2LH9A 3HPGA 3K6GA 1OISA 2CGPA 4HDUA 4E4HA 3H1CA 5L3CA 4EJOA 3HEFA 1Y0UA 1BW6A 3PNVA 1W0TA 3CCVI 1ZR2A 1OKRA 2VJJA 4EV0A 3S1NJ 1Z7UA 2LKPA 2Q2EA 1GV2A 1MKMA 4S05A 1MDMA 3HOVJ 2IA2A 1JHFA 2WAQA 3VSKA 2XAGA 2M1BA 3JRHA 2HGCA 2IXSA 1SFUA 2AXLA 2FOKA 5DCMB 3OL4A 1L3LA 3D5RC 3I59A 4AWXB 3IV5A 2R7UA 2O9LA 4A3KJ 9ANTA 2L7FP 4XMYA 1AA7A 2DMNA 2JPBA 2Y75A 3OR2C 3CJRB 4M6YA 1GT0C 2IA0A 3M7GA 4HEA2 1KQ9A 1OYYA 2QUFA 3MVPA 5CVRA 5D5XB 3QODA 4LD5A 3DKXA 2JK3A 2QQ9A 3E1SA 3QWLA 2GA2A 2NAZA 5M3FJ 1R6RA 2QSGX 3EQLF 3GFMA 3PQJA 4LGWA 1P4WA 1U5TA 3C2GA 4RA2A 3JRFA 4Q4ZF 2K7LA 3QOPA 1PYVA 2HKOA 5DUIA 2LY9A 2AXTC 4JP0A 4OAYA 4DBQA 2G7HA 3A2KA 4XQFA 5ERIA 1K83J 1MGTA 3DEUA 3J81Z 5KNLA 2E71A 1KGSA 2L4AA 3TBIA 1ZYRF 2W57A 2BZTA 2H6CA 5C4JJ 2IAIA 2HR3A 2V9PA 3NWTA 2ETHA 2DFIA 4XOTA 4A12A 2KIFA 3OWTA 4S0HB 1QVTA 3G1MA 3PUFA 2JT1A 3SFIA 2AQEA 5A2QZ 2R7VA 2V1XA 2GOXB 3CCQI 2BOLA 2EBIA 3RKYA 3U1KA 4BQQA 3OYKA 3O8GA 1GVDA 2F5DA 5B1BH 2HTSA 1XMXA 1ZG5A 3NWSA 2P81A 4BBRJ 3WTZA 3LFKA 4PJNA 3CCSI 3ESWB 2NS8A 4BS9A 1QZEA 2ZXHA 2EZIA 3FISA 1IW7F 4GYIA 4AD9A 5J8FA 1A31A 1R7JA 3EDPA 2O8KA 3IH4A 2CJJA 5J47A 2Z99A 3GBGA 1K4SA 5ICGA 4RDUA 5DD8A 3EUHC 3DEWA 2FBKA 4IL6C 3GCMA 4XLFA 3LSRA 1W4MA 5IP9J 1S3JA 2GAUA 4EJTA 1W5TA 2KDOA 1VQLI 2X1CA 1TP4A 4LFUA 1SANA 3WGIA 3OMYA 3ASNH 3L2CA 1SFEA 2BW3A 2XAHA 4DZPA 5FJ8J 2L9RA 2PFBA 2YR2A 4A3DJ 5EZHA 5D5WB 2EPFA 1BI3A 1FIPA 2YX4A 2WWYA 3WTVC 3OYDA 1ETXA 3AKZA 4NNJA 2ECBA 1JTYA 1X2MA 1RIOH 4B09A 1O3SA 5CYVA 4KYWA 2M87A 3FMSA 1Z21A 3TO7A 2E35A 1GLNA 1OR7C 2DFEA 4C3JJ 2EV0A 2HOEA 5JI6A 3ASOH 1K6OA 4E7SA 4OIQF 4UXNA 5BQTA 2NVXJ 3G4SI 1ZARA 5M5YJ 1G8XA 1IUFA 2Y0SA 3IC7A 3RJPA 2K3FA 4G94A 5FO5A 4N0BA 2JUCA 5FKLA 3GMEA 2XHKA 3ECOA 4K2EA 4L9TA 5M5WJ 4LK0F 2CV2A 3BTCA 4CYDA 4PJ0C 4BY1J 3KP6A 3F72A 3N4MA 3ZRGA 3CO6C 2BXZA 3WGHA 3BLYA 2RGVA 1J2XA 1QGPA 2L9VA 4PCQA 3QP6A 2FMYA 3HIFA 2JWTA 3ABUA 3S3NA 4CA0A 5BPDA 1FWZA 2W7NA 2JTVA 4I09A 1QZYA 1A5JA 1FT9A 3GEZA 1SD4A 2Y9YA 2RREA 3ROUA 4BE1A 2ZMEB 2VL8A 1Y8QB 3FKJA 5HLTA 1F9NA 2LTPA 4BQAA 4KN7X 1YW9A 2DU9A 2P5KA 4UB6C 1H9TA 3HSFA 1E17A 2IS2A 2HXOA 4M72A 4XM3A 2B9SA 1HKSA 2V6EA 2D45A 4EM1A 1KA8A 3WTWC 3OYBA 2ZNYA 2LYCA 5H2FC 3ELKA 1E2XA 4HNTA 4HSTA 4N4OB 2JZYA 1W7PB 2OQGA 1ZK8A 1MMDA 2BYVE 2VKHA 1UAAA 4CCKA 4I76A 2W00A 1W5SA 2VBZA 1FTZA 2K9MA 4A3IJ 2HWVA 2IBDA 2F6CA 1GXPA 1LVKA 4Q5SF 3LSIA 1X3UA 1YYVA 1S7AA 1R1TA 3A1YA 1WJFA 1P4XA 1SVLA 1XCVA 5DYMA 3MCZA 1XC5A 1REPC 2O8XA 4WXCA 5FKKA 3SDGA 3KP7A 1ZLJA 2CW8A 1LFBA 1VNDA 2VI6A 4RGUA 2XAJA 2R7QA 4BHCA 4DYRA 2K9SA 4BDYA 4EGYA 3GTPJ 2EILH 2EQRA 2WC2A 2EB7A 3FMRA 2BHYA 2H6BA 4EATA 5ED4A 2O7OA 4AM3A 5D8LB 4JOMA 3I54A 1B4AA 4RB0A 1S8NA 2WADA 2DTRA 2DK8A 1YIJI 3A02A 2DMTA 1ZTRA 2PEXA 2LY1A 2Q2EB 4EGZA 1MDMB 3BQZA 2CWEA 2LF8A 5DEQA 3RPQA 5ILUA 2XRLA 2X9DA 3HOZJ 4ZDOA 4D0PA 1I6HJ 2NS7A 1X1AA 2H27A 1IN6A 2WV1A 2ME6A 2L9NA 3ZCOA 1LDJA 2M2EA 1IUYA 2UV1A 2Z9OA 1T2KA 4Y7NJ 3CC7I 2VE9A 2OZUA 1J9IA 3CTAA 2F2EA 1SD5A 3SZPA 4RGXA 1Z91A 3ZMVA 3BG9A 4FETA 3KX2A 5FLVA 2QF7A 4PSWA 4G7HF 4QTRA 1FLIA 3ERMA 3EYIA 2XPWA 1IDYA 3BJAA 1K4TA 3CUOA 3A03A 2ZBKA 4WF2A 5K7ZA 1RRJA 1U5TB 3JCUC 1D0ZA 3VYSB 3ABLH 4I0BA 1WJAA 5HLHA 3E5XA 1N77A 2DJNA 3TEDA 1OCTC 1LQ1A 2JRMA 1J5YA 2K4BA 1OCOH 2HYGD 4OIOF 2DMUA 2VXZA 3MKYB 3RZOJ 2NS0A 2XUBA 4KIGA 5EEAA 3LA3A 4I98B 5CKTA 2FJ1A 5FKMA 5J40A 3DXJF 4F52A 1K61A 2GLOA 3I4MJ 2KISA 2XVCA 1MJBA 5DS9A 3EUAA 2XV4S 2P8TA 2F4OB 2GZWA 3AG4H 5LEKA 3I4NJ 1HC8A 3BROA 3FKIJ 1AKHA 2EWNA 2EZKA 3L9FA 1VQ7I 3UKGA 1O57A 1VQ6I 4A5MA 4FISA 2VE8A 5D5VB 1TT5B 1I6XA 1JKQC 2PN6A 2HOAA 2Y0SN 4LIUA 2XC7A 1WKMA 4G7OF 1JT0A 3H3VK 3E0JB 3FIWA 3EPZA 4M71A 2DA4A 4CCMA 2MBFA 5L3GA 4B3AA 1DPRA 4FHTA 4RS8A
chains in the Genus database with same CATH topology
1FBSA 5BMZA 3QAHA 2K27A 3RKWA 5DCFA 3E5QA 2IJLA 2IT0A 3QPHA 4HQEA 4HW0A 2EFOA 2PLYA 1HSJA 3D5LA 5D6FA 1D8JA 4KIBA 1IN4A 3F8CA 5K5QA 5F64A 2G9WA 2OD5A 3GF2A 1OYIA 4M74A 1RZ4A 3RYPA 2P6TA 1XGMA 3ZMTA 1PP8F 2ZJ2A 5HDNA 1SFXA 1ON1A 4KMUX 4HQMA 1FPQA 1K7AA 1ZREA 1I1SA 3IL2A 1Z6TA 3SQNA 5HLIA 2DW4A 2ZCWA 1ZAOA 2A3SA 3FHZA 4GGGA 2KIMA 2EJRA 3L09A 3QU6A 4RB2C 1KU3A 2F5EA 3TOAA 3ZMDA 2A6HF 1LVAA 4XLPF 2JRTA 5CVVA 4KUMA 4MNUA 3RIRA 1ONVA 5ILVA 2RV8A 1B9NA 1IZ1A 4IJAA 2WTEA 3DPLC 4A0XA 4L9JA 3ML6A 1KYZA 4BH9A 3IRQA 3N97A 4BHBA 2QZ8A 5E18F 3E97A 3MZYA 3V7CA 4HLYA 1U78A 2X4HA 1R58A 4HV6A 1G3WA 3ZN0A 1U8RA 5HVQC 5A2QK 1TW2A 1T38A 5D5UB 5IT3A 3F6OA 3O2PE 3REOA 1ZGAA 3KLOA 4EJVA 5DV5A 1H0MA 1U5TC 1ODDA 2VOOA 4ASNA 5LLQA 3LAJA 3GLXA 4IPAA 3C7JA 1BI0A 5ICCA 4TV7A 3LQRA 4OU0A 1V4RA 3T8TA 3DQVC 4LG0A 1SAXA 4NB5A 1UCRA 5IT9Z 2PMUA 1R1UA 5CJ9A 1A04A 3FMQA 1BIAA 1ZHFA 3SFZA 4IRGA 5LHHA 4HYEA 4I7HA 3TKYA 4M73A 4OOIA 1I27A 4Y15A 3JAMZ 3ISPA 4HAMA 2XGXA 4M6XA 3TOBA 1MJ9A 2ESHA 2NRAC 1YW7A 3DF8A 3WTSC 1TNSA 2RNJA 2QENA 2HYFA 2E7WA 4WXDA 2J5PA 3IRRA 2OU2A 3J7AO 5HLGA 3SZTA 2V79A 1P92A 3DKWA 3IHUA 3KE2A 2QLZA 4HX8A 3M8FA 2EFWA 3BPVA 3KP2A 2A07F 2MC3A 1F5TA 3V8LA 1BJAA 1B1BA 4G9YA 3RI4A 2OAZA 3V8KA 3GFLA 5L3FA 4XSZF 5KK1A 3JSPA 4ZZLA 2YSRA 3DFGA 2FNPA 3TO9A 2XKOA 3MFKA 2QM3A 3T1BA 3MAJA 3P7NA 4LK1F 2CG4A 1XN7A 2FEZA 1OPCA 3I64A 1FNNA 1T0FA 2HTJA 2F5CA 1XSXA 5LEJA 3BY6A 4EMSA 1MZBA 2OZ6A 5L3EA 2MH9A 3B02A 2GXGA 1BBYA 3E5UA 4ZZDA 1BOAA 3LA2A 1Z6RA 1QBJA 5HDGA 1R23A 4OIPF 2A5YB 5E8IA 2HFHA 2DPUA 4YFNF 1WQ2A 4LB6B 5E20A 1FP1D 4HV5A 2XKPA 4HF2A 5HS8A 2CO5A 2DO7A 2CSOA 2V9VA 3WU0A 3I5UA 2O03A 5BPIA 3H3ZA 5E8GA 2K02A 4ENJA 2GA1A 3R0AA 2ZXJA 3AAFA 4O5VA 2DK5A 1QNTA 4ON0A 1CF7B 3HRSA 3VEPA 1XMAA 4ZYGA 4OIRF 3T0YA 2VBXA 3GFIA 4RB3C 4WCGA 5JR3A 3ZN1A 3BZ6A 3F8MA 1AWCA 1PP7U 4WX9A 3K0LA 4U0VA 4FX4A 3I71A 4LG0B 3KFWX 5FB2A 2COMA 2W84A 1S29A 3EYYA 1FZPB 4N9HA 1NHAA 2E7XA 4P5OA 5HS7A 1EH6A 2GWRA 1T39A 3ECHA 2FU4A 1ZRDA 2IPQX 1F1ZA 1UB9A 2JPCA 4PGGA 2ZO4A 2VBWA 1SD7A 3ZMSA 3KP5A 1YTYA 3TDUC 4RAYA 1SD6A 5LGUA 2EA4A 5D6EA 5AIPA 1RNLA 2W25A 2DQLA 1FX7A 3FXRA 2ISYA 5D4SA 1QO0D 4KT5C 4IVNA 3HOTA 3VOEA 2K86A 2L01A 3K69A 1FSHA 3U9GA 3WTUC 2EK5A 3IKTA 1IF1A 1YS7A 5H6RA 4JBAA 3G3ZA 4RAZA 2UXXA 4ENMA 4RGSA 3E6MA 3KETA 1XGNA 2HKXA 5LGTA 2LSOA 2NYXA 2H94A 2DPDA 1BI1A 1ZLKA 4WXHA 3HRUA 1HKTA 2BE5F 2B0LA 3KZYA 1D3YA 3M8EA 1TQMA 1HBXG 3G73A 1QZZA 1U3EM 1SMTA 3FM3A 3BP8A 1AOYA 4L5IA 3CDHA 3HSRA 4CGZA 2PQ8A 1G3TA 4U0WA 5K1YA 1WI9A 3SXYA 4YFXF 1ON2A 3QPTA 2QWWA 5ICFA 1UFMA 2ZFWA 4Y17A 1GHCA 1O3TA 2PI0A 3HYIA 3KP4A 3L00A 3LQQA 3RYRA 4MQ9F 2Y48A 3CUQB 4JQFA 1MD0A 5IT9K 2IP2A 3C3WA 1LEAA 4HA8A 1ZRFA 2C6YA 2LF7A 5E1WA 1PDNC 1O3RA 4MHGA 4L18B 2A6EF 4RGRA 3ZMZA 3TO6A 2YX7A 1IXCA 3JAMK 1UHMA 1XGOA 5LBQA 4PDKA 3L7WA 3COAC 2Z3YA 4EQQA 1FYKA 2IRFG 4EJUA 2IW5A 1CGPA 3LA7A 5F1RA 1YS6A 2XAFA 1Z1DA 1KQ8A 3GFJA 2FF4A 5ICEA 4L5JA 4ZYHA 2O0YA 2H09A 3S2WA 4IRIA 2VBYA 3FXUA 3M1EA 2WV0A 3U2RA 1JHHA 3F8FA 1BC8C 4CDGA 3TQNA 5FD5A 4RB1A 1V3FA 4HLXA 4R8HA 3R60A 2VONA 1YIOA 3BDDA 6PAXA 2RKHA 2VT2A 1KU9A 3GWZA 5H20A 1FOKA 4IRHA 3GVAA 5FLXZ 2OBPA 1O7LA 1KU7A 5LGNA 3DPTA 1T98A 2CQKA 1TQIA 1XGSA 4LLLA 2FE3A 2EA2A 2UXNA 2E1CA 2TDXA 2P5LC 4P9UA 4LLGF 1USTA 4CXFA 5AONA 2QBYB 5F6FA 4B8XA 2O61A 4KIFA 1QQIA 2A69F 1OMIA 4UNOA 1GVJA 3B73A 2BBYA 3E6CC 3HRTA 2FXAA 2G7UA 1JE8A 1CF7A 3ZMUA 4LB5A 5J8CA 2DQRA 1RIOH 5DDGA 5LRSA 4UVBA 1YFHA 1R00A 1XMKA 3K1PA 1FP2A 3WU1B 4CO8A 4EJWA 1B59A 3FM5A 4YIFA 5HOOA 2UZKA 4M9SA 3MEXA 4MTDA 4L0YB 2A68F 4F7ZA 4MQVA 4GYGA 4HBLA 5D4RA 3CLOA 5BOXA 2IA1A 3GXOA 2M30A 2NNYA 2L54A 1XDUA 1LJ9A 3HRMA 4CICA 3CUQC 3M9AA 3ABTA 2KJBA 1FYMA 2HQNA 4DNCA 5LRRA 3ZQ7A 1K78A 2YU3A 2PJPA 4QLCU 2K4JA 1FBQA 2ZNZA 5E1XA 3WGGA 2DBBA 3BOQA 3MQ0A 2EFPA 4LLNA 1KQ0A 2D2WA 2V6CA 3CJNA 1K79A 3E6BA 2Q0OA 1I5ZA 1YG2A 1KYWA 1B9MA 1KU2A 1XSVA 3QP5A 3I0TA 1ZRCA 3GUDA 2ACJA 4P55A 3SHFA 1O7FA 1ZN2A 1IN7A 2RN7A 2KKOA 4KMFA 3J80Z 3IWFA 2M45A 2OA4A 2QYOA 1G6NA 1R22A 2PBIA 4L0ZB 2FQ3A 3F3XA 2GQQA 2IVMA 5E1ZB 1FYLA 2J5OA 2BGCA 4AIHA 2D1HA 4R1HA 3I53A 5J6XA 3Q5FA 1IRGA 4IF4A 1R5GA 4UHTA 2HQRA 3R4KA 5CVJA 2RQPA 3VODA 3FX3A 3HSEA 3IKVA 4E70A 4OMZA 3GYHX 4Y13A 1S6LA 1EV7A 1WRJA 1HW1A 1L0OC 1G4DA 5CLSA 4I0AA 3BWGA 4NQWA 1SMYF 1FBUA 2W85A 2VC1A 2HS5A 4ZH4F 5KVRA 2W24A 3RKXA 1J59A 1XB4A 1Q1HA 3KEQA 4MTEA 4AVPA 4A6DA 4YG2F 1WWXA 1TTYA 1S7OA 1DUXC 1LB2A 3CUQA 5FD6A 3KLNA 1XD7A 2BEOA 5EEHA 4ETSA 4M9XA 5L3BA 4QWQA 3JTGA 4XBFA 1XCBA 4XRFA 1R36A 4OMYA 4I2OA 3NRVA 4GXOA 4ENKA 1F4KA 4G6DA 2X0LA 4PGHA 3OOPA 5ILSA 3LAPA 3H3UA 4U88A 1DP7P 4N9IA 4UV9A 2P7VB 2M8EA 1TQPA 3BJ6A 4KA4A 3O6BB 4JK1X 3R6SA 4S04A 1IN8A 2XASA 1YQAA 1DPUA 3V7SA 3KEOA 1PUEE 1XSDA 2MLKA 2KRFA 4HZFA 1G3YA 4WK8F 5FGMA 1BI2A 5JFRA 5L3DA 2MH2A 2NNNA 5D8KB 1P4AA 2STTA 2ADUA 1R1VA 2CYYA 3JTHA 3P9CA 4BNCA 1BIBA 4A2UA 1K78B 1U2WA 2Y0MA 3T8RA 4L9NA 5JVTA 3GZ5A 4KNYA 1GXQA 1TW3A 1FSEA 2LDUA 2EV6A 1RUOA 1EH7A 5FFZA 4YFKF 3BPXA 3KP3A 2QBYA 4IHSA 5E17F 1JXSA 2E1NA 5FLXK 2P5VA 1IAWA 4KN4X 1Z05A 2L3DA 4Q48A 1HKQA 3JSOA 4HX4A 2GIVA 1I1GA 2DAOA 3TDZC 4P9FA 1IXRC 5JHUA 5AIQA 1LDKB 2YPRA 3P9IA 4DQ2A 1LEBA 2XIGA 2FBIA 2VC0A 3E3VA 3K9TA 1HW2A 1IXSB 2AS5F 4ESBA 1STZA 1BM9A 4UUVA 3PFIA 4I02A 5H6QA 1RUNA 3IWZA 3I58A 4UVCA 1P6RA 2Z33A 2MLGA 2P6SA 3HHHA 1WSUA 4XSXF 5DUKA 1H9GA 3E6DA 3ZP5A 3ULQB 1HSTA 4G7ZF 2ISZA 3EUHA 3FF5A 3I59B 4G6QA 2CFXA 3FWEA 4ZYDA 3RPUA 4O6JA 2R7FA 2FMLA 3WG9A 1LNWA 3GW2A 4PZJA 1BC7C 4NHJA 2DLLA 2V1UA 1RI7A 1YLFA 5EEGA 1OR7A 4BHPA 1HQCA 4WWCA 1QPMA 3K1NA 3O3KA 2VOPA 5BS6A 3HTSB 2EV5A 4YIIA 4UV8A 2P7CB 1FC3A 4IXAA 4Z2YA 4HX7A 3C1DA 3BJOA 2L02A 4A5NA 3K2ZA 3HUGA 4KICA 4AIJA 2RC4A 1BN5A 2MD5A 4H0EA 1G3SA 5LHIA 4IHTA 3WODF 3F8BA 3J80K 3VFZA 4CZZA 4MEYF 4MEXF 3V8JA 3KZZA 3NQOA 4BXUA 2BV6A 1FY7A 2M5WA 1MJAA 3I4PA 3P9KA 3WE3A 2HEOA 3FZVA 4AIKA 2FNAA 2PG4A 4ESFA 5DCMA 4A0ZA 2ELHA 3QU3A 4GO1A 3GO5A 3FXQA 5LHGA 2FA5A 3V4GA 3TGNA 3H92A 4ZYEA 1R5HA 5TRDA 2VODA 4HDVA 4G8XA 2XROA 3GX4X 3T5XA 1IRFA 5HS9A 1O3QA 5DD4A 2EFQA 4OINF 5HDKA 4R79A 3DP7A 5FFXA 3F23A 2STWA 2DT5A 2UWMA 1Z9CA 3OV8A 3WTYC 1C0WA 4LMYA 4U0YA 3Q9VA 1TLHB 2PMHA 3WTTC 3KCCA 2XRNA 1TBXA 4HF0A 3J81K 3QRFF 1EH8A 3NEUA 4A6EA 4U7DA 2R3SA 3EETA 2HZTA 1B6AA 3PQKA 5K5OA 4BYYA 2RVCA 1ZG1A 1ZH5A 2L4MA 2ZKZA 2FRHA 4GCVA 1USSA 3W6KB 5K5RA 3C18A 2KJCA 4EVIA 3Q9SA 3HHGA 2QQAA 4I01A 4UVAA 3W6JB 1T6SA 2VT3A 2QQBA 3CO7C 1HXDA 4FT8A 4KFCA 1LDDA 4EM2A 5TJJA 4P96A 3LWFA 2VN2A 4ESJA 1JGSA 2FBHA 1W7PD 4ENNA 2JSCA 4EM0B 2FSWA 2Z5UA 3F6VA 1J0RA 3R0JA 1U6GA 3R61A 2V1DA 1YW8A 3GZ6A 1VTNC 2KIUA 1YO5C 4MGRA 2CW0F 1TNTA 2OQRA 3ERED 3MZHA 3F22A 4HF1A 5CVIA 3WTXC 4HOBA 3U1DA 3HOSA 1DDNA 1IN5A 3D0SA 5CVUA 1ULYA 2A61A 3VB2A 2RDPA 3RTRA 3F8NA 2XAQA 1OYWA 3DV8A 1D8KA 1ZGJA 2LNBA 4Q47A 3ZPLA 1J75A 4CHUA 2GXBA 3JW4A 4U7BA 3F21A 3HTUA 4L9VA 2ZMEA 4KDPA 2R7DA 2QVOA 1D5VA 1P2FA 2D1VA 2EFNA 2ESNA 3K1MA 4M9ZA 1HW5A 4XLNF 2P4WA 3WE2A 1XDSA 2O3FA 2Q8KA 3V7RA 4LJZF 1W7PA 2F5FA 2HDCA 4BAYA 3RDIA 2DI3A 1J7KA 3MWMA 3LSTA 4FX0A 4A0YA 4O3MA 1ZG3A 1UHWA 2MA3A 2CGPA 4HDUA 5L3CA 4EJOA 1Y0UA 1OKRA 4EV0A 1Z7UA 2LKPA 2Q2EA 4S05A 1MKMA 1MDMA 2IA2A 1JHFA 2XAGA 2M1BA 2HGCA 1SFUA 2AXLA 2FOKA 5DCMB 1L3LA 3I59A 4AWXB 2JPBA 2Y75A 4M6YA 2IA0A 3M7GA 5CVRA 1KQ9A 1OYYA 2QUFA 5D5XB 4LD5A 2QQ9A 2GA2A 2NAZA 3EQLF 3GFMA 3PQJA 4LGWA 1P4WA 1U5TA 4Q4ZF 2K7LA 3QOPA 2HKOA 5DUIA 2G7HA 5ERIA 1MGTA 3DEUA 3J81Z 1KGSA 2L4AA 1ZYRF 2W57A 2H6CA 2HR3A 2ETHA 2DFIA 4A12A 2KIFA 2JT1A 5A2QZ 2V1XA 3RKYA 2F5DA 2HTSA 1ZG5A 3WTZA 3LFKA 4AD9A 1IW7F 4GYIA 5J8FA 1R7JA 3EDPA 2Z99A 5ICGA 5DD8A 2FBKA 1W4MA 1S3JA 2GAUA 4EJTA 1W5TA 4LFUA 3WGIA 3L2CA 1SFEA 2XAHA 2PFBA 2YR2A 5D5WB 1BI3A 2YX4A 2WWYA 3WTVC 4B09A 1O3SA 5CYVA 4KYWA 2M87A 3FMSA 3TO7A 2EV0A 2HOEA 5JI6A 1K6OA 4OIQF 4UXNA 5BQTA 1ZARA 3IC7A 3RJPA 4G94A 5FO5A 4N0BA 2XHKA 3ECOA 4K2EA 4L9TA 4LK0F 4CYDA 3KP6A 3F72A 3N4MA 3CO6C 3WGHA 2RGVA 1J2XA 1QGPA 4PCQA 3QP6A 2FMYA 3HIFA 3ABUA 5BPDA 1FWZA 2JTVA 4I09A 1QZYA 1FT9A 3GEZA 1SD4A 3ROUA 2ZMEB 1F9NA 4BQAA 4KN7X 1YW9A 2DU9A 2P5KA 1H9TA 3HSFA 1E17A 4M72A 1HKSA 2D45A 4EM1A 1KA8A 3WTWC 2ZNYA 3ELKA 1E2XA 2JZYA 1W7PB 2OQGA 2BYVE 1W5SA 2VBZA 2HWVA 1GXPA 4Q5SF 1X3UA 1YYVA 1S7AA 1R1TA 1P4XA 1XCVA 5DYMA 3MCZA 1REPC 2O8XA 4WXCA 3KP7A 1ZLJA 4RGUA 4BHCA 2XAJA 4EGYA 2WC2A 2EB7A 3FMRA 2H6BA 5ED4A 5D8LB 3I54A 1B4AA 4RB0A 1S8NA 2DTRA 2DK8A 2PEXA 4EGZA 1MDMB 2CWEA 2LF8A 5DEQA 3RPQA 5ILUA 4D0PA 2H27A 1IN6A 1LDJA 1IUYA 2Z9OA 1T2KA 2VE9A 2OZUA 1J9IA 3CTAA 2F2EA 1SD5A 3SZPA 4RGXA 1Z91A 3ZMVA 4G7HF 1FLIA 3EYIA 3BJAA 3CUOA 4WF2A 2ZBKA 1U5TB 4I0BA 5HLHA 3E5XA 1LQ1A 1J5YA 2K4BA 2HYGD 4OIOF 2VXZA 2NS0A 2XUBA 4KIGA 2O6GE 3LA3A 4I98B 3DXJF 2XVCA 1MJBA 2XV4S 2P8TA 2GZWA 5LEKA 3BROA 2EWNA 3L9FA 1O57A 4A5MA 2VE8A 5D5VB 1I6XA 2PN6A 1WKMA 4G7OF 4M71A 5L3GA 2MBFA 1DPRA 4FHTA 4RS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBS A;  5BMZ A;  3QAH A;  2K27 A;  3RKW A;  5DCF A;  3E5Q A;  2IJL A;  2IT0 A;  3QPH A;  4HQE A;  4HW0 A;  2EFO A;  2PLY A;  1HSJ A;  3D5L A;  5D6F A;  1D8J A;  4KIB A;  1IN4 A;  3F8C A;  5K5Q A;  5F64 A;  2G9W A;  2OD5 A;  3GF2 A;  1OYI A;  4M74 A;  1RZ4 A;  3RYP A;  2P6T A;  1XGM A;  3ZMT A;  1PP8 F;  2ZJ2 A;  5HDN A;  1SFX A;  1ON1 A;  4KMU X;  4HQM A;  1FPQ A;  1K7A A;  1ZRE A;  1I1S A;  3IL2 A;  1Z6T A;  3SQN A;  5HLI A;  2DW4 A;  2ZCW A;  1ZAO A;  2A3S A;  3FHZ A;  4GGG A;  2KIM A;  2EJR A;  3L09 A;  3QU6 A;  4RB2 C;  1KU3 A;  2F5E A;  3TOA A;  3ZMD A;  2A6H F;  1LVA A;  4XLP F;  2JRT A;  5CVV A;  4KUM A;  4MNU A;  3RIR A;  1ONV A;  5ILV A;  2RV8 A;  1B9N A;  1IZ1 A;  4IJA A;  2WTE A;  3DPL C;  4A0X A;  4L9J A;  3ML6 A;  1KYZ A;  4BH9 A;  3IRQ A;  3N97 A;  4BHB A;  2QZ8 A;  5E18 F;  3E97 A;  3MZY A;  3V7C A;  4HLY A;  1U78 A;  2X4H A;  1R58 A;  4HV6 A;  1G3W A;  3ZN0 A;  1U8R A;  5HVQ C;  5A2Q K;  1TW2 A;  1T38 A;  5D5U B;  5IT3 A;  3F6O A;  3O2P E;  3REO A;  1ZGA A;  3KLO A;  4EJV A;  5DV5 A;  1H0M A;  1U5T C;  1ODD A;  2VOO A;  4ASN A;  5LLQ A;  3LAJ A;  3GLX A;  4IPA A;  3C7J A;  1BI0 A;  5ICC A;  4TV7 A;  3LQR A;  4OU0 A;  1V4R A;  3T8T A;  3DQV C;  4LG0 A;  1SAX A;  4NB5 A;  1UCR A;  5IT9 Z;  2PMU A;  1R1U A;  5CJ9 A;  1A04 A;  3FMQ A;  1BIA A;  1ZHF A;  3SFZ A;  4IRG A;  5LHH A;  4HYE A;  4I7H A;  3TKY A;  4M73 A;  4OOI A;  1I27 A;  4Y15 A;  3JAM Z;  3ISP A;  4HAM A;  2XGX A;  4M6X A;  3TOB A;  1MJ9 A;  2ESH A;  2NRA C;  1YW7 A;  3DF8 A;  3WTS C;  1TNS A;  2RNJ A;  2QEN A;  2HYF A;  2E7W A;  4WXD A;  2J5P A;  3IRR A;  2OU2 A;  3J7A O;  5HLG A;  3SZT A;  2V79 A;  1P92 A;  3DKW A;  3IHU A;  3KE2 A;  2QLZ A;  4HX8 A;  3M8F A;  2EFW A;  3BPV A;  3KP2 A;  2A07 F;  2MC3 A;  1F5T A;  3V8L A;  1BJA A;  1B1B A;  4G9Y A;  3RI4 A;  2OAZ A;  3V8K A;  3GFL A;  5L3F A;  4XSZ F;  5KK1 A;  3JSP A;  4ZZL A;  2YSR A;  3DFG A;  2FNP A;  3TO9 A;  2XKO A;  3MFK A;  2QM3 A;  3T1B A;  3MAJ A;  3P7N A;  4LK1 F;  2CG4 A;  1XN7 A;  2FEZ A;  1OPC A;  3I64 A;  1FNN A;  1T0F A;  2HTJ A;  2F5C A;  1XSX A;  5LEJ A;  3BY6 A;  4EMS A;  1MZB A;  2OZ6 A;  5L3E A;  2MH9 A;  3B02 A;  2GXG A;  1BBY A;  3E5U A;  4ZZD A;  1BOA A;  3LA2 A;  1Z6R A;  1QBJ A;  5HDG A;  1R23 A;  4OIP F;  2A5Y B;  5E8I A;  2HFH A;  2DPU A;  4YFN F;  1WQ2 A;  4LB6 B;  5E20 A;  1FP1 D;  4HV5 A;  2XKP A;  4HF2 A;  5HS8 A;  2CO5 A;  2DO7 A;  2CSO A;  2V9V A;  3WU0 A;  3I5U A;  2O03 A;  5BPI A;  3H3Z A;  5E8G A;  2K02 A;  4ENJ A;  2GA1 A;  3R0A A;  2ZXJ A;  3AAF A;  4O5V A;  2DK5 A;  1QNT A;  4ON0 A;  1CF7 B;  3HRS A;  3VEP A;  1XMA A;  4ZYG A;  4OIR F;  3T0Y A;  2VBX A;  3GFI A;  4RB3 C;  4WCG A;  5JR3 A;  3ZN1 A;  3BZ6 A;  3F8M A;  1AWC A;  1PP7 U;  4WX9 A;  3K0L A;  4U0V A;  4FX4 A;  3I71 A;  4LG0 B;  3KFW X;  5FB2 A;  2COM A;  2W84 A;  1S29 A;  3EYY A;  1FZP B;  4N9H A;  1NHA A;  2E7X A;  4P5O A;  5HS7 A;  1EH6 A;  2GWR A;  1T39 A;  3ECH A;  2FU4 A;  1ZRD A;  2IPQ X;  1F1Z A;  1UB9 A;  2JPC A;  4PGG A;  2ZO4 A;  2VBW A;  1SD7 A;  3ZMS A;  3KP5 A;  1YTY A;  3TDU C;  4RAY A;  1SD6 A;  5LGU A;  2EA4 A;  5D6E A;  5AIP A;  1RNL A;  2W25 A;  2DQL A;  1FX7 A;  3FXR A;  2ISY A;  5D4S A;  1QO0 D;  4KT5 C;  4IVN A;  3HOT A;  3VOE A;  2K86 A;  2L01 A;  3K69 A;  1FSH A;  3U9G A;  3WTU C;  2EK5 A;  3IKT A;  1IF1 A;  1YS7 A;  5H6R A;  4JBA A;  3G3Z A;  4RAZ A;  2UXX A;  4ENM A;  4RGS A;  3E6M A;  3KET A;  1XGN A;  2HKX A;  5LGT A;  2LSO A;  2NYX A;  2H94 A;  2DPD A;  1BI1 A;  1ZLK A;  4WXH A;  3HRU A;  1HKT A;  2BE5 F;  2B0L A;  3KZY A;  1D3Y A;  3M8E A;  1TQM A;  1HBX G;  3G73 A;  1QZZ A;  1U3E M;  1SMT A;  3FM3 A;  3BP8 A;  1AOY A;  4L5I A;  3CDH A;  3HSR A;  4CGZ A;  2PQ8 A;  1G3T A;  4U0W A;  5K1Y A;  1WI9 A;  3SXY A;  4YFX F;  1ON2 A;  3QPT A;  2QWW A;  5ICF A;  1UFM A;  2ZFW A;  4Y17 A;  1GHC A;  1O3T A;  2PI0 A;  3HYI A;  3KP4 A;  3L00 A;  3LQQ A;  3RYR A;  4MQ9 F;  2Y48 A;  3CUQ B;  4JQF A;  1MD0 A;  5IT9 K;  2IP2 A;  3C3W A;  1LEA A;  4HA8 A;  1ZRF A;  2C6Y A;  2LF7 A;  5E1W A;  1PDN C;  1O3R A;  4MHG A;  4L18 B;  2A6E F;  4RGR A;  3ZMZ A;  3TO6 A;  2YX7 A;  1IXC A;  3JAM K;  1UHM A;  1XGO A;  5LBQ A;  4PDK A;  3L7W A;  3COA C;  2Z3Y A;  4EQQ A;  1FYK A;  2IRF G;  4EJU A;  2IW5 A;  1CGP A;  3LA7 A;  5F1R A;  1YS6 A;  2XAF A;  1Z1D A;  1KQ8 A;  3GFJ A;  2FF4 A;  5ICE A;  4L5J A;  4ZYH A;  2O0Y A;  2H09 A;  3S2W A;  4IRI A;  2VBY A;  3FXU A;  3M1E A;  2WV0 A;  3U2R A;  1JHH A;  3F8F A;  1BC8 C;  4CDG A;  3TQN A;  5FD5 A;  4RB1 A;  1V3F A;  4HLX A;  4R8H A;  3R60 A;  2VON A;  1YIO A;  3BDD A;  6PAX A;  2RKH A;  2VT2 A;  1KU9 A;  3GWZ A;  5H20 A;  1FOK A;  4IRH A;  3GVA A;  5FLX Z;  2OBP A;  1O7L A;  1KU7 A;  5LGN A;  3DPT A;  1T98 A;  2CQK A;  1TQI A;  1XGS A;  4LLL A;  2FE3 A;  2EA2 A;  2UXN A;  2E1C A;  2TDX A;  2P5L C;  4P9U A;  4LLG F;  1UST A;  4CXF A;  5AON A;  2QBY B;  5F6F A;  4B8X A;  2O61 A;  4KIF A;  1QQI A;  2A69 F;  1OMI A;  4UNO A;  1GVJ A;  3B73 A;  2BBY A;  3E6C C;  3HRT A;  2FXA A;  2G7U A;  1JE8 A;  1CF7 A;  3ZMU A;  4LB5 A;  5J8C A;  2DQR A;  1RIO H;  5DDG A;  5LRS A;  4UVB A;  1YFH A;  1R00 A;  1XMK A;  3K1P A;  1FP2 A;  3WU1 B;  4CO8 A;  4EJW A;  1B59 A;  3FM5 A;  4YIF A;  5HOO A;  2UZK A;  4M9S A;  3MEX A;  4MTD A;  4L0Y B;  2A68 F;  4F7Z A;  4MQV A;  4GYG A;  4HBL A;  5D4R A;  3CLO A;  5BOX A;  2IA1 A;  3GXO A;  2M30 A;  2NNY A;  2L54 A;  1XDU A;  1LJ9 A;  3HRM A;  4CIC A;  3CUQ C;  3M9A A;  3ABT A;  2KJB A;  1FYM A;  2HQN A;  4DNC A;  5LRR A;  3ZQ7 A;  1K78 A;  2YU3 A;  2PJP A;  4QLC U;  2K4J A;  1FBQ A;  2ZNZ A;  5E1X A;  3WGG A;  2DBB A;  3BOQ A;  3MQ0 A;  2EFP A;  4LLN A;  1KQ0 A;  2D2W A;  2V6C A;  3CJN A;  1K79 A;  3E6B A;  2Q0O A;  1I5Z A;  1YG2 A;  1KYW A;  1B9M A;  1KU2 A;  1XSV A;  3QP5 A;  3I0T A;  1ZRC A;  3GUD A;  2ACJ A;  4P55 A;  3SHF A;  1O7F A;  1ZN2 A;  1IN7 A;  2RN7 A;  2KKO A;  4KMF A;  3J80 Z;  3IWF A;  2M45 A;  2OA4 A;  2QYO A;  1G6N A;  1R22 A;  2PBI A;  4L0Z B;  2FQ3 A;  3F3X A;  2GQQ A;  2IVM A;  5E1Z B;  1FYL A;  2J5O A;  2BGC A;  4AIH A;  2D1H A;  4R1H A;  3I53 A;  5J6X A;  3Q5F A;  1IRG A;  4IF4 A;  1R5G A;  4UHT A;  2HQR A;  3R4K A;  5CVJ A;  2RQP A;  3VOD A;  3FX3 A;  3HSE A;  3IKV A;  4E70 A;  4OMZ A;  3GYH X;  4Y13 A;  1S6L A;  1EV7 A;  1WRJ A;  1HW1 A;  1L0O C;  1G4D A;  5CLS A;  4I0A A;  3BWG A;  4NQW A;  1SMY F;  1FBU A;  2W85 A;  2VC1 A;  2HS5 A;  4ZH4 F;  5KVR A;  2W24 A;  3RKX A;  1J59 A;  1XB4 A;  1Q1H A;  3KEQ A;  4MTE A;  4AVP A;  4A6D A;  4YG2 F;  1WWX A;  1TTY A;  1S7O A;  1DUX C;  1LB2 A;  3CUQ A;  5FD6 A;  3KLN A;  1XD7 A;  2BEO A;  5EEH A;  4ETS A;  4M9X A;  5L3B A;  4QWQ A;  3JTG A;  4XBF A;  1XCB A;  4XRF A;  1R36 A;  4OMY A;  4I2O A;  3NRV A;  4GXO A;  4ENK A;  1F4K A;  4G6D A;  2X0L A;  4PGH A;  3OOP A;  5ILS A;  3LAP A;  3H3U A;  4U88 A;  1DP7 P;  4N9I A;  4UV9 A;  2P7V B;  2M8E A;  1TQP A;  3BJ6 A;  4KA4 A;  3O6B B;  4JK1 X;  3R6S A;  4S04 A;  1IN8 A;  2XAS A;  1YQA A;  1DPU A;  3V7S A;  3KEO A;  1PUE E;  1XSD A;  2MLK A;  2KRF A;  4HZF A;  1G3Y A;  4WK8 F;  5FGM A;  1BI2 A;  5JFR A;  5L3D A;  2MH2 A;  2NNN A;  5D8K B;  1P4A A;  2STT A;  2ADU A;  1R1V A;  2CYY A;  3JTH A;  3P9C A;  4BNC A;  1BIB A;  4A2U A;  1K78 B;  1U2W A;  2Y0M A;  3T8R A;  4L9N A;  5JVT A;  3GZ5 A;  4KNY A;  1GXQ A;  1TW3 A;  1FSE A;  2LDU A;  2EV6 A;  1RUO A;  1EH7 A;  5FFZ A;  4YFK F;  3BPX A;  3KP3 A;  2QBY A;  4IHS A;  5E17 F;  1JXS A;  2E1N A;  5FLX K;  2P5V A;  1IAW A;  4KN4 X;  1Z05 A;  2L3D A;  4Q48 A;  1HKQ A;  3JSO A;  4HX4 A;  2GIV A;  1I1G A;  2DAO A;  3TDZ C;  4P9F A;  1IXR C;  5JHU A;  5AIQ A;  1LDK B;  2YPR A;  3P9I A;  4DQ2 A;  1LEB A;  2XIG A;  2FBI A;  2VC0 A;  3E3V A;  3K9T A;  1HW2 A;  1IXS B;  2AS5 F;  4ESB A;  1STZ A;  1BM9 A;  4UUV A;  3PFI A;  4I02 A;  5H6Q A;  1RUN A;  3IWZ A;  3I58 A;  4UVC A;  1P6R A;  2Z33 A;  2MLG A;  2P6S A;  3HHH A;  1WSU A;  4XSX F;  5DUK A;  1H9G A;  3E6D A;  3ZP5 A;  3ULQ B;  1HST A;  4G7Z F;  2ISZ A;  3EUH A;  3FF5 A;  3I59 B;  4G6Q A;  2CFX A;  3FWE A;  4ZYD A;  3RPU A;  4O6J A;  2R7F A;  2FML A;  3WG9 A;  1LNW A;  3GW2 A;  4PZJ A;  1BC7 C;  4NHJ A;  2DLL A;  2V1U A;  1RI7 A;  1YLF A;  5EEG A;  1OR7 A;  4BHP A;  1HQC A;  4WWC A;  1QPM A;  3K1N A;  3O3K A;  2VOP A;  5BS6 A;  3HTS B;  2EV5 A;  4YII A;  4UV8 A;  2P7C B;  1FC3 A;  4IXA A;  4Z2Y A;  4HX7 A;  3C1D A;  3BJO A;  2L02 A;  4A5N A;  3K2Z A;  3HUG A;  4KIC A;  4AIJ A;  2RC4 A;  1BN5 A;  2MD5 A;  4H0E A;  1G3S A;  5LHI A;  4IHT A;  3WOD F;  3F8B A;  3J80 K;  3VFZ A;  4CZZ A;  4MEY F;  4MEX F;  3V8J A;  3KZZ A;  3NQO A;  4BXU A;  2BV6 A;  1FY7 A;  2M5W A;  1MJA A;  3I4P A;  3P9K A;  3WE3 A;  2HEO A;  3FZV A;  4AIK A;  2FNA A;  2PG4 A;  4ESF A;  5DCM A;  4A0Z A;  2ELH A;  3QU3 A;  4GO1 A;  3GO5 A;  3FXQ A;  5LHG A;  2FA5 A;  3V4G A;  3TGN A;  3H92 A;  4ZYE A;  1R5H A;  5TRD A;  2VOD A;  4HDV A;  4G8X A;  2XRO A;  3GX4 X;  3T5X A;  1IRF A;  5HS9 A;  1O3Q A;  5DD4 A;  2EFQ A;  4OIN F;  5HDK A;  4R79 A;  3DP7 A;  5FFX A;  3F23 A;  2STW A;  2DT5 A;  2UWM A;  1Z9C A;  3OV8 A;  3WTY C;  1C0W A;  4LMY A;  4U0Y A;  3Q9V A;  1TLH B;  2PMH A;  3WTT C;  3KCC A;  2XRN A;  1TBX A;  4HF0 A;  3J81 K;  3QRF F;  1EH8 A;  3NEU A;  4A6E A;  4U7D A;  2R3S A;  3EET A;  2HZT A;  1B6A A;  3PQK A;  5K5O A;  4BYY A;  2RVC A;  1ZG1 A;  1ZH5 A;  2L4M A;  2ZKZ A;  2FRH A;  4GCV A;  1USS A;  3W6K B;  5K5R A;  3C18 A;  2KJC A;  4EVI A;  3Q9S A;  3HHG A;  2QQA A;  4I01 A;  4UVA A;  3W6J B;  1T6S A;  2VT3 A;  2QQB A;  3CO7 C;  1HXD A;  4FT8 A;  4KFC A;  1LDD A;  4EM2 A;  5TJJ A;  4P96 A;  3LWF A;  2VN2 A;  4ESJ A;  1JGS A;  2FBH A;  1W7P D;  4ENN A;  2JSC A;  4EM0 B;  2FSW A;  2Z5U A;  3F6V A;  1J0R A;  3R0J A;  1U6G A;  3R61 A;  2V1D A;  1YW8 A;  3GZ6 A;  1VTN C;  2KIU A;  1YO5 C;  4MGR A;  2CW0 F;  1TNT A;  2OQR A;  3ERE D;  3MZH A;  3F22 A;  4HF1 A;  5CVI A;  3WTX C;  4HOB A;  3U1D A;  3HOS A;  1DDN A;  1IN5 A;  3D0S A;  5CVU A;  1ULY A;  2A61 A;  3VB2 A;  2RDP A;  3RTR A;  3F8N A;  2XAQ A;  1OYW A;  3DV8 A;  1D8K A;  1ZGJ A;  2LNB A;  4Q47 A;  3ZPL A;  1J75 A;  4CHU A;  2GXB A;  3JW4 A;  4U7B A;  3F21 A;  3HTU A;  4L9V A;  2ZME A;  4KDP A;  2R7D A;  2QVO A;  1D5V A;  1P2F A;  2D1V A;  2EFN A;  2ESN A;  3K1M A;  4M9Z A;  1HW5 A;  4XLN F;  2P4W A;  3WE2 A;  1XDS A;  2O3F A;  2Q8K A;  3V7R A;  4LJZ F;  1W7P A;  2F5F A;  2HDC A;  4BAY A;  3RDI A;  2DI3 A;  1J7K A;  3MWM A;  3LST A;  4FX0 A;  4A0Y A;  4O3M A;  1ZG3 A;  1UHW A;  2MA3 A;  2CGP A;  4HDU A;  5L3C A;  4EJO A;  1Y0U A;  1OKR A;  4EV0 A;  1Z7U A;  2LKP A;  2Q2E A;  4S05 A;  1MKM A;  1MDM A;  2IA2 A;  1JHF A;  2XAG A;  2M1B A;  2HGC A;  1SFU A;  2AXL A;  2FOK A;  5DCM B;  1L3L A;  3I59 A;  4AWX B;  2JPB A;  2Y75 A;  4M6Y A;  2IA0 A;  3M7G A;  5CVR A;  1KQ9 A;  1OYY A;  2QUF A;  5D5X B;  4LD5 A;  2QQ9 A;  2GA2 A;  2NAZ A;  3EQL F;  3GFM A;  3PQJ A;  4LGW A;  1P4W A;  1U5T A;  4Q4Z F;  2K7L A;  3QOP A;  2HKO A;  5DUI A;  2G7H A;  5ERI A;  1MGT A;  3DEU A;  3J81 Z;  1KGS A;  2L4A A;  1ZYR F;  2W57 A;  2H6C A;  2HR3 A;  2ETH A;  2DFI A;  4A12 A;  2KIF A;  2JT1 A;  5A2Q Z;  2V1X A;  3RKY A;  2F5D A;  2HTS A;  1ZG5 A;  3WTZ A;  3LFK A;  4AD9 A;  1IW7 F;  4GYI A;  5J8F A;  1R7J A;  3EDP A;  2Z99 A;  5ICG A;  5DD8 A;  2FBK A;  1W4M A;  1S3J A;  2GAU A;  4EJT A;  1W5T A;  4LFU A;  3WGI A;  3L2C A;  1SFE A;  2XAH A;  2PFB A;  2YR2 A;  5D5W B;  1BI3 A;  2YX4 A;  2WWY A;  3WTV C;  4B09 A;  1O3S A;  5CYV A;  4KYW A;  2M87 A;  3FMS A;  3TO7 A;  2EV0 A;  2HOE A;  5JI6 A;  1K6O A;  4OIQ F;  4UXN A;  5BQT A;  1ZAR A;  3IC7 A;  3RJP A;  4G94 A;  5FO5 A;  4N0B A;  2XHK A;  3ECO A;  4K2E A;  4L9T A;  4LK0 F;  4CYD A;  3KP6 A;  3F72 A;  3N4M A;  3CO6 C;  3WGH A;  2RGV A;  1J2X A;  1QGP A;  4PCQ A;  3QP6 A;  2FMY A;  3HIF A;  3ABU A;  5BPD A;  1FWZ A;  2JTV A;  4I09 A;  1QZY A;  1FT9 A;  3GEZ A;  1SD4 A;  3ROU A;  2ZME B;  1F9N A;  4BQA A;  4KN7 X;  1YW9 A;  2DU9 A;  2P5K A;  1H9T A;  3HSF A;  1E17 A;  4M72 A;  1HKS A;  2D45 A;  4EM1 A;  1KA8 A;  3WTW C;  2ZNY A;  3ELK A;  1E2X A;  2JZY A;  1W7P B;  2OQG A;  2BYV E;  1W5S A;  2VBZ A;  2HWV A;  1GXP A;  4Q5S F;  1X3U A;  1YYV A;  1S7A A;  1R1T A;  1P4X A;  1XCV A;  5DYM A;  3MCZ A;  1REP C;  2O8X A;  4WXC A;  3KP7 A;  1ZLJ A;  4RGU A;  4BHC A;  2XAJ A;  4EGY A;  2WC2 A;  2EB7 A;  3FMR A;  2H6B A;  5ED4 A;  5D8L B;  3I54 A;  1B4A A;  4RB0 A;  1S8N A;  2DTR A;  2DK8 A;  2PEX A;  4EGZ A;  1MDM B;  2CWE A;  2LF8 A;  5DEQ A;  3RPQ A;  5ILU A;  4D0P A;  2H27 A;  1IN6 A;  1LDJ A;  1IUY A;  2Z9O A;  1T2K A;  2VE9 A;  2OZU A;  1J9I A;  3CTA A;  2F2E A;  1SD5 A;  3SZP A;  4RGX A;  1Z91 A;  3ZMV A;  4G7H F;  1FLI A;  3EYI A;  3BJA A;  3CUO A;  4WF2 A;  2ZBK A;  1U5T B;  4I0B A;  5HLH A;  3E5X A;  1LQ1 A;  1J5Y A;  2K4B A;  2HYG D;  4OIO F;  2VXZ A;  2NS0 A;  2XUB A;  4KIG A;  2O6G E;  3LA3 A;  4I98 B;  3DXJ F;  2XVC A;  1MJB A;  2XV4 S;  2P8T A;  2GZW A;  5LEK A;  3BRO A;  2EWN A;  3L9F A;  1O57 A;  4A5M A;  2VE8 A;  5D5V B;  1I6X A;  2PN6 A;  1WKM A;  4G7O F;  4M71 A;  5L3G A;  2MBF A;  1DPR A;  4FHT A;  4RS8 A; 
#chains in the Genus database with same CATH topology
 1U0J A;  1FBS A;  5BMZ A;  1BJZ A;  2LRD A;  2A05 A;  3QAH A;  2K27 A;  4DYQ A;  4BAC A;  3RKW A;  3OYE A;  5DCF A;  2R7T A;  3E5Q A;  1X3Z B;  2IJL A;  2IT0 A;  3QPH A;  2NVU B;  4HQE A;  2QSH X;  2X6W A;  4HW0 A;  2EFO A;  5KCM A;  2PLY A;  1HSJ A;  3LOC A;  3D5L A;  3OIO A;  3OYJ A;  5D6F A;  2BW3 B;  3S1M J;  1D8J A;  4KIB A;  1IN4 A;  3F8C A;  5K5Q A;  5F64 A;  3GZN B;  2G9W A;  5JHF A;  2OD5 A;  3GF2 A;  1Y6I A;  3PIP F;  1OYI A;  4M74 A;  1RZ4 A;  3RYP A;  1Z3X A;  4CYC A;  2DOA A;  2P6T A;  4E7I A;  2ZSH B;  4LOC A;  1XGM A;  2XB0 X;  3ZMT A;  1PP8 F;  1D1B A;  2ZJ2 A;  5EJC A;  5HDN A;  1SFX A;  1TWG J;  3GTQ J;  1ON1 A;  1W5C C;  4HQM A;  4KMU X;  1FPQ A;  2XDV A;  1TWF J;  3CD6 I;  1K7A A;  3BTJ A;  1ZRE A;  1MSF C;  2ID6 A;  1I1S A;  1W36 D;  3IL2 A;  1PUF A;  2E2H J;  1Z6T A;  2E5Z A;  3SQN A;  5HLI A;  3JRD A;  1JUM A;  2BY0 A;  3P5J A;  4A3E J;  2DT7 B;  1HF0 A;  4GFB A;  2DW4 A;  1ORK A;  2ZCW A;  1ZAO A;  3QQA A;  3OYA A;  3K70 C;  2A3S A;  2ZME C;  2COB A;  3FHZ A;  4GGG A;  2KIM A;  2EJR A;  3L09 A;  4UY8 I;  3QU6 A;  4RB2 C;  3S17 J;  1KU3 A;  2F5E A;  4XK4 A;  3TOA A;  3ZMD A;  3OYL A;  2A6H F;  1LVA A;  1SVO A;  1YE9 A;  2JRT A;  4XLP F;  5CVV A;  3CP8 A;  4KUM A;  4MNU A;  1S5L C;  2X6O A;  3RIR A;  4E7Z A;  2IEK A;  1ONV A;  5ILV A;  2RV8 A;  3J7Z I;  4HSR A;  1B9N A;  1IZ1 A;  1TZL A;  4IJA A;  2L7M P;  2WTE A;  5J1U A;  3DPL C;  1ETO A;  1HOM A;  2Z2S B;  4A0X A;  2Y31 A;  1T08 B;  4RMN A;  4B47 A;  4L9J A;  3ML6 A;  1KYZ A;  1NG7 A;  1H88 C;  3LSP A;  1SC7 A;  4BH9 A;  3HOY J;  3IRQ A;  3CCL I;  1X4P A;  3N97 A;  1X4O A;  4MFD A;  4BHB A;  2QZ8 A;  5E18 F;  2LKS A;  2MGQ A;  2JA2 A;  3E97 A;  3MZY A;  4XNF A;  5C4X J;  3V7C A;  1BR1 A;  4HLY A;  1U78 A;  2X4H A;  4RAF A;  2L9S A;  2IS4 A;  1ZR4 A;  2MG4 A;  1VQO I;  2M34 A;  1R58 A;  2HOT A;  4HV6 A;  1EA3 A;  4BUP A;  1SAU A;  1G3W A;  4G12 A;  3DEE A;  3ZN0 A;  1U8R A;  5HVQ C;  5A2Q K;  3OSF A;  1TW2 A;  4XID A;  1T38 A;  4J00 A;  5D5U B;  2KFD A;  5IT3 A;  1X3W B;  3F6O A;  2JA5 J;  3O2P E;  3REO A;  1ZGA A;  1Y1W J;  4D5C A;  2BVL A;  1E3O C;  2XSJ C;  3KLO A;  3BT9 A;  4EJV A;  1X19 A;  4ANJ A;  5DV5 A;  1H0M A;  1U5T C;  2WAE A;  1ODD A;  2VOO A;  3DLA A;  4ASN A;  5LLQ A;  2HDW A;  2ZJP F;  1JKP C;  3LAJ A;  3GLX A;  3CDL A;  3WG7 H;  4IPA A;  3C7J A;  2KLO A;  1BI0 A;  3QYE A;  5EG0 A;  2MC4 A;  2NVY J;  5ICC A;  3DTI A;  4TV7 A;  2X85 A;  3OYF A;  3LQR A;  4OU0 A;  1V4R A;  1WJC A;  3T8T A;  4XKW A;  3DQV C;  4LG0 A;  2P0W A;  1SAX A;  4DW6 A;  4NB5 A;  1UCR A;  5IT9 Z;  2IGO A;  2PMU A;  1JGG A;  2X6X A;  2HU9 A;  1R1U A;  5CJ9 A;  1A04 A;  3FMQ A;  3CMY A;  1Z0X A;  1BIA A;  1ZHF A;  3SFZ A;  4IRG A;  1FEX A;  5LHH A;  3OY9 A;  1Y39 A;  2ELJ A;  3CC2 I;  4HYE A;  4I7H A;  1DGW Y;  4BGD A;  3S2H J;  3TKY A;  3LL7 A;  1YRN A;  4M73 A;  4OOI A;  1EF4 A;  2DT6 A;  4C3I J;  3M1C A;  1I27 A;  4Y15 A;  5TIS C;  3DU6 A;  2GOM A;  2X1E A;  3JAM Z;  1AKH B;  4HNV A;  5E3L A;  2PJR A;  3ISP A;  3SEQ A;  2R7Z J;  4HAM A;  2XGX A;  5JVG F;  5CQE A;  1ZEL A;  4M6X A;  5HNH A;  3DTK A;  3TOB A;  1GV5 A;  1MJ9 A;  3A01 A;  1D5Y A;  3HOU J;  4RM3 A;  2OTL I;  4RLQ A;  2ESH A;  5K7F A;  2NXN B;  2NRA C;  1YW7 A;  2M3A A;  3DF8 A;  2DN0 A;  1V55 H;  1VZ0 A;  1D1C A;  3WTS C;  4CCJ A;  1TNS A;  5JLW A;  2RNJ A;  2QEN A;  2HYF A;  2E7W A;  4WXD A;  4CCL A;  1WJB A;  4XON A;  2J5P A;  2VB6 A;  3IRR A;  2OU2 A;  3J7A O;  5HLG A;  3SZT A;  2V79 A;  4II3 A;  3ZQL A;  1FIA A;  1P92 A;  3DKW A;  3S3M A;  3IHU A;  5B66 C;  3KE2 A;  2QLZ A;  4HX8 A;  3LSK A;  3IAM 2;  3M8F A;  2EFW A;  1WI3 A;  4XLH A;  3BPV A;  5IY5 H;  2JA8 J;  3KP2 A;  1JJ6 C;  2A07 F;  3CQZ J;  2MC3 A;  1F5T A;  3BR0 A;  2OC6 A;  2LG4 A;  3GTL J;  3V8L A;  4B43 A;  1BJA A;  3M8J A;  1B1B A;  4ZTJ A;  4G9Y A;  2A5W A;  2DFH A;  3RI4 A;  2OAZ A;  3V8K A;  3GFL A;  5EYR A;  1TWC J;  1T56 A;  5L3F A;  5FRN A;  4CYC B;  4XSZ F;  5KK1 A;  2AQF A;  4ZZL A;  3JSP A;  2YSR A;  1OQY A;  3BTL A;  3F9K A;  3KPH A;  3DFG A;  2FNP A;  3TO9 A;  2L2O A;  2XKO A;  4W1U A;  3MFK A;  2QM3 A;  3T1B A;  3MAJ A;  3P7N A;  4LK1 F;  2CG4 A;  2GXA A;  1PJR A;  2OF7 A;  3NAR A;  1KZH A;  1PUF B;  4NC8 A;  1XN7 A;  2FEZ A;  1E3P A;  3ZGK A;  1OPC A;  2K9N A;  3PSF A;  4E6K G;  2K9Q A;  3I64 A;  4IQ4 A;  3I56 I;  1FNN A;  1T0F A;  1UZC A;  2HTJ A;  2OCE A;  2F5C A;  4W97 A;  1XSX A;  2QGU A;  5LEJ A;  3V42 A;  3K4C A;  2DDA A;  1OCZ H;  4KJZ A;  3BY6 A;  4EMS A;  1MZB A;  4MO7 A;  2OTJ I;  3E7L A;  2VPR A;  3L2R A;  2M4G A;  1W1W E;  2OZ6 A;  1XG1 A;  4Y4R A;  2MH9 A;  3B02 A;  2GXG A;  5L3E A;  3ZQC A;  1WJD A;  1BBY A;  3E5U A;  4ZZD A;  1BOA A;  4YIR X;  5EZG A;  1T8I A;  3LA2 A;  1YX5 A;  1Z6R A;  1QBJ A;  5HDG A;  2WB1 A;  1R23 A;  3G1L A;  2A5Y B;  2X1D A;  5E8I A;  4OIP F;  2HFH A;  5E79 C;  4A69 C;  4YFN F;  2DOD A;  1R71 A;  1WQ2 A;  2DPU A;  4LB6 B;  5E20 A;  1FP1 D;  4HV5 A;  1LPQ A;  2XKP A;  4HF2 A;  3OYC A;  3DKY A;  4B3X A;  5HS8 A;  3OSG A;  2CO5 A;  2V9V A;  2CSO A;  2DO7 A;  3WU0 A;  1LUJ B;  1V5E A;  2O5R A;  3I5U A;  2O03 A;  1YHQ I;  4L5E A;  1U9N A;  5BPI A;  3H3Z A;  1I3Q J;  3CES A;  1X58 A;  1MBJ A;  5E8G A;  3LSJ A;  5IYC J;  3H0G J;  3MKW B;  3TP0 A;  4A3C J;  2K02 A;  4ENJ A;  2GA1 A;  1UEL B;  3PO3 J;  3KYD B;  1OCC H;  3I3L A;  4EEF G;  3R0A A;  2ZXJ A;  3AAF A;  1B72 A;  4ZYA A;  4O5V A;  2DK5 A;  1QNT A;  2NOJ B;  2MYS A;  4ON0 A;  2ICW G;  2CW7 A;  1CF7 B;  2R92 J;  4FCY A;  1HDP A;  3TP3 A;  3HRS A;  2E1M B;  3VEP A;  2DYS H;  2M7A A;  2QQ8 A;  2JA7 J;  5CPR B;  5CQG A;  1XMA A;  1HDD C;  3W2V A;  1FOW A;  4ZYG A;  4OIR F;  3FXJ A;  2VBX A;  3T0Y A;  1FTT A;  3GFI A;  2CQN A;  2K5C A;  4C3H J;  4IHV A;  3A4C A;  4RB3 C;  2EIM H;  1B8I A;  4WCG A;  2HQ5 A;  3HGY A;  5JR3 A;  4F3Q A;  3ZN1 A;  3BZ6 A;  4NUB A;  3F8M A;  3AL0 B;  1YJ9 I;  1AWC A;  1WJ5 A;  4A3M J;  2IS1 A;  5EG0 B;  4AUX A;  1PP7 U;  2Y30 A;  5EDN A;  1XPX A;  5GAH J;  3J7A Y;  5GAD J;  4WX9 A;  1UHS A;  2BVM A;  3K0L A;  4U0V A;  2XF7 A;  4FX4 A;  3I71 A;  4LG0 B;  2KZG A;  1MIJ A;  4F92 B;  3KFW X;  2BY2 A;  2CFO A;  5FB2 A;  2COM A;  2W84 A;  3SEZ A;  3SZG A;  1S29 A;  2LLK A;  3EYY A;  3DU5 A;  3OS0 A;  2V26 A;  1FZP B;  4N9H A;  2XSD C;  1NHA A;  2E7X A;  4P5O A;  5HS7 A;  1EH6 A;  2GWR A;  1WZ2 A;  1T39 A;  2WAQ N;  2V9K A;  3ECH A;  1WPK A;  2FU4 A;  1ZRD A;  2IPQ X;  1F1Z A;  1UB9 A;  2JPC A;  1I50 J;  2R7X A;  4PGG A;  2ZO4 A;  4LIT A;  2CRG A;  2VBW A;  2EH3 A;  1SD7 A;  3KP5 A;  4I99 C;  3ZMS A;  1YRN B;  1YTY A;  3K4N A;  3TDU C;  4RAY A;  1SD6 A;  3CZ6 A;  5LGU A;  2EA4 A;  2PX9 A;  4HNU A;  2PJR B;  2YUS A;  3K4L A;  2VAS A;  5D6E A;  5AIP A;  5FLM J;  1RNL A;  2W25 A;  4NC6 A;  4QPQ A;  2DQL A;  3VYU B;  3LSM A;  1FX7 A;  3FXR A;  2ISY A;  5D4S A;  1QO0 D;  1VQ4 I;  2CV1 A;  4KT5 C;  3A01 B;  1NH3 A;  3M07 A;  3HKZ A;  2WY7 Q;  3SDB A;  2VXD A;  4IVN A;  3HOT A;  3VOE A;  2K86 A;  2M8G X;  1SEU A;  1MMS A;  2E19 A;  2L01 A;  3FBI B;  3K69 A;  1FSH A;  2Y2Z A;  3U9G A;  2FQ4 A;  3RPU D;  2EK5 A;  3WTU C;  4AVZ A;  3IKT A;  2VJ4 A;  4JX4 A;  1IF1 A;  1YS7 A;  1R4N B;  2JSP A;  3I9V 2;  5H6R A;  3W2A A;  2WB1 N;  4JBA A;  3CCE I;  3G3Z A;  4RAZ A;  2UXX A;  4ENM A;  2HNH A;  1ZGW A;  4RGS A;  3E6M A;  3ZQI A;  2CQQ A;  3KET A;  2E60 A;  5IYD J;  1XGN A;  2HKX A;  5LGT A;  2LSO A;  2KIQ A;  3BG5 A;  2N8G A;  3IAS 2;  2NYX A;  1T95 A;  2NVQ J;  3H35 A;  1V5G A;  2H94 A;  2JVG A;  1BI1 A;  2DPD A;  1ZLK A;  4WXH A;  4XLA A;  2K40 A;  3HRU A;  1HKT A;  2DMP A;  1I39 A;  2BE5 F;  1GUU A;  2B0L A;  2CU7 A;  4XLC A;  2DOE A;  3KZY A;  1D3Y A;  3L1P A;  1E0E A;  3M8E A;  3BR3 A;  1E3H A;  1TQM A;  1HBX G;  2RNG A;  3G73 A;  1QZZ A;  1LKX A;  1KON A;  1NK2 P;  2R4G A;  1U3E M;  1SMT A;  2E2I J;  1RET A;  4IHY A;  3FM3 A;  2LBF A;  2B7E A;  3BP8 A;  4V2F A;  1AOY A;  1MBK A;  4L5I A;  3CDH A;  3HSR A;  4CGZ A;  2PQ8 A;  3GTK J;  1G3T A;  4U0W A;  5K1Y A;  1WI9 A;  2FOW A;  3SXY A;  2LR8 A;  3IH2 A;  4RLF A;  1JKR C;  4YFX F;  1ON2 A;  4B4C A;  4DBR A;  3BG7 A;  3QPT A;  3DTE A;  3ZR8 X;  1DU0 A;  1ETV A;  4XRM A;  3TMO A;  4C2U A;  3BR6 A;  1P7I A;  2QWW A;  1IGN A;  5ICF A;  1VFC A;  4DOZ A;  1UFM A;  2ZFW A;  4Y17 A;  1GHC A;  3A0H C;  2TRT A;  2WA0 A;  1RR7 A;  5GTI C;  1O3T A;  4C2M J;  4DIQ A;  2HYJ A;  1VQ8 I;  2VLA A;  2PI0 A;  1UMQ A;  3HYI A;  4C9Y A;  3KP4 A;  2W4S A;  3L00 A;  3KYC B;  3LQQ A;  4KIS A;  4V19 K;  3RYR A;  3QYB A;  4MQ9 F;  2Y48 A;  3CUQ B;  4FE4 A;  4JQF A;  1MD0 A;  3BZK A;  5IT9 K;  2IP2 A;  4NC7 A;  3C3W A;  1JJ8 C;  2CUF A;  1LEA A;  1W36 C;  1F43 A;  4HA8 A;  3OYM A;  1ZRF A;  2BY3 A;  2C6Y A;  2E1M C;  2LF7 A;  4N4N B;  3K4B A;  1RR8 C;  1JUP A;  3W2W A;  5E1W A;  1PDN C;  5DM6 F;  1O3R A;  2OJE D;  4MHG A;  4L18 B;  2F4M B;  2A6E F;  3HBL A;  1FMV A;  1UG2 A;  1YJN I;  2NOG A;  2G0E A;  4RGR A;  1A6I A;  3ZMZ A;  3WHB A;  3TO6 A;  2YX7 A;  1DGR M;  1IXC A;  2VQH A;  3MN2 A;  1B72 B;  3JAM K;  3FDY A;  3DBH B;  4Y3O A;  1UHM A;  1XGO A;  1UJ8 A;  5LBQ A;  4PDK A;  3L7W A;  3COA C;  2B63 J;  2Y9Z A;  2KRH A;  3AL0 C;  1MH4 A;  2Z3Y A;  1MBE A;  2GBY A;  5JLX A;  2HVR A;  4EQQ A;  4ZDP A;  4LIV A;  1FYK A;  2IRF G;  4BJ6 C;  4EJU A;  4B1R A;  2IW5 A;  2IGN A;  4IQJ A;  1CGP A;  3LA7 A;  1LE8 A;  1M1E B;  1JUS A;  4H4K C;  3HC7 A;  5F1R A;  1YS6 A;  2H8W A;  2XAF A;  1Z1D A;  1KQ8 A;  2ID3 A;  2FF4 A;  3GFJ A;  5ICE A;  3CCY A;  4L5J A;  2XGD A;  4ZYH A;  3OIQ A;  2O0Y A;  1HCR A;  1B8I B;  1IRX A;  2H09 A;  4PJM A;  3CCJ I;  2DA6 A;  3S2W A;  2JN6 A;  4IRI A;  1D1A A;  2VBY A;  3KZI C;  3FXU A;  3M1E A;  2R5Y A;  2MSY A;  4KIT B;  2Z16 A;  2WV0 A;  3U2R A;  1JHH A;  3F8F A;  1BC8 C;  4E7L A;  2HDD A;  4CDG A;  3AG3 H;  1UG0 A;  3B6C A;  3TQN A;  5FD5 A;  4BJ5 C;  4RB1 A;  1V3F A;  4HLX A;  4IOA F;  4R8H A;  5J4V A;  2LD5 A;  3R60 A;  1FJL A;  2VON A;  1YIO A;  3BDD A;  6PAX A;  4XN0 A;  1MNM C;  4C30 A;  3ABM H;  4E7K A;  2RKH A;  4ZDL A;  2VT2 A;  2R7W A;  1CQT A;  1KU9 A;  3GWZ A;  2R7S A;  2R7R A;  3HPH A;  5FRM A;  3OYN A;  1QA6 A;  5H20 A;  1FOK A;  4IRH A;  3AG2 H;  4AU7 A;  3GVA A;  5FLX Z;  1VQ5 I;  4BXF A;  2OBP A;  4D5F A;  1YI2 I;  1O7L A;  1KU7 A;  1EJ9 A;  5LGN A;  3DPT A;  1T98 A;  1Y0N A;  5F27 A;  2CQK A;  1TQI A;  1XGS A;  1MBG A;  4LLL A;  1X1D A;  2FE3 A;  1VQN I;  3ZQF A;  3JRE A;  2VUM J;  2EA2 A;  4F93 B;  2UXN A;  1F36 A;  2E1C A;  1RPW A;  1ZQ3 P;  2TDX A;  2P5L C;  3HL2 A;  4P9U A;  3S1R J;  4LLG F;  1UST A;  4CXF A;  5AON A;  2CQ7 A;  2QBY B;  5F6F A;  1X1B A;  2XB5 A;  1QU3 A;  4B8X A;  2XF5 A;  1YJW I;  2O61 A;  4KIF A;  1QQI A;  2ZB9 A;  4II2 A;  2A69 F;  3MKL A;  4BEH A;  1N75 A;  1IV8 A;  2XGE A;  1OMI A;  4FAS D;  4UNO A;  2FUG 2;  4XKC A;  1GVJ A;  3B73 A;  2BBY A;  2V4J C;  3E6C C;  1POG A;  2PMZ A;  3BR2 A;  3HRT A;  2FXA A;  3PNT A;  3K7A J;  2G7U A;  2EIN H;  3K2A A;  1JE8 A;  1CF7 A;  3RQ4 A;  3ZMU A;  4LB5 A;  2CH0 A;  3GTJ J;  5J8C A;  2DQR A;  2LFB A;  2V1N A;  2VKD A;  2I8D A;  2E36 A;  5DDG A;  2HVQ A;  2EZL A;  5LRS A;  4UVB A;  2LP0 A;  2VQG A;  1YFH A;  1R00 A;  4CSW A;  4CCO A;  3S16 J;  1XMK A;  3K1P A;  1FP2 A;  3WU1 B;  4CO8 A;  4M3F A;  4EJW A;  4X0G A;  3K4K A;  1B59 A;  3FM5 A;  4OWR B;  2DCE A;  4YIF A;  5HOO A;  2UZK A;  4M9S A;  3MEX A;  2LOO A;  1X2N A;  4X6A J;  4MTD A;  1T0F C;  3S14 J;  4GRI A;  4L0Y B;  2A68 F;  4F7Z A;  4MQV A;  4DYC A;  4GYG A;  1BOB A;  3IH3 A;  4HBL A;  5D4R A;  3CLO A;  5BOX A;  2IA1 A;  2LBF B;  2QA4 I;  1FMW A;  3GXO A;  2M30 A;  3CF2 A;  2NNY A;  2L54 A;  1DP3 A;  1H8A C;  1XDU A;  1LJ9 A;  3HRM A;  3JRB A;  4CIC A;  2NVT J;  1OFC X;  3CUQ C;  3M9A A;  3ABT A;  3CJT B;  3CJQ B;  3JRG A;  2KJB A;  3ZOB A;  2F48 A;  1FYM A;  2HQN A;  2H8R A;  1MW7 A;  4DNC A;  1JTX A;  3SJM A;  5LRR A;  4BE2 A;  1I3A A;  5IOY A;  3ZQ7 A;  1K78 A;  5DM7 F;  4XIC A;  2YU3 A;  4PJL A;  4BKX A;  4QLC U;  2PJP A;  2K4J A;  1R5I D;  1Z7L A;  3L2U A;  1FBQ A;  2ZNZ A;  5E1X A;  3LNQ A;  3WGG A;  4PFP A;  2DBB A;  3BOQ A;  2JUG A;  2EFP A;  3MQ0 A;  2CUE A;  3H5R A;  4LLN A;  1KQ0 A;  1LFP A;  2D2W A;  2V6C A;  1IDZ A;  3CJN A;  1K79 A;  4DJA A;  3E6B A;  2Q0O A;  3DLL F;  2M9H A;  1I5Z A;  1SFK A;  2OPT A;  5FKO A;  2MW8 A;  3DPU A;  2DJI A;  3W3C A;  2HOS A;  1YG2 A;  3VWB A;  4IX7 A;  2LRE A;  1KYW A;  1B9M A;  1KU2 A;  1XSV A;  1MND A;  1ZKG A;  3QYF A;  3BZC A;  5F0F A;  2KQR A;  3QP5 A;  3HB9 A;  3FK7 A;  2LVS A;  3I0T A;  1ZRC A;  4AID A;  4KT6 A;  1WH7 A;  3GUD A;  2ACJ A;  4P55 A;  1VQM I;  3VDX A;  3SHF A;  2CQX A;  1O7F A;  3JRA A;  1IO2 A;  1FOY A;  1ZN2 A;  2MD0 A;  1IN7 A;  2RN7 A;  2KKO A;  4KMF A;  3J80 Z;  3KEY A;  1QVU A;  3U21 A;  3IWF A;  2R5Z A;  2M45 A;  2OA4 A;  2QYO A;  3J7Y J;  1G6N A;  5FRO A;  1R22 A;  3BR5 A;  2PBI A;  4L0Z B;  2FQ3 A;  2DA2 A;  3F3X A;  3G6E I;  2HPM A;  2GQQ A;  1LE8 B;  5HOD A;  2IVM A;  5DTD A;  5E1Z B;  4ZJZ A;  2LMD A;  1FYL A;  2XAU A;  3TW7 A;  3S93 A;  2J5O A;  2K3P A;  2CMP A;  3OIP A;  3L2W A;  3UR3 C;  2BGC A;  4AIH A;  2D1H A;  4R1H A;  3HOW J;  3I53 A;  5J6X A;  5F1J A;  3Q5F A;  1IRG A;  4IF4 A;  1R5G A;  4UHT A;  1HA8 A;  3S32 A;  2HQR A;  3R4K A;  5CVJ A;  3WU2 C;  2R5Y B;  2RQP A;  3HM5 A;  3VOD A;  3FX3 A;  4AC0 A;  3HSE A;  3IKV A;  4E70 A;  2X6Y A;  4OMZ A;  4DGW B;  1U9O A;  2QKL B;  1ERD A;  4XLE A;  3GYH X;  4Y13 A;  1S6L A;  1EV7 A;  1WRJ A;  3S3O A;  1JI8 A;  2EZH A;  1HW1 A;  2M0M A;  1Y8R B;  2DYR H;  3QPS A;  3Q0W A;  2CUJ A;  3EUK L;  4BDZ A;  5E3M A;  1L0O C;  1G4D A;  3GTO J;  3PL8 A;  5CLS A;  3FXO A;  4I0A A;  3BWG A;  4NQW A;  1SMY F;  2IGK A;  3WHC A;  1FBU A;  2W85 A;  4MIM A;  2VC1 A;  2HS5 A;  4ZH4 F;  5KVR A;  2W24 A;  4PUS A;  3RKX A;  1J59 A;  4ITV A;  4NBQ A;  1XB4 A;  1Q1H A;  3KEQ A;  4MTE A;  3KYL A;  2DOF A;  2QSF X;  2KP6 A;  1MNE A;  4AVP A;  4A6D A;  4YG2 F;  4MLO A;  1WWX A;  1TTY A;  2IGM A;  3MKZ A;  1MSE C;  3CME I;  1S7O A;  1IRZ A;  1DUX C;  3BR1 A;  1LB2 A;  1D0X A;  3CUQ A;  2WY8 Q;  2BXY A;  4LG3 A;  5FD6 A;  2R7O A;  2ZJQ F;  2HI3 A;  3DWL E;  3KLN A;  2KRC A;  1AHD P;  2EIK H;  1XD7 A;  2BEO A;  5EEH A;  4ETS A;  4M9X A;  5L3B A;  4CH7 A;  4QWQ A;  4E7J A;  3JTG A;  2R0Q C;  4BEH B;  4FTH A;  1MBF A;  4XBF A;  1XCB A;  5IYB J;  4XRF A;  1R36 A;  3OR1 C;  4OMY A;  1ITY A;  2WAF A;  1TWH J;  1Z77 A;  4I2O A;  3NRV A;  4GXO A;  4ENK A;  1F4K A;  4DZJ A;  4G6D A;  4XN3 A;  2X0L A;  1Y56 A;  4PGH A;  3OOP A;  1RC9 A;  3LSG A;  1QHG A;  5ILS A;  4I6Z A;  3LAP A;  3H3U A;  4U88 A;  1A36 A;  1DP7 P;  2YU9 J;  1D0Y A;  5IP7 J;  4N9I A;  4UV9 A;  1AU7 A;  2P7V B;  4MFE A;  2M8E A;  1S9H A;  2ME0 A;  2ZFU A;  2LKX A;  2AO9 A;  1TQP A;  3BJ6 A;  4HRI A;  4KA4 A;  3S15 J;  3O6B B;  3HDD A;  3AFH A;  4JK1 X;  4P1W A;  3R6S A;  5GPA A;  1DU6 A;  4S04 A;  1IN8 A;  2XAS A;  4M3G A;  2L0K A;  4FE7 A;  4XKV A;  1YQA A;  1K6Y A;  1DPU A;  3ZXS A;  3D1N I;  3V7S A;  2DFF A;  3KEO A;  3W6V A;  1PUE E;  1XSD A;  2MLK A;  2KRF A;  4RBO A;  4HZF A;  3MMY B;  1QPI A;  1JKO C;  5KHD A;  1G3Y A;  1W0U A;  2CUZ A;  4WK8 F;  2MFZ A;  1YOV B;  2L7K A;  4V2G A;  5FGM A;  1NK3 P;  2HZD A;  1BI2 A;  1ETQ A;  5KAF C;  3BC8 A;  5JFR A;  1U8B A;  5L3D A;  3PNY A;  2MH2 A;  2NNN A;  5D8K B;  3OYH A;  3S8P A;  1P4A A;  2AHQ A;  2STT A;  3N05 A;  2ADU A;  1R1V A;  1WH5 A;  2CYY A;  2L5Q A;  3JTH A;  5EF6 A;  3PIO F;  2JQ7 A;  1X1C A;  3M3Y J;  3B6A A;  3P9C A;  3FXM A;  4J01 A;  1IJW C;  1VQK I;  2Y69 H;  3IUO A;  3TL4 X;  1BIB A;  3UNG C;  2D5V A;  4BNC A;  4HPQ A;  4A2U A;  1U2W A;  5B3S H;  5J1Y A;  1K78 B;  2Y0M A;  3T8R A;  2M7B A;  4L9N A;  4IEJ A;  5JVT A;  1WVR A;  3GZ5 A;  5K7H A;  4KNY A;  1GXQ A;  1TW3 A;  4UUS A;  1FSE A;  1P7J A;  2LDU A;  4PJJ A;  4PSX A;  2VKV A;  2Z1D A;  4M3D A;  2KL4 A;  2L7Z A;  2EV6 A;  3HOX J;  1RUO A;  1EH7 A;  3H36 A;  5FFZ A;  2ZC2 A;  4YFK F;  3BPX A;  3F0C A;  5M5X J;  3C2B A;  3KP3 A;  2QBY A;  1R4M B;  4IHS A;  3H9G A;  1MMG A;  3G71 I;  2CV0 A;  5F0C A;  5E17 F;  1IG7 A;  1JXS A;  3K4M A;  2E1N A;  5FLX K;  4YEJ A;  3LSH A;  2P5V A;  1S7E A;  1IAW A;  1APL C;  2KDZ A;  1MMA A;  4KN4 X;  3CC4 I;  3ZQH A;  3VSL A;  3X2Q H;  1Z05 A;  2RQQ A;  2L3D A;  4Q48 A;  5E3O A;  1HKQ A;  3JSO A;  4HX4 A;  2GIV A;  4XRS G;  1I1G A;  4B44 A;  2DAO A;  3TDZ C;  4P9F A;  1IXR C;  1EKE A;  2DA1 A;  2XF6 A;  5AIQ A;  5JHU A;  1QRY A;  1LDK B;  2YPR A;  3P9I A;  3VYR B;  2R5Z B;  2GIZ A;  3OOU A;  5M3M J;  4JX6 A;  2DTZ A;  4FQG A;  2ZXI A;  3CLQ A;  2QKM B;  1TC3 C;  4DQ2 A;  1LEB A;  3G2B A;  5EGO B;  3OYI A;  2XIG A;  2FBI A;  4GDF A;  4C2T A;  2VC0 A;  3Q0V A;  1G2H A;  3E3V A;  3K9T A;  1HW2 A;  4A3G J;  1IV6 A;  1IXS B;  4XOR A;  2AS5 F;  1OLT A;  4ESB A;  2KMU A;  1YX3 A;  1STZ A;  3ABK H;  4BQN A;  1BM9 A;  2FD5 A;  5GP9 A;  2DA5 A;  2VPL A;  3VYT B;  3H0D A;  4UUV A;  4XRS A;  3PFI A;  4I02 A;  1VQP I;  5H6Q A;  2QEX I;  1RUN A;  3IWZ A;  3I58 A;  4RAG A;  3H5N A;  4UVC A;  1P6R A;  2DDB A;  3RCO A;  4Z6Y A;  3CCR I;  3PFY A;  2Z33 A;  2MLG A;  2P6S A;  3HHH A;  1WSU A;  3BTI A;  4XSX F;  2WBM A;  5DUK A;  4AYB A;  1H9G A;  3E6D A;  3ZP5 A;  5BNG A;  3ULQ B;  4ZTF A;  1HST A;  1SVM A;  4G7Z F;  5C44 J;  2ISZ A;  3EUH A;  3FF5 A;  2I10 A;  4NQW B;  3G1O A;  2MAB A;  3I59 B;  4A3J J;  1N25 A;  3PJR A;  3QOE A;  4G6Q A;  2CFX A;  3FWE A;  2ZSI B;  4ZYD A;  5LD2 C;  2VJ5 A;  3H5A A;  1A6Q A;  2F5V A;  1Y1V J;  3LFU A;  4Y52 J;  3RPU A;  4O6J A;  3Q0U A;  5IOZ A;  4UUT A;  3ONQ A;  3OS2 A;  2R7F A;  3O8H A;  2FML A;  2VKE A;  3QPL A;  3BQY A;  3DBR B;  3WG9 A;  3RKQ A;  4IHW A;  1LNW A;  4QSH A;  3GW2 A;  1BR4 A;  4BY7 J;  4A3L J;  4PZJ A;  2ELK A;  1XTA A;  1BC7 C;  4HG2 A;  4NHJ A;  2DLL A;  2V1U A;  1RI7 A;  2FX0 A;  2TCT A;  1WJE A;  3ZQG A;  4JX5 A;  1YLF A;  5EEG A;  1OR7 A;  3JRI A;  2LC2 A;  4BHP A;  1HQC A;  2E1O A;  4A93 J;  4WWC A;  1NG6 A;  2M4K A;  3CP2 A;  1QPM A;  1TWA J;  2HQA A;  4D7N A;  1A35 A;  1JT6 A;  3FK6 A;  3K1N A;  4BL0 B;  3O3K A;  1R9T J;  4BBS J;  2VOP A;  5BS6 A;  4D9J A;  1IC8 A;  1TL8 A;  3HTS B;  3M4O J;  4XR6 A;  3NAU A;  3CF5 F;  2KHM A;  2EV5 A;  2W82 A;  4YII A;  4D7M A;  4UV8 A;  4F91 B;  2P7C B;  1FC3 A;  3JR9 A;  4U87 A;  2E2J J;  4IXA A;  4Z2Y A;  1TT0 A;  4ABZ A;  4HX7 A;  3C1D A;  3BJO A;  2L02 A;  2XGC A;  4QIW N;  4A5N A;  3BG3 A;  3K2Z A;  3RQI A;  3HUG A;  3HJE A;  4KIC A;  2V7F A;  3CMM A;  4AIJ A;  3HKZ N;  5LFA A;  2RC4 A;  3CCM I;  1BN5 A;  2MD5 A;  4J19 A;  1SFO J;  4H0E A;  1ETK A;  5J1R A;  1BW5 A;  3BCB A;  1HLV A;  3S2D J;  1G3S A;  4JYK A;  5GAG J;  5LHI A;  3SYT A;  5GPC A;  4IHT A;  1R49 A;  1V54 H;  3WOD F;  3F8B A;  5J3L A;  3J80 K;  3VFZ A;  4CZZ A;  4MEY F;  1J09 A;  4MEX F;  3LMM A;  3V8J A;  3KZZ A;  2KT0 A;  3NQO A;  4BXU A;  2BV6 A;  1FY7 A;  2M5W A;  1MJA A;  3I4P A;  3P9K A;  3WE3 A;  2HEO A;  3FZV A;  4AIK A;  2FNA A;  4BU2 A;  2PG4 A;  3AG1 H;  1O4X A;  5J4Y A;  2Q1Z B;  2VIX A;  4ESF A;  3HG9 A;  5DCM A;  4A0Z A;  2R93 J;  4IZZ A;  2ELH A;  3QU3 A;  4GO1 A;  3KIO A;  5F08 A;  3GLL A;  3GO5 A;  1GDT A;  4G6T B;  1NTC A;  3FXQ A;  5LHG A;  2FA5 A;  3V4G A;  3TGN A;  3H92 A;  4ZYE A;  3C2H A;  1R5H A;  4RM2 A;  1BR2 A;  5TRD A;  1S72 I;  4Y33 A;  2VOD A;  4HDV A;  5F04 A;  4G8X A;  5C3E J;  4UUS B;  1QHH D;  2XRO A;  4PK4 A;  3T5X A;  4M3E A;  3GX4 X;  1IRF A;  2EIJ H;  4A3B J;  3ZQQ A;  5HS9 A;  1VF9 A;  1O3Q A;  4AYB N;  1V5F A;  5DD4 A;  1OJL A;  2EFQ A;  3A0B C;  3IP4 B;  4M3B A;  4OIN F;  1MMN A;  2OUM A;  3L2V A;  5HDK A;  4R79 A;  1ETW A;  3RSN A;  1N78 A;  2IS6 A;  3DP7 A;  5FFX A;  2ECC A;  3F23 A;  1WFX A;  4E7H A;  4D1Q A;  2STW A;  2DT5 A;  2H1K A;  2UWM A;  1Z9C A;  1P9Q C;  4XL9 A;  2XPU A;  2W48 A;  2UUZ A;  3OV8 A;  3WTY C;  1C0W A;  4LMY A;  4U0Y A;  3Q9V A;  3GTG J;  1TLH B;  2PMH A;  3WTT C;  4CUG A;  3TW6 A;  4IHX A;  3K4J A;  3KCC A;  2XRN A;  1TBX A;  4HF0 A;  3J81 K;  3GTM J;  3QRF F;  4IOC F;  2VQL A;  1EH8 A;  2LY2 A;  2VQC A;  3NEU A;  4A6E A;  3JRC A;  4U7D A;  3VPR A;  2R3S A;  3EET A;  2HZT A;  1B6A A;  4F55 A;  3PQK A;  2F4I A;  3H9J A;  5K5O A;  1Z67 A;  1Z3Y A;  1BA5 A;  4BYY A;  3PM1 A;  1OCP A;  1FOX A;  2RVC A;  3CMA I;  1ZG1 A;  2L4M A;  1ZH5 A;  2ZKZ A;  2JA6 J;  1ENH A;  2GM4 A;  1X1P A;  3FHN A;  4PFO A;  4XKB A;  2FRH A;  4M6V A;  4GCV A;  1USS A;  2OCC H;  2DMQ A;  3W6K B;  4YEL A;  3C18 A;  5K5R A;  2KJC A;  4EVI A;  3RZD J;  3MZ8 A;  3CDI A;  2HPI A;  3Q9S A;  3K70 D;  3HHG A;  2QQA A;  2ZJR F;  2XPV A;  4I01 A;  4UVA A;  4BJT A;  1MBH A;  3W6J B;  1T6S A;  1T33 A;  4B48 A;  2VT3 A;  2QQB A;  1XX5 A;  1ACI A;  2M0C A;  3CO7 C;  3Q3S A;  1MH3 A;  2LK2 A;  2X51 A;  1HXD A;  1YIT I;  4FT8 A;  3FXL A;  4KFC A;  1WGX A;  4ZC3 A;  1LDD A;  4EM2 A;  5HNF A;  5TJJ A;  2OV7 A;  4P96 A;  3HGG A;  3L2Q A;  3LWF A;  3S1Q J;  2JJ7 A;  2VN2 A;  4ESJ A;  4CZC A;  1JGS A;  2FBH A;  1W7P D;  4YRV A;  4ENN A;  2JSC A;  4EM0 B;  2JVH A;  2FSW A;  2Z5U A;  2KZV A;  3F6V A;  1J0R A;  3R0J A;  1ETY A;  1U6G A;  3R61 A;  2BY1 A;  2H1L A;  2V1D A;  1RKW A;  1YW8 A;  2A6T A;  3GZ6 A;  1VTN C;  2HXI A;  2KIU A;  3PSI A;  2CW0 F;  3HZJ A;  4MGR A;  5F0H A;  1YO5 C;  1TNT A;  2OQR A;  3ERE D;  1WHU A;  2HVS A;  3MZH A;  3F22 A;  4HF1 A;  1WCM J;  4IO9 F;  3FXK A;  3DCF A;  5CVI A;  3WTX C;  2JMW A;  4HOB A;  3U1D A;  3DBL B;  5IP6 A;  5TGT A;  3HOS A;  3BCA A;  1DDN A;  1IN5 A;  3D0S A;  5CVU A;  1ULY A;  2A61 A;  3H9Q A;  4BE0 A;  3VB2 A;  4UB8 C;  3D5S C;  2RDP A;  5B5E C;  3CCU I;  3RTR A;  3F8N A;  4OAZ A;  2DXI A;  4XOP A;  1VI0 A;  2XAQ A;  1OYW A;  3DV8 A;  1D8K A;  1ZGJ A;  4BQO A;  2LNB A;  2QCO A;  5KAI C;  4Q47 A;  3ZPL A;  2K85 A;  1J75 A;  2X48 A;  4X1E A;  4CHU A;  1G59 A;  1VQ9 I;  3JW4 A;  2GXB A;  1PVE A;  1BL0 A;  2DA7 A;  4U7B A;  3BG6 A;  3F21 A;  3HTU A;  2DA3 A;  3PO2 J;  2E34 A;  3OS1 A;  4L9V A;  2ZME A;  2YS9 A;  2R7D A;  3MD2 A;  2QVO A;  4KDP A;  1D5V A;  1XS9 A;  3I55 I;  2CS3 A;  1P2F A;  2D1V A;  2EFN A;  5IPA A;  2ESN A;  3K1M A;  4M9Z A;  1HW5 A;  4XLN F;  2W1O A;  2P4W A;  3WE2 A;  2K9L A;  1DQU A;  1XDS A;  2O3F A;  5E3N A;  2RAE A;  1OCR H;  4NDL A;  2Q8K A;  3V7R A;  4LJZ F;  3HUG B;  5EGO A;  2I5U A;  1W7P A;  3OL3 A;  2F5F A;  2HDC A;  2VJI A;  4IKF A;  4BAY A;  5GTH C;  2ZXW H;  5B1A H;  3HXL A;  3FBN B;  3RDI A;  4BXX J;  2DI3 A;  1RKT A;  3OYG A;  1J7K A;  1Q1V A;  2E5N A;  3MWM A;  5GAE J;  3LST A;  4QPO A;  1H89 C;  4FX0 A;  2PMZ N;  4A0Y A;  3PUB A;  2BHZ A;  4CCN A;  1LFU P;  3K10 A;  4O3M A;  5FKN A;  1RES A;  1ZG3 A;  4A3F J;  2KPM A;  2O6G E;  1UHW A;  2MA3 A;  2LH9 A;  3HPG A;  3K6G A;  1OIS A;  2CGP A;  4HDU A;  4E4H A;  3H1C A;  5L3C A;  4EJO A;  3HEF A;  1Y0U A;  1BW6 A;  3PNV A;  1W0T A;  3CCV I;  1ZR2 A;  1OKR A;  2VJJ A;  4EV0 A;  3S1N J;  1Z7U A;  2LKP A;  2Q2E A;  1GV2 A;  1MKM A;  4S05 A;  1MDM A;  3HOV J;  2IA2 A;  1JHF A;  2WAQ A;  3VSK A;  2XAG A;  2M1B A;  3JRH A;  2HGC A;  2IXS A;  1SFU A;  2AXL A;  2FOK A;  5DCM B;  3OL4 A;  1L3L A;  3D5R C;  3I59 A;  4AWX B;  3IV5 A;  2R7U A;  2O9L A;  4A3K J;  9ANT A;  2L7F P;  4XMY A;  1AA7 A;  2DMN A;  2JPB A;  2Y75 A;  3OR2 C;  3CJR B;  4M6Y A;  1GT0 C;  2IA0 A;  3M7G A;  4HEA 2;  1KQ9 A;  1OYY A;  2QUF A;  3MVP A;  5CVR A;  5D5X B;  3QOD A;  4LD5 A;  3DKX A;  2JK3 A;  2QQ9 A;  3E1S A;  3QWL A;  2GA2 A;  2NAZ A;  5M3F J;  1R6R A;  2QSG X;  3EQL F;  3GFM A;  3PQJ A;  4LGW A;  1P4W A;  1U5T A;  3C2G A;  4RA2 A;  3JRF A;  4Q4Z F;  2K7L A;  3QOP A;  1PYV A;  2HKO A;  5DUI A;  2LY9 A;  2AXT C;  4JP0 A;  4OAY A;  4DBQ A;  2G7H A;  3A2K A;  4XQF A;  5ERI A;  1K83 J;  1MGT A;  3DEU A;  3J81 Z;  5KNL A;  2E71 A;  1KGS A;  2L4A A;  3TBI A;  1ZYR F;  2W57 A;  2BZT A;  2H6C A;  5C4J J;  2IAI A;  2HR3 A;  2V9P A;  3NWT A;  2ETH A;  2DFI A;  4XOT A;  4A12 A;  2KIF A;  3OWT A;  4S0H B;  1QVT A;  3G1M A;  3PUF A;  2JT1 A;  3SFI A;  2AQE A;  5A2Q Z;  2R7V A;  2V1X A;  2GOX B;  3CCQ I;  2BOL A;  2EBI A;  3RKY A;  3U1K A;  4BQQ A;  3OYK A;  3O8G A;  1GVD A;  2F5D A;  5B1B H;  2HTS A;  1XMX A;  1ZG5 A;  3NWS A;  2P81 A;  4BBR J;  3WTZ A;  3LFK A;  4PJN A;  3CCS I;  3ESW B;  2NS8 A;  4BS9 A;  1QZE A;  2ZXH A;  2EZI A;  3FIS A;  1IW7 F;  4GYI A;  4AD9 A;  5J8F A;  1A31 A;  1R7J A;  3EDP A;  2O8K A;  3IH4 A;  2CJJ A;  5J47 A;  2Z99 A;  3GBG A;  1K4S A;  5ICG A;  4RDU A;  5DD8 A;  3EUH C;  3DEW A;  2FBK A;  4IL6 C;  3GCM A;  4XLF A;  3LSR A;  1W4M A;  5IP9 J;  1S3J A;  2GAU A;  4EJT A;  1W5T A;  2KDO A;  1VQL I;  2X1C A;  1TP4 A;  4LFU A;  1SAN A;  3WGI A;  3OMY A;  3ASN H;  3L2C A;  1SFE A;  2BW3 A;  2XAH A;  4DZP A;  5FJ8 J;  2L9R A;  2PFB A;  2YR2 A;  4A3D J;  5EZH A;  5D5W B;  2EPF A;  1BI3 A;  1FIP A;  2YX4 A;  2WWY A;  3WTV C;  3OYD A;  1ETX A;  3AKZ A;  4NNJ A;  2ECB A;  1JTY A;  1X2M A;  1RIO H;  4B09 A;  1O3S A;  5CYV A;  4KYW A;  2M87 A;  3FMS A;  1Z21 A;  3TO7 A;  2E35 A;  1GLN A;  1OR7 C;  2DFE A;  4C3J J;  2EV0 A;  2HOE A;  5JI6 A;  3ASO H;  1K6O A;  4E7S A;  4OIQ F;  4UXN A;  5BQT A;  2NVX J;  3G4S I;  1ZAR A;  5M5Y J;  1G8X A;  1IUF A;  2Y0S A;  3IC7 A;  3RJP A;  2K3F A;  4G94 A;  5FO5 A;  4N0B A;  2JUC A;  5FKL A;  3GME A;  2XHK A;  3ECO A;  4K2E A;  4L9T A;  5M5W J;  4LK0 F;  2CV2 A;  3BTC A;  4CYD A;  4PJ0 C;  4BY1 J;  3KP6 A;  3F72 A;  3N4M A;  3ZRG A;  3CO6 C;  2BXZ A;  3WGH A;  3BLY A;  2RGV A;  1J2X A;  1QGP A;  2L9V A;  4PCQ A;  3QP6 A;  2FMY A;  3HIF A;  2JWT A;  3ABU A;  3S3N A;  4CA0 A;  5BPD A;  1FWZ A;  2W7N A;  2JTV A;  4I09 A;  1QZY A;  1A5J A;  1FT9 A;  3GEZ A;  1SD4 A;  2Y9Y A;  2RRE A;  3ROU A;  4BE1 A;  2ZME B;  2VL8 A;  1Y8Q B;  3FKJ A;  5HLT A;  1F9N A;  2LTP A;  4BQA A;  4KN7 X;  1YW9 A;  2DU9 A;  2P5K A;  4UB6 C;  1H9T A;  3HSF A;  1E17 A;  2IS2 A;  2HXO A;  4M72 A;  4XM3 A;  2B9S A;  1HKS A;  2V6E A;  2D45 A;  4EM1 A;  1KA8 A;  3WTW C;  3OYB A;  2ZNY A;  2LYC A;  5H2F C;  3ELK A;  1E2X A;  4HNT A;  4HST A;  4N4O B;  2JZY A;  1W7P B;  2OQG A;  1ZK8 A;  1MMD A;  2BYV E;  2VKH A;  1UAA A;  4CCK A;  4I76 A;  2W00 A;  1W5S A;  2VBZ A;  1FTZ A;  2K9M A;  4A3I J;  2HWV A;  2IBD A;  2F6C A;  1GXP A;  1LVK A;  4Q5S F;  3LSI A;  1X3U A;  1YYV A;  1S7A A;  1R1T A;  3A1Y A;  1WJF A;  1P4X A;  1SVL A;  1XCV A;  5DYM A;  3MCZ A;  1XC5 A;  1REP C;  2O8X A;  4WXC A;  5FKK A;  3SDG A;  3KP7 A;  1ZLJ A;  2CW8 A;  1LFB A;  1VND A;  2VI6 A;  4RGU A;  2XAJ A;  2R7Q A;  4BHC A;  4DYR A;  2K9S A;  4BDY A;  4EGY A;  3GTP J;  2EIL H;  2EQR A;  2WC2 A;  2EB7 A;  3FMR A;  2BHY A;  2H6B A;  4EAT A;  5ED4 A;  2O7O A;  4AM3 A;  5D8L B;  4JOM A;  3I54 A;  1B4A A;  4RB0 A;  1S8N A;  2WAD A;  2DTR A;  2DK8 A;  1YIJ I;  3A02 A;  2DMT A;  1ZTR A;  2PEX A;  2LY1 A;  2Q2E B;  4EGZ A;  1MDM B;  3BQZ A;  2CWE A;  2LF8 A;  5DEQ A;  3RPQ A;  5ILU A;  2XRL A;  2X9D A;  3HOZ J;  4ZDO A;  4D0P A;  1I6H J;  2NS7 A;  1X1A A;  2H27 A;  1IN6 A;  2WV1 A;  2ME6 A;  2L9N A;  3ZCO A;  1LDJ A;  2M2E A;  1IUY A;  2UV1 A;  2Z9O A;  1T2K A;  4Y7N J;  3CC7 I;  2VE9 A;  2OZU A;  1J9I A;  3CTA A;  2F2E A;  1SD5 A;  3SZP A;  4RGX A;  1Z91 A;  3ZMV A;  3BG9 A;  4FET A;  3KX2 A;  5FLV A;  2QF7 A;  4PSW A;  4G7H F;  4QTR A;  1FLI A;  3ERM A;  3EYI A;  2XPW A;  1IDY A;  3BJA A;  1K4T A;  3CUO A;  3A03 A;  2ZBK A;  4WF2 A;  5K7Z A;  1RRJ A;  1U5T B;  3JCU C;  1D0Z A;  3VYS B;  3ABL H;  4I0B A;  1WJA A;  5HLH A;  3E5X A;  1N77 A;  2DJN A;  3TED A;  1OCT C;  1LQ1 A;  2JRM A;  1J5Y A;  2K4B A;  1OCO H;  2HYG D;  4OIO F;  2DMU A;  2VXZ A;  3MKY B;  3RZO J;  2NS0 A;  2XUB A;  4KIG A;  5EEA A;  3LA3 A;  4I98 B;  5CKT A;  2FJ1 A;  5FKM A;  5J40 A;  3DXJ F;  4F52 A;  1K61 A;  2GLO A;  3I4M J;  2KIS A;  2XVC A;  1MJB A;  5DS9 A;  3EUA A;  2XV4 S;  2P8T A;  2F4O B;  2GZW A;  3AG4 H;  5LEK A;  3I4N J;  1HC8 A;  3BRO A;  3FKI J;  1AKH A;  2EWN A;  2EZK A;  3L9F A;  1VQ7 I;  3UKG A;  1O57 A;  1VQ6 I;  4A5M A;  4FIS A;  2VE8 A;  5D5V B;  1TT5 B;  1I6X A;  1JKQ C;  2PN6 A;  2HOA A;  2Y0S N;  4LIU A;  2XC7 A;  1WKM A;  4G7O F;  1JT0 A;  3H3V K;  3E0J B;  3FIW A;  3EPZ A;  4M71 A;  2DA4 A;  4CCM A;  2MBF A;  5L3G A;  4B3A A;  1DPR A;  4FHT A;  4RS8 A; 
#chains in the Genus database with same CATH homology
 1FBS A;  5BMZ A;  3QAH A;  2K27 A;  3RKW A;  5DCF A;  3E5Q A;  2IJL A;  2IT0 A;  3QPH A;  4HQE A;  4HW0 A;  2EFO A;  2PLY A;  1HSJ A;  3D5L A;  5D6F A;  1D8J A;  4KIB A;  1IN4 A;  3F8C A;  5K5Q A;  5F64 A;  2G9W A;  2OD5 A;  3GF2 A;  1OYI A;  4M74 A;  1RZ4 A;  3RYP A;  2P6T A;  1XGM A;  3ZMT A;  1PP8 F;  2ZJ2 A;  5HDN A;  1SFX A;  1ON1 A;  4KMU X;  4HQM A;  1FPQ A;  1K7A A;  1ZRE A;  1I1S A;  3IL2 A;  1Z6T A;  3SQN A;  5HLI A;  2DW4 A;  2ZCW A;  1ZAO A;  2A3S A;  3FHZ A;  4GGG A;  2KIM A;  2EJR A;  3L09 A;  3QU6 A;  4RB2 C;  1KU3 A;  2F5E A;  3TOA A;  3ZMD A;  2A6H F;  1LVA A;  4XLP F;  2JRT A;  5CVV A;  4KUM A;  4MNU A;  3RIR A;  1ONV A;  5ILV A;  2RV8 A;  1B9N A;  1IZ1 A;  4IJA A;  2WTE A;  3DPL C;  4A0X A;  4L9J A;  3ML6 A;  1KYZ A;  4BH9 A;  3IRQ A;  3N97 A;  4BHB A;  2QZ8 A;  5E18 F;  3E97 A;  3MZY A;  3V7C A;  4HLY A;  1U78 A;  2X4H A;  1R58 A;  4HV6 A;  1G3W A;  3ZN0 A;  1U8R A;  5HVQ C;  5A2Q K;  1TW2 A;  1T38 A;  5D5U B;  5IT3 A;  3F6O A;  3O2P E;  3REO A;  1ZGA A;  3KLO A;  4EJV A;  5DV5 A;  1H0M A;  1U5T C;  1ODD A;  2VOO A;  4ASN A;  5LLQ A;  3LAJ A;  3GLX A;  4IPA A;  3C7J A;  1BI0 A;  5ICC A;  4TV7 A;  3LQR A;  4OU0 A;  1V4R A;  3T8T A;  3DQV C;  4LG0 A;  1SAX A;  4NB5 A;  1UCR A;  5IT9 Z;  2PMU A;  1R1U A;  5CJ9 A;  1A04 A;  3FMQ A;  1BIA A;  1ZHF A;  3SFZ A;  4IRG A;  5LHH A;  4HYE A;  4I7H A;  3TKY A;  4M73 A;  4OOI A;  1I27 A;  4Y15 A;  3JAM Z;  3ISP A;  4HAM A;  2XGX A;  4M6X A;  3TOB A;  1MJ9 A;  2ESH A;  2NRA C;  1YW7 A;  3DF8 A;  3WTS C;  1TNS A;  2RNJ A;  2QEN A;  2HYF A;  2E7W A;  4WXD A;  2J5P A;  3IRR A;  2OU2 A;  3J7A O;  5HLG A;  3SZT A;  2V79 A;  1P92 A;  3DKW A;  3IHU A;  3KE2 A;  2QLZ A;  4HX8 A;  3M8F A;  2EFW A;  3BPV A;  3KP2 A;  2A07 F;  2MC3 A;  1F5T A;  3V8L A;  1BJA A;  1B1B A;  4G9Y A;  3RI4 A;  2OAZ A;  3V8K A;  3GFL A;  5L3F A;  4XSZ F;  5KK1 A;  3JSP A;  4ZZL A;  2YSR A;  3DFG A;  2FNP A;  3TO9 A;  2XKO A;  3MFK A;  2QM3 A;  3T1B A;  3MAJ A;  3P7N A;  4LK1 F;  2CG4 A;  1XN7 A;  2FEZ A;  1OPC A;  3I64 A;  1FNN A;  1T0F A;  2HTJ A;  2F5C A;  1XSX A;  5LEJ A;  3BY6 A;  4EMS A;  1MZB A;  2OZ6 A;  5L3E A;  2MH9 A;  3B02 A;  2GXG A;  1BBY A;  3E5U A;  4ZZD A;  1BOA A;  3LA2 A;  1Z6R A;  1QBJ A;  5HDG A;  1R23 A;  4OIP F;  2A5Y B;  5E8I A;  2HFH A;  2DPU A;  4YFN F;  1WQ2 A;  4LB6 B;  5E20 A;  1FP1 D;  4HV5 A;  2XKP A;  4HF2 A;  5HS8 A;  2CO5 A;  2DO7 A;  2CSO A;  2V9V A;  3WU0 A;  3I5U A;  2O03 A;  5BPI A;  3H3Z A;  5E8G A;  2K02 A;  4ENJ A;  2GA1 A;  3R0A A;  2ZXJ A;  3AAF A;  4O5V A;  2DK5 A;  1QNT A;  4ON0 A;  1CF7 B;  3HRS A;  3VEP A;  1XMA A;  4ZYG A;  4OIR F;  3T0Y A;  2VBX A;  3GFI A;  4RB3 C;  4WCG A;  5JR3 A;  3ZN1 A;  3BZ6 A;  3F8M A;  1AWC A;  1PP7 U;  4WX9 A;  3K0L A;  4U0V A;  4FX4 A;  3I71 A;  4LG0 B;  3KFW X;  5FB2 A;  2COM A;  2W84 A;  1S29 A;  3EYY A;  1FZP B;  4N9H A;  1NHA A;  2E7X A;  4P5O A;  5HS7 A;  1EH6 A;  2GWR A;  1T39 A;  3ECH A;  2FU4 A;  1ZRD A;  2IPQ X;  1F1Z A;  1UB9 A;  2JPC A;  4PGG A;  2ZO4 A;  2VBW A;  1SD7 A;  3ZMS A;  3KP5 A;  1YTY A;  3TDU C;  4RAY A;  1SD6 A;  5LGU A;  2EA4 A;  5D6E A;  5AIP A;  1RNL A;  2W25 A;  2DQL A;  1FX7 A;  3FXR A;  2ISY A;  5D4S A;  1QO0 D;  4KT5 C;  4IVN A;  3HOT A;  3VOE A;  2K86 A;  2L01 A;  3K69 A;  1FSH A;  3U9G A;  3WTU C;  2EK5 A;  3IKT A;  1IF1 A;  1YS7 A;  5H6R A;  4JBA A;  3G3Z A;  4RAZ A;  2UXX A;  4ENM A;  4RGS A;  3E6M A;  3KET A;  1XGN A;  2HKX A;  5LGT A;  2LSO A;  2NYX A;  2H94 A;  2DPD A;  1BI1 A;  1ZLK A;  4WXH A;  3HRU A;  1HKT A;  2BE5 F;  2B0L A;  3KZY A;  1D3Y A;  3M8E A;  1TQM A;  1HBX G;  3G73 A;  1QZZ A;  1U3E M;  1SMT A;  3FM3 A;  3BP8 A;  1AOY A;  4L5I A;  3CDH A;  3HSR A;  4CGZ A;  2PQ8 A;  1G3T A;  4U0W A;  5K1Y A;  1WI9 A;  3SXY A;  4YFX F;  1ON2 A;  3QPT A;  2QWW A;  5ICF A;  1UFM A;  2ZFW A;  4Y17 A;  1GHC A;  1O3T A;  2PI0 A;  3HYI A;  3KP4 A;  3L00 A;  3LQQ A;  3RYR A;  4MQ9 F;  2Y48 A;  3CUQ B;  4JQF A;  1MD0 A;  5IT9 K;  2IP2 A;  3C3W A;  1LEA A;  4HA8 A;  1ZRF A;  2C6Y A;  2LF7 A;  5E1W A;  1PDN C;  1O3R A;  4MHG A;  4L18 B;  2A6E F;  4RGR A;  3ZMZ A;  3TO6 A;  2YX7 A;  1IXC A;  3JAM K;  1UHM A;  1XGO A;  5LBQ A;  4PDK A;  3L7W A;  3COA C;  2Z3Y A;  4EQQ A;  1FYK A;  2IRF G;  4EJU A;  2IW5 A;  1CGP A;  3LA7 A;  5F1R A;  1YS6 A;  2XAF A;  1Z1D A;  1KQ8 A;  3GFJ A;  2FF4 A;  5ICE A;  4L5J A;  4ZYH A;  2O0Y A;  2H09 A;  3S2W A;  4IRI A;  2VBY A;  3FXU A;  3M1E A;  2WV0 A;  3U2R A;  1JHH A;  3F8F A;  1BC8 C;  4CDG A;  3TQN A;  5FD5 A;  4RB1 A;  1V3F A;  4HLX A;  4R8H A;  3R60 A;  2VON A;  1YIO A;  3BDD A;  6PAX A;  2RKH A;  2VT2 A;  1KU9 A;  3GWZ A;  5H20 A;  1FOK A;  4IRH A;  3GVA A;  5FLX Z;  2OBP A;  1O7L A;  1KU7 A;  5LGN A;  3DPT A;  1T98 A;  2CQK A;  1TQI A;  1XGS A;  4LLL A;  2FE3 A;  2EA2 A;  2UXN A;  2E1C A;  2TDX A;  2P5L C;  4P9U A;  4LLG F;  1UST A;  4CXF A;  5AON A;  2QBY B;  5F6F A;  4B8X A;  2O61 A;  4KIF A;  1QQI A;  2A69 F;  1OMI A;  4UNO A;  1GVJ A;  3B73 A;  2BBY A;  3E6C C;  3HRT A;  2FXA A;  2G7U A;  1JE8 A;  1CF7 A;  3ZMU A;  4LB5 A;  5J8C A;  2DQR A;  1RIO H;  5DDG A;  5LRS A;  4UVB A;  1YFH A;  1R00 A;  1XMK A;  3K1P A;  1FP2 A;  3WU1 B;  4CO8 A;  4EJW A;  1B59 A;  3FM5 A;  4YIF A;  5HOO A;  2UZK A;  4M9S A;  3MEX A;  4MTD A;  4L0Y B;  2A68 F;  4F7Z A;  4MQV A;  4GYG A;  4HBL A;  5D4R A;  3CLO A;  5BOX A;  2IA1 A;  3GXO A;  2M30 A;  2NNY A;  2L54 A;  1XDU A;  1LJ9 A;  3HRM A;  4CIC A;  3CUQ C;  3M9A A;  3ABT A;  2KJB A;  1FYM A;  2HQN A;  4DNC A;  5LRR A;  3ZQ7 A;  1K78 A;  2YU3 A;  2PJP A;  4QLC U;  2K4J A;  1FBQ A;  2ZNZ A;  5E1X A;  3WGG A;  2DBB A;  3BOQ A;  3MQ0 A;  2EFP A;  4LLN A;  1KQ0 A;  2D2W A;  2V6C A;  3CJN A;  1K79 A;  3E6B A;  2Q0O A;  1I5Z A;  1YG2 A;  1KYW A;  1B9M A;  1KU2 A;  1XSV A;  3QP5 A;  3I0T A;  1ZRC A;  3GUD A;  2ACJ A;  4P55 A;  3SHF A;  1O7F A;  1ZN2 A;  1IN7 A;  2RN7 A;  2KKO A;  4KMF A;  3J80 Z;  3IWF A;  2M45 A;  2OA4 A;  2QYO A;  1G6N A;  1R22 A;  2PBI A;  4L0Z B;  2FQ3 A;  3F3X A;  2GQQ A;  2IVM A;  5E1Z B;  1FYL A;  2J5O A;  2BGC A;  4AIH A;  2D1H A;  4R1H A;  3I53 A;  5J6X A;  3Q5F A;  1IRG A;  4IF4 A;  1R5G A;  4UHT A;  2HQR A;  3R4K A;  5CVJ A;  2RQP A;  3VOD A;  3FX3 A;  3HSE A;  3IKV A;  4E70 A;  4OMZ A;  3GYH X;  4Y13 A;  1S6L A;  1EV7 A;  1WRJ A;  1HW1 A;  1L0O C;  1G4D A;  5CLS A;  4I0A A;  3BWG A;  4NQW A;  1SMY F;  1FBU A;  2W85 A;  2VC1 A;  2HS5 A;  4ZH4 F;  5KVR A;  2W24 A;  3RKX A;  1J59 A;  1XB4 A;  1Q1H A;  3KEQ A;  4MTE A;  4AVP A;  4A6D A;  4YG2 F;  1WWX A;  1TTY A;  1S7O A;  1DUX C;  1LB2 A;  3CUQ A;  5FD6 A;  3KLN A;  1XD7 A;  2BEO A;  5EEH A;  4ETS A;  4M9X A;  5L3B A;  4QWQ A;  3JTG A;  4XBF A;  1XCB A;  4XRF A;  1R36 A;  4OMY A;  4I2O A;  3NRV A;  4GXO A;  4ENK A;  1F4K A;  4G6D A;  2X0L A;  4PGH A;  3OOP A;  5ILS A;  3LAP A;  3H3U A;  4U88 A;  1DP7 P;  4N9I A;  4UV9 A;  2P7V B;  2M8E A;  1TQP A;  3BJ6 A;  4KA4 A;  3O6B B;  4JK1 X;  3R6S A;  4S04 A;  1IN8 A;  2XAS A;  1YQA A;  1DPU A;  3V7S A;  3KEO A;  1PUE E;  1XSD A;  2MLK A;  2KRF A;  4HZF A;  1G3Y A;  4WK8 F;  5FGM A;  1BI2 A;  5JFR A;  5L3D A;  2MH2 A;  2NNN A;  5D8K B;  1P4A A;  2STT A;  2ADU A;  1R1V A;  2CYY A;  3JTH A;  3P9C A;  4BNC A;  1BIB A;  4A2U A;  1K78 B;  1U2W A;  2Y0M A;  3T8R A;  4L9N A;  5JVT A;  3GZ5 A;  4KNY A;  1GXQ A;  1TW3 A;  1FSE A;  2LDU A;  2EV6 A;  1RUO A;  1EH7 A;  5FFZ A;  4YFK F;  3BPX A;  3KP3 A;  2QBY A;  4IHS A;  5E17 F;  1JXS A;  2E1N A;  5FLX K;  2P5V A;  1IAW A;  4KN4 X;  1Z05 A;  2L3D A;  4Q48 A;  1HKQ A;  3JSO A;  4HX4 A;  2GIV A;  1I1G A;  2DAO A;  3TDZ C;  4P9F A;  1IXR C;  5JHU A;  5AIQ A;  1LDK B;  2YPR A;  3P9I A;  4DQ2 A;  1LEB A;  2XIG A;  2FBI A;  2VC0 A;  3E3V A;  3K9T A;  1HW2 A;  1IXS B;  2AS5 F;  4ESB A;  1STZ A;  1BM9 A;  4UUV A;  3PFI A;  4I02 A;  5H6Q A;  1RUN A;  3IWZ A;  3I58 A;  4UVC A;  1P6R A;  2Z33 A;  2MLG A;  2P6S A;  3HHH A;  1WSU A;  4XSX F;  5DUK A;  1H9G A;  3E6D A;  3ZP5 A;  3ULQ B;  1HST A;  4G7Z F;  2ISZ A;  3EUH A;  3FF5 A;  3I59 B;  4G6Q A;  2CFX A;  3FWE A;  4ZYD A;  3RPU A;  4O6J A;  2R7F A;  2FML A;  3WG9 A;  1LNW A;  3GW2 A;  4PZJ A;  1BC7 C;  4NHJ A;  2DLL A;  2V1U A;  1RI7 A;  1YLF A;  5EEG A;  1OR7 A;  4BHP A;  1HQC A;  4WWC A;  1QPM A;  3K1N A;  3O3K A;  2VOP A;  5BS6 A;  3HTS B;  2EV5 A;  4YII A;  4UV8 A;  2P7C B;  1FC3 A;  4IXA A;  4Z2Y A;  4HX7 A;  3C1D A;  3BJO A;  2L02 A;  4A5N A;  3K2Z A;  3HUG A;  4KIC A;  4AIJ A;  2RC4 A;  1BN5 A;  2MD5 A;  4H0E A;  1G3S A;  5LHI A;  4IHT A;  3WOD F;  3F8B A;  3J80 K;  3VFZ A;  4CZZ A;  4MEY F;  4MEX F;  3V8J A;  3KZZ A;  3NQO A;  4BXU A;  2BV6 A;  1FY7 A;  2M5W A;  1MJA A;  3I4P A;  3P9K A;  3WE3 A;  2HEO A;  3FZV A;  4AIK A;  2FNA A;  2PG4 A;  4ESF A;  5DCM A;  4A0Z A;  2ELH A;  3QU3 A;  4GO1 A;  3GO5 A;  3FXQ A;  5LHG A;  2FA5 A;  3V4G A;  3TGN A;  3H92 A;  4ZYE A;  1R5H A;  5TRD A;  2VOD A;  4HDV A;  4G8X A;  2XRO A;  3GX4 X;  3T5X A;  1IRF A;  5HS9 A;  1O3Q A;  5DD4 A;  2EFQ A;  4OIN F;  5HDK A;  4R79 A;  3DP7 A;  5FFX A;  3F23 A;  2STW A;  2DT5 A;  2UWM A;  1Z9C A;  3OV8 A;  3WTY C;  1C0W A;  4LMY A;  4U0Y A;  3Q9V A;  1TLH B;  2PMH A;  3WTT C;  3KCC A;  2XRN A;  1TBX A;  4HF0 A;  3J81 K;  3QRF F;  1EH8 A;  3NEU A;  4A6E A;  4U7D A;  2R3S A;  3EET A;  2HZT A;  1B6A A;  3PQK A;  5K5O A;  4BYY A;  2RVC A;  1ZG1 A;  1ZH5 A;  2L4M A;  2ZKZ A;  2FRH A;  4GCV A;  1USS A;  3W6K B;  5K5R A;  3C18 A;  2KJC A;  4EVI A;  3Q9S A;  3HHG A;  2QQA A;  4I01 A;  4UVA A;  3W6J B;  1T6S A;  2VT3 A;  2QQB A;  3CO7 C;  1HXD A;  4FT8 A;  4KFC A;  1LDD A;  4EM2 A;  5TJJ A;  4P96 A;  3LWF A;  2VN2 A;  4ESJ A;  1JGS A;  2FBH A;  1W7P D;  4ENN A;  2JSC A;  4EM0 B;  2FSW A;  2Z5U A;  3F6V A;  1J0R A;  3R0J A;  1U6G A;  3R61 A;  2V1D A;  1YW8 A;  3GZ6 A;  1VTN C;  2KIU A;  1YO5 C;  4MGR A;  2CW0 F;  1TNT A;  2OQR A;  3ERE D;  3MZH A;  3F22 A;  4HF1 A;  5CVI A;  3WTX C;  4HOB A;  3U1D A;  3HOS A;  1DDN A;  1IN5 A;  3D0S A;  5CVU A;  1ULY A;  2A61 A;  3VB2 A;  2RDP A;  3RTR A;  3F8N A;  2XAQ A;  1OYW A;  3DV8 A;  1D8K A;  1ZGJ A;  2LNB A;  4Q47 A;  3ZPL A;  1J75 A;  4CHU A;  2GXB A;  3JW4 A;  4U7B A;  3F21 A;  3HTU A;  4L9V A;  2ZME A;  4KDP A;  2R7D A;  2QVO A;  1D5V A;  1P2F A;  2D1V A;  2EFN A;  2ESN A;  3K1M A;  4M9Z A;  1HW5 A;  4XLN F;  2P4W A;  3WE2 A;  1XDS A;  2O3F A;  2Q8K A;  3V7R A;  4LJZ F;  1W7P A;  2F5F A;  2HDC A;  4BAY A;  3RDI A;  2DI3 A;  1J7K A;  3MWM A;  3LST A;  4FX0 A;  4A0Y A;  4O3M A;  1ZG3 A;  1UHW A;  2MA3 A;  2CGP A;  4HDU A;  5L3C A;  4EJO A;  1Y0U A;  1OKR A;  4EV0 A;  1Z7U A;  2LKP A;  2Q2E A;  4S05 A;  1MKM A;  1MDM A;  2IA2 A;  1JHF A;  2XAG A;  2M1B A;  2HGC A;  1SFU A;  2AXL A;  2FOK A;  5DCM B;  1L3L A;  3I59 A;  4AWX B;  2JPB A;  2Y75 A;  4M6Y A;  2IA0 A;  3M7G A;  5CVR A;  1KQ9 A;  1OYY A;  2QUF A;  5D5X B;  4LD5 A;  2QQ9 A;  2GA2 A;  2NAZ A;  3EQL F;  3GFM A;  3PQJ A;  4LGW A;  1P4W A;  1U5T A;  4Q4Z F;  2K7L A;  3QOP A;  2HKO A;  5DUI A;  2G7H A;  5ERI A;  1MGT A;  3DEU A;  3J81 Z;  1KGS A;  2L4A A;  1ZYR F;  2W57 A;  2H6C A;  2HR3 A;  2ETH A;  2DFI A;  4A12 A;  2KIF A;  2JT1 A;  5A2Q Z;  2V1X A;  3RKY A;  2F5D A;  2HTS A;  1ZG5 A;  3WTZ A;  3LFK A;  4AD9 A;  1IW7 F;  4GYI A;  5J8F A;  1R7J A;  3EDP A;  2Z99 A;  5ICG A;  5DD8 A;  2FBK A;  1W4M A;  1S3J A;  2GAU A;  4EJT A;  1W5T A;  4LFU A;  3WGI A;  3L2C A;  1SFE A;  2XAH A;  2PFB A;  2YR2 A;  5D5W B;  1BI3 A;  2YX4 A;  2WWY A;  3WTV C;  4B09 A;  1O3S A;  5CYV A;  4KYW A;  2M87 A;  3FMS A;  3TO7 A;  2EV0 A;  2HOE A;  5JI6 A;  1K6O A;  4OIQ F;  4UXN A;  5BQT A;  1ZAR A;  3IC7 A;  3RJP A;  4G94 A;  5FO5 A;  4N0B A;  2XHK A;  3ECO A;  4K2E A;  4L9T A;  4LK0 F;  4CYD A;  3KP6 A;  3F72 A;  3N4M A;  3CO6 C;  3WGH A;  2RGV A;  1J2X A;  1QGP A;  4PCQ A;  3QP6 A;  2FMY A;  3HIF A;  3ABU A;  5BPD A;  1FWZ A;  2JTV A;  4I09 A;  1QZY A;  1FT9 A;  3GEZ A;  1SD4 A;  3ROU A;  2ZME B;  1F9N A;  4BQA A;  4KN7 X;  1YW9 A;  2DU9 A;  2P5K A;  1H9T A;  3HSF A;  1E17 A;  4M72 A;  1HKS A;  2D45 A;  4EM1 A;  1KA8 A;  3WTW C;  2ZNY A;  3ELK A;  1E2X A;  2JZY A;  1W7P B;  2OQG A;  2BYV E;  1W5S A;  2VBZ A;  2HWV A;  1GXP A;  4Q5S F;  1X3U A;  1YYV A;  1S7A A;  1R1T A;  1P4X A;  1XCV A;  5DYM A;  3MCZ A;  1REP C;  2O8X A;  4WXC A;  3KP7 A;  1ZLJ A;  4RGU A;  4BHC A;  2XAJ A;  4EGY A;  2WC2 A;  2EB7 A;  3FMR A;  2H6B A;  5ED4 A;  5D8L B;  3I54 A;  1B4A A;  4RB0 A;  1S8N A;  2DTR A;  2DK8 A;  2PEX A;  4EGZ A;  1MDM B;  2CWE A;  2LF8 A;  5DEQ A;  3RPQ A;  5ILU A;  4D0P A;  2H27 A;  1IN6 A;  1LDJ A;  1IUY A;  2Z9O A;  1T2K A;  2VE9 A;  2OZU A;  1J9I A;  3CTA A;  2F2E A;  1SD5 A;  3SZP A;  4RGX A;  1Z91 A;  3ZMV A;  4G7H F;  1FLI A;  3EYI A;  3BJA A;  3CUO A;  4WF2 A;  2ZBK A;  1U5T B;  4I0B A;  5HLH A;  3E5X A;  1LQ1 A;  1J5Y A;  2K4B A;  2HYG D;  4OIO F;  2VXZ A;  2NS0 A;  2XUB A;  4KIG A;  2O6G E;  3LA3 A;  4I98 B;  3DXJ F;  2XVC A;  1MJB A;  2XV4 S;  2P8T A;  2GZW A;  5LEK A;  3BRO A;  2EWN A;  3L9F A;  1O57 A;  4A5M A;  2VE8 A;  5D5V B;  1I6X A;  2PN6 A;  1WKM A;  4G7O F;  4M71 A;  5L3G A;  2MBF A;  1DPR A;  4FHT A;  4RS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...