3F8CA

Crystal structure of multidrug binding transcriptional regulator lmrr complexed with hoechst 33342
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
106
structure length
103
Chain Sequence
EIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDEGRRKYYRLTEIGHENMRLAFESWSRVDKIIENLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the transcriptional regulator LmrR and its mechanism of multidrug recognition.
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, PadR-like family
total genus 36
structure length 103
sequence length 106
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f8cA00
2FNAA 4I98B 2PBIA 3J81Z 1FBQA 4HBLA 1FT9A 2RQPA 2D1VA 4CYDA 2P7CB 4IXAA 4HX4A 1K79A 4MEYF 1R5HA 2DTRA 4GCVA 4RB3C 2NYXA 2BV6A 3J80K 4HF0A 1G3WA 1D3YA 2DI3A 4RS8A 1JHFA 2XAGA 3F8CA 2P5VA 5HS9A 3R0AA 2M45A 3CO7C 2V6CA 2UXXA 1D5VA 4HQEA 2K4BA 2CFXA 3QP5A 3D0SA 4P9FA 1L0OC 3RJPA 3T5XA 2GXGA 1W5SA 2CYYA 4A0ZA 5D5VB 2XAQA 3V7SA 5FGMA 5HDGA 3GZ6A 2ACJA 4ENNA 3HSFA 3K1NA 3PQJA 2GIVA 1PP8F 2K4JA 1OR7A 2JTVA 4M9SA 1PP7U 2Y48A 3BPVA 2DPDA 2ZFWA 1Z91A 4KICA 2ZCWA 2IW5A 4RB1A 1D8JA 4GXOA 3M9AA 3FF5A 3DF8A 2GAUA 4LK0F 2GQQA 4KA4A 4IJAA 3Q5FA 2EA4A 4M9ZA 4Q5SF 3WTXC 4RGXA 1Z6TA 1R36A 2RVCA 5D8KB 3RKWA 3E5QA 1W5TA 1ZGJA 2YR2A 2O03A 5D4RA 5DCMA 2P4WA 4HZFA 4KMUX 3HRSA 3H3UA 4NQWA 2V79A 3I59B 1CF7B 1XMKA 3FMQA 2HQNA 1UHMA 3MZHA 1I5ZA 4BYYA 2O61A 1YIOA 5ICEA 3T1BA 5E1ZB 2ZMEB 4FHTA 2FF4A 3KP6A 5F64A 1HSJA 1O3RA 2EK5A 2IA2A 1VTNC 2P5KA 2FBHA 1S7AA 4KNYA 3U2RA 1BC7C 4QWQA 3FXRA 4PCQA 1J5YA 4MNUA 5CLSA 2D2WA 5CVIA 3GFJA 3HOTA 2WTEA 2DQRA 3LFKA 4HX8A 4XRFA 4HX7A 1RUNA 3CLOA 5F6FA 2PEXA 1TQPA 3QU6A 3GW2A 5FFZA 3ISPA 2NNYA 1IN7A 1FBUA 2Y75A 5H6QA 2F5FA 1OYIA 2ZNYA 2QLZA 2DPUA 4LLNA 1QPMA 1J7KA 4A6DA 4EJOA 4YG2F 3ZMUA 3ECHA 2MA3A 1X3UA 1ULYA 4OU0A 4NB5A 2ZNZA 2IPQX 5CJ9A 2XROA 2CG4A 5ICCA 3I58A 4O5VA 3WU0A 4YFNF 3HIFA 5FD5A 3BY6A 1TW3A 3BJOA 3DPLC 1KQ8A 4AVPA 1W7PA 4UXNA 3QU3A 2B0LA 4RGRA 4A5MA 2VC0A 1SAXA 4BH9A 2PN6A 1DP7P 3FMRA 3B73A 3HHHA 1W7PB 1BIBA 3FWEA 2J5PA 3G73A 4MTDA 1EH6A 2W24A 1BIAA 4ON0A 5AIPA 3WTZA 5DCFA 1MDMB 1Z7UA 1B9MA 4MQ9F 5A2QZ 2KJCA 1QZZA 3U9GA 2Q8KA 3LA3A 2F5CA 4ASNA 2G9WA 2L01A 3ABTA 2PI0A 2FEZA 1SFXA 3HUGA 1QQIA 4XSZF 4EGYA 3CO6C 3BP8A 3TDUC 4KT5C 3E5UA 4G8XA 3RPUA 1XCVA 1LQ1A 4EVIA 1E17A 2EA2A 2A5YB 3RYPA 4NHJA 1HXDA 5L3CA 1FY7A 2VT3A 1QNTA 1IUYA 3WTSC 5D5WB 5HLIA 2Z5UA 3ZMVA 1OYYA 1R1VA 2EV6A 5DD8A 1Z05A 2QENA 3K0LA 4L9VA 1TBXA 4UV8A 1KU3A 2HYGD 2R7FA 3TQNA 5BS6A 1KGSA 4HOBA 3GEZA 2LF7A 4IHSA 4ZH4F 2IP2A 5JI6A 5HDKA 4OIRF 4PGHA 5E1XA 5DUKA 2XVCA 4Y13A 5FD6A 1ZLJA 5DDGA 1IF1A 2QZ8A 3DP7A 2XIGA 3R0JA 4GO1A 4TV7A 4P9UA 2A07F 3TDZC 3MAJA 3F8MA 2VBXA 2X4HA 3EYYA 3BZ6A 3NRVA 2FSWA 4HA8A 5L3FA 3VFZA 3V7RA 1G6NA 2D45A 2DQLA 4I09A 2IA0A 3KCCA 5HVQC 2FMLA 2EFWA 1YW7A 4U0VA 3LA2A 4OIQF 5LGNA 4AIHA 4G9YA 1SFEA 5LRRA 3QOPA 4AIKA 1YS7A 4UNOA 1BC8C 5JFRA 3V4GA 2RV8A 4L5IA 4YFKF 5J8FA 2O6GE 2H09A 3R4KA 4GYGA 1I6XA 2STTA 1I1GA 4EJTA 2EFQA 3EDPA 3ABUA 3ZQ7A 3C1DA 4EM2A 1TW2A 2XKOA 3CJNA 3JTHA 1R00A 2PMUA 5CVJA 3IL2A 3KP7A 4BHBA 4GGGA 1USTA 2CQKA 4Q47A 4ESFA 1S8NA 3F22A 3JW4A 3O3KA 2ADUA 2EB7A 5FB2A 1EV7A 1K78A 1KYWA 3WODF 2QVOA 4RB0A 4HYEA 2A68F 4M6YA 1U2WA 2OQRA 3TO9A 1XB4A 3GYHX 2OQGA 4BHPA 1ON2A 3DKWA 2D1HA 4D0PA 2Z3YA 3DV8A 2CGPA 1SD6A 2QM3A 5D8LB 3WGIA 2E1CA 5HS7A 3O6BB 2DK5A 2C6YA 4EV0A 4Q4ZF 2VT2A 5IT9Z 2JRTA 1REPC 3FZVA 2M87A 3LAPA 2ZKZA 3IRRA 4OINF 3CTAA 1J2XA 2MH9A 2NAZA 1BOAA 2XV4S 4ETSA 1LDJA 3L2CA 1YW9A 2COMA 1RZ4A 2G7HA 3MCZA 2VOOA 5CVRA 4KIFA 4EJUA 1FX7A 3KEOA 5DV5A 5E8GA 1XSDA 3WTVC 1XD7A 1LB2A 1V3FA 1S29A 2ZO4A 3WE2A 3E6CC 4H0EA 1O3QA 3ECOA 4I7HA 1J75A 4UHTA 2KRFA 1GVJA 3LSTA 3J7AO 3RDIA 3ZMZA 4FX4A 5BMZA 4RGUA 1HKTA 5HLHA 1ZG5A 1P4AA 4IVNA 2X0LA 1O3SA 1ZRFA 1NHAA 1S7OA 2JSCA 5K1YA 2H27A 2DK8A 5L3BA 1UFMA 3NEUA 3E6DA 2QYOA 4R79A 3V8KA 3ZMSA 2ETHA 1Z6RA 5CVVA 2IA1A 1FSEA 3MZYA 4L18B 2W25A 1J59A 4IRGA 1BJAA 5JR3A 4PZJA 2FQ3A 1H9TA 1OKRA 4UUVA 3IC7A 3KFWX 2G7UA 1QGPA 4ZYDA 2PQ8A 1TQIA 5EEHA 5J6XA 1G3TA 1SD7A 3ERED 4I0AA 3GUDA 1DPRA 4MHGA 5JHUA 1JE8A 1WI9A 5TJJA 3COAC 4U0YA 2NS0A 2M1BA 1HW5A 4YIFA 4MQVA 1MDMA 2ESHA 1XDUA 2V1DA 3VODA 2KIMA 1R1UA 3S2WA 3RTRA 3IWZA 2R3SA 4A0YA 3GX4X 1Q1HA 4N9HA 1R58A 2DFIA 1JGSA 4EMSA 1EH7A 1O57A 3KP3A 4M72A 3KLOA 3PQKA 1ZLKA 1LJ9A 3P7NA 3I5UA 4A2UA 4Y15A 1XDSA 2LNBA 5BPDA 1DDNA 2NNNA 2VBWA 3DQVC 2K27A 3U1DA 6PAXA 5L3GA 1BI0A 1ZN2A 1FWZA 1P2FA 2VN2A 2R7DA 1YW8A 5ICFA 2V1XA 2HGCA 5ILSA 4DQ2A 3HRMA 3I54A 1FPQA 2LDUA 5FO5A 4E70A 1H9GA 1Y0UA 1IRFA 2HKOA 3EYIA 4UVCA 3JTGA 3C3WA 5AONA 5TRDA 3CUQA 3F6OA 1TTYA 4A6EA 2ISZA 3KP2A 1XGOA 2Q2EA 5HS8A 3LAJA 3JAMK 2RDPA 4BNCA 3FMSA 1OMIA 3E3VA 2AXLA 1ONVA 1WSUA 1TNSA 3CUQB 3I0TA 1IN6A 2DW4A 2FBKA 2Z9OA 4JQFA 1QZYA 4QLCU 4OIPF 3RKXA 2DU9A 2L3DA 3QAHA 1O7FA 3IKTA 4IF4A 2RN7A 2WC2A 4G6DA 2FU4A 3F23A 1U78A 3P9IA 2XAHA 5KK1A 3SXYA 4LB5A 3L09A 3D5LA 3RPQA 4KMFA 2FBIA 3QRFF 1ZYRF 1G3YA 1F1ZA 1U8RA 3P9KA 2A61A 5DYMA 3L00A 1SMYF 4CZZA 3JSOA 2QWWA 3MWMA 3ZN1A 1XGNA 1YTYA 5E1WA 3F8NA 5FFXA 5BQTA 3KETA 3IKVA 5ED4A 2UZKA 4M73A 1S3JA 1STZA 3QPTA 4R8HA 1BN5A 3FM3A 4HLXA 4RB2C 2VE9A 2ESNA 1ON1A 3SQNA 1K78B 2XUBA 4HV5A 2F5EA 4BHCA 4AIJA 2K7LA 4Z2YA 4PGGA 4IPAA 3P9CA 4LD5A 4A12A 1AOYA 1D8KA 3FXQA 5LHHA 2GWRA 2RKHA 5LGUA 3TO6A 2H6BA 3M8EA 5ERIA 4L0ZB 3RKYA 4OMYA 3BJAA 2HOEA 1RNLA 1F5TA 1P4WA 2YU3A 2YX4A 4A0XA 4KN4X 3FHZA 5K5OA 5HDNA 4LFUA 4FX0A 1ODDA 2FOKA 4AD9A 2GXBA 3HHGA 2IT0A 5D6FA 2HFHA 4HQMA 2VOPA 4OMZA 3ZP5A 1W4MA 2VBZA 2BGCA 4S04A 1U5TC 1YYVA 5LEJA 4ZYGA 1JHHA 3CUOA 1QBJA 3NQOA 2TDXA 3RI4A 3DEUA 2HYFA 4I02A 4G7ZF 3GXOA 2VBYA 1UCRA 3VB2A 3DFGA 2HQRA 2PMHA 3BDDA 4CHUA 3GZ5A 3W6KB 1TLHB 4WXDA 3N97A 1IAWA 4PDKA 1HBXG 1R5GA 5ILUA 4M71A 2JT1A 3GWZA 3FM5A 3LWFA 1O7LA 4P5OA 3I53A 4A5NA 4KUMA 1U3EM 3FX3A 4M6XA 3WGHA 2XRNA 5HLGA 3C18A 3HSEA 3VEPA 4KIGA 2EJRA 4MGRA 4G7OF 5LLQA 3ZMDA 3KZYA 3OOPA 5BOXA 3T0YA 4BAYA 2W57A 2DAOA 3TOAA 1FLIA 1SFUA 1OYWA 1K7AA 4UVBA 2P8TA 1T2KA 3QP6A 4N9IA 3ML6A 3WTYC 5FLXK 1L3LA 4AWXB 2UWMA 4HLYA 2XAFA 3K69A 2H94A 1Z9CA 4RAYA 4XLPF 1XSVA 3GFLA 3TGNA 1FOKA 5D5UB 2GA1A 1KA8A 1T0FA 4CXFA 4KYWA 1MJ9A 1MD0A 3WTWC 2O8XA 1T38A 1KU7A 2QQAA 2MC3A 1U6GA 1JXSA 5K5RA 2XKPA 5DD4A 2MH2A 4UV9A 4HF1A 1XCBA 2OA4A 2PJPA 1B4AA 3F21A 4LLLA 1BM9A 3F8FA 4YIIA 1C0WA 3K2ZA 4O3MA 2HTJA 4L5JA 4B8XA 3WTTC 4F7ZA 3TO7A 5A2QK 4L9TA 2FA5A 2A6HF 4MTEA 1KYZA 1XSXA 1ZGAA 2IVMA 3REOA 1LEBA 3I64A 3KE2A 4HF2A 3JAMZ 1FBSA 2GA2A 4EM0B 1B9NA 1FYLA 1ZARA 1AWCA 5AIQA 2JZYA 2LF8A 4EM1A 3HTSB 4U7BA 2WV0A 4LK1F 4ZZLA 4KIBA 1ZRCA 5DEQA 3E6BA 3I4PA 3L9FA 2DBBA 3RIRA 2MLKA 5F1RA 3SFZA 3BROA 1IN4A 3W6JB 4WWCA 2RC4A 4ENKA 4FT8A 2JPBA 2OAZA 3R61A 5FLXZ 4WXHA 5H20A 4XSXF 5KVRA 1KQ9A 4U7DA 3TOBA 2XHKA 2KIFA 4WX9A 1DUXC 2YPRA 1XGMA 1IXCA 2K86A 2O0YA 1SD4A 2MLGA 3K1PA 4HDVA 1G4DA 4WF2A 1FYMA 5D5XB 5E20A 2P5LC 2OD5A 4IRIA 2EV5A 4DNCA 3Q9SA 3T8RA 2KIUA 3MEXA 2UXNA 2P6SA 4GYIA 1BI1A 1UHWA 3KP5A 5ILVA 3J81K 4HDUA 1B59A 1MGTA 4N0BA 2F5DA 1P6RA 2ELHA 2MD5A 1IRGA 3F6VA 1EH8A 4KFCA 2XGXA 1IN8A 4KN7X 4CDGA 2ZJ2A 1J0RA 2M8EA 3IRQA 1RIOH 3HYIA 1HW2A 1BI2A 1W7PD 1WKMA 2BYVE 3LQQA 5CVUA 3GO5A 1FYKA 3I71A 1OPCA 2Q0OA 3IWFA 3GF2A 2QQ9A 1UB9A 3GLXA 2FE3A 4ENJA 1IXSB 2M5WA 4G6QA 1Z1DA 1SMTA 2EWNA 4IRHA 3BJ6A 2PFBA 1A04A 3H92A 5EEGA 4WXCA 5LEKA 1YFHA 1HSTA 4JK1X 3F3XA 2CW0F 2Y0MA 1ZH5A 3WE3A 4I01A 2OZ6A 4HAMA 1ZREA 2KKOA 2FNPA 5L3EA 4LMYA 2DO7A 2ZXJA 2XAJA 1FC3A 2V9VA 1HKQA 1YO5C 5CYVA 2YSRA 1BBYA 2HZTA 2VODA 2L54A 2EV0A 2FRHA 1ZHFA 1R22A 4EJWA 1TNTA 1LVAA 2RGVA 3ELKA 5LGTA 3AAFA 4I2OA 3F8BA 2PLYA 2GZWA 1PUEE 2MBFA 2L4MA 2CWEA 3KZZA 5D4SA 4ESJA 1U5TA 1WQ2A 2VC1A 3T8TA 5IT9K 2BEOA 2QUFA 4M74A 1LDDA 2CSOA 3OV8A 4UVAA 4CICA 3SZTA 3ZN0A 3WGGA 2HDCA 1IZ1A 1R7JA 1B6AA 5DUIA 1U5TB 4CGZA 1G3SA 1I27A 5LRSA 1YLFA 3MQ0A 5DCMB 2E7WA 4U88A 1P92A 2IRFG 3FXUA 3ROUA 3DPTA 3SHFA 4M9XA 4HV6A 1T98A 4OOIA 4L0YB 5LBQA 4EGZA 3M1EA 2FMYA 3I59A 1CF7A 5J8CA 4RAZA 4I0BA 1GXQA 3HTUA 1ZG3A 4WCGA 2F2EA 2ZMEA 3GFIA 2HWVA 3C7JA 3V8JA 3B02A 2A69F 3K9TA 4RGSA 1S6LA 2O3FA 4L9JA 3HOSA 2STWA 2RNJA 1CGPA 1MJAA 1PDNC 2VONA 1MJBA 2V1UA 4ENMA 1ZRDA 1IXRC 2QBYB 5K5QA 4G94A 3HSRA 3KEQA 4LJZF 1FNNA 2J5OA 4R1HA 1O3TA 4ESBA 3V8LA 3WU1B 1F9NA 2EFNA 1LEAA 3JSPA 5LHIA 2WWYA 2QBYA 2NRAC 4BXUA 2HEOA 4EJVA 1XMAA 2Z99A 1MZBA 2KJBA 2DT5A 1KU9A 4P96A 3ZMTA 1RI7A 1P4XA 3O2PE 3M7GA 3BPXA 4LLGF 3EQLF 4P55A 4YFXF 3ZPLA 1GXPA 1QO0D 4WK8F 2A6EF 2Z33A 4XLNF 3EUHA 2M30A 1IN5A 1H0MA 1SD5A 5HOOA 3E6MA 3R60A 2JPCA 3K1MA 3QPHA 4ZYEA 4EQQA 4K2EA 2YX7A 3IHUA 1J9IA 1FSHA 3L7WA 4ZYHA 3Q9VA 2ISYA 3LA7A 5BPIA 1DPUA 1MKMA 2PG4A 1TQMA 3HRTA 2HS5A 2IJLA 5L3DA 4L9NA 2ZBKA 2EFPA 2HR3A 1YQAA 1HKSA 2L02A 2OBPA 4U0WA 3SZPA 1T39A 5LHGA 1HW1A 2AS5F 3VOEA 3J80Z 4HW0A 1USSA 2HTSA 1XGSA 4XBFA 3WTUC 1YG2A 3PFIA 3EETA 4LG0A 1RUOA 3N4MA 2A3SA 3GFMA 5E18F 2LSOA 3KLNA 3LQRA 1YS6A 5JVTA 1XN7A 5E17F 2VE8A 3H3ZA 4LG0B 1FP2A 1KU2A 2DLLA 3CDHA 1IW7F 4MEXF 2FXAA 2EFOA 4CO8A 3HRUA 3DXJF 1WWXA 4KDPA 2LKPA 4Q48A 2H6CA 2OZUA 2OU2A 3WG9A 2BBYA 1V4RA 1F4KA 3CUQC 4B09A 1HQCA 3M8FA 4OIOF 2P6TA 1ZAOA 1BI3A 2E7XA 1KQ0A 1T6SA 2CO5A 1FZPB 1B1BA 2K02A 2W84A 3BOQA 3BWGA 4O6JA 5H6RA 3E97A 3F72A 4LB6B 2VXZA 2BE5F 2HKXA 4LGWA 2E1NA 2L4AA 3R6SA 5IT3A 3E5XA 5D6EA 1I1SA 5ICGA 4JBAA 3MFKA 3KP4A 1ZG1A 1FP1D 4Y17A 2XASA 1GHCA 1E2XA 4BQAA 4ZZDA 4S05A 1LDKB 3V7CA 2P7VB 2W85A 1LNWA 3GVAA 5E8IA 1K6OA 3G3ZA 4G7HF 1R1TA 4IHTA 2QQBA 3ULQB 1R23A 3RYRA 1WRJA 3TKYA
chains in the Genus database with same CATH superfamily
1V55H 2FNAA 4I98B 3OYNA 3NARA 2PBIA 3J81Z 5E3OA 1FBQA 4HBLA 3CJQB 2CQNA 3AG1H 2LREA 1FT9A 2RQPA 1TZLA 2D1VA 1ZQ3P 4CYDA 2P7CB 3BQYA 1WJ5A 1VQ6I 2Y0SN 4IXAA 3CP8A 4B3AA 3RZDJ 1EF4A 3BG7A 2MSYA 1MNEA 4HX4A 3VDXA 1K79A 4MEYF 1R5HA 1H8AC 2DTRA 4GCVA 4RB3C 1RKTA 5C4JJ 2NYXA 3AL0B 2W00A 4Y7NJ 2BV6A 2QF7A 3J80K 9ANTA 4HF0A 1FTTA 1KONA 1G3WA 3HDDA 1D3YA 2L2OA 2DI3A 4RS8A 1JHFA 3GMEA 1VZ0A 2XAGA 2P5VA 2DYSH 3F8CA 5JHFA 3OYEA 2GOXB 5FLMJ 1JKRC 5HS9A 3R0AA 2M45A 3CO7C 2V6CA 2UXXA 1OJLA 5CQEA 5C44J 1D5VA 4HQEA 4BL0B 2K4BA 3EUKL 2CFXA 3IUOA 4PJJA 3QP5A 3D0SA 3HOVJ 4P9FA 2VUMJ 1L0OC 4YELA 3RJPA 4W97A 5FKMA 2Y31A 3T5XA 1X1DA 2IGKA 4AVZA 1WGXA 2TCTA 2GXGA 1W5SA 2CYYA 2KQRA 4JOMA 2WB1A 4A0ZA 5D5VB 2OTJI 2YUSA 3H1CA 1UG0A 1IRXA 2XAQA 5IP6A 1PYVA 3V7SA 5FGMA 4D1QA 3PSFA 3G2BA 5HDGA 1MBHA 3GZ6A 2ACJA 3PNTA 4XLFA 4ENNA 3HSFA 3K1NA 1MBKA 3FBNB 3A01B 3PQJA 2GIVA 3ZGKA 2GOMA 1PP8F 2K4JA 2QEXI 2VLAA 2HQ5A 1OR7A 2JTVA 4M9SA 1PP7U 5J47A 2Y48A 3CZ6A 2Y9ZA 4CCJA 3BPVA 2DPDA 1T0FC 2ZFWA 3AFHA 2XPUA 1ITYA 3RQIA 1RETA 1Z91A 4XIDA 1MH3A 4KICA 2PMZN 2K5CA 3CCUI 5K7HA 2ZCWA 2IW5A 1ETQA 5JLXA 3NAUA 4RB1A 1D8JA 2KZVA 4GXOA 3M9AA 1UZCA 3FF5A 3DF8A 2GAUA 4LK0F 2GQQA 2COBA 2R5YA 4KA4A 5HNHA 3FXKA 1W1WE 1ZGWA 4IJAA 2XPVA 3Q5FA 2EA4A 4HEA2 2Y69H 3DLAA 4M9ZA 3J7ZI 4BJ5C 2LC2A 4HG2A 4CCOA 5J3LA 4Q5SF 2YS9A 3WTXC 2LG4A 3OS0A 4HNTA 5IP9J 4RGXA 1TT0A 5HODA 1Z6TA 1R36A 2RVCA 5D8KB 4PJLA 3GTKJ 3RKWA 3E5QA 3HB9A 1D1BA 1W5TA 1ZGJA 2EZLA 2YR2A 5E3MA 2O03A 5D4RA 2X9DA 2JVGA 1V54H 2P4WA 5DCMA 3VYUB 1AU7A 2EIKH 4HZFA 4KMUX 3HRSA 4LITA 4BJTA 3CCMI 3H3UA 4NQWA 2KL4A 2VIXA 2V79A 2ID6A 2Z1DA 3KZIC 3I59B 1CF7B 5EG0B 4JX5A 1XMKA 3OYIA 3FMQA 2HQNA 2ZSIB 1S7EA 1Q1VA 1UHMA 4RAGA 1VQ8I 3MZHA 1I5ZA 4BYYA 2O61A 1YIOA 5ICEA 3T1BA 2R7SA 5E1ZB 4AUXA 2ZMEB 2VJJA 4FHTA 2FF4A 3GTJJ 2R4GA 3KP6A 5F64A 2ZJRF 1HSJA 5C4XJ 1O3RA 3DBRB 2EK5A 3I4MJ 2IA2A 3JRCA 1VTNC 4D7MA 5EG0A 3CCEI 3IAM2 4BDZA 1WH7A 2P5KA 1X58A 3CF5F 2XGCA 4MFDA 2FBHA 1S7AA 1JJ6C 5EJCA 4KNYA 2CUJA 4XORA 1RRJA 1BR4A 4U87A 3U2RA 1BC7C 5EGOB 3S17J 4QWQA 2VKDA 3FXRA 4PCQA 1J5YA 1BA5A 4MNUA 1QVUA 2H1LA 2D2WA 5CLSA 2VPRA 1ETYA 5CVIA 4ZTFA 3GFJA 3HOTA 3VYTB 2BXZA 3G1OA 3H5AA 2WTEA 4CCLA 2DQRA 3LFKA 3JRIA 3EPZA 2JMWA 4HX8A 4BY7J 4XRFA 1SVOA 1JKOC 4HX7A 1RUNA 3CLOA 5F6FA 2PEXA 1MMGA 4Z6YA 3OYFA 3TW7A 1FMVA 1TQPA 1MBEA 5IOYA 3CMEI 4ABZA 3QU6A 3GW2A 5EGOA 5FFZA 3ISPA 2NNYA 3N05A 2IGNA 1IN7A 1XMXA 1V5GA 1FBUA 3LL7A 3AL0C 2X85A 2Y75A 5H6QA 2F5FA 2VASA 3CQZJ 1OYIA 3OR1C 3HOYJ 2ZNYA 2WY7Q 5EZHA 1WH5A 4YEJA 2QLZA 2DPUA 4LLNA 2KP6A 1QPMA 1YITI 3QYBA 2LR8A 1J7KA 2X1EA 4A6DA 3MKZA 2K3FA 2CU7A 2PJRB 4DZJA 3C2GA 4EJOA 2QGUA 3M3YJ 2DA6A 4AIDA 3DBLB 2HVQA 2Q1ZB 3ZMUA 4YG2F 3ECHA 1POGA 2MA3A 1X3UA 1HOMA 1ULYA 4OU0A 1N75A 4NB5A 1FOXA 2DDBA 2ZNZA 2IPQX 5CJ9A 1VQ7I 3K4CA 2VKVA 2XROA 3K4LA 2CG4A 2CS3A 2HDWA 3I58A 4O5VA 5ICCA 3OS2A 2HQAA 2V26A 2QSHX 4X6AJ 3WU0A 4YFNF 3HIFA 1R71A 4XOTA 4B43A 5FD5A 4BE1A 1WJDA 3BY6A 2DYRH 2VQCA 1TW3A 4UB8C 3BJOA 3DPLC 2XF7A 3HKZA 2IEKA 5FLVA 5FRMA 4AVPA 1W7PA 3DWLE 4D9JA 1KQ8A 4UXNA 3QU3A 2KISA 2M7AA 2EZKA 2B0LA 2H1KA 4RGRA 4A5MA 2VC0A 1SAXA 4BH9A 2PN6A 2MC4A 3LOCA 1UAAA 1DP7P 4DZPA 2JA2A 3BTCA 2VQHA 3FMRA 3B73A 4RM2A 4IHXA 3HHHA 2A6TA 4DW6A 1FOWA 3BR5A 1W7PB 2IS6A 1BIBA 3FWEA 4UB6C 2J5PA 3G73A 2R93J 3LSJA 1V5FA 4MTDA 1EH6A 2W24A 2WAEA 3K70C 4CCNA 1BIAA 4ON0A 3D5SC 3SEZA 3GCMA 1Y6IA 5AIPA 3WTZA 5JVGF 2KFDA 2XDVA 5DCFA 3HUGB 1QHGA 4YIRX 2DFHA 1MDMB 1Z7UA 1GV5A 3F9KA 2E71A 2H8RA 4BY1J 1B9MA 4MQ9F 2NOJB 5A2QZ 1K4TA 1W0UA 2KJCA 1QZZA 5CPRB 3U9GA 4B47A 2Q8KA 3LA3A 1HC8A 2VKHA 2F5CA 1B8IA 4ASNA 3HGYA 2G9WA 2L01A 3S3OA 3ABTA 3ZR8X 2PI0A 2FEZA 1SFXA 3HUGA 1QQIA 4XSZF 4EGYA 5IP7J 4YRVA 3CO6C 4X1EA 2L7KA 2L9NA 4KJZA 2MG4A 1YI2I 1XS9A 4A3CJ 2OTLI 4M3FA 3BZKA 4BXFA 4FASD 5K7FA 3BP8A 3TDUC 1YJNI 4N4OB 4KT5C 3HKZN 4W1UA 1SANA 3E5UA 4CUGA 3VPRA 4G8XA 1XC5A 3RPUA 1Z3YA 1W5CC 1XCVA 1LQ1A 4IHYA 5DM6F 2ECCA 2M3AA 4EVIA 1E17A 2EA2A 3UKGA 2A5YB 2WY8Q 3RYPA 2B9SA 2K40A 4NHJA 1HXDA 5L3CA 1FY7A 4F55A 2VT3A 1QNTA 3K6GA 1IUYA 3WTSC 2HVRA 5D5WB 5HLIA 3A2KA 3PO2J 1SC7A 2Z5UA 3ZMVA 1OYYA 1R1VA 2EV6A 1E0EA 5B1AH 3Q3SA 5DD8A 2LY2A 1Z05A 2QENA 3K4KA 4RBOA 3FIWA 3PUBA 4B1RA 3K0LA 1LKXA 2NVTJ 4L9VA 1TBXA 3LMMA 4UV8A 3FXLA 2O5RA 2OV7A 1KU3A 2JWTA 2HYGD 3ERMA 2R7FA 3TQNA 2QKMB 2X6WA 5BS6A 1KGSA 1VNDA 2VPLA 1JTYA 1OLTA 1OISA 2JUGA 4E7KA 1YHQI 4HOBA 3UNGC 3GEZA 2LF7A 1E3HA 2AQFA 1B72A 3WG7H 1IDZA 3BR3A 4IHSA 4ZH4F 2DDAA 2IP2A 5JI6A 5HDKA 2R7ZJ 5GAEJ 3OIQA 1OCOH 4FE4A 4OIRF 2KHMA 4PGHA 5E1XA 5DUKA 1FEXA 2XVCA 3RZOJ 4Y13A 2MABA 3CF2A 2JA8J 2Z16A 2L7ZA 5FD6A 1ZLJA 2ICWG 5DDGA 1SEUA 1IF1A 2QZ8A 2Q2EB 3DP7A 2X6YA 3Q0WA 3OR2C 1I3AA 2XB5A 1K4SA 2XIGA 3R0JA 4GO1A 2NVQJ 4AC0A 4TV7A 4P9UA 1R9TJ 3ZCOA 2A07F 3TDZC 3MAJA 1AKHA 3F8MA 2VBXA 2HZDA 2X4HA 2QSFX 2KZGA 3EYYA 3BZ6A 2ME6A 3NRVA 2FSWA 3I3LA 4GFBA 3W3CA 4HA8A 5L3FA 3VFZA 2JSPA 2LTPA 3V7RA 1G6NA 2NOGA 3BTIA 2D45A 2DQLA 1JI8A 1K61A 4I09A 2IA0A 3KCCA 1UELB 4ZDOA 4XN3A 2DT6A 5HVQC 3H9GA 2VJ5A 3BG6A 3BG5A 3KEYA 3IV5A 1BL0A 2B63J 4ZYAA 2FMLA 1M1EB 4RLFA 5GP9A 2EFWA 1YW7A 4Y52J 4U0VA 1K6YA 2XGDA 3LA2A 4OIQF 5LGNA 4AIHA 4G9YA 1SFEA 5LRRA 2KT0A 3JCUC 3QOPA 3GTMJ 4AIKA 1YS7A 4UNOA 1BC8C 5JFRA 3V4GA 2RV8A 3BCBA 4L5IA 3U1KA 4YFKF 4HNUA 5J8FA 2BXYA 2O6GE 1D1AA 2DMUA 4IOCF 2H09A 3R4KA 2WA0A 4GYGA 1I6XA 2STTA 3WU2C 1I1GA 1TWHJ 1OCRH 4B3XA 4EJTA 1TWCJ 2EFQA 3EDPA 2XB0X 3PIOF 3A01A 3ABUA 3ZQ7A 3C1DA 4D5FA 1LVKA 1TW2A 2EPFA 2XKOA 3CJNA 4EM2A 1FTZA 4J19A 3JTHA 1R00A 2PMUA 5CVJA 3IL2A 3KP7A 4BHBA 1T95A 4AM3A 1Z21A 4FETA 4GGGA 1NK2P 1USTA 2CQKA 4Q47A 4ESFA 3DU6A 1S8NA 3F22A 4ZC3A 3JW4A 3O3KA 3D5RC 3QODA 2ADUA 2AHQA 2EB7A 3BG9A 3W2VA 5GAHJ 4IQ4A 5FB2A 1EV7A 1K78A 2X1DA 1KYWA 3EUAA 3WODF 2QVOA 1D0XA 2EQRA 4RB0A 4HYEA 3H3VK 1Y0NA 2A68F 4M6YA 1U2WA 2IBDA 2LY1A 1JT0A 2R7UA 2OQRA 4F3QA 1W36D 2LBFA 3TO9A 3CCRI 1F36A 1XB4A 3GYHX 2OQGA 4RM3A 1T33A 4OAYA 4BHPA 1ON2A 4E7ZA 3DKWA 2D1HA 1MBGA 1RC9A 3ZQHA 4D0PA 2NXNB 3BR1A 3SDGA 2Z3YA 2LBFB 4XM3A 4ZJZA 3DV8A 1APLC 2CGPA 4M3EA 1SD6A 1Y1WJ 3H36A 2QM3A 1R4MB 2HXIA 5D8LB 1QZEA 5HS7A 3O6BB 3WGIA 2DK5A 5GTHC 2E1CA 2C6YA 3JRGA 4EV0A 4Q4ZF 1X2NA 2VT2A 2LOOA 2LH9A 5IT9Z 2EZIA 4II2A 2JRTA 4QPOA 1REPC 3FZVA 4BXXJ 2M87A 3LAPA 2ZKZA 3IRRA 1JUSA 4OINF 1A31A 3M1CA 4IOAF 3CTAA 1J2XA 2MH9A 2NAZA 1BOAA 2XV4S 2FJ1A 2EILH 2VJIA 4ETSA 3PJRA 1LDJA 1FIAA 4PFPA 3L2CA 1IJWC 2E36A 3W6VA 1YW9A 3G6EI 1I6HJ 2COMA 5LFAA 1RZ4A 3TW6A 2G7HA 3H0GJ 2V9KA 3MCZA 2VOOA 4Y3OA 4M3DA 3PIPF 5CVRA 4KIFA 4EJUA 1FX7A 3KEOA 5DV5A 4RMNA 5E8GA 3W2WA 3LSRA 5K7ZA 1X2MA 4IX7A 1XSDA 1U9NA 3WTVC 3A0HC 5FKLA 1XD7A 3ZXSA 3MZ8A 1LB2A 4N4NB 5J1UA 1DQUA 2HPIA 1V3FA 1S29A 1S72I 2ZO4A 3WE2A 4QSHA 3E6CC 4H0EA 1XPXA 1O3QA 5EYRA 3ECOA 1QHHD 4I7HA 1PUFB 2HVSA 2DOFA 1J75A 1OQYA 5KAIC 4D7NA 1IRZA 4AYBA 4UHTA 2KRFA 2M4KA 2Y2ZA 1GVJA 3LSTA 3J7AO 3RDIA 3ZMZA 4FX4A 5F08A 3HBLA 1E3OC 1XX5A 5BMZA 4RGUA 2LD5A 1HKTA 5HLHA 1ZG5A 1P4AA 4IVNA 1PUFA 4PJ0C 2X0LA 1O3SA 4XRMA 4FE7A 4B48A 1ZRFA 2KRHA 1NHAA 1S7OA 2JSCA 5K1YA 2MFZA 2BZTA 4CYCA 3L1PA 4I6ZA 2JQ7A 2H27A 3DLLF 2DK8A 3CCVI 5L3BA 1UFMA 4UUTA 3X2QH 2E2HJ 3FXOA 2LMDA 3PM1A 3NEUA 3S3MA 3E6DA 1SFKA 2QYOA 4C9YA 4R79A 1HA8A 3V8KA 4NC8A 3CC4I 4NC6A 3ZMSA 2ETHA 2Y9YA 1Z6RA 3FKJA 4XR6A 1BJZA 3DTIA 5CVVA 2IA1A 3CDLA 1FSEA 2DFFA 3MZYA 3CC7I 4L18B 1R4NB 2W25A 2GXAA 1MMDA 1J59A 3L2VA 1K83J 1XTAA 1BJAA 4IRGA 5JR3A 1QPIA 2ZXWH 1Y8QB 4PZJA 1YX5A 2DT7B 3S15J 2FQ3A 1H9TA 1OCTC 1OKRA 2QSGX 3IC7A 4UUVA 3KFWX 2G7UA 3I56I 1QGPA 2UV1A 3MN2A 4ZYDA 1EKEA 2DN0A 2PQ8A 1TQIA 5B66C 2W7NA 5EEHA 5J6XA 1G3TA 1SD7A 3IH4A 3HOWJ 2VXDA 3ERED 4I0AA 2MYSA 3GUDA 2BW3B 1DPRA 1VQ4I 4MHGA 3KIOA 5JHUA 1JE8A 1WI9A 1WI3A 5TJJA 3MKWB 5BNGA 4HNVA 3LSKA 3COAC 1BW6A 2CH0A 4LIVA 3F0CA 4NC7A 5E3NA 2NS0A 2M1BA 1HW5A 4U0YA 1VQ9I 1ETVA 4YIFA 3BT9A 4MQVA 4E7HA 1MDMA 4BGDA 2ESHA 3WHCA 1XDUA 2WBMA 3OYLA 2E60A 3K2AA 2BW3A 2V1DA 3VODA 2KIMA 1MNDA 3ASNH 1R1UA 2FQ4A 2ME0A 4ANJA 2Y30A 1GV2A 3S2WA 3OSFA 3HOZJ 2JVHA 3RTRA 3IWZA 2ZXHA 1WJAA 2R3SA 3CCYA 4A0YA 3GX4X 1Q1HA 4N9HA 2KIQA 4BE0A 4HRIA 4PJMA 3Q0UA 1R58A 2DFIA 1JGSA 4EMSA 3OSGA 1EH7A 1O57A 3KP3A 4NDLA 1GUUA 4M72A 3DTEA 4RDUA 3KLOA 3PQKA 1NH3A 3CJTB 4BEHA 1ZLKA 1LJ9A 3P7NA 2XPWA 2VB6A 3E7LA 3I5UA 4A2UA 2R92J 4Y15A 1XDSA 3HOUJ 1T08B 2LNBA 4C3IJ 4A3LJ 3MKYB 4A69C 5BPDA 1DDNA 2NNNA 2VBWA 3ZQQA 3DQVC 2K27A 3U1DA 5IYDJ 6PAXA 5L3GA 4DOZA 1BI0A 1ZN2A 1FWZA 1P2FA 2VN2A 3DKXA 2F4MB 4IO9F 2FX0A 1UMQA 2WAFA 2R7DA 2XC7A 1YW8A 5ICFA 3FDYA 3FBIB 2V1XA 2HGCA 1KZHA 3S1MJ 5ILSA 4DQ2A 2D5VA 3HRMA 3I54A 2V7FA 1BW5A 1FPQA 3OY9A 2LDUA 5FO5A 2IS1A 3ZQCA 2W82A 4E70A 4UY8I 3BZCA 1H9GA 1WFXA 1Y0UA 2DOAA 3DPUA 1X4PA 1IRFA 2HKOA 2R7QA 1VQLI 3CCJI 5FKNA 4IHVA 1U9OA 2DJNA 3EYIA 2WAQA 2JA5J 4UVCA 1ZTRA 3JTGA 3C3WA 5AONA 3VYRB 5TRDA 2E1MC 3H5NA 3M4OJ 2AXTC 1N78A 3CUQA 3F6OA 1LFUP 1ETKA 3GTGJ 1TTYA 3C2BA 4A6EA 2G0EA 4AU7A 2ISZA 3KP2A 1XGOA 2Q2EA 3FXJA 5HS8A 3LAJA 3JAMK 2RDPA 2M4GA 4BNCA 3FMSA 1IUFA 1OMIA 3FHNA 1JUPA 2P81A 2DMNA 3CC2I 3E3VA 2AXLA 2ECBA 1TWFJ 1ONVA 2JN6A 1WSUA 1AKHB 1TNSA 2JUCA 5FKKA 3CUQB 3I0TA 4IHWA 1IN6A 2DW4A 2FBKA 2PMZA 2Z9OA 4JQFA 4A3MJ 2L7FP 4HPQA 1QZYA 2OCEA 4QLCU 4OIPF 3RKXA 2M7BA 2DU9A 3H35A 2L3DA 2XF5A 4LG3A 3QAHA 4V19K 1O7FA 4IZZA 3IKTA 4IF4A 3K7AJ 3PNVA 2WC2A 2RN7A 1E3PA 2FU4A 4G6DA 3F23A 4ZDLA 3PUFA 3P9IA 1U78A 2XAHA 5KK1A 3CD6I 3SXYA 3L2WA 2VKEA 3IH2A 3MKLA 4LB5A 3L09A 2DA3A 3ZRGA 3D5LA 2VL8A 2K9LA 2IS4A 4A3DJ 2BOLA 1YOVB 3RPQA 3S14J 5B1BH 1QVTA 4KMFA 2BVLA 3LFUA 2OPTA 4KITB 2I8DA 3SFIA 2FBIA 2LP0A 3QRFF 1ZYRF 1G3YA 1NG7A 1F1ZA 4MIMA 3ASOH 2NVUB 1U8RA 1T8IA 3P9KA 2A61A 2O7OA 4A3JJ 4BBSJ 5DYMA 3D1NI 3L00A 1SAUA 1SMYF 4CZZA 3JSOA 2QWWA 5E79C 3FK6A 3MWMA 3ESWB 1BR1A 1DP3A 3HZJA 3ZN1A 1XGNA 2OF7A 3OOUA 1YTYA 3K4BA 5E1WA 3F8NA 3OYMA 5FFXA 2ELJA 2CW8A 2LK2A 2Z2SB 5KAFC 2DJIA 5J1RA 3BTJA 5BQTA 2NS8A 4DYQA 3KETA 1D5YA 2DODA 3GZNB 2AQEA 4A3GJ 3IKVA 5ED4A 2UZKA 3JRAA 2XRLA 4M73A 4IEJA 1S3JA 5J4VA 2R5ZA 1R5ID 1STZA 2F48A 1Z3XA 3QPTA 4R8HA 1WJFA 1BN5A 3FM3A 2DA4A 3OWTA 2B7EA 4HLXA 1P7IA 4RB2C 2VE9A 4XQFA 2ESNA 1ON1A 1V5EA 3SQNA 1K78B 2E2IJ 2XUBA 4HV5A 2F5EA 2OCCH 3BR2A 4BHCA 4AIJA 3L2UA 2K7LA 2GLOA 4Z2YA 4PGGA 2HYJA 2FD5A 2QCOA 5B5EC 4IPAA 3E0JB 3SEQA 3P9CA 4LD5A 1SFOJ 4A12A 4XKVA 1AOYA 3V42A 3QOEA 1D8KA 3FXQA 4EATA 4F92B 5LHHA 5DTDA 2GWRA 2RKHA 4BS9A 5LGUA 5J1YA 5TGTA 4NNJA 4XNFA 4V2FA 3TO6A 1ZKGA 2H6BA 3M8EA 4FISA 5ERIA 4L0ZB 3RKYA 4OMYA 1BR2A 2R7WA 1D0YA 3BJAA 2HOEA 5DS9A 3AKZA 4P1WA 3S16J 1RNLA 1RKWA 1F5TA 1P4WA 2KDZA 2YU3A 2YX4A 2A05A 2L7MP 4A0XA 1IV6A 4KN4X 3W2AA 4G12A 3FHZA 5K5OA 5HDNA 4LFUA 4FX0A 1ODDA 1LPQA 2FOKA 2L0KA 4AD9A 1WCMJ 1ZR2A 2K9MA 2GXBA 1TL8A 3HHGA 4XRSG 2IT0A 2F6CA 5D6FA 2HFHA 4HQMA 3DBHB 4A3FJ 2VOPA 4OMZA 3ZP5A 3MMYB 1W4MA 4CSWA 3JRDA 3K4JA 2VBZA 4QTRA 1NTCA 2BGCA 2NS7A 2CW7A 1MH4A 4S04A 5IY5H 1U5TC 3S93A 1YYVA 4C3HJ 3S1QJ 3BG3A 5E3LA 1LFPA 1O4XA 5LEJA 4ZYGA 3LNQA 1JHHA 3CUOA 1IV8A 1HLVA 1QBJA 3NQOA 2TDXA 4NBQA 3RI4A 3DEUA 2HYFA 4DYRA 4I02A 4G7ZF 3GXOA 2YU9J 1ETXA 2VBYA 1UCRA 3VB2A 3DFGA 2HQRA 3LSIA 3ABMH 5F04A 2PMHA 4XLCA 4DBRA 5IPAA 4C2UA 4PSWA 3BDDA 4CHUA 3L2RA 2CQXA 3GZ5A 1AHDP 3BR6A 1YRNB 3W6KB 1TLHB 4ZDPA 4BE2A 4WXDA 2JA7J 1UG2A 3ZOBA 4KT6A 3HEFA 2XSDC 3N97A 2E35A 1EJ9A 3A4CA 1IAWA 3S2DJ 4PDKA 1HBXG 1R5GA 2K3PA 5ILUA 4M71A 1ERDA 2JT1A 2ZMEC 3GWZA 3FM5A 3LWFA 1O7LA 4P5OA 3I53A 4V2GA 3JRHA 1ZR4A 4A5NA 4CYCB 1YE9A 4KUMA 1U3EM 3FX3A 4M6XA 3WGHA 3AG3H 2XRNA 5HLGA 3C18A 2XSJC 1A5JA 4PK4A 3HSEA 3VEPA 2R7TA 3AG2H 4KIGA 2L5QA 3QPSA 2DCEA 2EJRA 5F0HA 4MGRA 2OJED 2DTZA 3OYAA 4G7OF 5LLQA 3ZMDA 1VQNI 3KZYA 3TL4X 3OOPA 4EEFG 5BOXA 1OCZH 4BQNA 3T0YA 4A3KJ 4BAYA 3RCOA 2W57A 4J00A 2DAOA 3TOAA 2FOWA 2RREA 1HCRA 4XLAA 2LKXA 1X3WB 5F0CA 1FLIA 1A6IA 4D5CA 2HPMA 1SFUA 1VQMI 1MBJA 1OYWA 1K7AA 4UVBA 3A1YA 2P8TA 1SVLA 3KX2A 1T2KA 3G4SI 3QP6A 3CCQI 1X1PA 4N9IA 5KHDA 3ML6A 3MVPA 3WTYC 2VQGA 5FLXK 1L3LA 4AWXB 2UWMA 2K9QA 4HLYA 2XAFA 3K69A 2H94A 1Z9CA 1D0ZA 1QU3A 4RAYA 4XLPF 1XSVA 3GFLA 1X3ZB 2KLOA 1YX3A 3TGNA 1FOKA 2HNHA 4OWRB 5D5UB 4LOCA 3LSMA 2GA1A 1KA8A 2I5UA 1T0FA 3PFYA 4CXFA 4KYWA 1TP4A 1MJ9A 1MD0A 3WTWC 2O8XA 3LSGA 1WJBA 1XG1A 1T38A 1KU7A 2QQAA 1WJCA 2MC3A 1X1AA 3K4MA 1U6GA 1JXSA 2RNGA 3SYTA 5K5RA 2CQ7A 1LFBA 4C2TA 2XKPA 4F91B 2L9RA 3QYFA 5DD4A 3S32A 2MH2A 4UV9A 1T56A 2HU9A 4HF1A 1XCBA 2OA4A 2PJPA 1ORKA 1B4AA 4NUBA 3CMYA 3F21A 4LLLA 3SZGA 4B4CA 1FOYA 3VWBA 3FXMA 1ETOA 3PSIA 2V4JC 1BM9A 3JRBA 2VQLA 3F8FA 4YIIA 3BTLA 5IYCJ 4II3A 1NG6A 1U0JA 1C0WA 3K2ZA 4O3MA 3HXLA 2P0WA 4PUSA 2HTJA 4L5JA 4XN0A 2OC6A 3A03A 4BEHB 4A3BJ 4B8XA 3WTTC 4F7ZA 3TO7A 4MLOA 5A2QK 2LFBA 4L9TA 5KNLA 2FA5A 1GDTA 5C3EJ 2A6HF 3CLQA 2E5NA 4CCMA 4MTEA 3VYSB 1KYZA 3RSNA 1XSXA 1ZGAA 1ACIA 2L9VA 1MMAA 1R49A 2MGQA 4CZCA 2IVMA 3REOA 1LEBA 1MIJA 3I64A 4IQJA 3KE2A 1I50J 4HF2A 2BY0A 3JAMZ 1FJLA 1FBSA 2GA2A 4EM0B 3BC8A 1B9NA 3S2HJ 1FYLA 2IS2A 3GTPJ 1ZARA 2M0CA 1HDPA 3HJEA 1AWCA 4F93B 2CUZA 1VQKI 4RA2A 5AIQA 1ENHA 2EZHA 2JZYA 1X1CA 2LF8A 4EM1A 3HTSB 1MMNA 4U7BA 2WV0A 4JYKA 4LK1F 5FROA 4ZZLA 4KIBA 1ZRCA 3CCLI 5DEQA 3E6BA 3I4PA 3JREA 3L9FA 3KPHA 3TP3A 2R0QC 3OYBA 2DA5A 2DBBA 2DXIA 3RIRA 2H8WA 2MLKA 1ZELA 4M6VA 2BY2A 5F1RA 3SFZA 3BROA 3HPGA 1TWGJ 1IN4A 1G2HA 3W6JB 4WWCA 1S5LC 1F43A 2RC4A 4ENKA 4FT8A 1JGGA 2JPBA 2OAZA 3R61A 5FLXZ 5F0FA 1R6RA 5JLWA 4WXHA 5H20A 2A5WA 4PJNA 4XSXF 5KVRA 2JA6J 1KQ9A 2HXOA 4U7DA 3TOBA 2ELKA 2CV2A 2XHKA 2KIFA 4WX9A 1DUXC 5CKTA 2YPRA 1J09A 2GBYA 1XGMA 1IXCA 2M9HA 3DTKA 4CCKA 2K86A 2O0YA 1SD4A 4XICA 1H89C 2Y0SA 2MLGA 4A3EJ 1Z77A 3K1PA 4HDVA 1G4DA 4WF2A 1FIPA 1FYMA 5D5XB 5E20A 3BR0A 2OD5A 2P5LC 1IG7A 4RAFA 4IRIA 2EIJH 2EV5A 4XLEA 3ONQA 2R7OA 4DNCA 3S3NA 2IXSA 3Q9SA 3T8RA 2KIUA 3MEXA 3GTQJ 4ITVA 2WADA 2UXNA 1MBFA 4PFOA 5HLTA 1IC8A 2DA7A 2WAQN 3FISA 4XK4A 2P6SA 3HOXJ 2EINH 4GYIA 3H9QA 1BI1A 1UHWA 3KP5A 1ETWA 5ILVA 3RKQA 3I9V2 2F5VA 3J81K 1MNMC 2M2EA 1LE8B 3OYCA 4HDUA 2PX9A 1B59A 4BQOA 1MGTA 4N0BA 3B6AA 1I39A 2F5DA 5F1JA 5M5XJ 1P6RA 2ELHA 2GM4A 1X1BA 2MD5A 1OFCX 1IRGA 5GTIC 4OAZA 3F6VA 5F27A 1EH8A 1P7JA 2GIZA 2DMQA 4KFCA 3CESA 3A0BC 2DA2A 2E34A 2XGXA 2W4SA 3OIOA 1IN8A 4KN7X 4CDGA 3H9JA 2X6XA 2ZJ2A 1J0RA 2M8EA 3IRQA 1RR8C 1RIOH 3HYIA 2EBIA 3TEDA 1HW2A 2R5ZB 1BI2A 1W7PD 1WKMA 2BYVE 3LQQA 3RQ4A 5M3MJ 3OS1A 2X51A 4UUSB 2W1OA 5CVUA 3GO5A 1YRNA 3IP4B 3M07A 5GPCA 2NVXJ 1FMWA 1UHSA 2M0MA 3KYCB 1FYKA 3CMMA 2ZJQF 3I71A 5J40A 4MO7A 1OPCA 2Q0OA 3IWFA 3G1LA 3GF2A 2QQ9A 1UB9A 3GLXA 2FE3A 4A93J 3SDBA 4ENJA 2CQQA 1IXSB 3H0DA 2M5WA 4CH7A 4G6QA 4E7JA 4UUSA 3K10A 4DGWB 1GT0C 2HOTA 1Z1DA 5FRNA 1JT6A 2DMTA 4M3BA 3LSPA 1SMTA 1JKPC 2EWNA 4IRHA 1Y1VJ 3E1SA 3BJ6A 2PFBA 1N25A 5CQGA 1A04A 2E5ZA 3H92A 5EEGA 4WXCA 5LEKA 1YFHA 1HSTA 4AYBN 1IDYA 4JK1X 2MW8A 3TP0A 1JKQC 4BDYA 3F3XA 3VSKA 1JUMA 2M8GX 3OYKA 2WV1A 1A35A 2CW0F 2M34A 2Y0MA 1ZH5A 2V1NA 3WE3A 1VFCA 4I01A 2OZ6A 4HAMA 1ZREA 2KKOA 2EIMH 2FNPA 4C2MJ 5L3EA 4E7LA 1VQPI 4C30A 2KPMA 1OR7C 3GBGA 1YJWI 4J01A 4LMYA 4IKFA 2DO7A 2ZXJA 2CV0A 2XAJA 4HSRA 4LIUA 1FC3A 2V9VA 1DU6A 1HKQA 4BJ6C 1YO5C 3QPLA 2JRMA 2L9SA 5CYVA 2YSRA 1BBYA 3S8PA 2UUZA 2HZTA 2VODA 2L54A 5DM7F 2EV0A 2FRHA 4E4HA 3EUHC 1DGRM 2W48A 3O8GA 3U21A 1ZHFA 1NK3P 1R22A 4EJWA 1TNTA 3HPHA 4E7IA 1LVAA 2RGVA 3ELKA 4BUPA 1X4OA 3JR9A 3IAS2 5LGTA 3AAFA 1WZ2A 4I2OA 4HSTA 3F8BA 2F4OB 2PLYA 2GZWA 1PUEE 2LLKA 2MBFA 3O8HA 3BLYA 1EA3A 1MMSA 2L4MA 4FQGA 4JP0A 3FK7A 2R5YB 2CWEA 3KZZA 5D4SA 3GLLA 4ESJA 1U5TA 2KMUA 3BQZA 1WQ2A 2HOSA 2DMPA 2VC1A 3T8TA 5M5WJ 3IH3A 5IT9K 2QQ8A 2X6OA 2BEOA 2QUFA 4M74A 4DYCA 5IYBJ 1LDDA 2CSOA 3OV8A 4UVAA 5GADJ 4CICA 3SZTA 3ZN0A 3WGGA 2ZJPF 1G8XA 4C3JJ 2HDCA 1OCPA 1IGNA 1IZ1A 1R7JA 1H88C 1B6AA 3GTOJ 5DUIA 4XL9A 1U5TB 4CGZA 4E7SA 2K9SA 1G3SA 1I27A 3CJRB 5LRSA 1YLFA 2HOAA 3MQ0A 5DCMB 4BQQA 2E7WA 2R7XA 3QQAA 4U88A 1P92A 4I99C 3FXUA 3NWTA 2IRFG 3ROUA 3DPTA 2E2JJ 1Y8RB 3SHFA 4M9XA 4HV6A 2CV1A 1T98A 4OOIA 3ABKH 4NQWB 4L0YB 5LBQA 4EGZA 3M1EA 5EDNA 3I4NJ 2X1CA 2FMYA 3I59A 1CF7A 2K85A 3HM5A 4RAZA 5J8CA 4I0BA 1VQOI 3ABLH 1GXQA 3HTUA 2WB1N 5GAGJ 3JRFA 1ZG3A 4WCGA 1VQ5I 2VJ4A 3DU5A 2F2EA 2QKLB 1Y56A 2ZMEA 3G1MA 3GFIA 1OCCH 2HWVA 3C7JA 3V8JA 4A3IJ 3J7YJ 2DA1A 3B02A 1MSFC 2RAEA 2E1MB 1Y39A 2A69F 4DJAA 3K9TA 4RGSA 1S6LA 2O3FA 2XAUA 2ID3A 3VSLA 4L9JA 3HOSA 1YIJI 1IO2A 5TISC 2O9LA 2STWA 2BY1A 2ZSHB 2RNJA 3TMOA 1CGPA 2NVYJ 5M3FJ 2V6EA 2LRDA 2ZB9A 3ZQFA 3CDIA 1MJAA 4ZTJA 2I10A 1BOBA 4BBRJ 1PDNC 2VONA 3KYDB 1MJBA 1S9HA 2V1UA 4ENMA 1ZRDA 1IXRC 4XONA 5K5QA 2QBYB 3BCAA 3P5JA 4G94A 3HSRA 3KEQA 4LJZF 2CRGA 1FNNA 2J5OA 1HDDC 2HDDA 2RQQA 4R1HA 1O3TA 1Z0XA 2BHYA 4ESBA 5GPAA 3V8LA 4E6KG 3WU1B 3C2HA 1F9NA 4RLQA 2JK3A 3CCSI 2EFNA 1LEAA 3JSPA 1RR7A 5LHIA 2WWYA 3S1NJ 2QBYA 2NRAC 3HL2A 5HNFA 4KISA 1Z67A 4BXUA 2ZC2A 2HEOA 4M3GA 5H2FC 2XGEA 4EJVA 5M5YJ 1XMAA 2Z99A 2PJRA 1WHUA 1MZBA 2CFOA 2KJBA 2DT5A 1KU9A 3PO3J 4P96A 3ZMTA 1RI7A 2LKSA 3A02A 3OYDA 3HGGA 1P4XA 4H4KC 3O2PE 4PSXA 3M7GA 3BPXA 4GDFA 2CJJA 4LLGF 3EQLF 4P55A 3I55I 2BY3A 4YFXF 2LVSA 3ZPLA 1GXPA 1QO0D 3GTLJ 1UJ8A 3K70D 4WK8F 4QPQA 3LSHA 2A6EF 4XLHA 2Z33A 4XLNF 3EUHA 2M30A 3ZQLA 1IN5A 1H0MA 1U8BA 4Y4RA 1SD5A 2R7VA 5HOOA 3E6MA 1A36A 3R60A 2JPCA 3K1MA 2BVMA 3QPHA 4ZYEA 2MD0A 1QA6A 2AO9A 2BHZA 2ZXIA 4EQQA 3DKYA 4K2EA 2DFEA 1PJRA 2YX7A 1I3QJ 3IHUA 1J9IA 1FSHA 1WVRA 3L7WA 4ZYHA 4F52A 3Q9VA 4DIQA 2XF6A 2E19A 2ISYA 3LA7A 1YJ9I 1TC3C 5BPIA 4IL6C 3L2QA 4XKBA 3S1RJ 1DPUA 2X48A 4B44A 3H5RA 1X19A 4XMYA 1MKMA 2JJ7A 2PG4A 1TQMA 3ZQIA 3HRTA 1SVMA 4QIWN 2HS5A 2LYCA 2IJLA 1W36C 5L3DA 1WPKA 4L9NA 1QRYA 2EFPA 2ZBKA 2KRCA 3TBIA 2HR3A 3CMAI 1YQAA 3MD2A 1HKSA 2FUG2 4FCYA 2O8KA 4L5EA 1RESA 2L02A 2OBPA 4U0WA 3SZPA 1T39A 5LHGA 3B6CA 1HW1A 2AS5F 3VOEA 3J80Z 2EH3A 2QA4I 1JTXA 2CUFA 1ZK8A 1USSA 4HW0A 2HTSA 1XGSA 4BU2A 4XBFA 3DCFA 3WTUC 3Q0VA 1YG2A 2IGMA 3PFIA 3EETA 4LG0A 4DBQA 1RUOA 3OYHA 2IAIA 3OL4A 3N4MA 5KCMA 5FJ8J 1B8IB 2A3SA 3GFMA 1DGWY 4Y33A 1CQTA 2K9NA 1DU0A 2OUMA 4CA0A 5E18F 2LSOA 3KLNA 1TWAJ 3LQRA 1JJ8C 1YS6A 5JVTA 1XN7A 5E17F 2N8GA 3J7AY 2VE8A 3H3ZA 4LG0B 5FKOA 1D1CA 1FP2A 1KU2A 2DLLA 3CDHA 3SJMA 3KYLA 2CUEA 4G6TB 1IW7F 4I76A 1A6QA 4XOPA 3PNYA 4MEXF 2FXAA 2EFOA 4CO8A 5EF6A 3HRUA 4XKCA 4XRSA 2HI3A 3DXJF 3OIPA 5J4YA 1WWXA 4KDPA 1VI0A 2LKPA 1GVDA 4Q48A 2H6CA 2OZUA 2OU2A 3WG9A 3ZQGA 1MW7A 5EZGA 3DEEA 5EEAA 1AA7A 3AG4H 2BBYA 1V4RA 1F4KA 3WHBA 3CUQC 5IOZA 4B09A 1HQCA 3M8FA 4OIOF 3OL3A 2P6TA 1ZAOA 1BI3A 2CMPA 2E7XA 1KQ0A 1T6SA 3QWLA 4X0GA 1G59A 4JX4A 4XKWA 2VI6A 1VF9A 2CO5A 1B1BA 2K02A 2W84A 3BWGA 3BOQA 4O6JA 5H6RA 1FZPB 3E97A 2DOEA 3F72A 4LB6B 3FKIJ 5LD2C 2VXZA 2BE5F 4MFEA 2HKXA 4JX6A 2F4IA 4LGWA 2E1NA 2L4AA 3R6SA 5IT3A 3HC7A 1WJEA 2LY9A 3M8JA 2KDOA 1Z7LA 3E5XA 3PL8A 5D6EA 1I1SA 2R7RA 1B72B 5ICGA 3OMYA 4JBAA 3MFKA 3KP4A 2TRTA 1ZG1A 1GLNA 1FP1D 1HF0A 4Y17A 1LE8A 1P9QC 1RPWA 2V9PA 2XASA 3CP2A 1E2XA 1GHCA 4FTHA 4BQAA 4ZZDA 3NWSA 4BKXA 1MSEC 3RPUD 4S05A 4S0HB 3K4NA 3G71I 1W0TA 1TT5B 1LDKB 2P7VB 2W85A 3V7CA 2E1OA 2IGOA 4BACA 1PVEA 4GRIA 3QYEA 1LNWA 3GVAA 5E8IA 3DEWA 1K6OA 3G3ZA 1N77A 4G7HF 2ZFUA 1LUJB 1R1TA 3UR3C 5B3SH 2QQBA 3ULQB 3OYGA 4IHTA 3HG9A 1R23A 3RYRA 1WRJA 3TKYA 3OYJA
chains in the Genus database with same CATH topology
2FNAA 4I98B 2PBIA 3J81Z 1FBQA 4HBLA 1FT9A 2RQPA 2D1VA 4CYDA 2P7CB 4IXAA 4HX4A 1K79A 4MEYF 1R5HA 2DTRA 4GCVA 4RB3C 2NYXA 2BV6A 3J80K 4HF0A 1G3WA 1D3YA 2DI3A 4RS8A 1JHFA 2XAGA 3F8CA 2P5VA 5HS9A 3R0AA 2M45A 3CO7C 2V6CA 2UXXA 1D5VA 4HQEA 2K4BA 2CFXA 3QP5A 3D0SA 4P9FA 1L0OC 3RJPA 3T5XA 2GXGA 1W5SA 2CYYA 4A0ZA 5D5VB 2XAQA 3V7SA 5FGMA 5HDGA 3GZ6A 2ACJA 4ENNA 3HSFA 3K1NA 3PQJA 2GIVA 1PP8F 2K4JA 1OR7A 2JTVA 4M9SA 1PP7U 2Y48A 3BPVA 2DPDA 2ZFWA 1Z91A 4KICA 2ZCWA 2IW5A 4RB1A 1D8JA 4GXOA 3M9AA 3FF5A 3DF8A 2GAUA 4LK0F 2GQQA 4KA4A 4IJAA 3Q5FA 2EA4A 4M9ZA 4Q5SF 3WTXC 4RGXA 1Z6TA 1R36A 2RVCA 5D8KB 3RKWA 3E5QA 1W5TA 1ZGJA 2YR2A 2O03A 5D4RA 5DCMA 2P4WA 4HZFA 4KMUX 3HRSA 3H3UA 4NQWA 2V79A 3I59B 1CF7B 1XMKA 3FMQA 2HQNA 1UHMA 3MZHA 1I5ZA 4BYYA 2O61A 1YIOA 5ICEA 3T1BA 5E1ZB 2ZMEB 4FHTA 2FF4A 3KP6A 5F64A 1HSJA 1O3RA 2EK5A 2IA2A 1VTNC 2P5KA 2FBHA 1S7AA 4KNYA 3U2RA 1BC7C 4QWQA 3FXRA 4PCQA 1J5YA 4MNUA 5CLSA 2D2WA 5CVIA 3GFJA 3HOTA 2WTEA 2DQRA 3LFKA 4HX8A 4XRFA 4HX7A 1RUNA 3CLOA 5F6FA 2PEXA 1TQPA 3QU6A 3GW2A 5FFZA 3ISPA 2NNYA 1IN7A 1FBUA 2Y75A 5H6QA 2F5FA 1OYIA 2ZNYA 2QLZA 2DPUA 4LLNA 1QPMA 1J7KA 4A6DA 4EJOA 4YG2F 3ZMUA 3ECHA 2MA3A 1X3UA 1ULYA 4OU0A 4NB5A 2ZNZA 2IPQX 5CJ9A 2XROA 2CG4A 5ICCA 3I58A 4O5VA 3WU0A 4YFNF 3HIFA 5FD5A 3BY6A 1TW3A 3BJOA 3DPLC 1KQ8A 4AVPA 1W7PA 4UXNA 3QU3A 2B0LA 4RGRA 4A5MA 2VC0A 1SAXA 4BH9A 2PN6A 1DP7P 3FMRA 3B73A 3HHHA 1W7PB 1BIBA 3FWEA 2J5PA 3G73A 4MTDA 1EH6A 2W24A 1BIAA 4ON0A 5AIPA 3WTZA 5DCFA 1MDMB 1Z7UA 1B9MA 4MQ9F 5A2QZ 2KJCA 1QZZA 3U9GA 2Q8KA 3LA3A 2F5CA 4ASNA 2G9WA 2L01A 3ABTA 2PI0A 2FEZA 1SFXA 3HUGA 1QQIA 4XSZF 4EGYA 3CO6C 3BP8A 3TDUC 4KT5C 3E5UA 4G8XA 3RPUA 1XCVA 1LQ1A 4EVIA 1E17A 2EA2A 2A5YB 3RYPA 4NHJA 1HXDA 5L3CA 1FY7A 2VT3A 1QNTA 1IUYA 3WTSC 5D5WB 5HLIA 2Z5UA 3ZMVA 1OYYA 1R1VA 2EV6A 5DD8A 1Z05A 2QENA 3K0LA 4L9VA 1TBXA 4UV8A 1KU3A 2HYGD 2R7FA 3TQNA 5BS6A 1KGSA 4HOBA 3GEZA 2LF7A 4IHSA 4ZH4F 2IP2A 5JI6A 5HDKA 4OIRF 4PGHA 5E1XA 5DUKA 2XVCA 4Y13A 5FD6A 1ZLJA 5DDGA 1IF1A 2QZ8A 3DP7A 2XIGA 3R0JA 4GO1A 4TV7A 4P9UA 2A07F 3TDZC 3MAJA 3F8MA 2VBXA 2X4HA 3EYYA 3BZ6A 3NRVA 2FSWA 4HA8A 5L3FA 3VFZA 3V7RA 1G6NA 2D45A 2DQLA 4I09A 2IA0A 3KCCA 5HVQC 2FMLA 2EFWA 1YW7A 4U0VA 3LA2A 4OIQF 5LGNA 4AIHA 4G9YA 1SFEA 5LRRA 3QOPA 4AIKA 1YS7A 4UNOA 1BC8C 5JFRA 3V4GA 2RV8A 4L5IA 4YFKF 5J8FA 2O6GE 2H09A 3R4KA 4GYGA 1I6XA 2STTA 1I1GA 4EJTA 2EFQA 3EDPA 3ABUA 3ZQ7A 3C1DA 4EM2A 1TW2A 2XKOA 3CJNA 3JTHA 1R00A 2PMUA 5CVJA 3IL2A 3KP7A 4BHBA 4GGGA 1USTA 2CQKA 4Q47A 4ESFA 1S8NA 3F22A 3JW4A 3O3KA 2ADUA 2EB7A 5FB2A 1EV7A 1K78A 1KYWA 3WODF 2QVOA 4RB0A 4HYEA 2A68F 4M6YA 1U2WA 2OQRA 3TO9A 1XB4A 3GYHX 2OQGA 4BHPA 1ON2A 3DKWA 2D1HA 4D0PA 2Z3YA 3DV8A 2CGPA 1SD6A 2QM3A 5D8LB 3WGIA 2E1CA 5HS7A 3O6BB 2DK5A 2C6YA 4EV0A 4Q4ZF 2VT2A 5IT9Z 2JRTA 1REPC 3FZVA 2M87A 3LAPA 2ZKZA 3IRRA 4OINF 3CTAA 1J2XA 2MH9A 2NAZA 1BOAA 2XV4S 4ETSA 1LDJA 3L2CA 1YW9A 2COMA 1RZ4A 2G7HA 3MCZA 2VOOA 5CVRA 4KIFA 4EJUA 1FX7A 3KEOA 5DV5A 5E8GA 1XSDA 3WTVC 1XD7A 1LB2A 1V3FA 1S29A 2ZO4A 3WE2A 3E6CC 4H0EA 1O3QA 3ECOA 4I7HA 1J75A 4UHTA 2KRFA 1GVJA 3LSTA 3J7AO 3RDIA 3ZMZA 4FX4A 5BMZA 4RGUA 1HKTA 5HLHA 1ZG5A 1P4AA 4IVNA 2X0LA 1O3SA 1ZRFA 1NHAA 1S7OA 2JSCA 5K1YA 2H27A 2DK8A 5L3BA 1UFMA 3NEUA 3E6DA 2QYOA 4R79A 3V8KA 3ZMSA 2ETHA 1Z6RA 5CVVA 2IA1A 1FSEA 3MZYA 4L18B 2W25A 1J59A 4IRGA 1BJAA 5JR3A 4PZJA 2FQ3A 1H9TA 1OKRA 4UUVA 3IC7A 3KFWX 2G7UA 1QGPA 4ZYDA 2PQ8A 1TQIA 5EEHA 5J6XA 1G3TA 1SD7A 3ERED 4I0AA 3GUDA 1DPRA 4MHGA 5JHUA 1JE8A 1WI9A 5TJJA 3COAC 4U0YA 2NS0A 2M1BA 1HW5A 4YIFA 4MQVA 1MDMA 2ESHA 1XDUA 2V1DA 3VODA 2KIMA 1R1UA 3S2WA 3RTRA 3IWZA 2R3SA 4A0YA 3GX4X 1Q1HA 4N9HA 1R58A 2DFIA 1JGSA 4EMSA 1EH7A 1O57A 3KP3A 4M72A 3KLOA 3PQKA 1ZLKA 1LJ9A 3P7NA 3I5UA 4A2UA 4Y15A 1XDSA 2LNBA 5BPDA 1DDNA 2NNNA 2VBWA 3DQVC 2K27A 3U1DA 6PAXA 5L3GA 1BI0A 1ZN2A 1FWZA 1P2FA 2VN2A 2R7DA 1YW8A 5ICFA 2V1XA 2HGCA 5ILSA 4DQ2A 3HRMA 3I54A 1FPQA 2LDUA 5FO5A 4E70A 1H9GA 1Y0UA 1IRFA 2HKOA 3EYIA 4UVCA 3JTGA 3C3WA 5AONA 5TRDA 3CUQA 3F6OA 1TTYA 4A6EA 2ISZA 3KP2A 1XGOA 2Q2EA 5HS8A 3LAJA 3JAMK 2RDPA 4BNCA 3FMSA 1OMIA 3E3VA 2AXLA 1ONVA 1WSUA 1TNSA 3CUQB 3I0TA 1IN6A 2DW4A 2FBKA 2Z9OA 4JQFA 1QZYA 4QLCU 4OIPF 3RKXA 2DU9A 2L3DA 3QAHA 1O7FA 3IKTA 4IF4A 2RN7A 2WC2A 4G6DA 2FU4A 3F23A 1U78A 3P9IA 2XAHA 5KK1A 3SXYA 4LB5A 3L09A 3D5LA 3RPQA 4KMFA 2FBIA 3QRFF 1ZYRF 1G3YA 1F1ZA 1U8RA 3P9KA 2A61A 5DYMA 3L00A 1SMYF 4CZZA 3JSOA 2QWWA 3MWMA 3ZN1A 1XGNA 1YTYA 5E1WA 3F8NA 5FFXA 5BQTA 3KETA 3IKVA 5ED4A 2UZKA 4M73A 1S3JA 1STZA 3QPTA 4R8HA 1BN5A 3FM3A 4HLXA 4RB2C 2VE9A 2ESNA 1ON1A 3SQNA 1K78B 2XUBA 4HV5A 2F5EA 4BHCA 4AIJA 2K7LA 4Z2YA 4PGGA 4IPAA 3P9CA 4LD5A 4A12A 1AOYA 1D8KA 3FXQA 5LHHA 2GWRA 2RKHA 5LGUA 3TO6A 2H6BA 3M8EA 5ERIA 4L0ZB 3RKYA 4OMYA 3BJAA 2HOEA 1RNLA 1F5TA 1P4WA 2YU3A 2YX4A 4A0XA 4KN4X 3FHZA 5K5OA 5HDNA 4LFUA 4FX0A 1ODDA 2FOKA 4AD9A 2GXBA 3HHGA 2IT0A 5D6FA 2HFHA 4HQMA 2VOPA 4OMZA 3ZP5A 1W4MA 2VBZA 2BGCA 4S04A 1U5TC 1YYVA 5LEJA 4ZYGA 1JHHA 3CUOA 1QBJA 3NQOA 2TDXA 3RI4A 3DEUA 2HYFA 4I02A 4G7ZF 3GXOA 2VBYA 1UCRA 3VB2A 3DFGA 2HQRA 2PMHA 3BDDA 4CHUA 3GZ5A 3W6KB 1TLHB 4WXDA 3N97A 1IAWA 4PDKA 1HBXG 1R5GA 5ILUA 4M71A 2JT1A 3GWZA 3FM5A 3LWFA 1O7LA 4P5OA 3I53A 4A5NA 4KUMA 1U3EM 3FX3A 4M6XA 3WGHA 2XRNA 5HLGA 3C18A 3HSEA 3VEPA 4KIGA 2EJRA 4MGRA 4G7OF 5LLQA 3ZMDA 3KZYA 3OOPA 5BOXA 3T0YA 4BAYA 2W57A 2DAOA 3TOAA 1FLIA 1SFUA 1OYWA 1K7AA 4UVBA 2P8TA 1T2KA 3QP6A 4N9IA 3ML6A 3WTYC 5FLXK 1L3LA 4AWXB 2UWMA 4HLYA 2XAFA 3K69A 2H94A 1Z9CA 4RAYA 4XLPF 1XSVA 3GFLA 3TGNA 1FOKA 5D5UB 2GA1A 1KA8A 1T0FA 4CXFA 4KYWA 1MJ9A 1MD0A 3WTWC 2O8XA 1T38A 1KU7A 2QQAA 2MC3A 1U6GA 1JXSA 5K5RA 2XKPA 5DD4A 2MH2A 4UV9A 4HF1A 1XCBA 2OA4A 2PJPA 1B4AA 3F21A 4LLLA 1BM9A 3F8FA 4YIIA 1C0WA 3K2ZA 4O3MA 2HTJA 4L5JA 4B8XA 3WTTC 4F7ZA 3TO7A 5A2QK 4L9TA 2FA5A 2A6HF 4MTEA 1KYZA 1XSXA 1ZGAA 2IVMA 3REOA 1LEBA 3I64A 3KE2A 4HF2A 3JAMZ 1FBSA 2GA2A 4EM0B 1B9NA 1FYLA 1ZARA 1AWCA 5AIQA 2JZYA 2LF8A 4EM1A 3HTSB 4U7BA 2WV0A 4LK1F 4ZZLA 4KIBA 1ZRCA 5DEQA 3E6BA 3I4PA 3L9FA 2DBBA 3RIRA 2MLKA 5F1RA 3SFZA 3BROA 1IN4A 3W6JB 4WWCA 2RC4A 4ENKA 4FT8A 2JPBA 2OAZA 3R61A 5FLXZ 4WXHA 5H20A 4XSXF 5KVRA 1KQ9A 4U7DA 3TOBA 2XHKA 2KIFA 4WX9A 1DUXC 2YPRA 1XGMA 1IXCA 2K86A 2O0YA 1SD4A 2MLGA 3K1PA 4HDVA 1G4DA 4WF2A 1FYMA 5D5XB 5E20A 2P5LC 2OD5A 4IRIA 2EV5A 4DNCA 3Q9SA 3T8RA 2KIUA 3MEXA 2UXNA 2P6SA 4GYIA 1BI1A 1UHWA 3KP5A 5ILVA 3J81K 4HDUA 1B59A 1MGTA 4N0BA 2F5DA 1P6RA 2ELHA 2MD5A 1IRGA 3F6VA 1EH8A 4KFCA 2XGXA 1IN8A 4KN7X 4CDGA 2ZJ2A 1J0RA 2M8EA 3IRQA 1RIOH 3HYIA 1HW2A 1BI2A 1W7PD 1WKMA 2BYVE 3LQQA 5CVUA 3GO5A 1FYKA 3I71A 1OPCA 2Q0OA 3IWFA 3GF2A 2QQ9A 1UB9A 3GLXA 2FE3A 4ENJA 1IXSB 2M5WA 4G6QA 1Z1DA 1SMTA 2EWNA 4IRHA 3BJ6A 2PFBA 1A04A 3H92A 5EEGA 4WXCA 5LEKA 1YFHA 1HSTA 4JK1X 3F3XA 2CW0F 2Y0MA 1ZH5A 3WE3A 4I01A 2OZ6A 4HAMA 1ZREA 2KKOA 2FNPA 5L3EA 4LMYA 2DO7A 2ZXJA 2XAJA 1FC3A 2V9VA 1HKQA 1YO5C 5CYVA 2YSRA 1BBYA 2HZTA 2VODA 2L54A 2EV0A 2FRHA 1ZHFA 1R22A 4EJWA 1TNTA 1LVAA 2RGVA 3ELKA 5LGTA 3AAFA 4I2OA 3F8BA 2PLYA 2GZWA 1PUEE 2MBFA 2L4MA 2CWEA 3KZZA 5D4SA 4ESJA 1U5TA 1WQ2A 2VC1A 3T8TA 5IT9K 2BEOA 2QUFA 4M74A 1LDDA 2CSOA 3OV8A 4UVAA 4CICA 3SZTA 3ZN0A 3WGGA 2HDCA 1IZ1A 1R7JA 1B6AA 5DUIA 1U5TB 4CGZA 1G3SA 1I27A 5LRSA 1YLFA 3MQ0A 5DCMB 2E7WA 4U88A 1P92A 2IRFG 3FXUA 3ROUA 3DPTA 3SHFA 4M9XA 4HV6A 1T98A 4OOIA 4L0YB 5LBQA 4EGZA 3M1EA 2FMYA 3I59A 1CF7A 5J8CA 4RAZA 4I0BA 1GXQA 3HTUA 1ZG3A 4WCGA 2F2EA 2ZMEA 3GFIA 2HWVA 3C7JA 3V8JA 3B02A 2A69F 3K9TA 4RGSA 1S6LA 2O3FA 4L9JA 3HOSA 2STWA 2RNJA 1CGPA 1MJAA 1PDNC 2VONA 1MJBA 2V1UA 4ENMA 1ZRDA 1IXRC 2QBYB 5K5QA 4G94A 3HSRA 3KEQA 4LJZF 1FNNA 2J5OA 4R1HA 1O3TA 4ESBA 3V8LA 3WU1B 1F9NA 2EFNA 1LEAA 3JSPA 5LHIA 2WWYA 2QBYA 2NRAC 4BXUA 2HEOA 4EJVA 1XMAA 2Z99A 1MZBA 2KJBA 2DT5A 1KU9A 4P96A 3ZMTA 1RI7A 1P4XA 3O2PE 3M7GA 3BPXA 4LLGF 3EQLF 4P55A 4YFXF 3ZPLA 1GXPA 1QO0D 4WK8F 2A6EF 2Z33A 4XLNF 3EUHA 2M30A 1IN5A 1H0MA 1SD5A 5HOOA 3E6MA 3R60A 2JPCA 3K1MA 3QPHA 4ZYEA 4EQQA 4K2EA 2YX7A 3IHUA 1J9IA 1FSHA 3L7WA 4ZYHA 3Q9VA 2ISYA 3LA7A 5BPIA 1DPUA 1MKMA 2PG4A 1TQMA 3HRTA 2HS5A 2IJLA 5L3DA 4L9NA 2ZBKA 2EFPA 2HR3A 1YQAA 1HKSA 2L02A 2OBPA 4U0WA 3SZPA 1T39A 5LHGA 1HW1A 2AS5F 3VOEA 3J80Z 4HW0A 1USSA 2HTSA 1XGSA 4XBFA 3WTUC 1YG2A 3PFIA 3EETA 4LG0A 1RUOA 3N4MA 2A3SA 3GFMA 5E18F 2LSOA 3KLNA 3LQRA 1YS6A 5JVTA 1XN7A 5E17F 2VE8A 3H3ZA 4LG0B 1FP2A 1KU2A 2DLLA 3CDHA 1IW7F 4MEXF 2FXAA 2EFOA 4CO8A 3HRUA 3DXJF 1WWXA 4KDPA 2LKPA 4Q48A 2H6CA 2OZUA 2OU2A 3WG9A 2BBYA 1V4RA 1F4KA 3CUQC 4B09A 1HQCA 3M8FA 4OIOF 2P6TA 1ZAOA 1BI3A 2E7XA 1KQ0A 1T6SA 2CO5A 1FZPB 1B1BA 2K02A 2W84A 3BOQA 3BWGA 4O6JA 5H6RA 3E97A 3F72A 4LB6B 2VXZA 2BE5F 2HKXA 4LGWA 2E1NA 2L4AA 3R6SA 5IT3A 3E5XA 5D6EA 1I1SA 5ICGA 4JBAA 3MFKA 3KP4A 1ZG1A 1FP1D 4Y17A 2XASA 1GHCA 1E2XA 4BQAA 4ZZDA 4S05A 1LDKB 3V7CA 2P7VB 2W85A 1LNWA 3GVAA 5E8IA 1K6OA 3G3ZA 4G7HF 1R1TA 4IHTA 2QQBA 3ULQB 1R23A 3RYRA 1WRJA 3TKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FNA A;  4I98 B;  2PBI A;  3J81 Z;  1FBQ A;  4HBL A;  1FT9 A;  2RQP A;  2D1V A;  4CYD A;  2P7C B;  4IXA A;  4HX4 A;  1K79 A;  4MEY F;  1R5H A;  2DTR A;  4GCV A;  4RB3 C;  2NYX A;  2BV6 A;  3J80 K;  4HF0 A;  1G3W A;  1D3Y A;  2DI3 A;  4RS8 A;  1JHF A;  2XAG A;  3F8C A;  2P5V A;  5HS9 A;  3R0A A;  2M45 A;  3CO7 C;  2V6C A;  2UXX A;  1D5V A;  4HQE A;  2K4B A;  2CFX A;  3QP5 A;  3D0S A;  4P9F A;  1L0O C;  3RJP A;  3T5X A;  2GXG A;  1W5S A;  2CYY A;  4A0Z A;  5D5V B;  2XAQ A;  3V7S A;  5FGM A;  5HDG A;  3GZ6 A;  2ACJ A;  4ENN A;  3HSF A;  3K1N A;  3PQJ A;  2GIV A;  1PP8 F;  2K4J A;  1OR7 A;  2JTV A;  4M9S A;  1PP7 U;  2Y48 A;  3BPV A;  2DPD A;  2ZFW A;  1Z91 A;  4KIC A;  2ZCW A;  2IW5 A;  4RB1 A;  1D8J A;  4GXO A;  3M9A A;  3FF5 A;  3DF8 A;  2GAU A;  4LK0 F;  2GQQ A;  4KA4 A;  4IJA A;  3Q5F A;  2EA4 A;  4M9Z A;  4Q5S F;  3WTX C;  4RGX A;  1Z6T A;  1R36 A;  2RVC A;  5D8K B;  3RKW A;  3E5Q A;  1W5T A;  1ZGJ A;  2YR2 A;  2O03 A;  5D4R A;  5DCM A;  2P4W A;  4HZF A;  4KMU X;  3HRS A;  3H3U A;  4NQW A;  2V79 A;  3I59 B;  1CF7 B;  1XMK A;  3FMQ A;  2HQN A;  1UHM A;  3MZH A;  1I5Z A;  4BYY A;  2O61 A;  1YIO A;  5ICE A;  3T1B A;  5E1Z B;  2ZME B;  4FHT A;  2FF4 A;  3KP6 A;  5F64 A;  1HSJ A;  1O3R A;  2EK5 A;  2IA2 A;  1VTN C;  2P5K A;  2FBH A;  1S7A A;  4KNY A;  3U2R A;  1BC7 C;  4QWQ A;  3FXR A;  4PCQ A;  1J5Y A;  4MNU A;  5CLS A;  2D2W A;  5CVI A;  3GFJ A;  3HOT A;  2WTE A;  2DQR A;  3LFK A;  4HX8 A;  4XRF A;  4HX7 A;  1RUN A;  3CLO A;  5F6F A;  2PEX A;  1TQP A;  3QU6 A;  3GW2 A;  5FFZ A;  3ISP A;  2NNY A;  1IN7 A;  1FBU A;  2Y75 A;  5H6Q A;  2F5F A;  1OYI A;  2ZNY A;  2QLZ A;  2DPU A;  4LLN A;  1QPM A;  1J7K A;  4A6D A;  4EJO A;  4YG2 F;  3ZMU A;  3ECH A;  2MA3 A;  1X3U A;  1ULY A;  4OU0 A;  4NB5 A;  2ZNZ A;  2IPQ X;  5CJ9 A;  2XRO A;  2CG4 A;  5ICC A;  3I58 A;  4O5V A;  3WU0 A;  4YFN F;  3HIF A;  5FD5 A;  3BY6 A;  1TW3 A;  3BJO A;  3DPL C;  1KQ8 A;  4AVP A;  1W7P A;  4UXN A;  3QU3 A;  2B0L A;  4RGR A;  4A5M A;  2VC0 A;  1SAX A;  4BH9 A;  2PN6 A;  1DP7 P;  3FMR A;  3B73 A;  3HHH A;  1W7P B;  1BIB A;  3FWE A;  2J5P A;  3G73 A;  4MTD A;  1EH6 A;  2W24 A;  1BIA A;  4ON0 A;  5AIP A;  3WTZ A;  5DCF A;  1MDM B;  1Z7U A;  1B9M A;  4MQ9 F;  5A2Q Z;  2KJC A;  1QZZ A;  3U9G A;  2Q8K A;  3LA3 A;  2F5C A;  4ASN A;  2G9W A;  2L01 A;  3ABT A;  2PI0 A;  2FEZ A;  1SFX A;  3HUG A;  1QQI A;  4XSZ F;  4EGY A;  3CO6 C;  3BP8 A;  3TDU C;  4KT5 C;  3E5U A;  4G8X A;  3RPU A;  1XCV A;  1LQ1 A;  4EVI A;  1E17 A;  2EA2 A;  2A5Y B;  3RYP A;  4NHJ A;  1HXD A;  5L3C A;  1FY7 A;  2VT3 A;  1QNT A;  1IUY A;  3WTS C;  5D5W B;  5HLI A;  2Z5U A;  3ZMV A;  1OYY A;  1R1V A;  2EV6 A;  5DD8 A;  1Z05 A;  2QEN A;  3K0L A;  4L9V A;  1TBX A;  4UV8 A;  1KU3 A;  2HYG D;  2R7F A;  3TQN A;  5BS6 A;  1KGS A;  4HOB A;  3GEZ A;  2LF7 A;  4IHS A;  4ZH4 F;  2IP2 A;  5JI6 A;  5HDK A;  4OIR F;  4PGH A;  5E1X A;  5DUK A;  2XVC A;  4Y13 A;  5FD6 A;  1ZLJ A;  5DDG A;  1IF1 A;  2QZ8 A;  3DP7 A;  2XIG A;  3R0J A;  4GO1 A;  4TV7 A;  4P9U A;  2A07 F;  3TDZ C;  3MAJ A;  3F8M A;  2VBX A;  2X4H A;  3EYY A;  3BZ6 A;  3NRV A;  2FSW A;  4HA8 A;  5L3F A;  3VFZ A;  3V7R A;  1G6N A;  2D45 A;  2DQL A;  4I09 A;  2IA0 A;  3KCC A;  5HVQ C;  2FML A;  2EFW A;  1YW7 A;  4U0V A;  3LA2 A;  4OIQ F;  5LGN A;  4AIH A;  4G9Y A;  1SFE A;  5LRR A;  3QOP A;  4AIK A;  1YS7 A;  4UNO A;  1BC8 C;  5JFR A;  3V4G A;  2RV8 A;  4L5I A;  4YFK F;  5J8F A;  2O6G E;  2H09 A;  3R4K A;  4GYG A;  1I6X A;  2STT A;  1I1G A;  4EJT A;  2EFQ A;  3EDP A;  3ABU A;  3ZQ7 A;  3C1D A;  4EM2 A;  1TW2 A;  2XKO A;  3CJN A;  3JTH A;  1R00 A;  2PMU A;  5CVJ A;  3IL2 A;  3KP7 A;  4BHB A;  4GGG A;  1UST A;  2CQK A;  4Q47 A;  4ESF A;  1S8N A;  3F22 A;  3JW4 A;  3O3K A;  2ADU A;  2EB7 A;  5FB2 A;  1EV7 A;  1K78 A;  1KYW A;  3WOD F;  2QVO A;  4RB0 A;  4HYE A;  2A68 F;  4M6Y A;  1U2W A;  2OQR A;  3TO9 A;  1XB4 A;  3GYH X;  2OQG A;  4BHP A;  1ON2 A;  3DKW A;  2D1H A;  4D0P A;  2Z3Y A;  3DV8 A;  2CGP A;  1SD6 A;  2QM3 A;  5D8L B;  3WGI A;  2E1C A;  5HS7 A;  3O6B B;  2DK5 A;  2C6Y A;  4EV0 A;  4Q4Z F;  2VT2 A;  5IT9 Z;  2JRT A;  1REP C;  3FZV A;  2M87 A;  3LAP A;  2ZKZ A;  3IRR A;  4OIN F;  3CTA A;  1J2X A;  2MH9 A;  2NAZ A;  1BOA A;  2XV4 S;  4ETS A;  1LDJ A;  3L2C A;  1YW9 A;  2COM A;  1RZ4 A;  2G7H A;  3MCZ A;  2VOO A;  5CVR A;  4KIF A;  4EJU A;  1FX7 A;  3KEO A;  5DV5 A;  5E8G A;  1XSD A;  3WTV C;  1XD7 A;  1LB2 A;  1V3F A;  1S29 A;  2ZO4 A;  3WE2 A;  3E6C C;  4H0E A;  1O3Q A;  3ECO A;  4I7H A;  1J75 A;  4UHT A;  2KRF A;  1GVJ A;  3LST A;  3J7A O;  3RDI A;  3ZMZ A;  4FX4 A;  5BMZ A;  4RGU A;  1HKT A;  5HLH A;  1ZG5 A;  1P4A A;  4IVN A;  2X0L A;  1O3S A;  1ZRF A;  1NHA A;  1S7O A;  2JSC A;  5K1Y A;  2H27 A;  2DK8 A;  5L3B A;  1UFM A;  3NEU A;  3E6D A;  2QYO A;  4R79 A;  3V8K A;  3ZMS A;  2ETH A;  1Z6R A;  5CVV A;  2IA1 A;  1FSE A;  3MZY A;  4L18 B;  2W25 A;  1J59 A;  4IRG A;  1BJA A;  5JR3 A;  4PZJ A;  2FQ3 A;  1H9T A;  1OKR A;  4UUV A;  3IC7 A;  3KFW X;  2G7U A;  1QGP A;  4ZYD A;  2PQ8 A;  1TQI A;  5EEH A;  5J6X A;  1G3T A;  1SD7 A;  3ERE D;  4I0A A;  3GUD A;  1DPR A;  4MHG A;  5JHU A;  1JE8 A;  1WI9 A;  5TJJ A;  3COA C;  4U0Y A;  2NS0 A;  2M1B A;  1HW5 A;  4YIF A;  4MQV A;  1MDM A;  2ESH A;  1XDU A;  2V1D A;  3VOD A;  2KIM A;  1R1U A;  3S2W A;  3RTR A;  3IWZ A;  2R3S A;  4A0Y A;  3GX4 X;  1Q1H A;  4N9H A;  1R58 A;  2DFI A;  1JGS A;  4EMS A;  1EH7 A;  1O57 A;  3KP3 A;  4M72 A;  3KLO A;  3PQK A;  1ZLK A;  1LJ9 A;  3P7N A;  3I5U A;  4A2U A;  4Y15 A;  1XDS A;  2LNB A;  5BPD A;  1DDN A;  2NNN A;  2VBW A;  3DQV C;  2K27 A;  3U1D A;  6PAX A;  5L3G A;  1BI0 A;  1ZN2 A;  1FWZ A;  1P2F A;  2VN2 A;  2R7D A;  1YW8 A;  5ICF A;  2V1X A;  2HGC A;  5ILS A;  4DQ2 A;  3HRM A;  3I54 A;  1FPQ A;  2LDU A;  5FO5 A;  4E70 A;  1H9G A;  1Y0U A;  1IRF A;  2HKO A;  3EYI A;  4UVC A;  3JTG A;  3C3W A;  5AON A;  5TRD A;  3CUQ A;  3F6O A;  1TTY A;  4A6E A;  2ISZ A;  3KP2 A;  1XGO A;  2Q2E A;  5HS8 A;  3LAJ A;  3JAM K;  2RDP A;  4BNC A;  3FMS A;  1OMI A;  3E3V A;  2AXL A;  1ONV A;  1WSU A;  1TNS A;  3CUQ B;  3I0T A;  1IN6 A;  2DW4 A;  2FBK A;  2Z9O A;  4JQF A;  1QZY A;  4QLC U;  4OIP F;  3RKX A;  2DU9 A;  2L3D A;  3QAH A;  1O7F A;  3IKT A;  4IF4 A;  2RN7 A;  2WC2 A;  4G6D A;  2FU4 A;  3F23 A;  1U78 A;  3P9I A;  2XAH A;  5KK1 A;  3SXY A;  4LB5 A;  3L09 A;  3D5L A;  3RPQ A;  4KMF A;  2FBI A;  3QRF F;  1ZYR F;  1G3Y A;  1F1Z A;  1U8R A;  3P9K A;  2A61 A;  5DYM A;  3L00 A;  1SMY F;  4CZZ A;  3JSO A;  2QWW A;  3MWM A;  3ZN1 A;  1XGN A;  1YTY A;  5E1W A;  3F8N A;  5FFX A;  5BQT A;  3KET A;  3IKV A;  5ED4 A;  2UZK A;  4M73 A;  1S3J A;  1STZ A;  3QPT A;  4R8H A;  1BN5 A;  3FM3 A;  4HLX A;  4RB2 C;  2VE9 A;  2ESN A;  1ON1 A;  3SQN A;  1K78 B;  2XUB A;  4HV5 A;  2F5E A;  4BHC A;  4AIJ A;  2K7L A;  4Z2Y A;  4PGG A;  4IPA A;  3P9C A;  4LD5 A;  4A12 A;  1AOY A;  1D8K A;  3FXQ A;  5LHH A;  2GWR A;  2RKH A;  5LGU A;  3TO6 A;  2H6B A;  3M8E A;  5ERI A;  4L0Z B;  3RKY A;  4OMY A;  3BJA A;  2HOE A;  1RNL A;  1F5T A;  1P4W A;  2YU3 A;  2YX4 A;  4A0X A;  4KN4 X;  3FHZ A;  5K5O A;  5HDN A;  4LFU A;  4FX0 A;  1ODD A;  2FOK A;  4AD9 A;  2GXB A;  3HHG A;  2IT0 A;  5D6F A;  2HFH A;  4HQM A;  2VOP A;  4OMZ A;  3ZP5 A;  1W4M A;  2VBZ A;  2BGC A;  4S04 A;  1U5T C;  1YYV A;  5LEJ A;  4ZYG A;  1JHH A;  3CUO A;  1QBJ A;  3NQO A;  2TDX A;  3RI4 A;  3DEU A;  2HYF A;  4I02 A;  4G7Z F;  3GXO A;  2VBY A;  1UCR A;  3VB2 A;  3DFG A;  2HQR A;  2PMH A;  3BDD A;  4CHU A;  3GZ5 A;  3W6K B;  1TLH B;  4WXD A;  3N97 A;  1IAW A;  4PDK A;  1HBX G;  1R5G A;  5ILU A;  4M71 A;  2JT1 A;  3GWZ A;  3FM5 A;  3LWF A;  1O7L A;  4P5O A;  3I53 A;  4A5N A;  4KUM A;  1U3E M;  3FX3 A;  4M6X A;  3WGH A;  2XRN A;  5HLG A;  3C18 A;  3HSE A;  3VEP A;  4KIG A;  2EJR A;  4MGR A;  4G7O F;  5LLQ A;  3ZMD A;  3KZY A;  3OOP A;  5BOX A;  3T0Y A;  4BAY A;  2W57 A;  2DAO A;  3TOA A;  1FLI A;  1SFU A;  1OYW A;  1K7A A;  4UVB A;  2P8T A;  1T2K A;  3QP6 A;  4N9I A;  3ML6 A;  3WTY C;  5FLX K;  1L3L A;  4AWX B;  2UWM A;  4HLY A;  2XAF A;  3K69 A;  2H94 A;  1Z9C A;  4RAY A;  4XLP F;  1XSV A;  3GFL A;  3TGN A;  1FOK A;  5D5U B;  2GA1 A;  1KA8 A;  1T0F A;  4CXF A;  4KYW A;  1MJ9 A;  1MD0 A;  3WTW C;  2O8X A;  1T38 A;  1KU7 A;  2QQA A;  2MC3 A;  1U6G A;  1JXS A;  5K5R A;  2XKP A;  5DD4 A;  2MH2 A;  4UV9 A;  4HF1 A;  1XCB A;  2OA4 A;  2PJP A;  1B4A A;  3F21 A;  4LLL A;  1BM9 A;  3F8F A;  4YII A;  1C0W A;  3K2Z A;  4O3M A;  2HTJ A;  4L5J A;  4B8X A;  3WTT C;  4F7Z A;  3TO7 A;  5A2Q K;  4L9T A;  2FA5 A;  2A6H F;  4MTE A;  1KYZ A;  1XSX A;  1ZGA A;  2IVM A;  3REO A;  1LEB A;  3I64 A;  3KE2 A;  4HF2 A;  3JAM Z;  1FBS A;  2GA2 A;  4EM0 B;  1B9N A;  1FYL A;  1ZAR A;  1AWC A;  5AIQ A;  2JZY A;  2LF8 A;  4EM1 A;  3HTS B;  4U7B A;  2WV0 A;  4LK1 F;  4ZZL A;  4KIB A;  1ZRC A;  5DEQ A;  3E6B A;  3I4P A;  3L9F A;  2DBB A;  3RIR A;  2MLK A;  5F1R A;  3SFZ A;  3BRO A;  1IN4 A;  3W6J B;  4WWC A;  2RC4 A;  4ENK A;  4FT8 A;  2JPB A;  2OAZ A;  3R61 A;  5FLX Z;  4WXH A;  5H20 A;  4XSX F;  5KVR A;  1KQ9 A;  4U7D A;  3TOB A;  2XHK A;  2KIF A;  4WX9 A;  1DUX C;  2YPR A;  1XGM A;  1IXC A;  2K86 A;  2O0Y A;  1SD4 A;  2MLG A;  3K1P A;  4HDV A;  1G4D A;  4WF2 A;  1FYM A;  5D5X B;  5E20 A;  2P5L C;  2OD5 A;  4IRI A;  2EV5 A;  4DNC A;  3Q9S A;  3T8R A;  2KIU A;  3MEX A;  2UXN A;  2P6S A;  4GYI A;  1BI1 A;  1UHW A;  3KP5 A;  5ILV A;  3J81 K;  4HDU A;  1B59 A;  1MGT A;  4N0B A;  2F5D A;  1P6R A;  2ELH A;  2MD5 A;  1IRG A;  3F6V A;  1EH8 A;  4KFC A;  2XGX A;  1IN8 A;  4KN7 X;  4CDG A;  2ZJ2 A;  1J0R A;  2M8E A;  3IRQ A;  1RIO H;  3HYI A;  1HW2 A;  1BI2 A;  1W7P D;  1WKM A;  2BYV E;  3LQQ A;  5CVU A;  3GO5 A;  1FYK A;  3I71 A;  1OPC A;  2Q0O A;  3IWF A;  3GF2 A;  2QQ9 A;  1UB9 A;  3GLX A;  2FE3 A;  4ENJ A;  1IXS B;  2M5W A;  4G6Q A;  1Z1D A;  1SMT A;  2EWN A;  4IRH A;  3BJ6 A;  2PFB A;  1A04 A;  3H92 A;  5EEG A;  4WXC A;  5LEK A;  1YFH A;  1HST A;  4JK1 X;  3F3X A;  2CW0 F;  2Y0M A;  1ZH5 A;  3WE3 A;  4I01 A;  2OZ6 A;  4HAM A;  1ZRE A;  2KKO A;  2FNP A;  5L3E A;  4LMY A;  2DO7 A;  2ZXJ A;  2XAJ A;  1FC3 A;  2V9V A;  1HKQ A;  1YO5 C;  5CYV A;  2YSR A;  1BBY A;  2HZT A;  2VOD A;  2L54 A;  2EV0 A;  2FRH A;  1ZHF A;  1R22 A;  4EJW A;  1TNT A;  1LVA A;  2RGV A;  3ELK A;  5LGT A;  3AAF A;  4I2O A;  3F8B A;  2PLY A;  2GZW A;  1PUE E;  2MBF A;  2L4M A;  2CWE A;  3KZZ A;  5D4S A;  4ESJ A;  1U5T A;  1WQ2 A;  2VC1 A;  3T8T A;  5IT9 K;  2BEO A;  2QUF A;  4M74 A;  1LDD A;  2CSO A;  3OV8 A;  4UVA A;  4CIC A;  3SZT A;  3ZN0 A;  3WGG A;  2HDC A;  1IZ1 A;  1R7J A;  1B6A A;  5DUI A;  1U5T B;  4CGZ A;  1G3S A;  1I27 A;  5LRS A;  1YLF A;  3MQ0 A;  5DCM B;  2E7W A;  4U88 A;  1P92 A;  2IRF G;  3FXU A;  3ROU A;  3DPT A;  3SHF A;  4M9X A;  4HV6 A;  1T98 A;  4OOI A;  4L0Y B;  5LBQ A;  4EGZ A;  3M1E A;  2FMY A;  3I59 A;  1CF7 A;  5J8C A;  4RAZ A;  4I0B A;  1GXQ A;  3HTU A;  1ZG3 A;  4WCG A;  2F2E A;  2ZME A;  3GFI A;  2HWV A;  3C7J A;  3V8J A;  3B02 A;  2A69 F;  3K9T A;  4RGS A;  1S6L A;  2O3F A;  4L9J A;  3HOS A;  2STW A;  2RNJ A;  1CGP A;  1MJA A;  1PDN C;  2VON A;  1MJB A;  2V1U A;  4ENM A;  1ZRD A;  1IXR C;  2QBY B;  5K5Q A;  4G94 A;  3HSR A;  3KEQ A;  4LJZ F;  1FNN A;  2J5O A;  4R1H A;  1O3T A;  4ESB A;  3V8L A;  3WU1 B;  1F9N A;  2EFN A;  1LEA A;  3JSP A;  5LHI A;  2WWY A;  2QBY A;  2NRA C;  4BXU A;  2HEO A;  4EJV A;  1XMA A;  2Z99 A;  1MZB A;  2KJB A;  2DT5 A;  1KU9 A;  4P96 A;  3ZMT A;  1RI7 A;  1P4X A;  3O2P E;  3M7G A;  3BPX A;  4LLG F;  3EQL F;  4P55 A;  4YFX F;  3ZPL A;  1GXP A;  1QO0 D;  4WK8 F;  2A6E F;  2Z33 A;  4XLN F;  3EUH A;  2M30 A;  1IN5 A;  1H0M A;  1SD5 A;  5HOO A;  3E6M A;  3R60 A;  2JPC A;  3K1M A;  3QPH A;  4ZYE A;  4EQQ A;  4K2E A;  2YX7 A;  3IHU A;  1J9I A;  1FSH A;  3L7W A;  4ZYH A;  3Q9V A;  2ISY A;  3LA7 A;  5BPI A;  1DPU A;  1MKM A;  2PG4 A;  1TQM A;  3HRT A;  2HS5 A;  2IJL A;  5L3D A;  4L9N A;  2ZBK A;  2EFP A;  2HR3 A;  1YQA A;  1HKS A;  2L02 A;  2OBP A;  4U0W A;  3SZP A;  1T39 A;  5LHG A;  1HW1 A;  2AS5 F;  3VOE A;  3J80 Z;  4HW0 A;  1USS A;  2HTS A;  1XGS A;  4XBF A;  3WTU C;  1YG2 A;  3PFI A;  3EET A;  4LG0 A;  1RUO A;  3N4M A;  2A3S A;  3GFM A;  5E18 F;  2LSO A;  3KLN A;  3LQR A;  1YS6 A;  5JVT A;  1XN7 A;  5E17 F;  2VE8 A;  3H3Z A;  4LG0 B;  1FP2 A;  1KU2 A;  2DLL A;  3CDH A;  1IW7 F;  4MEX F;  2FXA A;  2EFO A;  4CO8 A;  3HRU A;  3DXJ F;  1WWX A;  4KDP A;  2LKP A;  4Q48 A;  2H6C A;  2OZU A;  2OU2 A;  3WG9 A;  2BBY A;  1V4R A;  1F4K A;  3CUQ C;  4B09 A;  1HQC A;  3M8F A;  4OIO F;  2P6T A;  1ZAO A;  1BI3 A;  2E7X A;  1KQ0 A;  1T6S A;  2CO5 A;  1FZP B;  1B1B A;  2K02 A;  2W84 A;  3BOQ A;  3BWG A;  4O6J A;  5H6R A;  3E97 A;  3F72 A;  4LB6 B;  2VXZ A;  2BE5 F;  2HKX A;  4LGW A;  2E1N A;  2L4A A;  3R6S A;  5IT3 A;  3E5X A;  5D6E A;  1I1S A;  5ICG A;  4JBA A;  3MFK A;  3KP4 A;  1ZG1 A;  1FP1 D;  4Y17 A;  2XAS A;  1GHC A;  1E2X A;  4BQA A;  4ZZD A;  4S05 A;  1LDK B;  3V7C A;  2P7V B;  2W85 A;  1LNW A;  3GVA A;  5E8I A;  1K6O A;  3G3Z A;  4G7H F;  1R1T A;  4IHT A;  2QQB A;  3ULQ B;  1R23 A;  3RYR A;  1WRJ A;  3TKY A; 
#chains in the Genus database with same CATH topology
 1V55 H;  2FNA A;  4I98 B;  3OYN A;  3NAR A;  2PBI A;  3J81 Z;  5E3O A;  1FBQ A;  4HBL A;  3CJQ B;  2CQN A;  3AG1 H;  2LRE A;  1FT9 A;  2RQP A;  1TZL A;  2D1V A;  1ZQ3 P;  4CYD A;  2P7C B;  3BQY A;  1WJ5 A;  1VQ6 I;  2Y0S N;  4IXA A;  3CP8 A;  4B3A A;  3RZD J;  1EF4 A;  3BG7 A;  2MSY A;  1MNE A;  4HX4 A;  3VDX A;  1K79 A;  4MEY F;  1R5H A;  1H8A C;  2DTR A;  4GCV A;  4RB3 C;  1RKT A;  5C4J J;  2NYX A;  3AL0 B;  2W00 A;  4Y7N J;  2BV6 A;  2QF7 A;  3J80 K;  9ANT A;  4HF0 A;  1FTT A;  1KON A;  1G3W A;  3HDD A;  1D3Y A;  2L2O A;  2DI3 A;  4RS8 A;  1JHF A;  3GME A;  1VZ0 A;  2XAG A;  2P5V A;  2DYS H;  3F8C A;  5JHF A;  3OYE A;  2GOX B;  5FLM J;  1JKR C;  5HS9 A;  3R0A A;  2M45 A;  3CO7 C;  2V6C A;  2UXX A;  1OJL A;  5CQE A;  5C44 J;  1D5V A;  4HQE A;  4BL0 B;  2K4B A;  3EUK L;  2CFX A;  3IUO A;  4PJJ A;  3QP5 A;  3D0S A;  3HOV J;  4P9F A;  2VUM J;  1L0O C;  4YEL A;  3RJP A;  4W97 A;  5FKM A;  2Y31 A;  3T5X A;  1X1D A;  2IGK A;  4AVZ A;  1WGX A;  2TCT A;  2GXG A;  1W5S A;  2CYY A;  2KQR A;  4JOM A;  2WB1 A;  4A0Z A;  5D5V B;  2OTJ I;  2YUS A;  3H1C A;  1UG0 A;  1IRX A;  2XAQ A;  5IP6 A;  1PYV A;  3V7S A;  5FGM A;  4D1Q A;  3PSF A;  3G2B A;  5HDG A;  1MBH A;  3GZ6 A;  2ACJ A;  3PNT A;  4XLF A;  4ENN A;  3HSF A;  3K1N A;  1MBK A;  3FBN B;  3A01 B;  3PQJ A;  2GIV A;  3ZGK A;  2GOM A;  1PP8 F;  2K4J A;  2QEX I;  2VLA A;  2HQ5 A;  1OR7 A;  2JTV A;  4M9S A;  1PP7 U;  5J47 A;  2Y48 A;  3CZ6 A;  2Y9Z A;  4CCJ A;  3BPV A;  2DPD A;  1T0F C;  2ZFW A;  3AFH A;  2XPU A;  1ITY A;  3RQI A;  1RET A;  1Z91 A;  4XID A;  1MH3 A;  4KIC A;  2PMZ N;  2K5C A;  3CCU I;  5K7H A;  2ZCW A;  2IW5 A;  1ETQ A;  5JLX A;  3NAU A;  4RB1 A;  1D8J A;  2KZV A;  4GXO A;  3M9A A;  1UZC A;  3FF5 A;  3DF8 A;  2GAU A;  4LK0 F;  2GQQ A;  2COB A;  2R5Y A;  4KA4 A;  5HNH A;  3FXK A;  1W1W E;  1ZGW A;  4IJA A;  2XPV A;  3Q5F A;  2EA4 A;  4HEA 2;  2Y69 H;  3DLA A;  4M9Z A;  3J7Z I;  4BJ5 C;  2LC2 A;  4HG2 A;  4CCO A;  5J3L A;  4Q5S F;  2YS9 A;  3WTX C;  2LG4 A;  3OS0 A;  4HNT A;  5IP9 J;  4RGX A;  1TT0 A;  5HOD A;  1Z6T A;  1R36 A;  2RVC A;  5D8K B;  4PJL A;  3GTK J;  3RKW A;  3E5Q A;  3HB9 A;  1D1B A;  1W5T A;  1ZGJ A;  2EZL A;  2YR2 A;  5E3M A;  2O03 A;  5D4R A;  2X9D A;  2JVG A;  1V54 H;  2P4W A;  5DCM A;  3VYU B;  1AU7 A;  2EIK H;  4HZF A;  4KMU X;  3HRS A;  4LIT A;  4BJT A;  3CCM I;  3H3U A;  4NQW A;  2KL4 A;  2VIX A;  2V79 A;  2ID6 A;  2Z1D A;  3KZI C;  3I59 B;  1CF7 B;  5EG0 B;  4JX5 A;  1XMK A;  3OYI A;  3FMQ A;  2HQN A;  2ZSI B;  1S7E A;  1Q1V A;  1UHM A;  4RAG A;  1VQ8 I;  3MZH A;  1I5Z A;  4BYY A;  2O61 A;  1YIO A;  5ICE A;  3T1B A;  2R7S A;  5E1Z B;  4AUX A;  2ZME B;  2VJJ A;  4FHT A;  2FF4 A;  3GTJ J;  2R4G A;  3KP6 A;  5F64 A;  2ZJR F;  1HSJ A;  5C4X J;  1O3R A;  3DBR B;  2EK5 A;  3I4M J;  2IA2 A;  3JRC A;  1VTN C;  4D7M A;  5EG0 A;  3CCE I;  3IAM 2;  4BDZ A;  1WH7 A;  2P5K A;  1X58 A;  3CF5 F;  2XGC A;  4MFD A;  2FBH A;  1S7A A;  1JJ6 C;  5EJC A;  4KNY A;  2CUJ A;  4XOR A;  1RRJ A;  1BR4 A;  4U87 A;  3U2R A;  1BC7 C;  5EGO B;  3S17 J;  4QWQ A;  2VKD A;  3FXR A;  4PCQ A;  1J5Y A;  1BA5 A;  4MNU A;  1QVU A;  2H1L A;  2D2W A;  5CLS A;  2VPR A;  1ETY A;  5CVI A;  4ZTF A;  3GFJ A;  3HOT A;  3VYT B;  2BXZ A;  3G1O A;  3H5A A;  2WTE A;  4CCL A;  2DQR A;  3LFK A;  3JRI A;  3EPZ A;  2JMW A;  4HX8 A;  4BY7 J;  4XRF A;  1SVO A;  1JKO C;  4HX7 A;  1RUN A;  3CLO A;  5F6F A;  2PEX A;  1MMG A;  4Z6Y A;  3OYF A;  3TW7 A;  1FMV A;  1TQP A;  1MBE A;  5IOY A;  3CME I;  4ABZ A;  3QU6 A;  3GW2 A;  5EGO A;  5FFZ A;  3ISP A;  2NNY A;  3N05 A;  2IGN A;  1IN7 A;  1XMX A;  1V5G A;  1FBU A;  3LL7 A;  3AL0 C;  2X85 A;  2Y75 A;  5H6Q A;  2F5F A;  2VAS A;  3CQZ J;  1OYI A;  3OR1 C;  3HOY J;  2ZNY A;  2WY7 Q;  5EZH A;  1WH5 A;  4YEJ A;  2QLZ A;  2DPU A;  4LLN A;  2KP6 A;  1QPM A;  1YIT I;  3QYB A;  2LR8 A;  1J7K A;  2X1E A;  4A6D A;  3MKZ A;  2K3F A;  2CU7 A;  2PJR B;  4DZJ A;  3C2G A;  4EJO A;  2QGU A;  3M3Y J;  2DA6 A;  4AID A;  3DBL B;  2HVQ A;  2Q1Z B;  3ZMU A;  4YG2 F;  3ECH A;  1POG A;  2MA3 A;  1X3U A;  1HOM A;  1ULY A;  4OU0 A;  1N75 A;  4NB5 A;  1FOX A;  2DDB A;  2ZNZ A;  2IPQ X;  5CJ9 A;  1VQ7 I;  3K4C A;  2VKV A;  2XRO A;  3K4L A;  2CG4 A;  2CS3 A;  2HDW A;  3I58 A;  4O5V A;  5ICC A;  3OS2 A;  2HQA A;  2V26 A;  2QSH X;  4X6A J;  3WU0 A;  4YFN F;  3HIF A;  1R71 A;  4XOT A;  4B43 A;  5FD5 A;  4BE1 A;  1WJD A;  3BY6 A;  2DYR H;  2VQC A;  1TW3 A;  4UB8 C;  3BJO A;  3DPL C;  2XF7 A;  3HKZ A;  2IEK A;  5FLV A;  5FRM A;  4AVP A;  1W7P A;  3DWL E;  4D9J A;  1KQ8 A;  4UXN A;  3QU3 A;  2KIS A;  2M7A A;  2EZK A;  2B0L A;  2H1K A;  4RGR A;  4A5M A;  2VC0 A;  1SAX A;  4BH9 A;  2PN6 A;  2MC4 A;  3LOC A;  1UAA A;  1DP7 P;  4DZP A;  2JA2 A;  3BTC A;  2VQH A;  3FMR A;  3B73 A;  4RM2 A;  4IHX A;  3HHH A;  2A6T A;  4DW6 A;  1FOW A;  3BR5 A;  1W7P B;  2IS6 A;  1BIB A;  3FWE A;  4UB6 C;  2J5P A;  3G73 A;  2R93 J;  3LSJ A;  1V5F A;  4MTD A;  1EH6 A;  2W24 A;  2WAE A;  3K70 C;  4CCN A;  1BIA A;  4ON0 A;  3D5S C;  3SEZ A;  3GCM A;  1Y6I A;  5AIP A;  3WTZ A;  5JVG F;  2KFD A;  2XDV A;  5DCF A;  3HUG B;  1QHG A;  4YIR X;  2DFH A;  1MDM B;  1Z7U A;  1GV5 A;  3F9K A;  2E71 A;  2H8R A;  4BY1 J;  1B9M A;  4MQ9 F;  2NOJ B;  5A2Q Z;  1K4T A;  1W0U A;  2KJC A;  1QZZ A;  5CPR B;  3U9G A;  4B47 A;  2Q8K A;  3LA3 A;  1HC8 A;  2VKH A;  2F5C A;  1B8I A;  4ASN A;  3HGY A;  2G9W A;  2L01 A;  3S3O A;  3ABT A;  3ZR8 X;  2PI0 A;  2FEZ A;  1SFX A;  3HUG A;  1QQI A;  4XSZ F;  4EGY A;  5IP7 J;  4YRV A;  3CO6 C;  4X1E A;  2L7K A;  2L9N A;  4KJZ A;  2MG4 A;  1YI2 I;  1XS9 A;  4A3C J;  2OTL I;  4M3F A;  3BZK A;  4BXF A;  4FAS D;  5K7F A;  3BP8 A;  3TDU C;  1YJN I;  4N4O B;  4KT5 C;  3HKZ N;  4W1U A;  1SAN A;  3E5U A;  4CUG A;  3VPR A;  4G8X A;  1XC5 A;  3RPU A;  1Z3Y A;  1W5C C;  1XCV A;  1LQ1 A;  4IHY A;  5DM6 F;  2ECC A;  2M3A A;  4EVI A;  1E17 A;  2EA2 A;  3UKG A;  2A5Y B;  2WY8 Q;  3RYP A;  2B9S A;  2K40 A;  4NHJ A;  1HXD A;  5L3C A;  1FY7 A;  4F55 A;  2VT3 A;  1QNT A;  3K6G A;  1IUY A;  3WTS C;  2HVR A;  5D5W B;  5HLI A;  3A2K A;  3PO2 J;  1SC7 A;  2Z5U A;  3ZMV A;  1OYY A;  1R1V A;  2EV6 A;  1E0E A;  5B1A H;  3Q3S A;  5DD8 A;  2LY2 A;  1Z05 A;  2QEN A;  3K4K A;  4RBO A;  3FIW A;  3PUB A;  4B1R A;  3K0L A;  1LKX A;  2NVT J;  4L9V A;  1TBX A;  3LMM A;  4UV8 A;  3FXL A;  2O5R A;  2OV7 A;  1KU3 A;  2JWT A;  2HYG D;  3ERM A;  2R7F A;  3TQN A;  2QKM B;  2X6W A;  5BS6 A;  1KGS A;  1VND A;  2VPL A;  1JTY A;  1OLT A;  1OIS A;  2JUG A;  4E7K A;  1YHQ I;  4HOB A;  3UNG C;  3GEZ A;  2LF7 A;  1E3H A;  2AQF A;  1B72 A;  3WG7 H;  1IDZ A;  3BR3 A;  4IHS A;  4ZH4 F;  2DDA A;  2IP2 A;  5JI6 A;  5HDK A;  2R7Z J;  5GAE J;  3OIQ A;  1OCO H;  4FE4 A;  4OIR F;  2KHM A;  4PGH A;  5E1X A;  5DUK A;  1FEX A;  2XVC A;  3RZO J;  4Y13 A;  2MAB A;  3CF2 A;  2JA8 J;  2Z16 A;  2L7Z A;  5FD6 A;  1ZLJ A;  2ICW G;  5DDG A;  1SEU A;  1IF1 A;  2QZ8 A;  2Q2E B;  3DP7 A;  2X6Y A;  3Q0W A;  3OR2 C;  1I3A A;  2XB5 A;  1K4S A;  2XIG A;  3R0J A;  4GO1 A;  2NVQ J;  4AC0 A;  4TV7 A;  4P9U A;  1R9T J;  3ZCO A;  2A07 F;  3TDZ C;  3MAJ A;  1AKH A;  3F8M A;  2VBX A;  2HZD A;  2X4H A;  2QSF X;  2KZG A;  3EYY A;  3BZ6 A;  2ME6 A;  3NRV A;  2FSW A;  3I3L A;  4GFB A;  3W3C A;  4HA8 A;  5L3F A;  3VFZ A;  2JSP A;  2LTP A;  3V7R A;  1G6N A;  2NOG A;  3BTI A;  2D45 A;  2DQL A;  1JI8 A;  1K61 A;  4I09 A;  2IA0 A;  3KCC A;  1UEL B;  4ZDO A;  4XN3 A;  2DT6 A;  5HVQ C;  3H9G A;  2VJ5 A;  3BG6 A;  3BG5 A;  3KEY A;  3IV5 A;  1BL0 A;  2B63 J;  4ZYA A;  2FML A;  1M1E B;  4RLF A;  5GP9 A;  2EFW A;  1YW7 A;  4Y52 J;  4U0V A;  1K6Y A;  2XGD A;  3LA2 A;  4OIQ F;  5LGN A;  4AIH A;  4G9Y A;  1SFE A;  5LRR A;  2KT0 A;  3JCU C;  3QOP A;  3GTM J;  4AIK A;  1YS7 A;  4UNO A;  1BC8 C;  5JFR A;  3V4G A;  2RV8 A;  3BCB A;  4L5I A;  3U1K A;  4YFK F;  4HNU A;  5J8F A;  2BXY A;  2O6G E;  1D1A A;  2DMU A;  4IOC F;  2H09 A;  3R4K A;  2WA0 A;  4GYG A;  1I6X A;  2STT A;  3WU2 C;  1I1G A;  1TWH J;  1OCR H;  4B3X A;  4EJT A;  1TWC J;  2EFQ A;  3EDP A;  2XB0 X;  3PIO F;  3A01 A;  3ABU A;  3ZQ7 A;  3C1D A;  4D5F A;  1LVK A;  1TW2 A;  2EPF A;  2XKO A;  3CJN A;  4EM2 A;  1FTZ A;  4J19 A;  3JTH A;  1R00 A;  2PMU A;  5CVJ A;  3IL2 A;  3KP7 A;  4BHB A;  1T95 A;  4AM3 A;  1Z21 A;  4FET A;  4GGG A;  1NK2 P;  1UST A;  2CQK A;  4Q47 A;  4ESF A;  3DU6 A;  1S8N A;  3F22 A;  4ZC3 A;  3JW4 A;  3O3K A;  3D5R C;  3QOD A;  2ADU A;  2AHQ A;  2EB7 A;  3BG9 A;  3W2V A;  5GAH J;  4IQ4 A;  5FB2 A;  1EV7 A;  1K78 A;  2X1D A;  1KYW A;  3EUA A;  3WOD F;  2QVO A;  1D0X A;  2EQR A;  4RB0 A;  4HYE A;  3H3V K;  1Y0N A;  2A68 F;  4M6Y A;  1U2W A;  2IBD A;  2LY1 A;  1JT0 A;  2R7U A;  2OQR A;  4F3Q A;  1W36 D;  2LBF A;  3TO9 A;  3CCR I;  1F36 A;  1XB4 A;  3GYH X;  2OQG A;  4RM3 A;  1T33 A;  4OAY A;  4BHP A;  1ON2 A;  4E7Z A;  3DKW A;  2D1H A;  1MBG A;  1RC9 A;  3ZQH A;  4D0P A;  2NXN B;  3BR1 A;  3SDG A;  2Z3Y A;  2LBF B;  4XM3 A;  4ZJZ A;  3DV8 A;  1APL C;  2CGP A;  4M3E A;  1SD6 A;  1Y1W J;  3H36 A;  2QM3 A;  1R4M B;  2HXI A;  5D8L B;  1QZE A;  5HS7 A;  3O6B B;  3WGI A;  2DK5 A;  5GTH C;  2E1C A;  2C6Y A;  3JRG A;  4EV0 A;  4Q4Z F;  1X2N A;  2VT2 A;  2LOO A;  2LH9 A;  5IT9 Z;  2EZI A;  4II2 A;  2JRT A;  4QPO A;  1REP C;  3FZV A;  4BXX J;  2M87 A;  3LAP A;  2ZKZ A;  3IRR A;  1JUS A;  4OIN F;  1A31 A;  3M1C A;  4IOA F;  3CTA A;  1J2X A;  2MH9 A;  2NAZ A;  1BOA A;  2XV4 S;  2FJ1 A;  2EIL H;  2VJI A;  4ETS A;  3PJR A;  1LDJ A;  1FIA A;  4PFP A;  3L2C A;  1IJW C;  2E36 A;  3W6V A;  1YW9 A;  3G6E I;  1I6H J;  2COM A;  5LFA A;  1RZ4 A;  3TW6 A;  2G7H A;  3H0G J;  2V9K A;  3MCZ A;  2VOO A;  4Y3O A;  4M3D A;  3PIP F;  5CVR A;  4KIF A;  4EJU A;  1FX7 A;  3KEO A;  5DV5 A;  4RMN A;  5E8G A;  3W2W A;  3LSR A;  5K7Z A;  1X2M A;  4IX7 A;  1XSD A;  1U9N A;  3WTV C;  3A0H C;  5FKL A;  1XD7 A;  3ZXS A;  3MZ8 A;  1LB2 A;  4N4N B;  5J1U A;  1DQU A;  2HPI A;  1V3F A;  1S29 A;  1S72 I;  2ZO4 A;  3WE2 A;  4QSH A;  3E6C C;  4H0E A;  1XPX A;  1O3Q A;  5EYR A;  3ECO A;  1QHH D;  4I7H A;  1PUF B;  2HVS A;  2DOF A;  1J75 A;  1OQY A;  5KAI C;  4D7N A;  1IRZ A;  4AYB A;  4UHT A;  2KRF A;  2M4K A;  2Y2Z A;  1GVJ A;  3LST A;  3J7A O;  3RDI A;  3ZMZ A;  4FX4 A;  5F08 A;  3HBL A;  1E3O C;  1XX5 A;  5BMZ A;  4RGU A;  2LD5 A;  1HKT A;  5HLH A;  1ZG5 A;  1P4A A;  4IVN A;  1PUF A;  4PJ0 C;  2X0L A;  1O3S A;  4XRM A;  4FE7 A;  4B48 A;  1ZRF A;  2KRH A;  1NHA A;  1S7O A;  2JSC A;  5K1Y A;  2MFZ A;  2BZT A;  4CYC A;  3L1P A;  4I6Z A;  2JQ7 A;  2H27 A;  3DLL F;  2DK8 A;  3CCV I;  5L3B A;  1UFM A;  4UUT A;  3X2Q H;  2E2H J;  3FXO A;  2LMD A;  3PM1 A;  3NEU A;  3S3M A;  3E6D A;  1SFK A;  2QYO A;  4C9Y A;  4R79 A;  1HA8 A;  3V8K A;  4NC8 A;  3CC4 I;  4NC6 A;  3ZMS A;  2ETH A;  2Y9Y A;  1Z6R A;  3FKJ A;  4XR6 A;  1BJZ A;  3DTI A;  5CVV A;  2IA1 A;  3CDL A;  1FSE A;  2DFF A;  3MZY A;  3CC7 I;  4L18 B;  1R4N B;  2W25 A;  2GXA A;  1MMD A;  1J59 A;  3L2V A;  1K83 J;  1XTA A;  1BJA A;  4IRG A;  5JR3 A;  1QPI A;  2ZXW H;  1Y8Q B;  4PZJ A;  1YX5 A;  2DT7 B;  3S15 J;  2FQ3 A;  1H9T A;  1OCT C;  1OKR A;  2QSG X;  3IC7 A;  4UUV A;  3KFW X;  2G7U A;  3I56 I;  1QGP A;  2UV1 A;  3MN2 A;  4ZYD A;  1EKE A;  2DN0 A;  2PQ8 A;  1TQI A;  5B66 C;  2W7N A;  5EEH A;  5J6X A;  1G3T A;  1SD7 A;  3IH4 A;  3HOW J;  2VXD A;  3ERE D;  4I0A A;  2MYS A;  3GUD A;  2BW3 B;  1DPR A;  1VQ4 I;  4MHG A;  3KIO A;  5JHU A;  1JE8 A;  1WI9 A;  1WI3 A;  5TJJ A;  3MKW B;  5BNG A;  4HNV A;  3LSK A;  3COA C;  1BW6 A;  2CH0 A;  4LIV A;  3F0C A;  4NC7 A;  5E3N A;  2NS0 A;  2M1B A;  1HW5 A;  4U0Y A;  1VQ9 I;  1ETV A;  4YIF A;  3BT9 A;  4MQV A;  4E7H A;  1MDM A;  4BGD A;  2ESH A;  3WHC A;  1XDU A;  2WBM A;  3OYL A;  2E60 A;  3K2A A;  2BW3 A;  2V1D A;  3VOD A;  2KIM A;  1MND A;  3ASN H;  1R1U A;  2FQ4 A;  2ME0 A;  4ANJ A;  2Y30 A;  1GV2 A;  3S2W A;  3OSF A;  3HOZ J;  2JVH A;  3RTR A;  3IWZ A;  2ZXH A;  1WJA A;  2R3S A;  3CCY A;  4A0Y A;  3GX4 X;  1Q1H A;  4N9H A;  2KIQ A;  4BE0 A;  4HRI A;  4PJM A;  3Q0U A;  1R58 A;  2DFI A;  1JGS A;  4EMS A;  3OSG A;  1EH7 A;  1O57 A;  3KP3 A;  4NDL A;  1GUU A;  4M72 A;  3DTE A;  4RDU A;  3KLO A;  3PQK A;  1NH3 A;  3CJT B;  4BEH A;  1ZLK A;  1LJ9 A;  3P7N A;  2XPW A;  2VB6 A;  3E7L A;  3I5U A;  4A2U A;  2R92 J;  4Y15 A;  1XDS A;  3HOU J;  1T08 B;  2LNB A;  4C3I J;  4A3L J;  3MKY B;  4A69 C;  5BPD A;  1DDN A;  2NNN A;  2VBW A;  3ZQQ A;  3DQV C;  2K27 A;  3U1D A;  5IYD J;  6PAX A;  5L3G A;  4DOZ A;  1BI0 A;  1ZN2 A;  1FWZ A;  1P2F A;  2VN2 A;  3DKX A;  2F4M B;  4IO9 F;  2FX0 A;  1UMQ A;  2WAF A;  2R7D A;  2XC7 A;  1YW8 A;  5ICF A;  3FDY A;  3FBI B;  2V1X A;  2HGC A;  1KZH A;  3S1M J;  5ILS A;  4DQ2 A;  2D5V A;  3HRM A;  3I54 A;  2V7F A;  1BW5 A;  1FPQ A;  3OY9 A;  2LDU A;  5FO5 A;  2IS1 A;  3ZQC A;  2W82 A;  4E70 A;  4UY8 I;  3BZC A;  1H9G A;  1WFX A;  1Y0U A;  2DOA A;  3DPU A;  1X4P A;  1IRF A;  2HKO A;  2R7Q A;  1VQL I;  3CCJ I;  5FKN A;  4IHV A;  1U9O A;  2DJN A;  3EYI A;  2WAQ A;  2JA5 J;  4UVC A;  1ZTR A;  3JTG A;  3C3W A;  5AON A;  3VYR B;  5TRD A;  2E1M C;  3H5N A;  3M4O J;  2AXT C;  1N78 A;  3CUQ A;  3F6O A;  1LFU P;  1ETK A;  3GTG J;  1TTY A;  3C2B A;  4A6E A;  2G0E A;  4AU7 A;  2ISZ A;  3KP2 A;  1XGO A;  2Q2E A;  3FXJ A;  5HS8 A;  3LAJ A;  3JAM K;  2RDP A;  2M4G A;  4BNC A;  3FMS A;  1IUF A;  1OMI A;  3FHN A;  1JUP A;  2P81 A;  2DMN A;  3CC2 I;  3E3V A;  2AXL A;  2ECB A;  1TWF J;  1ONV A;  2JN6 A;  1WSU A;  1AKH B;  1TNS A;  2JUC A;  5FKK A;  3CUQ B;  3I0T A;  4IHW A;  1IN6 A;  2DW4 A;  2FBK A;  2PMZ A;  2Z9O A;  4JQF A;  4A3M J;  2L7F P;  4HPQ A;  1QZY A;  2OCE A;  4QLC U;  4OIP F;  3RKX A;  2M7B A;  2DU9 A;  3H35 A;  2L3D A;  2XF5 A;  4LG3 A;  3QAH A;  4V19 K;  1O7F A;  4IZZ A;  3IKT A;  4IF4 A;  3K7A J;  3PNV A;  2WC2 A;  2RN7 A;  1E3P A;  2FU4 A;  4G6D A;  3F23 A;  4ZDL A;  3PUF A;  3P9I A;  1U78 A;  2XAH A;  5KK1 A;  3CD6 I;  3SXY A;  3L2W A;  2VKE A;  3IH2 A;  3MKL A;  4LB5 A;  3L09 A;  2DA3 A;  3ZRG A;  3D5L A;  2VL8 A;  2K9L A;  2IS4 A;  4A3D J;  2BOL A;  1YOV B;  3RPQ A;  3S14 J;  5B1B H;  1QVT A;  4KMF A;  2BVL A;  3LFU A;  2OPT A;  4KIT B;  2I8D A;  3SFI A;  2FBI A;  2LP0 A;  3QRF F;  1ZYR F;  1G3Y A;  1NG7 A;  1F1Z A;  4MIM A;  3ASO H;  2NVU B;  1U8R A;  1T8I A;  3P9K A;  2A61 A;  2O7O A;  4A3J J;  4BBS J;  5DYM A;  3D1N I;  3L00 A;  1SAU A;  1SMY F;  4CZZ A;  3JSO A;  2QWW A;  5E79 C;  3FK6 A;  3MWM A;  3ESW B;  1BR1 A;  1DP3 A;  3HZJ A;  3ZN1 A;  1XGN A;  2OF7 A;  3OOU A;  1YTY A;  3K4B A;  5E1W A;  3F8N A;  3OYM A;  5FFX A;  2ELJ A;  2CW8 A;  2LK2 A;  2Z2S B;  5KAF C;  2DJI A;  5J1R A;  3BTJ A;  5BQT A;  2NS8 A;  4DYQ A;  3KET A;  1D5Y A;  2DOD A;  3GZN B;  2AQE A;  4A3G J;  3IKV A;  5ED4 A;  2UZK A;  3JRA A;  2XRL A;  4M73 A;  4IEJ A;  1S3J A;  5J4V A;  2R5Z A;  1R5I D;  1STZ A;  2F48 A;  1Z3X A;  3QPT A;  4R8H A;  1WJF A;  1BN5 A;  3FM3 A;  2DA4 A;  3OWT A;  2B7E A;  4HLX A;  1P7I A;  4RB2 C;  2VE9 A;  4XQF A;  2ESN A;  1ON1 A;  1V5E A;  3SQN A;  1K78 B;  2E2I J;  2XUB A;  4HV5 A;  2F5E A;  2OCC H;  3BR2 A;  4BHC A;  4AIJ A;  3L2U A;  2K7L A;  2GLO A;  4Z2Y A;  4PGG A;  2HYJ A;  2FD5 A;  2QCO A;  5B5E C;  4IPA A;  3E0J B;  3SEQ A;  3P9C A;  4LD5 A;  1SFO J;  4A12 A;  4XKV A;  1AOY A;  3V42 A;  3QOE A;  1D8K A;  3FXQ A;  4EAT A;  4F92 B;  5LHH A;  5DTD A;  2GWR A;  2RKH A;  4BS9 A;  5LGU A;  5J1Y A;  5TGT A;  4NNJ A;  4XNF A;  4V2F A;  3TO6 A;  1ZKG A;  2H6B A;  3M8E A;  4FIS A;  5ERI A;  4L0Z B;  3RKY A;  4OMY A;  1BR2 A;  2R7W A;  1D0Y A;  3BJA A;  2HOE A;  5DS9 A;  3AKZ A;  4P1W A;  3S16 J;  1RNL A;  1RKW A;  1F5T A;  1P4W A;  2KDZ A;  2YU3 A;  2YX4 A;  2A05 A;  2L7M P;  4A0X A;  1IV6 A;  4KN4 X;  3W2A A;  4G12 A;  3FHZ A;  5K5O A;  5HDN A;  4LFU A;  4FX0 A;  1ODD A;  1LPQ A;  2FOK A;  2L0K A;  4AD9 A;  1WCM J;  1ZR2 A;  2K9M A;  2GXB A;  1TL8 A;  3HHG A;  4XRS G;  2IT0 A;  2F6C A;  5D6F A;  2HFH A;  4HQM A;  3DBH B;  4A3F J;  2VOP A;  4OMZ A;  3ZP5 A;  3MMY B;  1W4M A;  4CSW A;  3JRD A;  3K4J A;  2VBZ A;  4QTR A;  1NTC A;  2BGC A;  2NS7 A;  2CW7 A;  1MH4 A;  4S04 A;  5IY5 H;  1U5T C;  3S93 A;  1YYV A;  4C3H J;  3S1Q J;  3BG3 A;  5E3L A;  1LFP A;  1O4X A;  5LEJ A;  4ZYG A;  3LNQ A;  1JHH A;  3CUO A;  1IV8 A;  1HLV A;  1QBJ A;  3NQO A;  2TDX A;  4NBQ A;  3RI4 A;  3DEU A;  2HYF A;  4DYR A;  4I02 A;  4G7Z F;  3GXO A;  2YU9 J;  1ETX A;  2VBY A;  1UCR A;  3VB2 A;  3DFG A;  2HQR A;  3LSI A;  3ABM H;  5F04 A;  2PMH A;  4XLC A;  4DBR A;  5IPA A;  4C2U A;  4PSW A;  3BDD A;  4CHU A;  3L2R A;  2CQX A;  3GZ5 A;  1AHD P;  3BR6 A;  1YRN B;  3W6K B;  1TLH B;  4ZDP A;  4BE2 A;  4WXD A;  2JA7 J;  1UG2 A;  3ZOB A;  4KT6 A;  3HEF A;  2XSD C;  3N97 A;  2E35 A;  1EJ9 A;  3A4C A;  1IAW A;  3S2D J;  4PDK A;  1HBX G;  1R5G A;  2K3P A;  5ILU A;  4M71 A;  1ERD A;  2JT1 A;  2ZME C;  3GWZ A;  3FM5 A;  3LWF A;  1O7L A;  4P5O A;  3I53 A;  4V2G A;  3JRH A;  1ZR4 A;  4A5N A;  4CYC B;  1YE9 A;  4KUM A;  1U3E M;  3FX3 A;  4M6X A;  3WGH A;  3AG3 H;  2XRN A;  5HLG A;  3C18 A;  2XSJ C;  1A5J A;  4PK4 A;  3HSE A;  3VEP A;  2R7T A;  3AG2 H;  4KIG A;  2L5Q A;  3QPS A;  2DCE A;  2EJR A;  5F0H A;  4MGR A;  2OJE D;  2DTZ A;  3OYA A;  4G7O F;  5LLQ A;  3ZMD A;  1VQN I;  3KZY A;  3TL4 X;  3OOP A;  4EEF G;  5BOX A;  1OCZ H;  4BQN A;  3T0Y A;  4A3K J;  4BAY A;  3RCO A;  2W57 A;  4J00 A;  2DAO A;  3TOA A;  2FOW A;  2RRE A;  1HCR A;  4XLA A;  2LKX A;  1X3W B;  5F0C A;  1FLI A;  1A6I A;  4D5C A;  2HPM A;  1SFU A;  1VQM I;  1MBJ A;  1OYW A;  1K7A A;  4UVB A;  3A1Y A;  2P8T A;  1SVL A;  3KX2 A;  1T2K A;  3G4S I;  3QP6 A;  3CCQ I;  1X1P A;  4N9I A;  5KHD A;  3ML6 A;  3MVP A;  3WTY C;  2VQG A;  5FLX K;  1L3L A;  4AWX B;  2UWM A;  2K9Q A;  4HLY A;  2XAF A;  3K69 A;  2H94 A;  1Z9C A;  1D0Z A;  1QU3 A;  4RAY A;  4XLP F;  1XSV A;  3GFL A;  1X3Z B;  2KLO A;  1YX3 A;  3TGN A;  1FOK A;  2HNH A;  4OWR B;  5D5U B;  4LOC A;  3LSM A;  2GA1 A;  1KA8 A;  2I5U A;  1T0F A;  3PFY A;  4CXF A;  4KYW A;  1TP4 A;  1MJ9 A;  1MD0 A;  3WTW C;  2O8X A;  3LSG A;  1WJB A;  1XG1 A;  1T38 A;  1KU7 A;  2QQA A;  1WJC A;  2MC3 A;  1X1A A;  3K4M A;  1U6G A;  1JXS A;  2RNG A;  3SYT A;  5K5R A;  2CQ7 A;  1LFB A;  4C2T A;  2XKP A;  4F91 B;  2L9R A;  3QYF A;  5DD4 A;  3S32 A;  2MH2 A;  4UV9 A;  1T56 A;  2HU9 A;  4HF1 A;  1XCB A;  2OA4 A;  2PJP A;  1ORK A;  1B4A A;  4NUB A;  3CMY A;  3F21 A;  4LLL A;  3SZG A;  4B4C A;  1FOY A;  3VWB A;  3FXM A;  1ETO A;  3PSI A;  2V4J C;  1BM9 A;  3JRB A;  2VQL A;  3F8F A;  4YII A;  3BTL A;  5IYC J;  4II3 A;  1NG6 A;  1U0J A;  1C0W A;  3K2Z A;  4O3M A;  3HXL A;  2P0W A;  4PUS A;  2HTJ A;  4L5J A;  4XN0 A;  2OC6 A;  3A03 A;  4BEH B;  4A3B J;  4B8X A;  3WTT C;  4F7Z A;  3TO7 A;  4MLO A;  5A2Q K;  2LFB A;  4L9T A;  5KNL A;  2FA5 A;  1GDT A;  5C3E J;  2A6H F;  3CLQ A;  2E5N A;  4CCM A;  4MTE A;  3VYS B;  1KYZ A;  3RSN A;  1XSX A;  1ZGA A;  1ACI A;  2L9V A;  1MMA A;  1R49 A;  2MGQ A;  4CZC A;  2IVM A;  3REO A;  1LEB A;  1MIJ A;  3I64 A;  4IQJ A;  3KE2 A;  1I50 J;  4HF2 A;  2BY0 A;  3JAM Z;  1FJL A;  1FBS A;  2GA2 A;  4EM0 B;  3BC8 A;  1B9N A;  3S2H J;  1FYL A;  2IS2 A;  3GTP J;  1ZAR A;  2M0C A;  1HDP A;  3HJE A;  1AWC A;  4F93 B;  2CUZ A;  1VQK I;  4RA2 A;  5AIQ A;  1ENH A;  2EZH A;  2JZY A;  1X1C A;  2LF8 A;  4EM1 A;  3HTS B;  1MMN A;  4U7B A;  2WV0 A;  4JYK A;  4LK1 F;  5FRO A;  4ZZL A;  4KIB A;  1ZRC A;  3CCL I;  5DEQ A;  3E6B A;  3I4P A;  3JRE A;  3L9F A;  3KPH A;  3TP3 A;  2R0Q C;  3OYB A;  2DA5 A;  2DBB A;  2DXI A;  3RIR A;  2H8W A;  2MLK A;  1ZEL A;  4M6V A;  2BY2 A;  5F1R A;  3SFZ A;  3BRO A;  3HPG A;  1TWG J;  1IN4 A;  1G2H A;  3W6J B;  4WWC A;  1S5L C;  1F43 A;  2RC4 A;  4ENK A;  4FT8 A;  1JGG A;  2JPB A;  2OAZ A;  3R61 A;  5FLX Z;  5F0F A;  1R6R A;  5JLW A;  4WXH A;  5H20 A;  2A5W A;  4PJN A;  4XSX F;  5KVR A;  2JA6 J;  1KQ9 A;  2HXO A;  4U7D A;  3TOB A;  2ELK A;  2CV2 A;  2XHK A;  2KIF A;  4WX9 A;  1DUX C;  5CKT A;  2YPR A;  1J09 A;  2GBY A;  1XGM A;  1IXC A;  2M9H A;  3DTK A;  4CCK A;  2K86 A;  2O0Y A;  1SD4 A;  4XIC A;  1H89 C;  2Y0S A;  2MLG A;  4A3E J;  1Z77 A;  3K1P A;  4HDV A;  1G4D A;  4WF2 A;  1FIP A;  1FYM A;  5D5X B;  5E20 A;  3BR0 A;  2OD5 A;  2P5L C;  1IG7 A;  4RAF A;  4IRI A;  2EIJ H;  2EV5 A;  4XLE A;  3ONQ A;  2R7O A;  4DNC A;  3S3N A;  2IXS A;  3Q9S A;  3T8R A;  2KIU A;  3MEX A;  3GTQ J;  4ITV A;  2WAD A;  2UXN A;  1MBF A;  4PFO A;  5HLT A;  1IC8 A;  2DA7 A;  2WAQ N;  3FIS A;  4XK4 A;  2P6S A;  3HOX J;  2EIN H;  4GYI A;  3H9Q A;  1BI1 A;  1UHW A;  3KP5 A;  1ETW A;  5ILV A;  3RKQ A;  3I9V 2;  2F5V A;  3J81 K;  1MNM C;  2M2E A;  1LE8 B;  3OYC A;  4HDU A;  2PX9 A;  1B59 A;  4BQO A;  1MGT A;  4N0B A;  3B6A A;  1I39 A;  2F5D A;  5F1J A;  5M5X J;  1P6R A;  2ELH A;  2GM4 A;  1X1B A;  2MD5 A;  1OFC X;  1IRG A;  5GTI C;  4OAZ A;  3F6V A;  5F27 A;  1EH8 A;  1P7J A;  2GIZ A;  2DMQ A;  4KFC A;  3CES A;  3A0B C;  2DA2 A;  2E34 A;  2XGX A;  2W4S A;  3OIO A;  1IN8 A;  4KN7 X;  4CDG A;  3H9J A;  2X6X A;  2ZJ2 A;  1J0R A;  2M8E A;  3IRQ A;  1RR8 C;  1RIO H;  3HYI A;  2EBI A;  3TED A;  1HW2 A;  2R5Z B;  1BI2 A;  1W7P D;  1WKM A;  2BYV E;  3LQQ A;  3RQ4 A;  5M3M J;  3OS1 A;  2X51 A;  4UUS B;  2W1O A;  5CVU A;  3GO5 A;  1YRN A;  3IP4 B;  3M07 A;  5GPC A;  2NVX J;  1FMW A;  1UHS A;  2M0M A;  3KYC B;  1FYK A;  3CMM A;  2ZJQ F;  3I71 A;  5J40 A;  4MO7 A;  1OPC A;  2Q0O A;  3IWF A;  3G1L A;  3GF2 A;  2QQ9 A;  1UB9 A;  3GLX A;  2FE3 A;  4A93 J;  3SDB A;  4ENJ A;  2CQQ A;  1IXS B;  3H0D A;  2M5W A;  4CH7 A;  4G6Q A;  4E7J A;  4UUS A;  3K10 A;  4DGW B;  1GT0 C;  2HOT A;  1Z1D A;  5FRN A;  1JT6 A;  2DMT A;  4M3B A;  3LSP A;  1SMT A;  1JKP C;  2EWN A;  4IRH A;  1Y1V J;  3E1S A;  3BJ6 A;  2PFB A;  1N25 A;  5CQG A;  1A04 A;  2E5Z A;  3H92 A;  5EEG A;  4WXC A;  5LEK A;  1YFH A;  1HST A;  4AYB N;  1IDY A;  4JK1 X;  2MW8 A;  3TP0 A;  1JKQ C;  4BDY A;  3F3X A;  3VSK A;  1JUM A;  2M8G X;  3OYK A;  2WV1 A;  1A35 A;  2CW0 F;  2M34 A;  2Y0M A;  1ZH5 A;  2V1N A;  3WE3 A;  1VFC A;  4I01 A;  2OZ6 A;  4HAM A;  1ZRE A;  2KKO A;  2EIM H;  2FNP A;  4C2M J;  5L3E A;  4E7L A;  1VQP I;  4C30 A;  2KPM A;  1OR7 C;  3GBG A;  1YJW I;  4J01 A;  4LMY A;  4IKF A;  2DO7 A;  2ZXJ A;  2CV0 A;  2XAJ A;  4HSR A;  4LIU A;  1FC3 A;  2V9V A;  1DU6 A;  1HKQ A;  4BJ6 C;  1YO5 C;  3QPL A;  2JRM A;  2L9S A;  5CYV A;  2YSR A;  1BBY A;  3S8P A;  2UUZ A;  2HZT A;  2VOD A;  2L54 A;  5DM7 F;  2EV0 A;  2FRH A;  4E4H A;  3EUH C;  1DGR M;  2W48 A;  3O8G A;  3U21 A;  1ZHF A;  1NK3 P;  1R22 A;  4EJW A;  1TNT A;  3HPH A;  4E7I A;  1LVA A;  2RGV A;  3ELK A;  4BUP A;  1X4O A;  3JR9 A;  3IAS 2;  5LGT A;  3AAF A;  1WZ2 A;  4I2O A;  4HST A;  3F8B A;  2F4O B;  2PLY A;  2GZW A;  1PUE E;  2LLK A;  2MBF A;  3O8H A;  3BLY A;  1EA3 A;  1MMS A;  2L4M A;  4FQG A;  4JP0 A;  3FK7 A;  2R5Y B;  2CWE A;  3KZZ A;  5D4S A;  3GLL A;  4ESJ A;  1U5T A;  2KMU A;  3BQZ A;  1WQ2 A;  2HOS A;  2DMP A;  2VC1 A;  3T8T A;  5M5W J;  3IH3 A;  5IT9 K;  2QQ8 A;  2X6O A;  2BEO A;  2QUF A;  4M74 A;  4DYC A;  5IYB J;  1LDD A;  2CSO A;  3OV8 A;  4UVA A;  5GAD J;  4CIC A;  3SZT A;  3ZN0 A;  3WGG A;  2ZJP F;  1G8X A;  4C3J J;  2HDC A;  1OCP A;  1IGN A;  1IZ1 A;  1R7J A;  1H88 C;  1B6A A;  3GTO J;  5DUI A;  4XL9 A;  1U5T B;  4CGZ A;  4E7S A;  2K9S A;  1G3S A;  1I27 A;  3CJR B;  5LRS A;  1YLF A;  2HOA A;  3MQ0 A;  5DCM B;  4BQQ A;  2E7W A;  2R7X A;  3QQA A;  4U88 A;  1P92 A;  4I99 C;  3FXU A;  3NWT A;  2IRF G;  3ROU A;  3DPT A;  2E2J J;  1Y8R B;  3SHF A;  4M9X A;  4HV6 A;  2CV1 A;  1T98 A;  4OOI A;  3ABK H;  4NQW B;  4L0Y B;  5LBQ A;  4EGZ A;  3M1E A;  5EDN A;  3I4N J;  2X1C A;  2FMY A;  3I59 A;  1CF7 A;  2K85 A;  3HM5 A;  4RAZ A;  5J8C A;  4I0B A;  1VQO I;  3ABL H;  1GXQ A;  3HTU A;  2WB1 N;  5GAG J;  3JRF A;  1ZG3 A;  4WCG A;  1VQ5 I;  2VJ4 A;  3DU5 A;  2F2E A;  2QKL B;  1Y56 A;  2ZME A;  3G1M A;  3GFI A;  1OCC H;  2HWV A;  3C7J A;  3V8J A;  4A3I J;  3J7Y J;  2DA1 A;  3B02 A;  1MSF C;  2RAE A;  2E1M B;  1Y39 A;  2A69 F;  4DJA A;  3K9T A;  4RGS A;  1S6L A;  2O3F A;  2XAU A;  2ID3 A;  3VSL A;  4L9J A;  3HOS A;  1YIJ I;  1IO2 A;  5TIS C;  2O9L A;  2STW A;  2BY1 A;  2ZSH B;  2RNJ A;  3TMO A;  1CGP A;  2NVY J;  5M3F J;  2V6E A;  2LRD A;  2ZB9 A;  3ZQF A;  3CDI A;  1MJA A;  4ZTJ A;  2I10 A;  1BOB A;  4BBR J;  1PDN C;  2VON A;  3KYD B;  1MJB A;  1S9H A;  2V1U A;  4ENM A;  1ZRD A;  1IXR C;  4XON A;  5K5Q A;  2QBY B;  3BCA A;  3P5J A;  4G94 A;  3HSR A;  3KEQ A;  4LJZ F;  2CRG A;  1FNN A;  2J5O A;  1HDD C;  2HDD A;  2RQQ A;  4R1H A;  1O3T A;  1Z0X A;  2BHY A;  4ESB A;  5GPA A;  3V8L A;  4E6K G;  3WU1 B;  3C2H A;  1F9N A;  4RLQ A;  2JK3 A;  3CCS I;  2EFN A;  1LEA A;  3JSP A;  1RR7 A;  5LHI A;  2WWY A;  3S1N J;  2QBY A;  2NRA C;  3HL2 A;  5HNF A;  4KIS A;  1Z67 A;  4BXU A;  2ZC2 A;  2HEO A;  4M3G A;  5H2F C;  2XGE A;  4EJV A;  5M5Y J;  1XMA A;  2Z99 A;  2PJR A;  1WHU A;  1MZB A;  2CFO A;  2KJB A;  2DT5 A;  1KU9 A;  3PO3 J;  4P96 A;  3ZMT A;  1RI7 A;  2LKS A;  3A02 A;  3OYD A;  3HGG A;  1P4X A;  4H4K C;  3O2P E;  4PSX A;  3M7G A;  3BPX A;  4GDF A;  2CJJ A;  4LLG F;  3EQL F;  4P55 A;  3I55 I;  2BY3 A;  4YFX F;  2LVS A;  3ZPL A;  1GXP A;  1QO0 D;  3GTL J;  1UJ8 A;  3K70 D;  4WK8 F;  4QPQ A;  3LSH A;  2A6E F;  4XLH A;  2Z33 A;  4XLN F;  3EUH A;  2M30 A;  3ZQL A;  1IN5 A;  1H0M A;  1U8B A;  4Y4R A;  1SD5 A;  2R7V A;  5HOO A;  3E6M A;  1A36 A;  3R60 A;  2JPC A;  3K1M A;  2BVM A;  3QPH A;  4ZYE A;  2MD0 A;  1QA6 A;  2AO9 A;  2BHZ A;  2ZXI A;  4EQQ A;  3DKY A;  4K2E A;  2DFE A;  1PJR A;  2YX7 A;  1I3Q J;  3IHU A;  1J9I A;  1FSH A;  1WVR A;  3L7W A;  4ZYH A;  4F52 A;  3Q9V A;  4DIQ A;  2XF6 A;  2E19 A;  2ISY A;  3LA7 A;  1YJ9 I;  1TC3 C;  5BPI A;  4IL6 C;  3L2Q A;  4XKB A;  3S1R J;  1DPU A;  2X48 A;  4B44 A;  3H5R A;  1X19 A;  4XMY A;  1MKM A;  2JJ7 A;  2PG4 A;  1TQM A;  3ZQI A;  3HRT A;  1SVM A;  4QIW N;  2HS5 A;  2LYC A;  2IJL A;  1W36 C;  5L3D A;  1WPK A;  4L9N A;  1QRY A;  2EFP A;  2ZBK A;  2KRC A;  3TBI A;  2HR3 A;  3CMA I;  1YQA A;  3MD2 A;  1HKS A;  2FUG 2;  4FCY A;  2O8K A;  4L5E A;  1RES A;  2L02 A;  2OBP A;  4U0W A;  3SZP A;  1T39 A;  5LHG A;  3B6C A;  1HW1 A;  2AS5 F;  3VOE A;  3J80 Z;  2EH3 A;  2QA4 I;  1JTX A;  2CUF A;  1ZK8 A;  1USS A;  4HW0 A;  2HTS A;  1XGS A;  4BU2 A;  4XBF A;  3DCF A;  3WTU C;  3Q0V A;  1YG2 A;  2IGM A;  3PFI A;  3EET A;  4LG0 A;  4DBQ A;  1RUO A;  3OYH A;  2IAI A;  3OL4 A;  3N4M A;  5KCM A;  5FJ8 J;  1B8I B;  2A3S A;  3GFM A;  1DGW Y;  4Y33 A;  1CQT A;  2K9N A;  1DU0 A;  2OUM A;  4CA0 A;  5E18 F;  2LSO A;  3KLN A;  1TWA J;  3LQR A;  1JJ8 C;  1YS6 A;  5JVT A;  1XN7 A;  5E17 F;  2N8G A;  3J7A Y;  2VE8 A;  3H3Z A;  4LG0 B;  5FKO A;  1D1C A;  1FP2 A;  1KU2 A;  2DLL A;  3CDH A;  3SJM A;  3KYL A;  2CUE A;  4G6T B;  1IW7 F;  4I76 A;  1A6Q A;  4XOP A;  3PNY A;  4MEX F;  2FXA A;  2EFO A;  4CO8 A;  5EF6 A;  3HRU A;  4XKC A;  4XRS A;  2HI3 A;  3DXJ F;  3OIP A;  5J4Y A;  1WWX A;  4KDP A;  1VI0 A;  2LKP A;  1GVD A;  4Q48 A;  2H6C A;  2OZU A;  2OU2 A;  3WG9 A;  3ZQG A;  1MW7 A;  5EZG A;  3DEE A;  5EEA A;  1AA7 A;  3AG4 H;  2BBY A;  1V4R A;  1F4K A;  3WHB A;  3CUQ C;  5IOZ A;  4B09 A;  1HQC A;  3M8F A;  4OIO F;  3OL3 A;  2P6T A;  1ZAO A;  1BI3 A;  2CMP A;  2E7X A;  1KQ0 A;  1T6S A;  3QWL A;  4X0G A;  1G59 A;  4JX4 A;  4XKW A;  2VI6 A;  1VF9 A;  2CO5 A;  1B1B A;  2K02 A;  2W84 A;  3BWG A;  3BOQ A;  4O6J A;  5H6R A;  1FZP B;  3E97 A;  2DOE A;  3F72 A;  4LB6 B;  3FKI J;  5LD2 C;  2VXZ A;  2BE5 F;  4MFE A;  2HKX A;  4JX6 A;  2F4I A;  4LGW A;  2E1N A;  2L4A A;  3R6S A;  5IT3 A;  3HC7 A;  1WJE A;  2LY9 A;  3M8J A;  2KDO A;  1Z7L A;  3E5X A;  3PL8 A;  5D6E A;  1I1S A;  2R7R A;  1B72 B;  5ICG A;  3OMY A;  4JBA A;  3MFK A;  3KP4 A;  2TRT A;  1ZG1 A;  1GLN A;  1FP1 D;  1HF0 A;  4Y17 A;  1LE8 A;  1P9Q C;  1RPW A;  2V9P A;  2XAS A;  3CP2 A;  1E2X A;  1GHC A;  4FTH A;  4BQA A;  4ZZD A;  3NWS A;  4BKX A;  1MSE C;  3RPU D;  4S05 A;  4S0H B;  3K4N A;  3G71 I;  1W0T A;  1TT5 B;  1LDK B;  2P7V B;  2W85 A;  3V7C A;  2E1O A;  2IGO A;  4BAC A;  1PVE A;  4GRI A;  3QYE A;  1LNW A;  3GVA A;  5E8I A;  3DEW A;  1K6O A;  3G3Z A;  1N77 A;  4G7H F;  2ZFU A;  1LUJ B;  1R1T A;  3UR3 C;  5B3S H;  2QQB A;  3ULQ B;  3OYG A;  4IHT A;  3HG9 A;  1R23 A;  3RYR A;  1WRJ A;  3TKY A;  3OYJ A; 
#chains in the Genus database with same CATH homology
 2FNA A;  4I98 B;  2PBI A;  3J81 Z;  1FBQ A;  4HBL A;  1FT9 A;  2RQP A;  2D1V A;  4CYD A;  2P7C B;  4IXA A;  4HX4 A;  1K79 A;  4MEY F;  1R5H A;  2DTR A;  4GCV A;  4RB3 C;  2NYX A;  2BV6 A;  3J80 K;  4HF0 A;  1G3W A;  1D3Y A;  2DI3 A;  4RS8 A;  1JHF A;  2XAG A;  3F8C A;  2P5V A;  5HS9 A;  3R0A A;  2M45 A;  3CO7 C;  2V6C A;  2UXX A;  1D5V A;  4HQE A;  2K4B A;  2CFX A;  3QP5 A;  3D0S A;  4P9F A;  1L0O C;  3RJP A;  3T5X A;  2GXG A;  1W5S A;  2CYY A;  4A0Z A;  5D5V B;  2XAQ A;  3V7S A;  5FGM A;  5HDG A;  3GZ6 A;  2ACJ A;  4ENN A;  3HSF A;  3K1N A;  3PQJ A;  2GIV A;  1PP8 F;  2K4J A;  1OR7 A;  2JTV A;  4M9S A;  1PP7 U;  2Y48 A;  3BPV A;  2DPD A;  2ZFW A;  1Z91 A;  4KIC A;  2ZCW A;  2IW5 A;  4RB1 A;  1D8J A;  4GXO A;  3M9A A;  3FF5 A;  3DF8 A;  2GAU A;  4LK0 F;  2GQQ A;  4KA4 A;  4IJA A;  3Q5F A;  2EA4 A;  4M9Z A;  4Q5S F;  3WTX C;  4RGX A;  1Z6T A;  1R36 A;  2RVC A;  5D8K B;  3RKW A;  3E5Q A;  1W5T A;  1ZGJ A;  2YR2 A;  2O03 A;  5D4R A;  5DCM A;  2P4W A;  4HZF A;  4KMU X;  3HRS A;  3H3U A;  4NQW A;  2V79 A;  3I59 B;  1CF7 B;  1XMK A;  3FMQ A;  2HQN A;  1UHM A;  3MZH A;  1I5Z A;  4BYY A;  2O61 A;  1YIO A;  5ICE A;  3T1B A;  5E1Z B;  2ZME B;  4FHT A;  2FF4 A;  3KP6 A;  5F64 A;  1HSJ A;  1O3R A;  2EK5 A;  2IA2 A;  1VTN C;  2P5K A;  2FBH A;  1S7A A;  4KNY A;  3U2R A;  1BC7 C;  4QWQ A;  3FXR A;  4PCQ A;  1J5Y A;  4MNU A;  5CLS A;  2D2W A;  5CVI A;  3GFJ A;  3HOT A;  2WTE A;  2DQR A;  3LFK A;  4HX8 A;  4XRF A;  4HX7 A;  1RUN A;  3CLO A;  5F6F A;  2PEX A;  1TQP A;  3QU6 A;  3GW2 A;  5FFZ A;  3ISP A;  2NNY A;  1IN7 A;  1FBU A;  2Y75 A;  5H6Q A;  2F5F A;  1OYI A;  2ZNY A;  2QLZ A;  2DPU A;  4LLN A;  1QPM A;  1J7K A;  4A6D A;  4EJO A;  4YG2 F;  3ZMU A;  3ECH A;  2MA3 A;  1X3U A;  1ULY A;  4OU0 A;  4NB5 A;  2ZNZ A;  2IPQ X;  5CJ9 A;  2XRO A;  2CG4 A;  5ICC A;  3I58 A;  4O5V A;  3WU0 A;  4YFN F;  3HIF A;  5FD5 A;  3BY6 A;  1TW3 A;  3BJO A;  3DPL C;  1KQ8 A;  4AVP A;  1W7P A;  4UXN A;  3QU3 A;  2B0L A;  4RGR A;  4A5M A;  2VC0 A;  1SAX A;  4BH9 A;  2PN6 A;  1DP7 P;  3FMR A;  3B73 A;  3HHH A;  1W7P B;  1BIB A;  3FWE A;  2J5P A;  3G73 A;  4MTD A;  1EH6 A;  2W24 A;  1BIA A;  4ON0 A;  5AIP A;  3WTZ A;  5DCF A;  1MDM B;  1Z7U A;  1B9M A;  4MQ9 F;  5A2Q Z;  2KJC A;  1QZZ A;  3U9G A;  2Q8K A;  3LA3 A;  2F5C A;  4ASN A;  2G9W A;  2L01 A;  3ABT A;  2PI0 A;  2FEZ A;  1SFX A;  3HUG A;  1QQI A;  4XSZ F;  4EGY A;  3CO6 C;  3BP8 A;  3TDU C;  4KT5 C;  3E5U A;  4G8X A;  3RPU A;  1XCV A;  1LQ1 A;  4EVI A;  1E17 A;  2EA2 A;  2A5Y B;  3RYP A;  4NHJ A;  1HXD A;  5L3C A;  1FY7 A;  2VT3 A;  1QNT A;  1IUY A;  3WTS C;  5D5W B;  5HLI A;  2Z5U A;  3ZMV A;  1OYY A;  1R1V A;  2EV6 A;  5DD8 A;  1Z05 A;  2QEN A;  3K0L A;  4L9V A;  1TBX A;  4UV8 A;  1KU3 A;  2HYG D;  2R7F A;  3TQN A;  5BS6 A;  1KGS A;  4HOB A;  3GEZ A;  2LF7 A;  4IHS A;  4ZH4 F;  2IP2 A;  5JI6 A;  5HDK A;  4OIR F;  4PGH A;  5E1X A;  5DUK A;  2XVC A;  4Y13 A;  5FD6 A;  1ZLJ A;  5DDG A;  1IF1 A;  2QZ8 A;  3DP7 A;  2XIG A;  3R0J A;  4GO1 A;  4TV7 A;  4P9U A;  2A07 F;  3TDZ C;  3MAJ A;  3F8M A;  2VBX A;  2X4H A;  3EYY A;  3BZ6 A;  3NRV A;  2FSW A;  4HA8 A;  5L3F A;  3VFZ A;  3V7R A;  1G6N A;  2D45 A;  2DQL A;  4I09 A;  2IA0 A;  3KCC A;  5HVQ C;  2FML A;  2EFW A;  1YW7 A;  4U0V A;  3LA2 A;  4OIQ F;  5LGN A;  4AIH A;  4G9Y A;  1SFE A;  5LRR A;  3QOP A;  4AIK A;  1YS7 A;  4UNO A;  1BC8 C;  5JFR A;  3V4G A;  2RV8 A;  4L5I A;  4YFK F;  5J8F A;  2O6G E;  2H09 A;  3R4K A;  4GYG A;  1I6X A;  2STT A;  1I1G A;  4EJT A;  2EFQ A;  3EDP A;  3ABU A;  3ZQ7 A;  3C1D A;  4EM2 A;  1TW2 A;  2XKO A;  3CJN A;  3JTH A;  1R00 A;  2PMU A;  5CVJ A;  3IL2 A;  3KP7 A;  4BHB A;  4GGG A;  1UST A;  2CQK A;  4Q47 A;  4ESF A;  1S8N A;  3F22 A;  3JW4 A;  3O3K A;  2ADU A;  2EB7 A;  5FB2 A;  1EV7 A;  1K78 A;  1KYW A;  3WOD F;  2QVO A;  4RB0 A;  4HYE A;  2A68 F;  4M6Y A;  1U2W A;  2OQR A;  3TO9 A;  1XB4 A;  3GYH X;  2OQG A;  4BHP A;  1ON2 A;  3DKW A;  2D1H A;  4D0P A;  2Z3Y A;  3DV8 A;  2CGP A;  1SD6 A;  2QM3 A;  5D8L B;  3WGI A;  2E1C A;  5HS7 A;  3O6B B;  2DK5 A;  2C6Y A;  4EV0 A;  4Q4Z F;  2VT2 A;  5IT9 Z;  2JRT A;  1REP C;  3FZV A;  2M87 A;  3LAP A;  2ZKZ A;  3IRR A;  4OIN F;  3CTA A;  1J2X A;  2MH9 A;  2NAZ A;  1BOA A;  2XV4 S;  4ETS A;  1LDJ A;  3L2C A;  1YW9 A;  2COM A;  1RZ4 A;  2G7H A;  3MCZ A;  2VOO A;  5CVR A;  4KIF A;  4EJU A;  1FX7 A;  3KEO A;  5DV5 A;  5E8G A;  1XSD A;  3WTV C;  1XD7 A;  1LB2 A;  1V3F A;  1S29 A;  2ZO4 A;  3WE2 A;  3E6C C;  4H0E A;  1O3Q A;  3ECO A;  4I7H A;  1J75 A;  4UHT A;  2KRF A;  1GVJ A;  3LST A;  3J7A O;  3RDI A;  3ZMZ A;  4FX4 A;  5BMZ A;  4RGU A;  1HKT A;  5HLH A;  1ZG5 A;  1P4A A;  4IVN A;  2X0L A;  1O3S A;  1ZRF A;  1NHA A;  1S7O A;  2JSC A;  5K1Y A;  2H27 A;  2DK8 A;  5L3B A;  1UFM A;  3NEU A;  3E6D A;  2QYO A;  4R79 A;  3V8K A;  3ZMS A;  2ETH A;  1Z6R A;  5CVV A;  2IA1 A;  1FSE A;  3MZY A;  4L18 B;  2W25 A;  1J59 A;  4IRG A;  1BJA A;  5JR3 A;  4PZJ A;  2FQ3 A;  1H9T A;  1OKR A;  4UUV A;  3IC7 A;  3KFW X;  2G7U A;  1QGP A;  4ZYD A;  2PQ8 A;  1TQI A;  5EEH A;  5J6X A;  1G3T A;  1SD7 A;  3ERE D;  4I0A A;  3GUD A;  1DPR A;  4MHG A;  5JHU A;  1JE8 A;  1WI9 A;  5TJJ A;  3COA C;  4U0Y A;  2NS0 A;  2M1B A;  1HW5 A;  4YIF A;  4MQV A;  1MDM A;  2ESH A;  1XDU A;  2V1D A;  3VOD A;  2KIM A;  1R1U A;  3S2W A;  3RTR A;  3IWZ A;  2R3S A;  4A0Y A;  3GX4 X;  1Q1H A;  4N9H A;  1R58 A;  2DFI A;  1JGS A;  4EMS A;  1EH7 A;  1O57 A;  3KP3 A;  4M72 A;  3KLO A;  3PQK A;  1ZLK A;  1LJ9 A;  3P7N A;  3I5U A;  4A2U A;  4Y15 A;  1XDS A;  2LNB A;  5BPD A;  1DDN A;  2NNN A;  2VBW A;  3DQV C;  2K27 A;  3U1D A;  6PAX A;  5L3G A;  1BI0 A;  1ZN2 A;  1FWZ A;  1P2F A;  2VN2 A;  2R7D A;  1YW8 A;  5ICF A;  2V1X A;  2HGC A;  5ILS A;  4DQ2 A;  3HRM A;  3I54 A;  1FPQ A;  2LDU A;  5FO5 A;  4E70 A;  1H9G A;  1Y0U A;  1IRF A;  2HKO A;  3EYI A;  4UVC A;  3JTG A;  3C3W A;  5AON A;  5TRD A;  3CUQ A;  3F6O A;  1TTY A;  4A6E A;  2ISZ A;  3KP2 A;  1XGO A;  2Q2E A;  5HS8 A;  3LAJ A;  3JAM K;  2RDP A;  4BNC A;  3FMS A;  1OMI A;  3E3V A;  2AXL A;  1ONV A;  1WSU A;  1TNS A;  3CUQ B;  3I0T A;  1IN6 A;  2DW4 A;  2FBK A;  2Z9O A;  4JQF A;  1QZY A;  4QLC U;  4OIP F;  3RKX A;  2DU9 A;  2L3D A;  3QAH A;  1O7F A;  3IKT A;  4IF4 A;  2RN7 A;  2WC2 A;  4G6D A;  2FU4 A;  3F23 A;  1U78 A;  3P9I A;  2XAH A;  5KK1 A;  3SXY A;  4LB5 A;  3L09 A;  3D5L A;  3RPQ A;  4KMF A;  2FBI A;  3QRF F;  1ZYR F;  1G3Y A;  1F1Z A;  1U8R A;  3P9K A;  2A61 A;  5DYM A;  3L00 A;  1SMY F;  4CZZ A;  3JSO A;  2QWW A;  3MWM A;  3ZN1 A;  1XGN A;  1YTY A;  5E1W A;  3F8N A;  5FFX A;  5BQT A;  3KET A;  3IKV A;  5ED4 A;  2UZK A;  4M73 A;  1S3J A;  1STZ A;  3QPT A;  4R8H A;  1BN5 A;  3FM3 A;  4HLX A;  4RB2 C;  2VE9 A;  2ESN A;  1ON1 A;  3SQN A;  1K78 B;  2XUB A;  4HV5 A;  2F5E A;  4BHC A;  4AIJ A;  2K7L A;  4Z2Y A;  4PGG A;  4IPA A;  3P9C A;  4LD5 A;  4A12 A;  1AOY A;  1D8K A;  3FXQ A;  5LHH A;  2GWR A;  2RKH A;  5LGU A;  3TO6 A;  2H6B A;  3M8E A;  5ERI A;  4L0Z B;  3RKY A;  4OMY A;  3BJA A;  2HOE A;  1RNL A;  1F5T A;  1P4W A;  2YU3 A;  2YX4 A;  4A0X A;  4KN4 X;  3FHZ A;  5K5O A;  5HDN A;  4LFU A;  4FX0 A;  1ODD A;  2FOK A;  4AD9 A;  2GXB A;  3HHG A;  2IT0 A;  5D6F A;  2HFH A;  4HQM A;  2VOP A;  4OMZ A;  3ZP5 A;  1W4M A;  2VBZ A;  2BGC A;  4S04 A;  1U5T C;  1YYV A;  5LEJ A;  4ZYG A;  1JHH A;  3CUO A;  1QBJ A;  3NQO A;  2TDX A;  3RI4 A;  3DEU A;  2HYF A;  4I02 A;  4G7Z F;  3GXO A;  2VBY A;  1UCR A;  3VB2 A;  3DFG A;  2HQR A;  2PMH A;  3BDD A;  4CHU A;  3GZ5 A;  3W6K B;  1TLH B;  4WXD A;  3N97 A;  1IAW A;  4PDK A;  1HBX G;  1R5G A;  5ILU A;  4M71 A;  2JT1 A;  3GWZ A;  3FM5 A;  3LWF A;  1O7L A;  4P5O A;  3I53 A;  4A5N A;  4KUM A;  1U3E M;  3FX3 A;  4M6X A;  3WGH A;  2XRN A;  5HLG A;  3C18 A;  3HSE A;  3VEP A;  4KIG A;  2EJR A;  4MGR A;  4G7O F;  5LLQ A;  3ZMD A;  3KZY A;  3OOP A;  5BOX A;  3T0Y A;  4BAY A;  2W57 A;  2DAO A;  3TOA A;  1FLI A;  1SFU A;  1OYW A;  1K7A A;  4UVB A;  2P8T A;  1T2K A;  3QP6 A;  4N9I A;  3ML6 A;  3WTY C;  5FLX K;  1L3L A;  4AWX B;  2UWM A;  4HLY A;  2XAF A;  3K69 A;  2H94 A;  1Z9C A;  4RAY A;  4XLP F;  1XSV A;  3GFL A;  3TGN A;  1FOK A;  5D5U B;  2GA1 A;  1KA8 A;  1T0F A;  4CXF A;  4KYW A;  1MJ9 A;  1MD0 A;  3WTW C;  2O8X A;  1T38 A;  1KU7 A;  2QQA A;  2MC3 A;  1U6G A;  1JXS A;  5K5R A;  2XKP A;  5DD4 A;  2MH2 A;  4UV9 A;  4HF1 A;  1XCB A;  2OA4 A;  2PJP A;  1B4A A;  3F21 A;  4LLL A;  1BM9 A;  3F8F A;  4YII A;  1C0W A;  3K2Z A;  4O3M A;  2HTJ A;  4L5J A;  4B8X A;  3WTT C;  4F7Z A;  3TO7 A;  5A2Q K;  4L9T A;  2FA5 A;  2A6H F;  4MTE A;  1KYZ A;  1XSX A;  1ZGA A;  2IVM A;  3REO A;  1LEB A;  3I64 A;  3KE2 A;  4HF2 A;  3JAM Z;  1FBS A;  2GA2 A;  4EM0 B;  1B9N A;  1FYL A;  1ZAR A;  1AWC A;  5AIQ A;  2JZY A;  2LF8 A;  4EM1 A;  3HTS B;  4U7B A;  2WV0 A;  4LK1 F;  4ZZL A;  4KIB A;  1ZRC A;  5DEQ A;  3E6B A;  3I4P A;  3L9F A;  2DBB A;  3RIR A;  2MLK A;  5F1R A;  3SFZ A;  3BRO A;  1IN4 A;  3W6J B;  4WWC A;  2RC4 A;  4ENK A;  4FT8 A;  2JPB A;  2OAZ A;  3R61 A;  5FLX Z;  4WXH A;  5H20 A;  4XSX F;  5KVR A;  1KQ9 A;  4U7D A;  3TOB A;  2XHK A;  2KIF A;  4WX9 A;  1DUX C;  2YPR A;  1XGM A;  1IXC A;  2K86 A;  2O0Y A;  1SD4 A;  2MLG A;  3K1P A;  4HDV A;  1G4D A;  4WF2 A;  1FYM A;  5D5X B;  5E20 A;  2P5L C;  2OD5 A;  4IRI A;  2EV5 A;  4DNC A;  3Q9S A;  3T8R A;  2KIU A;  3MEX A;  2UXN A;  2P6S A;  4GYI A;  1BI1 A;  1UHW A;  3KP5 A;  5ILV A;  3J81 K;  4HDU A;  1B59 A;  1MGT A;  4N0B A;  2F5D A;  1P6R A;  2ELH A;  2MD5 A;  1IRG A;  3F6V A;  1EH8 A;  4KFC A;  2XGX A;  1IN8 A;  4KN7 X;  4CDG A;  2ZJ2 A;  1J0R A;  2M8E A;  3IRQ A;  1RIO H;  3HYI A;  1HW2 A;  1BI2 A;  1W7P D;  1WKM A;  2BYV E;  3LQQ A;  5CVU A;  3GO5 A;  1FYK A;  3I71 A;  1OPC A;  2Q0O A;  3IWF A;  3GF2 A;  2QQ9 A;  1UB9 A;  3GLX A;  2FE3 A;  4ENJ A;  1IXS B;  2M5W A;  4G6Q A;  1Z1D A;  1SMT A;  2EWN A;  4IRH A;  3BJ6 A;  2PFB A;  1A04 A;  3H92 A;  5EEG A;  4WXC A;  5LEK A;  1YFH A;  1HST A;  4JK1 X;  3F3X A;  2CW0 F;  2Y0M A;  1ZH5 A;  3WE3 A;  4I01 A;  2OZ6 A;  4HAM A;  1ZRE A;  2KKO A;  2FNP A;  5L3E A;  4LMY A;  2DO7 A;  2ZXJ A;  2XAJ A;  1FC3 A;  2V9V A;  1HKQ A;  1YO5 C;  5CYV A;  2YSR A;  1BBY A;  2HZT A;  2VOD A;  2L54 A;  2EV0 A;  2FRH A;  1ZHF A;  1R22 A;  4EJW A;  1TNT A;  1LVA A;  2RGV A;  3ELK A;  5LGT A;  3AAF A;  4I2O A;  3F8B A;  2PLY A;  2GZW A;  1PUE E;  2MBF A;  2L4M A;  2CWE A;  3KZZ A;  5D4S A;  4ESJ A;  1U5T A;  1WQ2 A;  2VC1 A;  3T8T A;  5IT9 K;  2BEO A;  2QUF A;  4M74 A;  1LDD A;  2CSO A;  3OV8 A;  4UVA A;  4CIC A;  3SZT A;  3ZN0 A;  3WGG A;  2HDC A;  1IZ1 A;  1R7J A;  1B6A A;  5DUI A;  1U5T B;  4CGZ A;  1G3S A;  1I27 A;  5LRS A;  1YLF A;  3MQ0 A;  5DCM B;  2E7W A;  4U88 A;  1P92 A;  2IRF G;  3FXU A;  3ROU A;  3DPT A;  3SHF A;  4M9X A;  4HV6 A;  1T98 A;  4OOI A;  4L0Y B;  5LBQ A;  4EGZ A;  3M1E A;  2FMY A;  3I59 A;  1CF7 A;  5J8C A;  4RAZ A;  4I0B A;  1GXQ A;  3HTU A;  1ZG3 A;  4WCG A;  2F2E A;  2ZME A;  3GFI A;  2HWV A;  3C7J A;  3V8J A;  3B02 A;  2A69 F;  3K9T A;  4RGS A;  1S6L A;  2O3F A;  4L9J A;  3HOS A;  2STW A;  2RNJ A;  1CGP A;  1MJA A;  1PDN C;  2VON A;  1MJB A;  2V1U A;  4ENM A;  1ZRD A;  1IXR C;  2QBY B;  5K5Q A;  4G94 A;  3HSR A;  3KEQ A;  4LJZ F;  1FNN A;  2J5O A;  4R1H A;  1O3T A;  4ESB A;  3V8L A;  3WU1 B;  1F9N A;  2EFN A;  1LEA A;  3JSP A;  5LHI A;  2WWY A;  2QBY A;  2NRA C;  4BXU A;  2HEO A;  4EJV A;  1XMA A;  2Z99 A;  1MZB A;  2KJB A;  2DT5 A;  1KU9 A;  4P96 A;  3ZMT A;  1RI7 A;  1P4X A;  3O2P E;  3M7G A;  3BPX A;  4LLG F;  3EQL F;  4P55 A;  4YFX F;  3ZPL A;  1GXP A;  1QO0 D;  4WK8 F;  2A6E F;  2Z33 A;  4XLN F;  3EUH A;  2M30 A;  1IN5 A;  1H0M A;  1SD5 A;  5HOO A;  3E6M A;  3R60 A;  2JPC A;  3K1M A;  3QPH A;  4ZYE A;  4EQQ A;  4K2E A;  2YX7 A;  3IHU A;  1J9I A;  1FSH A;  3L7W A;  4ZYH A;  3Q9V A;  2ISY A;  3LA7 A;  5BPI A;  1DPU A;  1MKM A;  2PG4 A;  1TQM A;  3HRT A;  2HS5 A;  2IJL A;  5L3D A;  4L9N A;  2ZBK A;  2EFP A;  2HR3 A;  1YQA A;  1HKS A;  2L02 A;  2OBP A;  4U0W A;  3SZP A;  1T39 A;  5LHG A;  1HW1 A;  2AS5 F;  3VOE A;  3J80 Z;  4HW0 A;  1USS A;  2HTS A;  1XGS A;  4XBF A;  3WTU C;  1YG2 A;  3PFI A;  3EET A;  4LG0 A;  1RUO A;  3N4M A;  2A3S A;  3GFM A;  5E18 F;  2LSO A;  3KLN A;  3LQR A;  1YS6 A;  5JVT A;  1XN7 A;  5E17 F;  2VE8 A;  3H3Z A;  4LG0 B;  1FP2 A;  1KU2 A;  2DLL A;  3CDH A;  1IW7 F;  4MEX F;  2FXA A;  2EFO A;  4CO8 A;  3HRU A;  3DXJ F;  1WWX A;  4KDP A;  2LKP A;  4Q48 A;  2H6C A;  2OZU A;  2OU2 A;  3WG9 A;  2BBY A;  1V4R A;  1F4K A;  3CUQ C;  4B09 A;  1HQC A;  3M8F A;  4OIO F;  2P6T A;  1ZAO A;  1BI3 A;  2E7X A;  1KQ0 A;  1T6S A;  2CO5 A;  1FZP B;  1B1B A;  2K02 A;  2W84 A;  3BOQ A;  3BWG A;  4O6J A;  5H6R A;  3E97 A;  3F72 A;  4LB6 B;  2VXZ A;  2BE5 F;  2HKX A;  4LGW A;  2E1N A;  2L4A A;  3R6S A;  5IT3 A;  3E5X A;  5D6E A;  1I1S A;  5ICG A;  4JBA A;  3MFK A;  3KP4 A;  1ZG1 A;  1FP1 D;  4Y17 A;  2XAS A;  1GHC A;  1E2X A;  4BQA A;  4ZZD A;  4S05 A;  1LDK B;  3V7C A;  2P7V B;  2W85 A;  1LNW A;  3GVA A;  5E8I A;  1K6O A;  3G3Z A;  4G7H F;  1R1T A;  4IHT A;  2QQB A;  3ULQ B;  1R23 A;  3RYR A;  1WRJ A;  3TKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...