3F8CA

Crystal structure of multidrug binding transcriptional regulator lmrr complexed with hoechst 33342
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
106
structure length
103
Chain Sequence
EIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDEGRRKYYRLTEIGHENMRLAFESWSRVDKIIENLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the transcriptional regulator LmrR and its mechanism of multidrug recognition.
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, PadR-like family
total genus 36
structure length 103
sequence length 106
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f8cA00
4EM2A 2MBFA 3IKVA 5D4RA 4Y13A 2HQRA 2A07F 2C6YA 2DLLA 2V79A 2KKOA 3E6MA 3MZYA 3F8BA 4LMYA 2MLKA 1NHAA 5ICCA 3WTVC 1SFEA 3WODF 2JZYA 2H27A 1TNSA 1Z6TA 3GVAA 2GA1A 1USTA 4P9FA 1PP8F 3MWMA 5IT9K 1JHFA 3F72A 2FOKA 3KLNA 3HRMA 2DI3A 2J5OA 1U5TB 3DQVC 3E6DA 1QQIA 2D45A 5F64A 2NNYA 1QPMA 1EH7A 4Q4ZF 1C0WA 1ZGAA 2XIGA 5ERIA 3J80Z 1LVAA 3FHZA 2VC0A 4ZZDA 4IHTA 1G3SA 3GXOA 1ZRCA 2BBYA 2FBHA 4RGSA 3C1DA 5KK1A 4RGUA 3WTZA 5E1WA 3B73A 1R22A 4LG0A 2PJPA 3V4GA 1Q1HA 1KYZA 3HUGA 1Z7UA 3QU3A 4N9IA 1B6AA 1RUNA 2Q8KA 1IAWA 1O3SA 4I01A 1B1BA 3WGGA 2PEXA 3ISPA 1FYLA 2V9VA 3I53A 1R36A 3CO7C 3TKYA 3F22A 2Z5UA 1XDSA 4I0BA 3QU6A 1G3WA 1S8NA 2WTEA 5E1ZB 2K86A 2XAQA 3R6SA 1S29A 2P8TA 3QOPA 4KICA 3Q5FA 4P9UA 4ZYEA 3RKYA 2DT5A 2ESNA 3W6KB 1LDKB 3ZMVA 1DUXC 2MA3A 1F4KA 3P9KA 3KP7A 5HDGA 3FZVA 1D5VA 2ELHA 4R8HA 2ZXJA 2FF4A 4P96A 2QM3A 1IRGA 3MQ0A 3IRRA 3I0TA 3V8LA 4QLCU 5JI6A 3K69A 2IRFG 2PLYA 1Z9CA 2HTSA 1SFXA 1SD5A 2OQRA 1HKQA 3E5QA 1G6NA 1XSVA 3W6JB 3F3XA 2DK8A 1LEAA 5L3GA 2A6EF 1FP1D 2XKOA 1U2WA 1WSUA 1P4AA 4UVBA 5CVUA 2VN2A 4H0EA 3QP6A 1R58A 2D2WA 1HXDA 4EMSA 2WV0A 1UB9A 5BOXA 3G73A 3OV8A 3TOAA 3R0JA 3J81Z 3FMQA 4Q48A 5HLGA 2YPRA 3WE3A 2DQLA 4Y17A 2XHKA 4UV9A 1O7LA 2ZCWA 3GLXA 2ZNYA 3L09A 4FT8A 1SD7A 3V7SA 1B9NA 4G7OF 4M71A 3QPHA 1ZREA 4XSZF 3COAC 2IA1A 5JFRA 4OIOF 1KA8A 2MH9A 3ZMZA 5K5QA 2XROA 3LWFA 4EJOA 4NQWA 5L3BA 3JTHA 1W7PA 3M8EA 2DTRA 2IT0A 3LQRA 4I7HA 4ZYDA 1JE8A 1AOYA 4IHSA 2RGVA 1J59A 2CG4A 3F6OA 5E8GA 2ESHA 2G7HA 2EV0A 3DEUA 3ZMDA 4L5JA 4UNOA 2OQGA 4K2EA 4RGRA 1OKRA 3GYHX 5HLHA 1EH6A 2O6GE 2G7UA 3T5XA 4G94A 1FY7A 1ULYA 3K1PA 1AWCA 1P6RA 2W24A 3I54A 1GXPA 1R5GA 3I4PA 4AWXB 1MKMA 4OIQF 2KJBA 2DFIA 4RS8A 4WF2A 3Q9SA 4M72A 3O2PE 4R1HA 1BIAA 5FFZA 1QNTA 1ZG1A 1XCVA 3JAMK 4MHGA 3ABTA 4I02A 1UHWA 3AAFA 1MJ9A 4FX4A 4PCQA 4U0VA 5JR3A 3E6BA 1CF7A 2M5WA 2P7VB 2M45A 1LB2A 2R3SA 3B02A 4B09A 1OR7A 1BI2A 1I5ZA 1O3TA 2ADUA 3ERED 1OPCA 2PI0A 2FBKA 3SXYA 3HHGA 2K02A 1IXSB 1HQCA 4B8XA 4M9XA 2VBXA 3TDZC 3CUOA 1P4XA 4JBAA 2X4HA 4U7DA 2FQ3A 1XDUA 3RYRA 2EV6A 2CSOA 2IA2A 4HZFA 3TDUC 1I6XA 1XGOA 3PFIA 1P2FA 3U1DA 2O3FA 4L9VA 2STTA 3WTSC 2IP2A 1QZYA 2HTJA 5DCFA 3DFGA 2DO7A 4WK8F 5LGNA 4YFXF 1R1VA 2ZMEA 3F8NA 2JPBA 4I0AA 3HTUA 3VB2A 1LDDA 5FLXK 2QWWA 4L5IA 4YIFA 4A6EA 4EJWA 2F5FA 1T39A 4HV6A 4M9ZA 4O3MA 3QP5A 3EDPA 4HDUA 1ZLKA 2ZFWA 1K78A 2M87A 2JT1A 2YU3A 4HQEA 1O3QA 3HRUA 2FNPA 4TV7A 4HOBA 3BDDA 2H6BA 1WQ2A 1T38A 4GXOA 4N9HA 2LKPA 2Z9OA 2RC4A 3DF8A 4RAZA 2L01A 3I59A 4CXFA 2IVMA 2RKHA 2HOEA 1FOKA 1LQ1A 1ZRFA 2Q0OA 2GXGA 5FD6A 4IRGA 5FLXZ 2XUBA 3IHUA 1J2XA 1D3YA 1TBXA 3M9AA 5L3CA 2W57A 1MDMB 2VXZA 1YW8A 5LBQA 4RAYA 3V7CA 1P92A 2KIUA 2PG4A 2AXLA 2QQAA 5IT9Z 3HSFA 4CDGA 3HRTA 4LG0B 3T8RA 4IVNA 1WKMA 4P5OA 4HF1A 4YFKF 3BJAA 1W4MA 2ISYA 2XVCA 2HQNA 3C7JA 3KCCA 5J8FA 1UCRA 5CVRA 1LDJA 3MZHA 4A0XA 3ML6A 2XRNA 3F8FA 4DNCA 3R60A 3WTUC 4HLXA 1FX7A 1V4RA 3KZYA 3K9TA 5DCMA 4EJVA 1ZG3A 3R4KA 3FM3A 5E17F 5D6EA 5LHIA 2P6TA 3F8MA 3RPUA 1R1UA 3I64A 2CYYA 1TQMA 4EVIA 1I1GA 3GZ5A 3E5UA 2HDCA 2O0YA 4A0YA 4L0YB 1R23A 4Q5SF 3VEPA 1ZG5A 1HKSA 1KU2A 5BPIA 4PGGA 3HOTA 4HW0A 3KP4A 2F5CA 1R00A 1BBYA 4ZYHA 4BH9A 1F1ZA 5K5OA 2O61A 1XGSA 4ZH4F 4F7ZA 5CVIA 2OU2A 3GFJA 4LD5A 1XGMA 2V1UA 2RNJA 2JSCA 2CGPA 3D5LA 1BN5A 3ULQB 5J6XA 3T1BA 4G8XA 4UV8A 1PUEE 2UWMA 4UVCA 3WGHA 4GO1A 1QO0D 2KIFA 3L9FA 2ZBKA 3K2ZA 2GXBA 3BOQA 4HAMA 5A2QZ 3NRVA 3MEXA 1FPQA 5HS7A 3FXRA 4Q47A 4UUVA 1S7OA 2R7FA 1LEBA 2HWVA 3DPLC 3HIFA 2MC3A 3R0AA 1K6OA 1OYWA 2JTVA 3FMSA 5FO5A 4EJUA 1S3JA 3KE2A 3O6BB 2FA5A 1ZH5A 3DXJF 5H6RA 3L7WA 4LFUA 2CWEA 1D8JA 4XBFA 1IXCA 3IRQA 3ZPLA 3J81K 2A68F 1T2KA 2H09A 4HYEA 3N97A 5AONA 4YG2F 4MQVA 5FB2A 3IWZA 3ZN0A 1FC3A 2VBYA 4KN7X 5DD8A 3H3ZA 4I09A 1L3LA 2P4WA 2QLZA 4EM1A 1RNLA 2XAGA 4KIBA 5AIQA 1Z05A 4D0PA 1MJBA 4A2UA 4ESJA 5BS6A 3SQNA 3LA3A 4M74A 3RIRA 3JTGA 3H3UA 4HX7A 4KT5C 3KP5A 4OOIA 2CQKA 2VONA 5BQTA 3GFMA 4ASNA 1BIBA 3P7NA 3LAPA 2XAHA 2FSWA 2YX4A 3KZZA 1XMKA 3RYPA 1IN4A 3K1NA 1RUOA 2ZMEB 4DQ2A 5D5WB 3KEOA 2BGCA 4RGXA 4OIPF 1MGTA 3HOSA 2PBIA 1W5SA 3EYIA 4HX8A 5D5VB 3SZPA 2BYVE 4ENKA 4ZYGA 4L9NA 2ZNZA 4MTDA 1H9TA 3G3ZA 4PGHA 4BHCA 3ZMUA 1BM9A 2QYOA 2RDPA 2P5LC 2HFHA 4KMFA 4EM0B 3WG9A 2ZO4A 1IN8A 3ZP5A 3IL2A 3LAJA 4CHUA 5FFXA 3O3KA 1PP7U 1BI0A 4LLLA 2L3DA 3F6VA 4OIRF 4L18B 1XB4A 1PDNC 4AIKA 1U6GA 5L3FA 1BC7C 2XGXA 2CO5A 3LA7A 1F9NA 2STWA 2KRFA 3E6CC 2G9WA 2NAZA 3CLOA 5ILSA 1YLFA 1D8KA 5K1YA 1XMAA 1YYVA 1EV7A 5L3DA 4EV0A 5D4SA 3U2RA 3GZ6A 4WCGA 5DUIA 2ZKZA 2WWYA 2A3SA 2HGCA 4IXAA 2RVCA 1UFMA 4EGYA 1T98A 4JQFA 4PDKA 5ICFA 4FHTA 3PQKA 3T8TA 1J75A 2KJCA 3TQNA 3CO6C 2EB7A 2EFNA 5DEQA 3GX4X 4IF4A 2D1VA 2MLGA 3FWEA 2DW4A 5DUKA 3LQQA 4GGGA 1Z6RA 2DAOA 2E1NA 1TLHB 3CJNA 1ON2A 4RB3C 3OOPA 5ICGA 6PAXA 4KYWA 2A6HF 3MFKA 3BJ6A 4A5MA 3T0YA 2PMHA 4WXCA 2VT3A 3IWFA 1I27A 1OYIA 2OZ6A 3GO5A 2LDUA 5CLSA 2ETHA 3L2CA 1U78A 1IN6A 3JAMZ 4G7HF 5E20A 3K0LA 3JSOA 2IA0A 4L9TA 3ZMTA 2FE3A 1CF7B 2EA4A 2Z33A 4EJTA 3REOA 1H0MA 5TRDA 2DQRA 2GWRA 2UXNA 1XCBA 2XASA 1L0OC 4HQMA 2FU4A 2P6SA 3HRSA 4GYIA 1ZGJA 4CO8A 3FMRA 4LJZF 4LLNA 3CDHA 3QPTA 1OYYA 4CICA 1MD0A 2DBBA 2Y75A 3K1MA 1MDMA 2FNAA 1FYMA 2HS5A 3BPVA 1J9IA 4FX0A 3WTYC 1ONVA 3NQOA 3C3WA 3SZTA 1U5TC 3F8CA 2BV6A 3GFIA 2K4JA 3M8FA 1KQ0A 4LLGF 4BHBA 3RJPA 2F2EA 1ZAOA 4BYYA 1YW7A 3S2WA 2E7XA 1IUYA 2PMUA 4EQQA 3TOBA 2VBWA 2PFBA 5FD5A 1MJAA 2TDXA 3RKXA 3WU1B 5EEHA 2PQ8A 1IN5A 2DU9A 3LSTA 2VE8A 4AVPA 3VFZA 4OMYA 2NS0A 4L0ZB 2M30A 4ESBA 5CYVA 5BMZA 1KYWA 5BPDA 1R1TA 3EETA 1KGSA 1O3RA 3DPTA 5JHUA 4AIHA 1JXSA 5LEJA 2P5KA 2L02A 2FMYA 3ZQ7A 2EFPA 4M6YA 2V1DA 3IC7A 2GIVA 4OU0A 5CVJA 1IF1A 4KIGA 3I58A 5HS8A 4I2OA 4ETSA 2L4AA 3E97A 1SD4A 2ACJA 4O5VA 3TGNA 5HOOA 5A2QK 1HW1A 3FXQA 2A61A 1W5TA 2EK5A 2M8EA 1QGPA 2LF7A 3HYIA 1XGNA 2DK5A 5AIPA 5E18F 5LGUA 1Z91A 2FBIA 2P7CB 2NYXA 2JRTA 5J8CA 2EV5A 2VODA 1HBXG 4WXHA 2E7WA 3BZ6A 3JSPA 1YS7A 2WC2A 3WU0A 1HW5A 3M1EA 3V7RA 3F21A 4MEYF 1BC8C 3QRFF 1O7FA 3FM5A 1YW9A 1H9GA 1ZLJA 3BWGA 4OMZA 1RZ4A 2CFXA 2ZJ2A 1FZPB 5ED4A 1ZN2A 2XV4S 1USSA 1K79A 1S6LA 5DCMB 1U3EM 2Q2EA 2W85A 1S7AA 3I71A 4L9JA 4G6DA 4M9SA 2QQBA 1FT9A 5F1RA 3EQLF 2A5YB 3RKWA 5HDNA 2W84A 1KU7A 1GHCA 2COMA 3BPXA 1FSEA 3MAJA 4BQAA 1WRJA 3DP7A 4N0BA 5E1XA 3M7GA 2QBYB 5E8IA 3E5XA 4LGWA 3FF5A 1OMIA 4XLPF 1FWZA 4LB6B 3TO9A 2UZKA 1DPRA 5D5XB 3RDIA 3CUQA 3TO6A 2L54A 3I59B 1JGSA 2EFQA 2QZ8A 5CVVA 4ENJA 1B9MA 1K7AA 2OZUA 1DDNA 5LHGA 1UHMA 1BI1A 1G3YA 1KU9A 4E70A 2E1CA 3NEUA 1YO5C 4CZZA 2YR2A 1HSJA 3L00A 4QWQA 3KP6A 5LGTA 1BOAA 2IJLA 3BY6A 1RIOH 4WWCA 5KVRA 2QVOA 2AS5F 3WE2A 3CTAA 2EFOA 4ENNA 5LHHA 4U7BA 2FEZA 4AD9A 3J7AO 2MH2A 2HYFA 1FYKA 5CJ9A 5DV5A 1G3TA 1SD6A 1EH8A 3GUDA 4MGRA 4NHJA 3ZMSA 1P4WA 3SHFA 4LK1F 2A69F 3I5UA 1E2XA 1MZBA 1R5HA 4UHTA 4ESFA 3MCZA 4R79A 4KN4X 1WI9A 4NB5A 2HKXA 3RTRA 2VE9A 1B4AA 1V3FA 3V8KA 1DPUA 5FGMA 2YSRA 3D0SA 3GEZA 2X0LA 1X3UA 4JK1X 4S05A 4M73A 4IJAA 2HYGD 4S04A 2J5PA 1XSXA 1R7JA 2NRAC 1Z1DA 1FP2A 4YFNF 1J7KA 1IZ1A 2FXAA 4U0WA 2GAUA 4U0YA 1GXQA 4GYGA 3GF2A 2K4BA 4A0ZA 2ISZA 3HTSB 1YS6A 1SAXA 2FRHA 4EGZA 1YFHA 1W7PD 4RB0A 3WTWC 2XKPA 4MEXF 3EUHA 1U8RA 3H92A 4UVAA 1T6SA 4M6XA 2B0LA 2JPCA 3KEQA 2GA2A 5HS9A 4WXDA 4AIJA 1F5TA 2GZWA 2RV8A 2Y48A 1XD7A 4XLNF 1ZARA 4IRIA 5ICEA 1HKTA 2H6CA 5HDKA 1KU3A 2RN7A 1SMTA 1K78B 1TW3A 2V1XA 3JW4A 1IXRC 4OINF 2QBYA 2BEOA 3PQJA 5K5RA 5L3EA 4O6JA 1J5YA 3WTTC 1BI3A 2DPDA 1DP7P 2IPQX 3KP2A 2YX7A 2OBPA 4GCVA 3GWZA 4LB5A 3P9IA 2IW5A 3KLOA 4MTEA 1ZYRF 5LEKA 2VOPA 2R7DA 2CW0F 1CGPA 3SFZA 1SMYF 5F6FA 1ON1A 5D6FA 4A12A 1FBSA 4CYDA 1BJAA 2V6CA 5D8KB 2EWNA 2OD5A 2EA2A 4U88A 2LNBA 3HHHA 2HEOA 4KUMA 4KA4A 3WTXC 4G6QA 2FMLA 1O57A 4HBLA 2HKOA 1RI7A 1IW7F 1XSDA 1YQAA 4G7ZF 4XSXF 3P9CA 2OA4A 2LF8A 4KNYA 2QQ9A 3WGIA 1WWXA 2GQQA 2P5VA 2QUFA 4IRHA 4I98B 2LSOA 1TQIA 4KFCA 2PN6A 5LLQA 5LRSA 3VODA 3ZN1A 2K27A 1W7PB 2D1HA 4ON0A 3F23A 4A5NA 1QBJA 3RPQA 2VOOA 4HLYA 1QZZA 5H6QA 1J0RA 5H20A 3V8JA 4MNUA 5ILUA 2L4MA 4BAYA 4MQ9F 1VTNC 2VC1A 5D8LB 3FXUA 4WX9A 3N4MA 1YG2A 5DYMA 4KIFA 3KP3A 3IKTA 4KDPA 1JHHA 3CUQC 4A6DA 1XN7A 5ILVA 3ABUA 1TTYA 3LA2A 4BNCA 4RB2C 2BE5F 3ECOA 2OAZA 1LJ9A 4IPAA 3DV8A 3ECHA 3RI4A 3U9GA 3ELKA 1IRFA 2M1BA 1ZRDA 2W25A 2HR3A 3DKWA 1A04A 3HSRA 2RQPA 5D5UB 3C18A 2H94A 2XAFA 1KQ9A 1IN7A 2MD5A 4HDVA 4HV5A 3CUQB 5HVQC 3GFLA 1HSTA 4HX4A 2Z3YA 4RB1A 5DD4A 3Q9VA 4ENMA 2O03A 4HF0A 4Y15A 3BJOA 3KFWX 1U5TA 3EYYA 1FNNA 2Z99A 2QENA 1T0FA 2XAJA 3TO7A 3VOEA 4P55A 1FBUA 4Z2YA 1TW2A 4BHPA 3FX3A 1YTYA 5IT3A 1G4DA 4G9YA 1TQPA 1B59A 1TNTA 3E3VA 1Y0UA 1FLIA 1SFUA 1FSHA 2UXXA 1ODDA 2KIMA 4CGZA 1FBQA 1ZHFA 4ZZLA 2DPUA 1YIOA 3GW2A 2VT2A 2EJRA 1HW2A 5LRRA 2F5EA 1GVJA 4LK0F 4UXNA 2HZTA 3ROUA 1STZA 3KETA 5JVTA 1REPC 3R61A 2VBZA 3BP8A 5TJJA 4BXUA 2K7LA 4XRFA 5DDGA 2EFWA 2Y0MA 5HLIA 5EEGA 3HSEA 1E17A 2O8XA 4YIIA 4KMUX 3QAHA 3BROA 3LFKA 1I1SA 4HA8A 3J80K 1LNWA 4PZJA 2F5DA 2NNNA 4HF2A 1KQ8A
chains in the Genus database with same CATH superfamily
2OV7A 2D5VA 5B3SH 4EM2A 2MBFA 3IKVA 5D4RA 4Y13A 2HQRA 2A07F 2MYSA 3M3YJ 3BG6A 2C6YA 5J40A 2DLLA 2V79A 4X6AJ 2EILH 2KKOA 3E6MA 2L9VA 4HSRA 3MZYA 3F8BA 4Y33A 1WH7A 4LMYA 5EDNA 2MLKA 1NHAA 5ICCA 3WTVC 2IS6A 1SFEA 3H5RA 2MSYA 3WODF 3L2RA 2XPUA 2JZYA 2LR8A 3CJQB 3OSGA 2H27A 4A3JJ 3BR6A 1TNSA 3BTCA 2CJJA 1Z6TA 4BBSJ 3GVAA 1K4TA 5J4VA 4C2TA 2GA1A 1USTA 4P9FA 1DP3A 1PP8F 2IGKA 1JJ8C 3VYRB 3MWMA 4DJAA 3G6EI 5IT9K 1JHFA 2RREA 3F72A 2FOKA 3KLNA 4IHYA 1OCOH 1GLNA 3JCUC 2DODA 2VKVA 3HRMA 2DI3A 2J5OA 1U5TB 1VQKI 3DQVC 1A35A 1H89C 3E6DA 1QQIA 1LE8A 2D45A 2CUJA 5F64A 2NNYA 1JKOC 3UNGC 1QPMA 1EH7A 3RQIA 2R7QA 3Q0WA 4CCOA 4Q4ZF 1C0WA 4B43A 1ZGAA 2XIGA 1ETOA 2QKLB 5EG0A 4D1QA 5ERIA 3J80Z 1LVAA 1YIJI 3FHZA 2H1LA 2VC0A 1QHGA 2DJIA 1XMXA 4ZZDA 3GMEA 4IHTA 3H5NA 1G3SA 1E3OC 5GADJ 3GXOA 1ZRCA 2IXSA 2IGOA 2BBYA 2FBHA 4CZCA 4RGSA 3C1DA 3AFHA 5KK1A 2CW8A 4RGUA 3WTZA 5E1WA 1LPQA 3B73A 1R22A 4LG0A 4AVZA 2PJPA 3V4GA 5FKNA 1Q1HA 1KYZA 3HUGA 4NBQA 3RSNA 1Z7UA 3QU3A 4N9IA 1B6AA 4RAFA 3K10A 1RUNA 2W00A 5JLWA 2Q8KA 1IAWA 2M4KA 1O3SA 4XMYA 4AU7A 3BLYA 4I01A 1B8IB 1B1BA 2AQFA 3WGGA 2DFEA 2PEXA 3ISPA 1FYLA 2B63J 2V9VA 3KX2A 3I53A 2QEXI 4XIDA 1H8AC 3FBNB 3EUAA 1R36A 2M7BA 3OYAA 3CO7C 3EPZA 4XLCA 3K4NA 1DU0A 5TISC 3ZQQA 3TKYA 1WI3A 3F22A 2Z5UA 1XDSA 4PJJA 4I0BA 3QU6A 1G3WA 1S8NA 2WTEA 5E1ZB 3J7AY 1VZ0A 4C3IJ 2K86A 2XAQA 3R6SA 1RKWA 3K6GA 1S29A 2P8TA 4BQNA 2W1OA 3QOPA 4PUSA 2QSHX 4KICA 3Q5FA 3HG9A 4P9UA 4ZYEA 3RKYA 3CCMI 5IOYA 2DT5A 2ESNA 5GPAA 3W6KB 1LDKB 3DTKA 3ZMVA 4NUBA 2CU7A 1DUXC 3CP8A 2MA3A 2HVQA 2LKXA 1F4KA 4BY7J 3P9KA 3TP0A 1Z7LA 3KP7A 5HDGA 3GTMJ 3FZVA 1D5VA 4F55A 1VQPI 2ELHA 2Y0SA 4R8HA 2ZXJA 1IG7A 2BW3A 2FF4A 4P96A 2QM3A 1IRGA 3MQ0A 4N4OB 3IRRA 3GTLJ 3RKQA 3I0TA 3V8LA 4QLCU 1N25A 5JI6A 3K69A 2IRFG 2PLYA 1X1PA 1Z9CA 2OTLI 2HTSA 3JRFA 1SFXA 2K9QA 2GM4A 2XB0X 4M3DA 1SD5A 1MNEA 2JJ7A 2OQRA 2LP0A 4XORA 1HKQA 5C44J 4NC6A 4XOTA 3LSHA 2LY2A 3E5QA 1G6NA 1XSVA 1VQLI 3W6JB 2YUSA 3F3XA 1IV8A 2DK8A 1LEAA 2B9SA 3CF2A 5L3GA 2A6EF 3DKYA 3ZRGA 1Y39A 1FP1D 5FROA 2XKOA 3BTIA 1PVEA 2X6XA 1EJ9A 1U2WA 4G12A 1P4AA 1WSUA 4UVBA 5CVUA 3HGYA 2DT7B 1TWAJ 2VN2A 4H0EA 2X6OA 5FRMA 4P1WA 3QP6A 2X85A 1FOWA 1R58A 4FASD 2D2WA 1HXDA 4EMSA 2WV0A 3A01A 2R4GA 1ENHA 4LOCA 1UB9A 2ECCA 1NK3P 5BOXA 3G73A 3OV8A 1X3WB 3OMYA 3AG3H 1AU7A 3TOAA 3R0JA 3J81Z 3FMQA 3DBLB 1RC9A 5E3LA 4Q48A 5HLGA 1O4XA 2YPRA 4BE1A 3WE3A 2DQLA 4CYCA 1TWGJ 3ZXSA 3G1OA 5EGOB 2JA2A 2XHKA 4Y17A 4UV9A 1O7LA 5F27A 4PJMA 2ZCWA 2FUG2 3GLXA 2ZNYA 3PO3J 4PSXA 1LFPA 3L09A 3PJRA 4E6KG 4BDZA 4FT8A 1SD7A 3KZIC 3V7SA 1B9NA 4G7OF 3Q0UA 3GTOJ 4M71A 3QPHA 2LD5A 2HOAA 2EZLA 1ZREA 4ZDPA 4XSZF 3COAC 2IA1A 3AG1H 5JFRA 4OIOF 1KA8A 2MH9A 2VJIA 3ZMZA 2DYSH 3SZGA 2A6TA 5K5QA 1FTZA 2XROA 3LWFA 3FK7A 4EJOA 4NQWA 5L3BA 3Q3SA 3BT9A 3JTHA 1W7PA 3M8EA 2DTRA 2IT0A 3LQRA 1DQUA 4OAZA 4I7HA 5KHDA 4ZYDA 3HM5A 1YITI 1JE8A 2R7TA 1AOYA 2HVSA 4LIUA 2RGVA 3JRIA 1J59A 4IHSA 2CG4A 3F6OA 5E8GA 2ESHA 2G7HA 1IO2A 2EV0A 3DEUA 4D9JA 3ZMDA 4L5JA 4UNOA 2OQGA 4K2EA 4RGRA 3S1QJ 4NNJA 2IS1A 1OKRA 3LFUA 4ITVA 5FKKA 3GYHX 5HLHA 1EH6A 2O6GE 1RRJA 2QGUA 2G7UA 4CSWA 2HI3A 3T5XA 4G94A 4C9YA 1FY7A 1ULYA 3K1PA 1AWCA 4X1EA 1P6RA 2W24A 4C2MJ 2O7OA 3I54A 4Y3OA 1R5GA 3I4PA 4AWXB 1MKMA 1GXPA 4OIQF 3G71I 1S5LC 1ETWA 2AO9A 2KJBA 2NOGA 2DFIA 1W36C 4RS8A 3A0HC 5GP9A 4WF2A 3Q9SA 4M72A 5IY5H 1MNDA 2LVSA 2R93J 3IH3A 1X19A 3O2PE 2GOXB 1LVKA 2VQHA 2ZMEC 3OOUA 4R1HA 4RLQA 1BIAA 4MIMA 5FFZA 1QNTA 1R4NB 3BTJA 1ZG1A 1XCVA 1GUUA 3JAMK 4MHGA 3ABTA 4I02A 1UHWA 3AAFA 1MJ9A 4FX4A 4Y52J 4PCQA 4U0VA 3HOYJ 5JR3A 3E6BA 2M5WA 1CF7A 2P7VB 4E7HA 2M45A 1LB2A 2R3SA 3B02A 5C3EJ 4B09A 1U0JA 1I3QJ 1OR7A 4DZJA 1BI2A 1I5ZA 3FDYA 1O3TA 2ADUA 3ERED 1OPCA 2PI0A 3GCMA 3MKYB 3LMMA 2FBKA 3FK6A 3SXYA 3HHGA 3FISA 2K02A 3OYCA 1IXSB 3E1SA 1HQCA 4MFEA 4B8XA 4M9XA 2VBXA 4H4KC 3W2VA 3TDZC 4M3GA 3TMOA 3K2AA 3CUOA 1P4XA 2LREA 1BW6A 2XGEA 2AXTC 1HA8A 4JBAA 2X4HA 4U7DA 1T33A 2FQ3A 1XDUA 1I50J 2WBMA 3RYRA 2EV6A 3JR9A 3OYDA 2CSOA 2IA2A 4HZFA 3PIPF 3TDUC 1JUMA 1I6XA 1X1DA 2A05A 1XGOA 3SFIA 3PFIA 1P2FA 4IOCF 2DDAA 3U1DA 5FRNA 2O3FA 2BZTA 4L9VA 2STTA 3WTSC 1GV2A 2IP2A 1QZYA 2HTJA 5DCFA 4EEFG 5GPCA 2O5RA 1YOVB 2UV1A 3DFGA 2E36A 3OYKA 2DO7A 5JVGF 1JJ6C 4WK8F 5LGNA 1SEUA 4YFXF 2KZVA 5EG0B 1R1VA 2ZMEA 2FX0A 3F8NA 2JPBA 4I0AA 5J1RA 3HTUA 3VB2A 1P7IA 1LDDA 1ORKA 4XL9A 4W97A 1TWCJ 3S17J 5FLXK 2QWWA 4L5IA 4YIFA 3LSGA 4A6EA 5EF6A 3A01B 1M1EB 4HNTA 4EJWA 4BJTA 4CCKA 3LSPA 3D5SC 3CCJI 1EA3A 2BY1A 2F5FA 4HV6A 1T39A 4M9ZA 4O3MA 3QP5A 5C4JJ 2XC7A 3D5RC 3EDPA 4HDUA 1ZLKA 2ZFWA 2V1NA 4BQOA 3LOCA 1K78A 2M87A 1ACIA 2JT1A 2YU3A 2GXAA 2NS7A 3JRGA 4HQEA 1O3QA 3HRUA 2FNPA 4TV7A 4ZTFA 4FISA 1Z67A 4HOBA 3BDDA 3G2BA 3DCFA 2H6BA 1JUPA 3S93A 1A31A 1TWFJ 2F4OB 3A4CA 1WJBA 1WQ2A 2MG4A 3H0DA 2VKHA 1T38A 4UY8I 4GXOA 5DTDA 1BL0A 1EKEA 3CP2A 4N9HA 2E2IJ 2IEKA 1D1AA 4XKCA 5E3MA 2LKPA 5IP7J 2Z9OA 1LFBA 2RC4A 3DF8A 4RAZA 2L01A 4HSTA 3I59A 4CXFA 2HOTA 2IVMA 2RKHA 3I56I 5CPRB 3VYTB 3HL2A 3K70D 3S3OA 2HOEA 3TBIA 2R0QC 1YJ9I 4A3MJ 1FOKA 1LQ1A 5B1AH 1ZRFA 3QWLA 4JX6A 3V42A 3BR0A 3SJMA 1T0FC 2Q0OA 3J7ZI 3OYJA 4E7LA 1JKPC 2GXGA 5FD6A 4IRGA 5FLXZ 4OAYA 5E79C 2XUBA 1AA7A 3IHUA 1R49A 1J2XA 1D3YA 1TBXA 3M9AA 5L3CA 2W57A 2E35A 1WH5A 5GAEJ 1MDMB 3SYTA 5M5WJ 2VXZA 3J7YJ 1FEXA 1JT0A 1YW8A 2E1MB 5LBQA 4RAYA 3CMEI 3MN2A 1RR8C 1CQTA 1UJ8A 2XAUA 3V7CA 1P92A 4NDLA 2KIUA 2PG4A 5LD2C 2L7FP 1YJWI 2AXLA 2QQAA 4AYBA 3HSFA 2CV1A 5IT9Z 4CDGA 4PFPA 5GTHC 3L1PA 3QYEA 4PJNA 3HRTA 4MFDA 2JA8J 1OLTA 2JRMA 1IRZA 4LG0B 3I4NJ 3T8RA 3OWTA 3H9JA 4IVNA 4V2FA 4DBRA 1JKRC 3HJEA 4HNVA 1WKMA 3S1NJ 4P5OA 4HF1A 4YFKF 3BJAA 2CUEA 1BOBA 3O8HA 1W4MA 2ISYA 2XVCA 3ZQGA 1A36A 2HQNA 3VYUB 3C7JA 3OYNA 3VSLA 3KCCA 4F93B 1T56A 5J8FA 1UCRA 5CVRA 2JA6J 5IOZA 4E7KA 1LDJA 3OY9A 3MZHA 4A0XA 4A69C 3ML6A 2XRNA 3QYFA 1VQ4I 2R7ZJ 3F8FA 3CCLI 4DNCA 3R60A 1Z3YA 4M3BA 1QRYA 3WTUC 1APLC 5HNHA 1X1AA 4HLXA 3HGGA 2V9KA 3CC2I 3ABMH 2L2OA 2DMUA 1FX7A 3DU6A 1V4RA 3H35A 3KZYA 4FE4A 5M5YJ 3K9TA 1NK2P 5DCMA 4EJVA 2WA0A 1HLVA 1UZCA 1ZG3A 2ID3A 3FM3A 3R4KA 5K7ZA 5E17F 5D6EA 3C2HA 1PUFA 5LHIA 2P6TA 1BW5A 3F8MA 3RPUA 1R1UA 1WJFA 2CYYA 3I64A 3OIOA 3ZQHA 1TQMA 4EVIA 1I1GA 3GZ5A 3E5UA 5EJCA 4A3EJ 2QKMB 2HDCA 4HRIA 2O0YA 1QVUA 4A0YA 4L0YB 5M3FJ 3IUOA 5IP6A 1MMDA 1R23A 4Y4RA 5KNLA 4Q5SF 2LYCA 3K4LA 3VEPA 2VLAA 1ZG5A 1HKSA 1FMVA 2I8DA 3K4KA 4LITA 1DU6A 2B7EA 2V26A 1KU2A 5EEAA 4BE2A 5FJ8J 4V19K 5BPIA 4PGGA 3HOTA 2DMQA 4HW0A 4A3CJ 3A02A 3KP4A 1XPXA 1YX3A 4C30A 3VWBA 3H3VK 1Z21A 4IX7A 2M34A 3PO2J 1QPIA 1JTYA 2M7AA 1Y8QB 2F5CA 1R00A 2DN0A 1BBYA 4ZYHA 4BH9A 3IH2A 3W6VA 2LK2A 2PMZA 3S2HJ 1F1ZA 1MBHA 5K5OA 2O61A 1XGSA 4ZH4F 4F7ZA 5CVIA 3DLLF 2OU2A 3GFJA 4LD5A 2HNHA 1XGMA 4CCMA 3EUKL 2V1UA 3PL8A 2P0WA 2RNJA 2JSCA 2CGPA 2E60A 3D5LA 1BN5A 1IDZA 3ULQB 5J6XA 4RLFA 3T1BA 2R7RA 3DBHB 4G8XA 4DYCA 4UV8A 3ZQFA 1KZHA 1PUEE 1MMGA 2UWMA 5KAIC 2H8RA 4UVCA 3WGHA 1YX5A 2CS3A 2WAFA 2E71A 4GO1A 1HOMA 1QO0D 4D5CA 2KIFA 3L9FA 4BACA 2V4JC 2ZBKA 4IO9F 3K2ZA 2GXBA 1ETKA 3BOQA 4HAMA 4F92B 5A2QZ 1VNDA 3NRVA 2X1EA 3MEXA 1FPQA 5HS7A 2IS4A 3HZJA 3FXRA 4Q47A 3HOVJ 4FTHA 4UUVA 2Y69H 3OS1A 3F0CA 1V55H 1TT5B 1S7OA 2R7UA 3WHCA 2R7FA 1LEBA 2HWVA 3DPLC 3HIFA 1MBKA 2MC3A 2IAIA 4CCNA 3JRBA 1J09A 3R0AA 1K6OA 2X6YA 1OYWA 2JTVA 3FMSA 2GLOA 5FO5A 4EJUA 1S3JA 3H9QA 3KE2A 3O6BB 1KONA 2FA5A 3FKJA 1NG7A 1ZH5A 3DXJF 5H6RA 5JHFA 3A0BC 1W0UA 3L7WA 4B4CA 4LFUA 2CWEA 2XF5A 1D8JA 4XBFA 4YEJA 1IXCA 2FQ4A 4XR6A 4E4HA 4IKFA 1WJAA 3CZ6A 2TRTA 3IRQA 3ZPLA 3OL3A 3J81K 3NWTA 2A68F 4RBOA 5EZGA 1T2KA 3S3NA 2H09A 5E3OA 4HYEA 1WPKA 4XONA 3N97A 5AONA 4YG2F 2HQAA 4MQVA 5FB2A 1Y1VJ 2E5NA 3IWZA 1MH4A 3ZN0A 2WV1A 4XQFA 1FC3A 2VBYA 2F48A 4KN7X 3LNQA 1IC8A 2EINH 1R71A 3JRDA 3BR5A 1V5EA 2HXIA 1XC5A 3MKWB 4S0HB 5DD8A 3H3ZA 1G8XA 2EIMH 3RQ4A 4RM2A 3HKZA 3HC7A 4I09A 1L3LA 1OCCH 2P4WA 3KEYA 2VUMJ 3IP4B 1ZR4A 2PMZN 4XN3A 2QLZA 4EM1A 1RNLA 3ZGKA 2XAGA 4KIBA 2KRCA 5AIQA 1Z05A 1AHDP 4D0PA 5DM6F 1MJBA 1S7EA 5KAFC 4A2UA 1OCRH 2CUFA 4ESJA 5BS6A 3SQNA 3C2GA 4QIWN 3LA3A 4M74A 3RIRA 2DMNA 4BU2A 3MKZA 3JTGA 4E7SA 4RAGA 3H3UA 4A3KJ 4HX7A 1R4MB 4AC0A 2WADA 4KT5C 1K4SA 3KP5A 4OOIA 2CQKA 2XDVA 2QA4I 2VONA 5BQTA 3GFMA 1OCZH 2DFFA 3MVPA 4ASNA 1BIBA 3P7NA 1IUFA 3G1LA 5DS9A 2QF7A 4YIRX 3CDIA 3LAPA 1U9NA 2XAHA 2LBFA 2FSWA 2YX4A 4GRIA 4YELA 3ABLH 3KZZA 1XMKA 3PNTA 2JN6A 3RYPA 1A6QA 4FCYA 1IN4A 3CJTB 3K1NA 2VQGA 2DA4A 1SFOJ 1RUOA 2ZSHB 2ZMEB 4DQ2A 5D5WB 3CJRB 3KEOA 5FLMJ 1F36A 2BGCA 2BVMA 5BNGA 3ZQCA 4RGXA 4OIPF 4BXXJ 1MGTA 4PK4A 3HOSA 5EYRA 2PBIA 2E2JJ 1W5SA 3PNYA 3EYIA 4B3AA 4HX8A 5D5VB 3SZPA 1RPWA 2BYVE 3BZCA 2X51A 4ENKA 4IZZA 4ZYGA 4L9NA 2ZNZA 3S32A 4MTDA 1H9TA 3G3ZA 2BHYA 4PGHA 1HC8A 4ZDOA 5TGTA 1I6HJ 4BHCA 2XF7A 3ZMUA 9ANTA 1BM9A 1E3PA 2QYOA 2RDPA 2P5LC 1WFXA 2HFHA 2HYJA 4KMFA 1GVDA 1WJEA 4EM0B 3WG9A 2ZO4A 2HPIA 1RR7A 1IN8A 3HPGA 4E7ZA 3ZP5A 2R5ZA 3IL2A 1WGXA 3LAJA 5FKOA 4CHUA 1Y0NA 5FFXA 3O3KA 3OYEA 1PP7U 1BI0A 4LLLA 2L3DA 3F6VA 5HNFA 2WB1N 1A6IA 4OIRF 4L18B 1X58A 1XB4A 4BJ5C 3WU2C 1PDNC 1ITYA 4AIKA 2VQLA 1U6GA 3CCSI 5L3FA 1BC7C 2XGXA 2MABA 2CO5A 3LA7A 3OYGA 1F9NA 4BJ6C 2E2HJ 2KRFA 4XN0A 2STWA 3E6CC 1F43A 2G9WA 2NAZA 3CLOA 5ILSA 2KFDA 1YLFA 1D8KA 5K1YA 3A03A 1XMAA 1YYVA 1EV7A 4C3HJ 2R5ZB 5L3DA 2ELKA 2OC6A 4EV0A 2OF7A 5D4SA 1UMQA 3U2RA 3GZ6A 4WCGA 5DUIA 3TEDA 3CCVI 2XF6A 2ZKZA 2WWYA 2A3SA 1MNMC 2HGCA 3AG4H 2HQ5A 4HG2A 4IQ4A 1IV6A 4IXAA 3RCOA 2RVCA 1UFMA 3K4BA 3LSRA 4A3GJ 4EGYA 1T98A 2KIQA 4JQFA 4PDKA 4RM3A 2M9HA 2LRDA 2O9LA 2JVGA 1TL8A 2DDBA 5HLTA 5ICFA 4QSHA 4FHTA 3PQKA 2GBYA 3T8TA 4EATA 3PSFA 1J75A 2KJCA 1MW7A 3TQNA 3CO6C 2LKSA 4XKBA 4E7IA 2EB7A 2EFNA 2QQ8A 5DEQA 3GX4X 4IF4A 3GTGJ 3ASOH 2D1VA 4L5EA 3ONQA 1ETVA 2MLGA 3FWEA 3QODA 2DW4A 5DUKA 3LQQA 4GGGA 3HOZJ 1Z6RA 2DAOA 2E1OA 2I10A 2ZFUA 2L9SA 5JLXA 2E1NA 1TLHB 3CJNA 1ON2A 4RB3C 3OYIA 2CUZA 3OOPA 5ICGA 2CRGA 5IYDJ 2BXZA 4KITB 2VJJA 2V9PA 2BY0A 6PAXA 2Z2SB 5K7HA 1ZK8A 2DCEA 4J19A 4KYWA 2EZHA 2Q1ZB 2K9SA 3L2UA 2A6HF 3ZCOA 3MFKA 2DYRH 3BJ6A 3W2AA 3OYHA 4A5MA 3T0YA 2A5WA 2L7KA 1WJDA 2PMHA 1VF9A 3E7LA 4WXCA 2VT3A 3IWFA 3BG3A 4DYQA 1I27A 1XG1A 3AKZA 1U8BA 1BJZA 1OYIA 3AL0C 3LSIA 3AG2H 2JMWA 2OZ6A 3GO5A 2LDUA 5CLSA 2ETHA 2R5YB 3L2CA 1U78A 1IN6A 1BA5A 3JAMZ 2ZXWH 2EQRA 2JVHA 4G7HF 2BVLA 5E20A 3K0LA 3JSOA 3QOEA 2IA0A 1BR4A 4L9TA 4QPQA 4CH7A 4DBQA 3BZKA 4GFBA 3ZMTA 2FE3A 2LTPA 3DPUA 3CC7I 3HB9A 2ECBA 1CF7B 2EA4A 4F91B 5B66C 2Z33A 2DA5A 1K61A 2H1KA 1XX5A 3REOA 4EJTA 1N78A 3GZNB 2VASA 3PNVA 4UUSB 5KCMA 1DGRM 1H0MA 3CCYA 5TRDA 2DQRA 2GWRA 2CQNA 2UXNA 3FXLA 4QTRA 1XCBA 2F5VA 5J1UA 2DTZA 2LY1A 2XASA 3CQZJ 1L0OC 2KT0A 1SFKA 4HQMA 1GDTA 1P9QC 1JT6A 2FU4A 2P6SA 3HRSA 1POGA 3FXKA 4GYIA 1ZGJA 4CO8A 3FMRA 3VPRA 1GV5A 3QPSA 5F1JA 2KZGA 4LJZF 4LLNA 1KQ8A 3CDHA 3QPTA 1OYYA 4CICA 1MD0A 2DBBA 2Y75A 4HEA2 3K1MA 1D0XA 1MDMA 2FNAA 1RETA 2L0KA 2K9LA 2M8GX 4E7JA 1FYMA 2HS5A 2X48A 3BPVA 4UB6C 4FX0A 4JP0A 1J9IA 3TW6A 3WTYC 1ONVA 2TCTA 1W1WE 3NQOA 2DXIA 1UAAA 4D5FA 1GT0C 3C3WA 4BEHA 3CESA 1U5TC 3SZTA 3F8CA 1Z77A 2BV6A 2VJ4A 3GFIA 2K4JA 3QYBA 5IYCJ 2WY8Q 3M8FA 1YHQI 2XRLA 2WY7Q 2ME6A 3HKZN 2L7MP 1KQ0A 4LLGF 1MH3A 4BHBA 3RJPA 2F2EA 1ZAOA 1LKXA 3FXJA 3HOWJ 1WJCA 2F4IA 4BYYA 1YW7A 2Y30A 3S2WA 2E7XA 2LOOA 2NVTJ 2H8WA 1OISA 1OJLA 3OS2A 2L9RA 3SEZA 1IUYA 2VB6A 2PMUA 4EQQA 3TOBA 2VBWA 2DMPA 2PFBA 5FD5A 2OPTA 1MJAA 2TDXA 1AKHB 2YU9J 2M2EA 3RKXA 3WU1B 4M3FA 2ICWG 3OR2C 2CV0A 4BEHB 5EEHA 3LL7A 2PQ8A 1IN5A 2L5QA 2DU9A 3FXMA 3LSTA 2VE8A 2CV2A 4AVPA 2BOLA 3VFZA 2Y9ZA 1X4OA 1LE8B 2NS0A 3HDDA 4OMYA 4L0ZB 2XB5A 3UKGA 2EPFA 1X2MA 3HUGB 2M30A 3KYDB 3K70C 4ESBA 5CYVA 5BMZA 1KYWA 4BE0A 5BPDA 1X2NA 4NC8A 1R1TA 3EETA 1B8IA 1Y6IA 4B44A 1KGSA 1O3RA 3DPTA 5JHUA 4M6VA 1AKHA 4AIHA 4YRVA 1PJRA 1DGWY 5LEJA 1JXSA 2P5KA 1X1CA 2O8KA 2L02A 3BG9A 1W0TA 2FMYA 3ZQ7A 1FIPA 3CMAI 2N8GA 1SAUA 2XGDA 5IYBJ 3ESWB 2EFPA 2BXYA 3U21A 4UUSA 4M6YA 2V1DA 1MBJA 3IC7A 4JX5A 3ZR8X 2GIVA 4OU0A 4PJLA 4DW6A 3CCQI 5CVJA 4XICA 4KT6A 1IF1A 3BG7A 1V5GA 1VQ5I 4KIGA 3DKXA 2K85A 3I58A 5HS8A 5J47A 4I2OA 4I76A 3KPHA 4ETSA 3QPLA 4IOAF 3GTPJ 2L4AA 3E97A 1SD4A 2ACJA 4B48A 3FIWA 2IS2A 4O5VA 3CCRI 3CMMA 3TGNA 5HOOA 5A2QK 1K83J 4IHWA 1HW1A 3FXQA 3L2VA 3S1MJ 4FETA 2A61A 3G1MA 3MZ8A 3TW7A 1W5TA 1S72I 2EK5A 3JRCA 2M8EA 1QGPA 3OSFA 1OCPA 2LF7A 3OYBA 3HYIA 1XGNA 3S3MA 1ZGWA 2HVRA 3BC8A 1FMWA 4XLFA 2CFOA 2DK5A 5AIPA 5E18F 2NVXJ 4XLAA 5LGUA 1SC7A 1E0EA 1Z91A 2FBIA 2L7ZA 2P7CB 2NYXA 3W2WA 2V6EA 4KISA 3IV5A 4IQJA 3HOUJ 2JRTA 5J8CA 2EV5A 2VODA 1HBXG 4WXHA 2BW3B 2E7WA 3OIPA 3S8PA 2Z1DA 1TZLA 4QPOA 3CC4I 2NVUB 4J00A 3BZ6A 3JSPA 1TP4A 1D0YA 1YS7A 2KHMA 2WC2A 3WU0A 4UB8C 1HW5A 3M1EA 3V7RA 3F21A 2NVQJ 2R7OA 4MEYF 1BC8C 2LMDA 3QRFF 4ZC3A 1O7FA 4XM3A 3FM5A 4Z6YA 1JTXA 1YW9A 1H9GA 1ZLJA 3BWGA 3TL4X 1ETYA 1TC3C 4OMZA 1RZ4A 2CFXA 2ZJ2A 1FZPB 5ED4A 4FE7A 4RDUA 1ZN2A 3GLLA 2XV4S 1USSA 2HDDA 1K79A 1HDDC 1S6LA 5J3LA 5DCMB 1U3EM 2Q2EA 2W85A 1S7AA 2KISA 3KIOA 5CKTA 3M8JA 3GTJJ 3BR2A 3I71A 4UUTA 5CQEA 1P7JA 4M3EA 4L9JA 2PJRA 4XLEA 4G6DA 4M9SA 2QQBA 2EIKH 1FT9A 2EBIA 2GIZA 2JK3A 4CCLA 3S16J 5F1RA 3EQLF 2A5YB 1T08B 3RKWA 5HDNA 2W84A 2UUZA 2QSGX 2DA3A 4XOPA 4JX4A 2LFBA 1KU7A 1V5FA 1GHCA 4V2GA 2COMA 3ERMA 4OWRB 3BPXA 2VIXA 2DA6A 1FSEA 2JA5J 1ZQ3P 3MAJA 4BQAA 2FJ1A 1WRJA 3DP7A 4N0BA 1VQMI 3I55I 5E1XA 3M7GA 2QBYB 1X3ZB 5E8IA 3E5XA 4LGWA 3FF5A 1OMIA 4XLPF 3OS0A 3N05A 2HZDA 1FWZA 1OR7C 5F04A 5M5XJ 4LB6B 3TO9A 2UZKA 3CDLA 2DA7A 3O8GA 1DPRA 5D5XB 2DT6A 3PM1A 1VI0A 2HPMA 2K3FA 3F9KA 5FKLA 3CUQA 3RDIA 3TO6A 2L54A 3I59B 1EF4A 1XTAA 1JGSA 2EFQA 2QZ8A 5CVVA 4ENJA 1B9MA 1K7AA 2OZUA 3BG5A 3MMYB 2LBFB 1DDNA 4AM3A 3H0GJ 5LHGA 1UHMA 3NAUA 1BI1A 1G3YA 1KU9A 4E70A 1T8IA 2XPWA 1H88C 2E1CA 2W4SA 3NEUA 1YO5C 4CZZA 2YR2A 3H5AA 1HSJA 3L00A 2HDWA 4QWQA 2OCEA 3KP6A 2NVYJ 5LGTA 1BOAA 2IJLA 3BY6A 1B72B 1RIOH 4WWCA 5KVRA 1Y1WJ 2CQXA 1T95A 2DA1A 2QVOA 1SVLA 3WE2A 2AS5F 3CTAA 2AHQA 3IAS2 2OUMA 2EFOA 4ENNA 3IAM2 3K4JA 3SDBA 5DM7F 1JI8A 1NH3A 5LHHA 4U7BA 2FEZA 4AD9A 3ASNH 1VQ8I 2ZXHA 3J7AO 2MH2A 4XNFA 2HYFA 1FYKA 5CJ9A 5DV5A 5EZHA 1G3TA 1RESA 1SD6A 1EH8A 3GUDA 1QU3A 2K9MA 4MGRA 4NHJA 3ZMSA 2XPVA 2EZIA 1P4WA 3SHFA 2YS9A 4LK1F 2A69F 3I5UA 1ZKGA 1E2XA 1MZBA 1R5HA 4UHTA 3DTIA 1VQOI 4ESFA 3MCZA 5C4XJ 4R79A 1WI9A 4KN4X 2X1DA 4BQQA 4NB5A 2KRHA 1FJLA 1VFCA 2HKXA 3RTRA 3ZQLA 2VE9A 1B4AA 1V3FA 3V8KA 1DPUA 5FGMA 4II2A 2R7XA 2YSRA 3D0SA 1HF0A 3GEZA 2JUGA 2X0LA 1X3UA 4JK1X 4S05A 2XGCA 2EH3A 1YI2I 2MGQA 4ZYAA 4M73A 2X6WA 4IJAA 2HYGD 1BR1A 4S04A 1WJ5A 3S14J 3VYSB 2J5PA 1XSXA 1R7JA 2PX9A 4HNUA 3CCUI 3QQAA 1Z1DA 2NRAC 1FP2A 3LSMA 4U87A 3JREA 3RZDJ 1ZELA 4YFNF 5FLVA 1J7KA 1IZ1A 2FXAA 4U0WA 3C2BA 1I39A 1MMNA 2GAUA 4XRMA 4XK4A 4U0YA 3H1CA 1GXQA 4FQGA 3GF2A 4GYGA 2K4BA 2DJNA 3OL4A 4A0ZA 2ISZA 3NARA 3HTSB 1YS6A 3LSJA 3BQZA 3DWLE 1SAXA 2FRHA 4EGZA 3AL0B 1YFHA 1W7PD 2ZB9A 1D1BA 4NC7A 4RB0A 4W1UA 3FXOA 1HCRA 3WTWC 3OR1C 3K7AJ 1IJWC 2ZJQF 2XKPA 4MEXF 2E34A 3EUHA 3HXLA 3SDGA 1U8RA 4F52A 3H92A 4RMNA 4UVAA 2CW7A 1T6SA 4KJZA 4M6XA 2LC2A 2B0LA 2JPCA 5GTIC 4B1RA 2CH0A 1W36D 3KEQA 3BR3A 1W5CC 4BKXA 2GA2A 5B1BH 5HS9A 4WXDA 1MSFC 1LUJB 4AIJA 2WAQA 1MBFA 3KYLA 1F5TA 1YE9A 2GZWA 2RQQA 3OYLA 2RV8A 1LFUP 2Y48A 1XD7A 4XLNF 1ZARA 1N77A 4IRIA 4BY1J 1Y8RB 5ICEA 4I6ZA 3RPUD 1HDPA 2M0MA 1MMSA 1TT0A 3L2QA 4MO7A 2H6CA 5HDKA 1KU3A 1HKTA 2RN7A 3BR1A 1SMTA 1K78B 1TW3A 4LIVA 4XKVA 2V1XA 3JW4A 4DZPA 2R5YA 1X1BA 1IXRC 1SVOA 2DOAA 4OINF 2BEOA 1OCTC 2MW8A 3ABKH 4DIQA 2JUCA 2QBYA 3PQJA 5K5RA 1Y56A 2RAEA 3ZQIA 2P81A 4JOMA 5L3EA 4O6JA 1PYVA 2I5UA 2OJED 1J5YA 2FD5A 3WTTC 1BI3A 2DPDA 1DP7P 2IPQX 3KP2A 3VDXA 2QCOA 2YX7A 1NTCA 2RNGA 3L2WA 2OBPA 4GCVA 3UR3C 3GWZA 4LB5A 2E19A 2FOWA 3P9IA 3H36A 1VQ6I 1E3HA 1OQYA 2IW5A 3KLOA 4MTEA 2K40A 1Z0XA 1ZYRF 3PSIA 2GOMA 5LEKA 3I9V2 2VOPA 2R7DA 3GBGA 1X4PA 1U9OA 2V7FA 2CW0F 1CGPA 3SFZA 1ETXA 2KMUA 4IHXA 2E5ZA 1SMYF 1FTTA 5F6FA 1VQ9I 1ON1A 5D6FA 4A12A 4AIDA 1FBSA 2Y9YA 3DTEA 3H9GA 4CYDA 1BJAA 3BCAA 5GAGJ 4HPQA 2V6CA 5D8KB 2R92J 2EWNA 2Q2EB 2OD5A 2W7NA 2EA2A 4U88A 2LNBA 3HHHA 2HEOA 4KUMA 4LG3A 1WCMJ 4KA4A 4IEJA 3WTXC 2LLKA 4G6QA 2DA2A 2EZKA 5IPAA 3S2DJ 2FMLA 1O57A 3CCEI 4HBLA 2HKOA 2PJRB 1RI7A 1IW7F 2M4GA 2BHZA 1XSDA 5K7FA 4B3XA 1YQAA 4N4NB 2MD0A 4G7ZF 3TP3A 4XSXF 1MSEC 3P9CA 5F0CA 3PUFA 2OA4A 2LF8A 4KNYA 2QQ9A 3WGIA 1WWXA 2GQQA 2P5VA 2CQQA 3DEWA 2QUFA 4IRHA 4I98B 1QZEA 1K6YA 3X2QH 2KDOA 2LSOA 1TQIA 3A2KA 4KFCA 2HOSA 2PN6A 5LLQA 5LRSA 2E1MC 3VODA 3ZN1A 1QA6A 4XRSG 5F08A 5HODA 2OTJI 2WAQN 2ME0A 2DMTA 2K27A 1W7PB 2DOFA 4BDYA 3JRHA 2D1HA 3DBRB 2JSPA 4ON0A 3F23A 4A5NA 2HXOA 2KL4A 5FKMA 1QBJA 3RPQA 2VOOA 3KYCB 2AQEA 4Y7NJ 4HLYA 1QZZA 5B5EC 4BBRJ 3K4CA 2BY3A 5F0FA 5H6QA 1J0RA 5H20A 3V8JA 4MNUA 4X0GA 5ILUA 2X9DA 2L4MA 2R7WA 1VQNI 2M3AA 4BAYA 4MQ9F 1VTNC 2VC1A 2XSDC 1YRNB 1ZTRA 2LH9A 3PFYA 5D8LB 3K4MA 3FXUA 3I3LA 4WX9A 1SVMA 3N4MA 1YG2A 5DYMA 4KIFA 3KP3A 3IKTA 4PFOA 4KDPA 1JHHA 2W82A 2K9NA 3CUQC 4A3DJ 1I3AA 4A6DA 1XN7A 5ILVA 3ABUA 1TTYA 1YJNI 2EIJH 3LA2A 4BNCA 1IDYA 3B6CA 4BL0B 4RB2C 3HEFA 4A3IJ 2BE5F 4G6TB 1MBGA 3ECOA 2MC4A 4IHVA 2OAZA 1LJ9A 4RA2A 2ZJRF 4IPAA 3DV8A 3ECHA 2VKDA 5M3MJ 3RI4A 2VI6A 3U9GA 4C3JJ 3ELKA 3U1KA 1IRFA 2M1BA 2COBA 2NXNB 2WB1A 1YRNA 1ZRDA 2W25A 1Z3XA 2X1CA 3G4SI 3ZOBA 4J01A 2HR3A 3M07A 1R5ID 4DYRA 3DKWA 1FOXA 1A04A 3FKIJ 2LY9A 2KPMA 3CF5F 1FOYA 4CA0A 2ZC2A 3HSRA 2KLOA 2RQPA 2R7SA 1JGGA 4JYKA 2ZJPF 2G0EA 5D5UB 3DU5A 3C18A 3CLQA 1ZR2A 3GTQJ 2H94A 3CMYA 5J1YA 2NS8A 2VXDA 2XAFA 1QVTA 1KQ9A 2VPLA 1IN7A 3GTKJ 2MD5A 2XSJC 4HDVA 1A5JA 4XRSA 1UG2A 1UELB 4MLOA 4HV5A 1B72A 3CUQB 1OFCX 3W3CA 4BS9A 5HVQC 3GFLA 1HSTA 4HX4A 3HPHA 2ID6A 1UHSA 2Z3YA 3E0JB 2F4MB 4BXFA 3WHBA 4RB1A 5DD4A 3Q9VA 5CQGA 1D1CA 4ENMA 3S1RJ 1ERDA 2L9NA 2O03A 1UG0A 4HF0A 4Y15A 1WHUA 2DOEA 3BJOA 5E3NA 3KFWX 1JKQC 1U5TA 3DEEA 3D1NI 2W48A 4BGDA 3I4MJ 3EYYA 3LSKA 1FNNA 2Y31A 2Z99A 4DGWB 3OIQA 4C2UA 2QENA 5J4YA 1T0FA 5IP9J 1V54H 2OCCH 3P5JA 3MD2A 2K3PA 2XAJA 1VQ7I 3TO7A 3VOEA 1ETQA 4P55A 5EGOA 2QSFX 2VKEA 1R6RA 1FBUA 4XKWA 4Z2YA 3SEQA 1G59A 3OYMA 1TW2A 4BHPA 3DLAA 3FX3A 1R9TJ 1YTYA 2Z16A 5IT3A 3M4OJ 4PJ0C 4D7NA 1G4DA 4G9YA 1TQPA 2MFZA 2F6CA 1D5YA 3BCBA 3MKLA 1WVRA 5H2FC 1B59A 1RKTA 3PIOF 1TNTA 3CD6I 3E3VA 1Y0UA 4GDFA 1FLIA 2Y2ZA 1N75A 1SFUA 1IGNA 1FSHA 2JWTA 3JRAA 2UXXA 1ODDA 2KIMA 3M1CA 3Q0VA 3B6AA 4CGZA 4IL6C 1FBQA 5LFAA 1ZHFA 4PSWA 2Y0SN 4ZZLA 4ZJZA 2DFHA 2DPUA 2VL8A 4AYBN 2M0CA 4CYCB 2NOJB 1G2HA 4AUXA 1TWHJ 1YIOA 3GW2A 3RZOJ 2VJ5A 1MMAA 2KDZA 2VT2A 4A93J 4F3QA 3FBIB 4DOZA 2R7VA 1SANA 1MBEA 1S9HA 2EJRA 5LRRA 1HW2A 2F5EA 1GVJA 4LK0F 4UXNA 2HZTA 3ROUA 1NG6A 3VSKA 1STZA 3KETA 4BUPA 5JVTA 3IH4A 1REPC 2LG4A 4CUGA 2WAEA 3R61A 2VBZA 3HOXJ 3HBLA 2IBDA 2JQ7A 3BP8A 4I99C 5TJJA 4BXUA 2K7LA 1JUSA 3BQYA 4XRFA 3A1YA 5DDGA 2EFWA 4NQWB 2KP6A 1XS9A 2BY2A 2CMPA 4A3BJ 3S15J 2Y0MA 2ZXIA 1PUFB 5HLIA 1IRXA 5GAHJ 4A3LJ 5EEGA 2IGNA 4XLHA 1D0ZA 4A3FJ 3HSEA 1E17A 3PUBA 2O8XA 2JA7J 1MIJA 2K5CA 3WG7H 2VQCA 3FHNA 4ZTJA 1Q1VA 4YIIA 2ELJA 3BTLA 3NWSA 4KMUX 3QAHA 4II3A 4B47A 3OYFA 1BR2A 5F0HA 3BROA 2HU9A 3EUHC 3LFKA 4ZDLA 4ANJA 1FIAA 1I1SA 4HA8A 3J80K 1LNWA 1QHHD 4PZJA 2CQ7A 2F5DA 2KQRA 4CCJA 1WZ2A 2ZSIB 2IGMA 2NNNA 4D7MA 4ABZA 4HF2A 2VPRA
chains in the Genus database with same CATH topology
4EM2A 2MBFA 3IKVA 5D4RA 4Y13A 2HQRA 2A07F 2C6YA 2DLLA 2V79A 2KKOA 3E6MA 3MZYA 3F8BA 4LMYA 2MLKA 1NHAA 5ICCA 3WTVC 1SFEA 3WODF 2JZYA 2H27A 1TNSA 1Z6TA 3GVAA 2GA1A 1USTA 4P9FA 1PP8F 3MWMA 5IT9K 1JHFA 3F72A 2FOKA 3KLNA 3HRMA 2DI3A 2J5OA 1U5TB 3DQVC 3E6DA 1QQIA 2D45A 5F64A 2NNYA 1QPMA 1EH7A 4Q4ZF 1C0WA 1ZGAA 2XIGA 5ERIA 3J80Z 1LVAA 3FHZA 2VC0A 4ZZDA 4IHTA 1G3SA 3GXOA 1ZRCA 2BBYA 2FBHA 4RGSA 3C1DA 5KK1A 4RGUA 3WTZA 5E1WA 3B73A 1R22A 4LG0A 2PJPA 3V4GA 1Q1HA 1KYZA 3HUGA 1Z7UA 3QU3A 4N9IA 1B6AA 1RUNA 2Q8KA 1IAWA 1O3SA 4I01A 1B1BA 3WGGA 2PEXA 3ISPA 1FYLA 2V9VA 3I53A 1R36A 3CO7C 3TKYA 3F22A 2Z5UA 1XDSA 4I0BA 3QU6A 1G3WA 1S8NA 2WTEA 5E1ZB 2K86A 2XAQA 3R6SA 1S29A 2P8TA 3QOPA 4KICA 3Q5FA 4P9UA 4ZYEA 3RKYA 2DT5A 2ESNA 3W6KB 1LDKB 3ZMVA 1DUXC 2MA3A 1F4KA 3P9KA 3KP7A 5HDGA 3FZVA 1D5VA 2ELHA 4R8HA 2ZXJA 2FF4A 4P96A 2QM3A 1IRGA 3MQ0A 3IRRA 3I0TA 3V8LA 4QLCU 5JI6A 3K69A 2IRFG 2PLYA 1Z9CA 2HTSA 1SFXA 1SD5A 2OQRA 1HKQA 3E5QA 1G6NA 1XSVA 3W6JB 3F3XA 2DK8A 1LEAA 5L3GA 2A6EF 1FP1D 2XKOA 1U2WA 1WSUA 1P4AA 4UVBA 5CVUA 2VN2A 4H0EA 3QP6A 1R58A 2D2WA 1HXDA 4EMSA 2WV0A 1UB9A 5BOXA 3G73A 3OV8A 3TOAA 3R0JA 3J81Z 3FMQA 4Q48A 5HLGA 2YPRA 3WE3A 2DQLA 4Y17A 2XHKA 4UV9A 1O7LA 2ZCWA 3GLXA 2ZNYA 3L09A 4FT8A 1SD7A 3V7SA 1B9NA 4G7OF 4M71A 3QPHA 1ZREA 4XSZF 3COAC 2IA1A 5JFRA 4OIOF 1KA8A 2MH9A 3ZMZA 5K5QA 2XROA 3LWFA 4EJOA 4NQWA 5L3BA 3JTHA 1W7PA 3M8EA 2DTRA 2IT0A 3LQRA 4I7HA 4ZYDA 1JE8A 1AOYA 4IHSA 2RGVA 1J59A 2CG4A 3F6OA 5E8GA 2ESHA 2G7HA 2EV0A 3DEUA 3ZMDA 4L5JA 4UNOA 2OQGA 4K2EA 4RGRA 1OKRA 3GYHX 5HLHA 1EH6A 2O6GE 2G7UA 3T5XA 4G94A 1FY7A 1ULYA 3K1PA 1AWCA 1P6RA 2W24A 3I54A 1GXPA 1R5GA 3I4PA 4AWXB 1MKMA 4OIQF 2KJBA 2DFIA 4RS8A 4WF2A 3Q9SA 4M72A 3O2PE 4R1HA 1BIAA 5FFZA 1QNTA 1ZG1A 1XCVA 3JAMK 4MHGA 3ABTA 4I02A 1UHWA 3AAFA 1MJ9A 4FX4A 4PCQA 4U0VA 5JR3A 3E6BA 1CF7A 2M5WA 2P7VB 2M45A 1LB2A 2R3SA 3B02A 4B09A 1OR7A 1BI2A 1I5ZA 1O3TA 2ADUA 3ERED 1OPCA 2PI0A 2FBKA 3SXYA 3HHGA 2K02A 1IXSB 1HQCA 4B8XA 4M9XA 2VBXA 3TDZC 3CUOA 1P4XA 4JBAA 2X4HA 4U7DA 2FQ3A 1XDUA 3RYRA 2EV6A 2CSOA 2IA2A 4HZFA 3TDUC 1I6XA 1XGOA 3PFIA 1P2FA 3U1DA 2O3FA 4L9VA 2STTA 3WTSC 2IP2A 1QZYA 2HTJA 5DCFA 3DFGA 2DO7A 4WK8F 5LGNA 4YFXF 1R1VA 2ZMEA 3F8NA 2JPBA 4I0AA 3HTUA 3VB2A 1LDDA 5FLXK 2QWWA 4L5IA 4YIFA 4A6EA 4EJWA 2F5FA 1T39A 4HV6A 4M9ZA 4O3MA 3QP5A 3EDPA 4HDUA 1ZLKA 2ZFWA 1K78A 2M87A 2JT1A 2YU3A 4HQEA 1O3QA 3HRUA 2FNPA 4TV7A 4HOBA 3BDDA 2H6BA 1WQ2A 1T38A 4GXOA 4N9HA 2LKPA 2Z9OA 2RC4A 3DF8A 4RAZA 2L01A 3I59A 4CXFA 2IVMA 2RKHA 2HOEA 1FOKA 1LQ1A 1ZRFA 2Q0OA 2GXGA 5FD6A 4IRGA 5FLXZ 2XUBA 3IHUA 1J2XA 1D3YA 1TBXA 3M9AA 5L3CA 2W57A 1MDMB 2VXZA 1YW8A 5LBQA 4RAYA 3V7CA 1P92A 2KIUA 2PG4A 2AXLA 2QQAA 5IT9Z 3HSFA 4CDGA 3HRTA 4LG0B 3T8RA 4IVNA 1WKMA 4P5OA 4HF1A 4YFKF 3BJAA 1W4MA 2ISYA 2XVCA 2HQNA 3C7JA 3KCCA 5J8FA 1UCRA 5CVRA 1LDJA 3MZHA 4A0XA 3ML6A 2XRNA 3F8FA 4DNCA 3R60A 3WTUC 4HLXA 1FX7A 1V4RA 3KZYA 3K9TA 5DCMA 4EJVA 1ZG3A 3R4KA 3FM3A 5E17F 5D6EA 5LHIA 2P6TA 3F8MA 3RPUA 1R1UA 3I64A 2CYYA 1TQMA 4EVIA 1I1GA 3GZ5A 3E5UA 2HDCA 2O0YA 4A0YA 4L0YB 1R23A 4Q5SF 3VEPA 1ZG5A 1HKSA 1KU2A 5BPIA 4PGGA 3HOTA 4HW0A 3KP4A 2F5CA 1R00A 1BBYA 4ZYHA 4BH9A 1F1ZA 5K5OA 2O61A 1XGSA 4ZH4F 4F7ZA 5CVIA 2OU2A 3GFJA 4LD5A 1XGMA 2V1UA 2RNJA 2JSCA 2CGPA 3D5LA 1BN5A 3ULQB 5J6XA 3T1BA 4G8XA 4UV8A 1PUEE 2UWMA 4UVCA 3WGHA 4GO1A 1QO0D 2KIFA 3L9FA 2ZBKA 3K2ZA 2GXBA 3BOQA 4HAMA 5A2QZ 3NRVA 3MEXA 1FPQA 5HS7A 3FXRA 4Q47A 4UUVA 1S7OA 2R7FA 1LEBA 2HWVA 3DPLC 3HIFA 2MC3A 3R0AA 1K6OA 1OYWA 2JTVA 3FMSA 5FO5A 4EJUA 1S3JA 3KE2A 3O6BB 2FA5A 1ZH5A 3DXJF 5H6RA 3L7WA 4LFUA 2CWEA 1D8JA 4XBFA 1IXCA 3IRQA 3ZPLA 3J81K 2A68F 1T2KA 2H09A 4HYEA 3N97A 5AONA 4YG2F 4MQVA 5FB2A 3IWZA 3ZN0A 1FC3A 2VBYA 4KN7X 5DD8A 3H3ZA 4I09A 1L3LA 2P4WA 2QLZA 4EM1A 1RNLA 2XAGA 4KIBA 5AIQA 1Z05A 4D0PA 1MJBA 4A2UA 4ESJA 5BS6A 3SQNA 3LA3A 4M74A 3RIRA 3JTGA 3H3UA 4HX7A 4KT5C 3KP5A 4OOIA 2CQKA 2VONA 5BQTA 3GFMA 4ASNA 1BIBA 3P7NA 3LAPA 2XAHA 2FSWA 2YX4A 3KZZA 1XMKA 3RYPA 1IN4A 3K1NA 1RUOA 2ZMEB 4DQ2A 5D5WB 3KEOA 2BGCA 4RGXA 4OIPF 1MGTA 3HOSA 2PBIA 1W5SA 3EYIA 4HX8A 5D5VB 3SZPA 2BYVE 4ENKA 4ZYGA 4L9NA 2ZNZA 4MTDA 1H9TA 3G3ZA 4PGHA 4BHCA 3ZMUA 1BM9A 2QYOA 2RDPA 2P5LC 2HFHA 4KMFA 4EM0B 3WG9A 2ZO4A 1IN8A 3ZP5A 3IL2A 3LAJA 4CHUA 5FFXA 3O3KA 1PP7U 1BI0A 4LLLA 2L3DA 3F6VA 4OIRF 4L18B 1XB4A 1PDNC 4AIKA 1U6GA 5L3FA 1BC7C 2XGXA 2CO5A 3LA7A 1F9NA 2STWA 2KRFA 3E6CC 2G9WA 2NAZA 3CLOA 5ILSA 1YLFA 1D8KA 5K1YA 1XMAA 1YYVA 1EV7A 5L3DA 4EV0A 5D4SA 3U2RA 3GZ6A 4WCGA 5DUIA 2ZKZA 2WWYA 2A3SA 2HGCA 4IXAA 2RVCA 1UFMA 4EGYA 1T98A 4JQFA 4PDKA 5ICFA 4FHTA 3PQKA 3T8TA 1J75A 2KJCA 3TQNA 3CO6C 2EB7A 2EFNA 5DEQA 3GX4X 4IF4A 2D1VA 2MLGA 3FWEA 2DW4A 5DUKA 3LQQA 4GGGA 1Z6RA 2DAOA 2E1NA 1TLHB 3CJNA 1ON2A 4RB3C 3OOPA 5ICGA 6PAXA 4KYWA 2A6HF 3MFKA 3BJ6A 4A5MA 3T0YA 2PMHA 4WXCA 2VT3A 3IWFA 1I27A 1OYIA 2OZ6A 3GO5A 2LDUA 5CLSA 2ETHA 3L2CA 1U78A 1IN6A 3JAMZ 4G7HF 5E20A 3K0LA 3JSOA 2IA0A 4L9TA 3ZMTA 2FE3A 1CF7B 2EA4A 2Z33A 4EJTA 3REOA 1H0MA 5TRDA 2DQRA 2GWRA 2UXNA 1XCBA 2XASA 1L0OC 4HQMA 2FU4A 2P6SA 3HRSA 4GYIA 1ZGJA 4CO8A 3FMRA 4LJZF 4LLNA 3CDHA 3QPTA 1OYYA 4CICA 1MD0A 2DBBA 2Y75A 3K1MA 1MDMA 2FNAA 1FYMA 2HS5A 3BPVA 1J9IA 4FX0A 3WTYC 1ONVA 3NQOA 3C3WA 3SZTA 1U5TC 3F8CA 2BV6A 3GFIA 2K4JA 3M8FA 1KQ0A 4LLGF 4BHBA 3RJPA 2F2EA 1ZAOA 4BYYA 1YW7A 3S2WA 2E7XA 1IUYA 2PMUA 4EQQA 3TOBA 2VBWA 2PFBA 5FD5A 1MJAA 2TDXA 3RKXA 3WU1B 5EEHA 2PQ8A 1IN5A 2DU9A 3LSTA 2VE8A 4AVPA 3VFZA 4OMYA 2NS0A 4L0ZB 2M30A 4ESBA 5CYVA 5BMZA 1KYWA 5BPDA 1R1TA 3EETA 1KGSA 1O3RA 3DPTA 5JHUA 4AIHA 1JXSA 5LEJA 2P5KA 2L02A 2FMYA 3ZQ7A 2EFPA 4M6YA 2V1DA 3IC7A 2GIVA 4OU0A 5CVJA 1IF1A 4KIGA 3I58A 5HS8A 4I2OA 4ETSA 2L4AA 3E97A 1SD4A 2ACJA 4O5VA 3TGNA 5HOOA 5A2QK 1HW1A 3FXQA 2A61A 1W5TA 2EK5A 2M8EA 1QGPA 2LF7A 3HYIA 1XGNA 2DK5A 5AIPA 5E18F 5LGUA 1Z91A 2FBIA 2P7CB 2NYXA 2JRTA 5J8CA 2EV5A 2VODA 1HBXG 4WXHA 2E7WA 3BZ6A 3JSPA 1YS7A 2WC2A 3WU0A 1HW5A 3M1EA 3V7RA 3F21A 4MEYF 1BC8C 3QRFF 1O7FA 3FM5A 1YW9A 1H9GA 1ZLJA 3BWGA 4OMZA 1RZ4A 2CFXA 2ZJ2A 1FZPB 5ED4A 1ZN2A 2XV4S 1USSA 1K79A 1S6LA 5DCMB 1U3EM 2Q2EA 2W85A 1S7AA 3I71A 4L9JA 4G6DA 4M9SA 2QQBA 1FT9A 5F1RA 3EQLF 2A5YB 3RKWA 5HDNA 2W84A 1KU7A 1GHCA 2COMA 3BPXA 1FSEA 3MAJA 4BQAA 1WRJA 3DP7A 4N0BA 5E1XA 3M7GA 2QBYB 5E8IA 3E5XA 4LGWA 3FF5A 1OMIA 4XLPF 1FWZA 4LB6B 3TO9A 2UZKA 1DPRA 5D5XB 3RDIA 3CUQA 3TO6A 2L54A 3I59B 1JGSA 2EFQA 2QZ8A 5CVVA 4ENJA 1B9MA 1K7AA 2OZUA 1DDNA 5LHGA 1UHMA 1BI1A 1G3YA 1KU9A 4E70A 2E1CA 3NEUA 1YO5C 4CZZA 2YR2A 1HSJA 3L00A 4QWQA 3KP6A 5LGTA 1BOAA 2IJLA 3BY6A 1RIOH 4WWCA 5KVRA 2QVOA 2AS5F 3WE2A 3CTAA 2EFOA 4ENNA 5LHHA 4U7BA 2FEZA 4AD9A 3J7AO 2MH2A 2HYFA 1FYKA 5CJ9A 5DV5A 1G3TA 1SD6A 1EH8A 3GUDA 4MGRA 4NHJA 3ZMSA 1P4WA 3SHFA 4LK1F 2A69F 3I5UA 1E2XA 1MZBA 1R5HA 4UHTA 4ESFA 3MCZA 4R79A 4KN4X 1WI9A 4NB5A 2HKXA 3RTRA 2VE9A 1B4AA 1V3FA 3V8KA 1DPUA 5FGMA 2YSRA 3D0SA 3GEZA 2X0LA 1X3UA 4JK1X 4S05A 4M73A 4IJAA 2HYGD 4S04A 2J5PA 1XSXA 1R7JA 2NRAC 1Z1DA 1FP2A 4YFNF 1J7KA 1IZ1A 2FXAA 4U0WA 2GAUA 4U0YA 1GXQA 4GYGA 3GF2A 2K4BA 4A0ZA 2ISZA 3HTSB 1YS6A 1SAXA 2FRHA 4EGZA 1YFHA 1W7PD 4RB0A 3WTWC 2XKPA 4MEXF 3EUHA 1U8RA 3H92A 4UVAA 1T6SA 4M6XA 2B0LA 2JPCA 3KEQA 2GA2A 5HS9A 4WXDA 4AIJA 1F5TA 2GZWA 2RV8A 2Y48A 1XD7A 4XLNF 1ZARA 4IRIA 5ICEA 1HKTA 2H6CA 5HDKA 1KU3A 2RN7A 1SMTA 1K78B 1TW3A 2V1XA 3JW4A 1IXRC 4OINF 2QBYA 2BEOA 3PQJA 5K5RA 5L3EA 4O6JA 1J5YA 3WTTC 1BI3A 2DPDA 1DP7P 2IPQX 3KP2A 2YX7A 2OBPA 4GCVA 3GWZA 4LB5A 3P9IA 2IW5A 3KLOA 4MTEA 1ZYRF 5LEKA 2VOPA 2R7DA 2CW0F 1CGPA 3SFZA 1SMYF 5F6FA 1ON1A 5D6FA 4A12A 1FBSA 4CYDA 1BJAA 2V6CA 5D8KB 2EWNA 2OD5A 2EA2A 4U88A 2LNBA 3HHHA 2HEOA 4KUMA 4KA4A 3WTXC 4G6QA 2FMLA 1O57A 4HBLA 2HKOA 1RI7A 1IW7F 1XSDA 1YQAA 4G7ZF 4XSXF 3P9CA 2OA4A 2LF8A 4KNYA 2QQ9A 3WGIA 1WWXA 2GQQA 2P5VA 2QUFA 4IRHA 4I98B 2LSOA 1TQIA 4KFCA 2PN6A 5LLQA 5LRSA 3VODA 3ZN1A 2K27A 1W7PB 2D1HA 4ON0A 3F23A 4A5NA 1QBJA 3RPQA 2VOOA 4HLYA 1QZZA 5H6QA 1J0RA 5H20A 3V8JA 4MNUA 5ILUA 2L4MA 4BAYA 4MQ9F 1VTNC 2VC1A 5D8LB 3FXUA 4WX9A 3N4MA 1YG2A 5DYMA 4KIFA 3KP3A 3IKTA 4KDPA 1JHHA 3CUQC 4A6DA 1XN7A 5ILVA 3ABUA 1TTYA 3LA2A 4BNCA 4RB2C 2BE5F 3ECOA 2OAZA 1LJ9A 4IPAA 3DV8A 3ECHA 3RI4A 3U9GA 3ELKA 1IRFA 2M1BA 1ZRDA 2W25A 2HR3A 3DKWA 1A04A 3HSRA 2RQPA 5D5UB 3C18A 2H94A 2XAFA 1KQ9A 1IN7A 2MD5A 4HDVA 4HV5A 3CUQB 5HVQC 3GFLA 1HSTA 4HX4A 2Z3YA 4RB1A 5DD4A 3Q9VA 4ENMA 2O03A 4HF0A 4Y15A 3BJOA 3KFWX 1U5TA 3EYYA 1FNNA 2Z99A 2QENA 1T0FA 2XAJA 3TO7A 3VOEA 4P55A 1FBUA 4Z2YA 1TW2A 4BHPA 3FX3A 1YTYA 5IT3A 1G4DA 4G9YA 1TQPA 1B59A 1TNTA 3E3VA 1Y0UA 1FLIA 1SFUA 1FSHA 2UXXA 1ODDA 2KIMA 4CGZA 1FBQA 1ZHFA 4ZZLA 2DPUA 1YIOA 3GW2A 2VT2A 2EJRA 1HW2A 5LRRA 2F5EA 1GVJA 4LK0F 4UXNA 2HZTA 3ROUA 1STZA 3KETA 5JVTA 1REPC 3R61A 2VBZA 3BP8A 5TJJA 4BXUA 2K7LA 4XRFA 5DDGA 2EFWA 2Y0MA 5HLIA 5EEGA 3HSEA 1E17A 2O8XA 4YIIA 4KMUX 3QAHA 3BROA 3LFKA 1I1SA 4HA8A 3J80K 1LNWA 4PZJA 2F5DA 2NNNA 4HF2A 1KQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EM2 A;  2MBF A;  3IKV A;  5D4R A;  4Y13 A;  2HQR A;  2A07 F;  2C6Y A;  2DLL A;  2V79 A;  2KKO A;  3E6M A;  3MZY A;  3F8B A;  4LMY A;  2MLK A;  1NHA A;  5ICC A;  3WTV C;  1SFE A;  3WOD F;  2JZY A;  2H27 A;  1TNS A;  1Z6T A;  3GVA A;  2GA1 A;  1UST A;  4P9F A;  1PP8 F;  3MWM A;  5IT9 K;  1JHF A;  3F72 A;  2FOK A;  3KLN A;  3HRM A;  2DI3 A;  2J5O A;  1U5T B;  3DQV C;  3E6D A;  1QQI A;  2D45 A;  5F64 A;  2NNY A;  1QPM A;  1EH7 A;  4Q4Z F;  1C0W A;  1ZGA A;  2XIG A;  5ERI A;  3J80 Z;  1LVA A;  3FHZ A;  2VC0 A;  4ZZD A;  4IHT A;  1G3S A;  3GXO A;  1ZRC A;  2BBY A;  2FBH A;  4RGS A;  3C1D A;  5KK1 A;  4RGU A;  3WTZ A;  5E1W A;  3B73 A;  1R22 A;  4LG0 A;  2PJP A;  3V4G A;  1Q1H A;  1KYZ A;  3HUG A;  1Z7U A;  3QU3 A;  4N9I A;  1B6A A;  1RUN A;  2Q8K A;  1IAW A;  1O3S A;  4I01 A;  1B1B A;  3WGG A;  2PEX A;  3ISP A;  1FYL A;  2V9V A;  3I53 A;  1R36 A;  3CO7 C;  3TKY A;  3F22 A;  2Z5U A;  1XDS A;  4I0B A;  3QU6 A;  1G3W A;  1S8N A;  2WTE A;  5E1Z B;  2K86 A;  2XAQ A;  3R6S A;  1S29 A;  2P8T A;  3QOP A;  4KIC A;  3Q5F A;  4P9U A;  4ZYE A;  3RKY A;  2DT5 A;  2ESN A;  3W6K B;  1LDK B;  3ZMV A;  1DUX C;  2MA3 A;  1F4K A;  3P9K A;  3KP7 A;  5HDG A;  3FZV A;  1D5V A;  2ELH A;  4R8H A;  2ZXJ A;  2FF4 A;  4P96 A;  2QM3 A;  1IRG A;  3MQ0 A;  3IRR A;  3I0T A;  3V8L A;  4QLC U;  5JI6 A;  3K69 A;  2IRF G;  2PLY A;  1Z9C A;  2HTS A;  1SFX A;  1SD5 A;  2OQR A;  1HKQ A;  3E5Q A;  1G6N A;  1XSV A;  3W6J B;  3F3X A;  2DK8 A;  1LEA A;  5L3G A;  2A6E F;  1FP1 D;  2XKO A;  1U2W A;  1WSU A;  1P4A A;  4UVB A;  5CVU A;  2VN2 A;  4H0E A;  3QP6 A;  1R58 A;  2D2W A;  1HXD A;  4EMS A;  2WV0 A;  1UB9 A;  5BOX A;  3G73 A;  3OV8 A;  3TOA A;  3R0J A;  3J81 Z;  3FMQ A;  4Q48 A;  5HLG A;  2YPR A;  3WE3 A;  2DQL A;  4Y17 A;  2XHK A;  4UV9 A;  1O7L A;  2ZCW A;  3GLX A;  2ZNY A;  3L09 A;  4FT8 A;  1SD7 A;  3V7S A;  1B9N A;  4G7O F;  4M71 A;  3QPH A;  1ZRE A;  4XSZ F;  3COA C;  2IA1 A;  5JFR A;  4OIO F;  1KA8 A;  2MH9 A;  3ZMZ A;  5K5Q A;  2XRO A;  3LWF A;  4EJO A;  4NQW A;  5L3B A;  3JTH A;  1W7P A;  3M8E A;  2DTR A;  2IT0 A;  3LQR A;  4I7H A;  4ZYD A;  1JE8 A;  1AOY A;  4IHS A;  2RGV A;  1J59 A;  2CG4 A;  3F6O A;  5E8G A;  2ESH A;  2G7H A;  2EV0 A;  3DEU A;  3ZMD A;  4L5J A;  4UNO A;  2OQG A;  4K2E A;  4RGR A;  1OKR A;  3GYH X;  5HLH A;  1EH6 A;  2O6G E;  2G7U A;  3T5X A;  4G94 A;  1FY7 A;  1ULY A;  3K1P A;  1AWC A;  1P6R A;  2W24 A;  3I54 A;  1GXP A;  1R5G A;  3I4P A;  4AWX B;  1MKM A;  4OIQ F;  2KJB A;  2DFI A;  4RS8 A;  4WF2 A;  3Q9S A;  4M72 A;  3O2P E;  4R1H A;  1BIA A;  5FFZ A;  1QNT A;  1ZG1 A;  1XCV A;  3JAM K;  4MHG A;  3ABT A;  4I02 A;  1UHW A;  3AAF A;  1MJ9 A;  4FX4 A;  4PCQ A;  4U0V A;  5JR3 A;  3E6B A;  1CF7 A;  2M5W A;  2P7V B;  2M45 A;  1LB2 A;  2R3S A;  3B02 A;  4B09 A;  1OR7 A;  1BI2 A;  1I5Z A;  1O3T A;  2ADU A;  3ERE D;  1OPC A;  2PI0 A;  2FBK A;  3SXY A;  3HHG A;  2K02 A;  1IXS B;  1HQC A;  4B8X A;  4M9X A;  2VBX A;  3TDZ C;  3CUO A;  1P4X A;  4JBA A;  2X4H A;  4U7D A;  2FQ3 A;  1XDU A;  3RYR A;  2EV6 A;  2CSO A;  2IA2 A;  4HZF A;  3TDU C;  1I6X A;  1XGO A;  3PFI A;  1P2F A;  3U1D A;  2O3F A;  4L9V A;  2STT A;  3WTS C;  2IP2 A;  1QZY A;  2HTJ A;  5DCF A;  3DFG A;  2DO7 A;  4WK8 F;  5LGN A;  4YFX F;  1R1V A;  2ZME A;  3F8N A;  2JPB A;  4I0A A;  3HTU A;  3VB2 A;  1LDD A;  5FLX K;  2QWW A;  4L5I A;  4YIF A;  4A6E A;  4EJW A;  2F5F A;  1T39 A;  4HV6 A;  4M9Z A;  4O3M A;  3QP5 A;  3EDP A;  4HDU A;  1ZLK A;  2ZFW A;  1K78 A;  2M87 A;  2JT1 A;  2YU3 A;  4HQE A;  1O3Q A;  3HRU A;  2FNP A;  4TV7 A;  4HOB A;  3BDD A;  2H6B A;  1WQ2 A;  1T38 A;  4GXO A;  4N9H A;  2LKP A;  2Z9O A;  2RC4 A;  3DF8 A;  4RAZ A;  2L01 A;  3I59 A;  4CXF A;  2IVM A;  2RKH A;  2HOE A;  1FOK A;  1LQ1 A;  1ZRF A;  2Q0O A;  2GXG A;  5FD6 A;  4IRG A;  5FLX Z;  2XUB A;  3IHU A;  1J2X A;  1D3Y A;  1TBX A;  3M9A A;  5L3C A;  2W57 A;  1MDM B;  2VXZ A;  1YW8 A;  5LBQ A;  4RAY A;  3V7C A;  1P92 A;  2KIU A;  2PG4 A;  2AXL A;  2QQA A;  5IT9 Z;  3HSF A;  4CDG A;  3HRT A;  4LG0 B;  3T8R A;  4IVN A;  1WKM A;  4P5O A;  4HF1 A;  4YFK F;  3BJA A;  1W4M A;  2ISY A;  2XVC A;  2HQN A;  3C7J A;  3KCC A;  5J8F A;  1UCR A;  5CVR A;  1LDJ A;  3MZH A;  4A0X A;  3ML6 A;  2XRN A;  3F8F A;  4DNC A;  3R60 A;  3WTU C;  4HLX A;  1FX7 A;  1V4R A;  3KZY A;  3K9T A;  5DCM A;  4EJV A;  1ZG3 A;  3R4K A;  3FM3 A;  5E17 F;  5D6E A;  5LHI A;  2P6T A;  3F8M A;  3RPU A;  1R1U A;  3I64 A;  2CYY A;  1TQM A;  4EVI A;  1I1G A;  3GZ5 A;  3E5U A;  2HDC A;  2O0Y A;  4A0Y A;  4L0Y B;  1R23 A;  4Q5S F;  3VEP A;  1ZG5 A;  1HKS A;  1KU2 A;  5BPI A;  4PGG A;  3HOT A;  4HW0 A;  3KP4 A;  2F5C A;  1R00 A;  1BBY A;  4ZYH A;  4BH9 A;  1F1Z A;  5K5O A;  2O61 A;  1XGS A;  4ZH4 F;  4F7Z A;  5CVI A;  2OU2 A;  3GFJ A;  4LD5 A;  1XGM A;  2V1U A;  2RNJ A;  2JSC A;  2CGP A;  3D5L A;  1BN5 A;  3ULQ B;  5J6X A;  3T1B A;  4G8X A;  4UV8 A;  1PUE E;  2UWM A;  4UVC A;  3WGH A;  4GO1 A;  1QO0 D;  2KIF A;  3L9F A;  2ZBK A;  3K2Z A;  2GXB A;  3BOQ A;  4HAM A;  5A2Q Z;  3NRV A;  3MEX A;  1FPQ A;  5HS7 A;  3FXR A;  4Q47 A;  4UUV A;  1S7O A;  2R7F A;  1LEB A;  2HWV A;  3DPL C;  3HIF A;  2MC3 A;  3R0A A;  1K6O A;  1OYW A;  2JTV A;  3FMS A;  5FO5 A;  4EJU A;  1S3J A;  3KE2 A;  3O6B B;  2FA5 A;  1ZH5 A;  3DXJ F;  5H6R A;  3L7W A;  4LFU A;  2CWE A;  1D8J A;  4XBF A;  1IXC A;  3IRQ A;  3ZPL A;  3J81 K;  2A68 F;  1T2K A;  2H09 A;  4HYE A;  3N97 A;  5AON A;  4YG2 F;  4MQV A;  5FB2 A;  3IWZ A;  3ZN0 A;  1FC3 A;  2VBY A;  4KN7 X;  5DD8 A;  3H3Z A;  4I09 A;  1L3L A;  2P4W A;  2QLZ A;  4EM1 A;  1RNL A;  2XAG A;  4KIB A;  5AIQ A;  1Z05 A;  4D0P A;  1MJB A;  4A2U A;  4ESJ A;  5BS6 A;  3SQN A;  3LA3 A;  4M74 A;  3RIR A;  3JTG A;  3H3U A;  4HX7 A;  4KT5 C;  3KP5 A;  4OOI A;  2CQK A;  2VON A;  5BQT A;  3GFM A;  4ASN A;  1BIB A;  3P7N A;  3LAP A;  2XAH A;  2FSW A;  2YX4 A;  3KZZ A;  1XMK A;  3RYP A;  1IN4 A;  3K1N A;  1RUO A;  2ZME B;  4DQ2 A;  5D5W B;  3KEO A;  2BGC A;  4RGX A;  4OIP F;  1MGT A;  3HOS A;  2PBI A;  1W5S A;  3EYI A;  4HX8 A;  5D5V B;  3SZP A;  2BYV E;  4ENK A;  4ZYG A;  4L9N A;  2ZNZ A;  4MTD A;  1H9T A;  3G3Z A;  4PGH A;  4BHC A;  3ZMU A;  1BM9 A;  2QYO A;  2RDP A;  2P5L C;  2HFH A;  4KMF A;  4EM0 B;  3WG9 A;  2ZO4 A;  1IN8 A;  3ZP5 A;  3IL2 A;  3LAJ A;  4CHU A;  5FFX A;  3O3K A;  1PP7 U;  1BI0 A;  4LLL A;  2L3D A;  3F6V A;  4OIR F;  4L18 B;  1XB4 A;  1PDN C;  4AIK A;  1U6G A;  5L3F A;  1BC7 C;  2XGX A;  2CO5 A;  3LA7 A;  1F9N A;  2STW A;  2KRF A;  3E6C C;  2G9W A;  2NAZ A;  3CLO A;  5ILS A;  1YLF A;  1D8K A;  5K1Y A;  1XMA A;  1YYV A;  1EV7 A;  5L3D A;  4EV0 A;  5D4S A;  3U2R A;  3GZ6 A;  4WCG A;  5DUI A;  2ZKZ A;  2WWY A;  2A3S A;  2HGC A;  4IXA A;  2RVC A;  1UFM A;  4EGY A;  1T98 A;  4JQF A;  4PDK A;  5ICF A;  4FHT A;  3PQK A;  3T8T A;  1J75 A;  2KJC A;  3TQN A;  3CO6 C;  2EB7 A;  2EFN A;  5DEQ A;  3GX4 X;  4IF4 A;  2D1V A;  2MLG A;  3FWE A;  2DW4 A;  5DUK A;  3LQQ A;  4GGG A;  1Z6R A;  2DAO A;  2E1N A;  1TLH B;  3CJN A;  1ON2 A;  4RB3 C;  3OOP A;  5ICG A;  6PAX A;  4KYW A;  2A6H F;  3MFK A;  3BJ6 A;  4A5M A;  3T0Y A;  2PMH A;  4WXC A;  2VT3 A;  3IWF A;  1I27 A;  1OYI A;  2OZ6 A;  3GO5 A;  2LDU A;  5CLS A;  2ETH A;  3L2C A;  1U78 A;  1IN6 A;  3JAM Z;  4G7H F;  5E20 A;  3K0L A;  3JSO A;  2IA0 A;  4L9T A;  3ZMT A;  2FE3 A;  1CF7 B;  2EA4 A;  2Z33 A;  4EJT A;  3REO A;  1H0M A;  5TRD A;  2DQR A;  2GWR A;  2UXN A;  1XCB A;  2XAS A;  1L0O C;  4HQM A;  2FU4 A;  2P6S A;  3HRS A;  4GYI A;  1ZGJ A;  4CO8 A;  3FMR A;  4LJZ F;  4LLN A;  3CDH A;  3QPT A;  1OYY A;  4CIC A;  1MD0 A;  2DBB A;  2Y75 A;  3K1M A;  1MDM A;  2FNA A;  1FYM A;  2HS5 A;  3BPV A;  1J9I A;  4FX0 A;  3WTY C;  1ONV A;  3NQO A;  3C3W A;  3SZT A;  1U5T C;  3F8C A;  2BV6 A;  3GFI A;  2K4J A;  3M8F A;  1KQ0 A;  4LLG F;  4BHB A;  3RJP A;  2F2E A;  1ZAO A;  4BYY A;  1YW7 A;  3S2W A;  2E7X A;  1IUY A;  2PMU A;  4EQQ A;  3TOB A;  2VBW A;  2PFB A;  5FD5 A;  1MJA A;  2TDX A;  3RKX A;  3WU1 B;  5EEH A;  2PQ8 A;  1IN5 A;  2DU9 A;  3LST A;  2VE8 A;  4AVP A;  3VFZ A;  4OMY A;  2NS0 A;  4L0Z B;  2M30 A;  4ESB A;  5CYV A;  5BMZ A;  1KYW A;  5BPD A;  1R1T A;  3EET A;  1KGS A;  1O3R A;  3DPT A;  5JHU A;  4AIH A;  1JXS A;  5LEJ A;  2P5K A;  2L02 A;  2FMY A;  3ZQ7 A;  2EFP A;  4M6Y A;  2V1D A;  3IC7 A;  2GIV A;  4OU0 A;  5CVJ A;  1IF1 A;  4KIG A;  3I58 A;  5HS8 A;  4I2O A;  4ETS A;  2L4A A;  3E97 A;  1SD4 A;  2ACJ A;  4O5V A;  3TGN A;  5HOO A;  5A2Q K;  1HW1 A;  3FXQ A;  2A61 A;  1W5T A;  2EK5 A;  2M8E A;  1QGP A;  2LF7 A;  3HYI A;  1XGN A;  2DK5 A;  5AIP A;  5E18 F;  5LGU A;  1Z91 A;  2FBI A;  2P7C B;  2NYX A;  2JRT A;  5J8C A;  2EV5 A;  2VOD A;  1HBX G;  4WXH A;  2E7W A;  3BZ6 A;  3JSP A;  1YS7 A;  2WC2 A;  3WU0 A;  1HW5 A;  3M1E A;  3V7R A;  3F21 A;  4MEY F;  1BC8 C;  3QRF F;  1O7F A;  3FM5 A;  1YW9 A;  1H9G A;  1ZLJ A;  3BWG A;  4OMZ A;  1RZ4 A;  2CFX A;  2ZJ2 A;  1FZP B;  5ED4 A;  1ZN2 A;  2XV4 S;  1USS A;  1K79 A;  1S6L A;  5DCM B;  1U3E M;  2Q2E A;  2W85 A;  1S7A A;  3I71 A;  4L9J A;  4G6D A;  4M9S A;  2QQB A;  1FT9 A;  5F1R A;  3EQL F;  2A5Y B;  3RKW A;  5HDN A;  2W84 A;  1KU7 A;  1GHC A;  2COM A;  3BPX A;  1FSE A;  3MAJ A;  4BQA A;  1WRJ A;  3DP7 A;  4N0B A;  5E1X A;  3M7G A;  2QBY B;  5E8I A;  3E5X A;  4LGW A;  3FF5 A;  1OMI A;  4XLP F;  1FWZ A;  4LB6 B;  3TO9 A;  2UZK A;  1DPR A;  5D5X B;  3RDI A;  3CUQ A;  3TO6 A;  2L54 A;  3I59 B;  1JGS A;  2EFQ A;  2QZ8 A;  5CVV A;  4ENJ A;  1B9M A;  1K7A A;  2OZU A;  1DDN A;  5LHG A;  1UHM A;  1BI1 A;  1G3Y A;  1KU9 A;  4E70 A;  2E1C A;  3NEU A;  1YO5 C;  4CZZ A;  2YR2 A;  1HSJ A;  3L00 A;  4QWQ A;  3KP6 A;  5LGT A;  1BOA A;  2IJL A;  3BY6 A;  1RIO H;  4WWC A;  5KVR A;  2QVO A;  2AS5 F;  3WE2 A;  3CTA A;  2EFO A;  4ENN A;  5LHH A;  4U7B A;  2FEZ A;  4AD9 A;  3J7A O;  2MH2 A;  2HYF A;  1FYK A;  5CJ9 A;  5DV5 A;  1G3T A;  1SD6 A;  1EH8 A;  3GUD A;  4MGR A;  4NHJ A;  3ZMS A;  1P4W A;  3SHF A;  4LK1 F;  2A69 F;  3I5U A;  1E2X A;  1MZB A;  1R5H A;  4UHT A;  4ESF A;  3MCZ A;  4R79 A;  4KN4 X;  1WI9 A;  4NB5 A;  2HKX A;  3RTR A;  2VE9 A;  1B4A A;  1V3F A;  3V8K A;  1DPU A;  5FGM A;  2YSR A;  3D0S A;  3GEZ A;  2X0L A;  1X3U A;  4JK1 X;  4S05 A;  4M73 A;  4IJA A;  2HYG D;  4S04 A;  2J5P A;  1XSX A;  1R7J A;  2NRA C;  1Z1D A;  1FP2 A;  4YFN F;  1J7K A;  1IZ1 A;  2FXA A;  4U0W A;  2GAU A;  4U0Y A;  1GXQ A;  4GYG A;  3GF2 A;  2K4B A;  4A0Z A;  2ISZ A;  3HTS B;  1YS6 A;  1SAX A;  2FRH A;  4EGZ A;  1YFH A;  1W7P D;  4RB0 A;  3WTW C;  2XKP A;  4MEX F;  3EUH A;  1U8R A;  3H92 A;  4UVA A;  1T6S A;  4M6X A;  2B0L A;  2JPC A;  3KEQ A;  2GA2 A;  5HS9 A;  4WXD A;  4AIJ A;  1F5T A;  2GZW A;  2RV8 A;  2Y48 A;  1XD7 A;  4XLN F;  1ZAR A;  4IRI A;  5ICE A;  1HKT A;  2H6C A;  5HDK A;  1KU3 A;  2RN7 A;  1SMT A;  1K78 B;  1TW3 A;  2V1X A;  3JW4 A;  1IXR C;  4OIN F;  2QBY A;  2BEO A;  3PQJ A;  5K5R A;  5L3E A;  4O6J A;  1J5Y A;  3WTT C;  1BI3 A;  2DPD A;  1DP7 P;  2IPQ X;  3KP2 A;  2YX7 A;  2OBP A;  4GCV A;  3GWZ A;  4LB5 A;  3P9I A;  2IW5 A;  3KLO A;  4MTE A;  1ZYR F;  5LEK A;  2VOP A;  2R7D A;  2CW0 F;  1CGP A;  3SFZ A;  1SMY F;  5F6F A;  1ON1 A;  5D6F A;  4A12 A;  1FBS A;  4CYD A;  1BJA A;  2V6C A;  5D8K B;  2EWN A;  2OD5 A;  2EA2 A;  4U88 A;  2LNB A;  3HHH A;  2HEO A;  4KUM A;  4KA4 A;  3WTX C;  4G6Q A;  2FML A;  1O57 A;  4HBL A;  2HKO A;  1RI7 A;  1IW7 F;  1XSD A;  1YQA A;  4G7Z F;  4XSX F;  3P9C A;  2OA4 A;  2LF8 A;  4KNY A;  2QQ9 A;  3WGI A;  1WWX A;  2GQQ A;  2P5V A;  2QUF A;  4IRH A;  4I98 B;  2LSO A;  1TQI A;  4KFC A;  2PN6 A;  5LLQ A;  5LRS A;  3VOD A;  3ZN1 A;  2K27 A;  1W7P B;  2D1H A;  4ON0 A;  3F23 A;  4A5N A;  1QBJ A;  3RPQ A;  2VOO A;  4HLY A;  1QZZ A;  5H6Q A;  1J0R A;  5H20 A;  3V8J A;  4MNU A;  5ILU A;  2L4M A;  4BAY A;  4MQ9 F;  1VTN C;  2VC1 A;  5D8L B;  3FXU A;  4WX9 A;  3N4M A;  1YG2 A;  5DYM A;  4KIF A;  3KP3 A;  3IKT A;  4KDP A;  1JHH A;  3CUQ C;  4A6D A;  1XN7 A;  5ILV A;  3ABU A;  1TTY A;  3LA2 A;  4BNC A;  4RB2 C;  2BE5 F;  3ECO A;  2OAZ A;  1LJ9 A;  4IPA A;  3DV8 A;  3ECH A;  3RI4 A;  3U9G A;  3ELK A;  1IRF A;  2M1B A;  1ZRD A;  2W25 A;  2HR3 A;  3DKW A;  1A04 A;  3HSR A;  2RQP A;  5D5U B;  3C18 A;  2H94 A;  2XAF A;  1KQ9 A;  1IN7 A;  2MD5 A;  4HDV A;  4HV5 A;  3CUQ B;  5HVQ C;  3GFL A;  1HST A;  4HX4 A;  2Z3Y A;  4RB1 A;  5DD4 A;  3Q9V A;  4ENM A;  2O03 A;  4HF0 A;  4Y15 A;  3BJO A;  3KFW X;  1U5T A;  3EYY A;  1FNN A;  2Z99 A;  2QEN A;  1T0F A;  2XAJ A;  3TO7 A;  3VOE A;  4P55 A;  1FBU A;  4Z2Y A;  1TW2 A;  4BHP A;  3FX3 A;  1YTY A;  5IT3 A;  1G4D A;  4G9Y A;  1TQP A;  1B59 A;  1TNT A;  3E3V A;  1Y0U A;  1FLI A;  1SFU A;  1FSH A;  2UXX A;  1ODD A;  2KIM A;  4CGZ A;  1FBQ A;  1ZHF A;  4ZZL A;  2DPU A;  1YIO A;  3GW2 A;  2VT2 A;  2EJR A;  1HW2 A;  5LRR A;  2F5E A;  1GVJ A;  4LK0 F;  4UXN A;  2HZT A;  3ROU A;  1STZ A;  3KET A;  5JVT A;  1REP C;  3R61 A;  2VBZ A;  3BP8 A;  5TJJ A;  4BXU A;  2K7L A;  4XRF A;  5DDG A;  2EFW A;  2Y0M A;  5HLI A;  5EEG A;  3HSE A;  1E17 A;  2O8X A;  4YII A;  4KMU X;  3QAH A;  3BRO A;  3LFK A;  1I1S A;  4HA8 A;  3J80 K;  1LNW A;  4PZJ A;  2F5D A;  2NNN A;  4HF2 A;  1KQ8 A; 
#chains in the Genus database with same CATH topology
 2OV7 A;  2D5V A;  5B3S H;  4EM2 A;  2MBF A;  3IKV A;  5D4R A;  4Y13 A;  2HQR A;  2A07 F;  2MYS A;  3M3Y J;  3BG6 A;  2C6Y A;  5J40 A;  2DLL A;  2V79 A;  4X6A J;  2EIL H;  2KKO A;  3E6M A;  2L9V A;  4HSR A;  3MZY A;  3F8B A;  4Y33 A;  1WH7 A;  4LMY A;  5EDN A;  2MLK A;  1NHA A;  5ICC A;  3WTV C;  2IS6 A;  1SFE A;  3H5R A;  2MSY A;  3WOD F;  3L2R A;  2XPU A;  2JZY A;  2LR8 A;  3CJQ B;  3OSG A;  2H27 A;  4A3J J;  3BR6 A;  1TNS A;  3BTC A;  2CJJ A;  1Z6T A;  4BBS J;  3GVA A;  1K4T A;  5J4V A;  4C2T A;  2GA1 A;  1UST A;  4P9F A;  1DP3 A;  1PP8 F;  2IGK A;  1JJ8 C;  3VYR B;  3MWM A;  4DJA A;  3G6E I;  5IT9 K;  1JHF A;  2RRE A;  3F72 A;  2FOK A;  3KLN A;  4IHY A;  1OCO H;  1GLN A;  3JCU C;  2DOD A;  2VKV A;  3HRM A;  2DI3 A;  2J5O A;  1U5T B;  1VQK I;  3DQV C;  1A35 A;  1H89 C;  3E6D A;  1QQI A;  1LE8 A;  2D45 A;  2CUJ A;  5F64 A;  2NNY A;  1JKO C;  3UNG C;  1QPM A;  1EH7 A;  3RQI A;  2R7Q A;  3Q0W A;  4CCO A;  4Q4Z F;  1C0W A;  4B43 A;  1ZGA A;  2XIG A;  1ETO A;  2QKL B;  5EG0 A;  4D1Q A;  5ERI A;  3J80 Z;  1LVA A;  1YIJ I;  3FHZ A;  2H1L A;  2VC0 A;  1QHG A;  2DJI A;  1XMX A;  4ZZD A;  3GME A;  4IHT A;  3H5N A;  1G3S A;  1E3O C;  5GAD J;  3GXO A;  1ZRC A;  2IXS A;  2IGO A;  2BBY A;  2FBH A;  4CZC A;  4RGS A;  3C1D A;  3AFH A;  5KK1 A;  2CW8 A;  4RGU A;  3WTZ A;  5E1W A;  1LPQ A;  3B73 A;  1R22 A;  4LG0 A;  4AVZ A;  2PJP A;  3V4G A;  5FKN A;  1Q1H A;  1KYZ A;  3HUG A;  4NBQ A;  3RSN A;  1Z7U A;  3QU3 A;  4N9I A;  1B6A A;  4RAF A;  3K10 A;  1RUN A;  2W00 A;  5JLW A;  2Q8K A;  1IAW A;  2M4K A;  1O3S A;  4XMY A;  4AU7 A;  3BLY A;  4I01 A;  1B8I B;  1B1B A;  2AQF A;  3WGG A;  2DFE A;  2PEX A;  3ISP A;  1FYL A;  2B63 J;  2V9V A;  3KX2 A;  3I53 A;  2QEX I;  4XID A;  1H8A C;  3FBN B;  3EUA A;  1R36 A;  2M7B A;  3OYA A;  3CO7 C;  3EPZ A;  4XLC A;  3K4N A;  1DU0 A;  5TIS C;  3ZQQ A;  3TKY A;  1WI3 A;  3F22 A;  2Z5U A;  1XDS A;  4PJJ A;  4I0B A;  3QU6 A;  1G3W A;  1S8N A;  2WTE A;  5E1Z B;  3J7A Y;  1VZ0 A;  4C3I J;  2K86 A;  2XAQ A;  3R6S A;  1RKW A;  3K6G A;  1S29 A;  2P8T A;  4BQN A;  2W1O A;  3QOP A;  4PUS A;  2QSH X;  4KIC A;  3Q5F A;  3HG9 A;  4P9U A;  4ZYE A;  3RKY A;  3CCM I;  5IOY A;  2DT5 A;  2ESN A;  5GPA A;  3W6K B;  1LDK B;  3DTK A;  3ZMV A;  4NUB A;  2CU7 A;  1DUX C;  3CP8 A;  2MA3 A;  2HVQ A;  2LKX A;  1F4K A;  4BY7 J;  3P9K A;  3TP0 A;  1Z7L A;  3KP7 A;  5HDG A;  3GTM J;  3FZV A;  1D5V A;  4F55 A;  1VQP I;  2ELH A;  2Y0S A;  4R8H A;  2ZXJ A;  1IG7 A;  2BW3 A;  2FF4 A;  4P96 A;  2QM3 A;  1IRG A;  3MQ0 A;  4N4O B;  3IRR A;  3GTL J;  3RKQ A;  3I0T A;  3V8L A;  4QLC U;  1N25 A;  5JI6 A;  3K69 A;  2IRF G;  2PLY A;  1X1P A;  1Z9C A;  2OTL I;  2HTS A;  3JRF A;  1SFX A;  2K9Q A;  2GM4 A;  2XB0 X;  4M3D A;  1SD5 A;  1MNE A;  2JJ7 A;  2OQR A;  2LP0 A;  4XOR A;  1HKQ A;  5C44 J;  4NC6 A;  4XOT A;  3LSH A;  2LY2 A;  3E5Q A;  1G6N A;  1XSV A;  1VQL I;  3W6J B;  2YUS A;  3F3X A;  1IV8 A;  2DK8 A;  1LEA A;  2B9S A;  3CF2 A;  5L3G A;  2A6E F;  3DKY A;  3ZRG A;  1Y39 A;  1FP1 D;  5FRO A;  2XKO A;  3BTI A;  1PVE A;  2X6X A;  1EJ9 A;  1U2W A;  4G12 A;  1P4A A;  1WSU A;  4UVB A;  5CVU A;  3HGY A;  2DT7 B;  1TWA J;  2VN2 A;  4H0E A;  2X6O A;  5FRM A;  4P1W A;  3QP6 A;  2X85 A;  1FOW A;  1R58 A;  4FAS D;  2D2W A;  1HXD A;  4EMS A;  2WV0 A;  3A01 A;  2R4G A;  1ENH A;  4LOC A;  1UB9 A;  2ECC A;  1NK3 P;  5BOX A;  3G73 A;  3OV8 A;  1X3W B;  3OMY A;  3AG3 H;  1AU7 A;  3TOA A;  3R0J A;  3J81 Z;  3FMQ A;  3DBL B;  1RC9 A;  5E3L A;  4Q48 A;  5HLG A;  1O4X A;  2YPR A;  4BE1 A;  3WE3 A;  2DQL A;  4CYC A;  1TWG J;  3ZXS A;  3G1O A;  5EGO B;  2JA2 A;  2XHK A;  4Y17 A;  4UV9 A;  1O7L A;  5F27 A;  4PJM A;  2ZCW A;  2FUG 2;  3GLX A;  2ZNY A;  3PO3 J;  4PSX A;  1LFP A;  3L09 A;  3PJR A;  4E6K G;  4BDZ A;  4FT8 A;  1SD7 A;  3KZI C;  3V7S A;  1B9N A;  4G7O F;  3Q0U A;  3GTO J;  4M71 A;  3QPH A;  2LD5 A;  2HOA A;  2EZL A;  1ZRE A;  4ZDP A;  4XSZ F;  3COA C;  2IA1 A;  3AG1 H;  5JFR A;  4OIO F;  1KA8 A;  2MH9 A;  2VJI A;  3ZMZ A;  2DYS H;  3SZG A;  2A6T A;  5K5Q A;  1FTZ A;  2XRO A;  3LWF A;  3FK7 A;  4EJO A;  4NQW A;  5L3B A;  3Q3S A;  3BT9 A;  3JTH A;  1W7P A;  3M8E A;  2DTR A;  2IT0 A;  3LQR A;  1DQU A;  4OAZ A;  4I7H A;  5KHD A;  4ZYD A;  3HM5 A;  1YIT I;  1JE8 A;  2R7T A;  1AOY A;  2HVS A;  4LIU A;  2RGV A;  3JRI A;  1J59 A;  4IHS A;  2CG4 A;  3F6O A;  5E8G A;  2ESH A;  2G7H A;  1IO2 A;  2EV0 A;  3DEU A;  4D9J A;  3ZMD A;  4L5J A;  4UNO A;  2OQG A;  4K2E A;  4RGR A;  3S1Q J;  4NNJ A;  2IS1 A;  1OKR A;  3LFU A;  4ITV A;  5FKK A;  3GYH X;  5HLH A;  1EH6 A;  2O6G E;  1RRJ A;  2QGU A;  2G7U A;  4CSW A;  2HI3 A;  3T5X A;  4G94 A;  4C9Y A;  1FY7 A;  1ULY A;  3K1P A;  1AWC A;  4X1E A;  1P6R A;  2W24 A;  4C2M J;  2O7O A;  3I54 A;  4Y3O A;  1R5G A;  3I4P A;  4AWX B;  1MKM A;  1GXP A;  4OIQ F;  3G71 I;  1S5L C;  1ETW A;  2AO9 A;  2KJB A;  2NOG A;  2DFI A;  1W36 C;  4RS8 A;  3A0H C;  5GP9 A;  4WF2 A;  3Q9S A;  4M72 A;  5IY5 H;  1MND A;  2LVS A;  2R93 J;  3IH3 A;  1X19 A;  3O2P E;  2GOX B;  1LVK A;  2VQH A;  2ZME C;  3OOU A;  4R1H A;  4RLQ A;  1BIA A;  4MIM A;  5FFZ A;  1QNT A;  1R4N B;  3BTJ A;  1ZG1 A;  1XCV A;  1GUU A;  3JAM K;  4MHG A;  3ABT A;  4I02 A;  1UHW A;  3AAF A;  1MJ9 A;  4FX4 A;  4Y52 J;  4PCQ A;  4U0V A;  3HOY J;  5JR3 A;  3E6B A;  2M5W A;  1CF7 A;  2P7V B;  4E7H A;  2M45 A;  1LB2 A;  2R3S A;  3B02 A;  5C3E J;  4B09 A;  1U0J A;  1I3Q J;  1OR7 A;  4DZJ A;  1BI2 A;  1I5Z A;  3FDY A;  1O3T A;  2ADU A;  3ERE D;  1OPC A;  2PI0 A;  3GCM A;  3MKY B;  3LMM A;  2FBK A;  3FK6 A;  3SXY A;  3HHG A;  3FIS A;  2K02 A;  3OYC A;  1IXS B;  3E1S A;  1HQC A;  4MFE A;  4B8X A;  4M9X A;  2VBX A;  4H4K C;  3W2V A;  3TDZ C;  4M3G A;  3TMO A;  3K2A A;  3CUO A;  1P4X A;  2LRE A;  1BW6 A;  2XGE A;  2AXT C;  1HA8 A;  4JBA A;  2X4H A;  4U7D A;  1T33 A;  2FQ3 A;  1XDU A;  1I50 J;  2WBM A;  3RYR A;  2EV6 A;  3JR9 A;  3OYD A;  2CSO A;  2IA2 A;  4HZF A;  3PIP F;  3TDU C;  1JUM A;  1I6X A;  1X1D A;  2A05 A;  1XGO A;  3SFI A;  3PFI A;  1P2F A;  4IOC F;  2DDA A;  3U1D A;  5FRN A;  2O3F A;  2BZT A;  4L9V A;  2STT A;  3WTS C;  1GV2 A;  2IP2 A;  1QZY A;  2HTJ A;  5DCF A;  4EEF G;  5GPC A;  2O5R A;  1YOV B;  2UV1 A;  3DFG A;  2E36 A;  3OYK A;  2DO7 A;  5JVG F;  1JJ6 C;  4WK8 F;  5LGN A;  1SEU A;  4YFX F;  2KZV A;  5EG0 B;  1R1V A;  2ZME A;  2FX0 A;  3F8N A;  2JPB A;  4I0A A;  5J1R A;  3HTU A;  3VB2 A;  1P7I A;  1LDD A;  1ORK A;  4XL9 A;  4W97 A;  1TWC J;  3S17 J;  5FLX K;  2QWW A;  4L5I A;  4YIF A;  3LSG A;  4A6E A;  5EF6 A;  3A01 B;  1M1E B;  4HNT A;  4EJW A;  4BJT A;  4CCK A;  3LSP A;  3D5S C;  3CCJ I;  1EA3 A;  2BY1 A;  2F5F A;  4HV6 A;  1T39 A;  4M9Z A;  4O3M A;  3QP5 A;  5C4J J;  2XC7 A;  3D5R C;  3EDP A;  4HDU A;  1ZLK A;  2ZFW A;  2V1N A;  4BQO A;  3LOC A;  1K78 A;  2M87 A;  1ACI A;  2JT1 A;  2YU3 A;  2GXA A;  2NS7 A;  3JRG A;  4HQE A;  1O3Q A;  3HRU A;  2FNP A;  4TV7 A;  4ZTF A;  4FIS A;  1Z67 A;  4HOB A;  3BDD A;  3G2B A;  3DCF A;  2H6B A;  1JUP A;  3S93 A;  1A31 A;  1TWF J;  2F4O B;  3A4C A;  1WJB A;  1WQ2 A;  2MG4 A;  3H0D A;  2VKH A;  1T38 A;  4UY8 I;  4GXO A;  5DTD A;  1BL0 A;  1EKE A;  3CP2 A;  4N9H A;  2E2I J;  2IEK A;  1D1A A;  4XKC A;  5E3M A;  2LKP A;  5IP7 J;  2Z9O A;  1LFB A;  2RC4 A;  3DF8 A;  4RAZ A;  2L01 A;  4HST A;  3I59 A;  4CXF A;  2HOT A;  2IVM A;  2RKH A;  3I56 I;  5CPR B;  3VYT B;  3HL2 A;  3K70 D;  3S3O A;  2HOE A;  3TBI A;  2R0Q C;  1YJ9 I;  4A3M J;  1FOK A;  1LQ1 A;  5B1A H;  1ZRF A;  3QWL A;  4JX6 A;  3V42 A;  3BR0 A;  3SJM A;  1T0F C;  2Q0O A;  3J7Z I;  3OYJ A;  4E7L A;  1JKP C;  2GXG A;  5FD6 A;  4IRG A;  5FLX Z;  4OAY A;  5E79 C;  2XUB A;  1AA7 A;  3IHU A;  1R49 A;  1J2X A;  1D3Y A;  1TBX A;  3M9A A;  5L3C A;  2W57 A;  2E35 A;  1WH5 A;  5GAE J;  1MDM B;  3SYT A;  5M5W J;  2VXZ A;  3J7Y J;  1FEX A;  1JT0 A;  1YW8 A;  2E1M B;  5LBQ A;  4RAY A;  3CME I;  3MN2 A;  1RR8 C;  1CQT A;  1UJ8 A;  2XAU A;  3V7C A;  1P92 A;  4NDL A;  2KIU A;  2PG4 A;  5LD2 C;  2L7F P;  1YJW I;  2AXL A;  2QQA A;  4AYB A;  3HSF A;  2CV1 A;  5IT9 Z;  4CDG A;  4PFP A;  5GTH C;  3L1P A;  3QYE A;  4PJN A;  3HRT A;  4MFD A;  2JA8 J;  1OLT A;  2JRM A;  1IRZ A;  4LG0 B;  3I4N J;  3T8R A;  3OWT A;  3H9J A;  4IVN A;  4V2F A;  4DBR A;  1JKR C;  3HJE A;  4HNV A;  1WKM A;  3S1N J;  4P5O A;  4HF1 A;  4YFK F;  3BJA A;  2CUE A;  1BOB A;  3O8H A;  1W4M A;  2ISY A;  2XVC A;  3ZQG A;  1A36 A;  2HQN A;  3VYU B;  3C7J A;  3OYN A;  3VSL A;  3KCC A;  4F93 B;  1T56 A;  5J8F A;  1UCR A;  5CVR A;  2JA6 J;  5IOZ A;  4E7K A;  1LDJ A;  3OY9 A;  3MZH A;  4A0X A;  4A69 C;  3ML6 A;  2XRN A;  3QYF A;  1VQ4 I;  2R7Z J;  3F8F A;  3CCL I;  4DNC A;  3R60 A;  1Z3Y A;  4M3B A;  1QRY A;  3WTU C;  1APL C;  5HNH A;  1X1A A;  4HLX A;  3HGG A;  2V9K A;  3CC2 I;  3ABM H;  2L2O A;  2DMU A;  1FX7 A;  3DU6 A;  1V4R A;  3H35 A;  3KZY A;  4FE4 A;  5M5Y J;  3K9T A;  1NK2 P;  5DCM A;  4EJV A;  2WA0 A;  1HLV A;  1UZC A;  1ZG3 A;  2ID3 A;  3FM3 A;  3R4K A;  5K7Z A;  5E17 F;  5D6E A;  3C2H A;  1PUF A;  5LHI A;  2P6T A;  1BW5 A;  3F8M A;  3RPU A;  1R1U A;  1WJF A;  2CYY A;  3I64 A;  3OIO A;  3ZQH A;  1TQM A;  4EVI A;  1I1G A;  3GZ5 A;  3E5U A;  5EJC A;  4A3E J;  2QKM B;  2HDC A;  4HRI A;  2O0Y A;  1QVU A;  4A0Y A;  4L0Y B;  5M3F J;  3IUO A;  5IP6 A;  1MMD A;  1R23 A;  4Y4R A;  5KNL A;  4Q5S F;  2LYC A;  3K4L A;  3VEP A;  2VLA A;  1ZG5 A;  1HKS A;  1FMV A;  2I8D A;  3K4K A;  4LIT A;  1DU6 A;  2B7E A;  2V26 A;  1KU2 A;  5EEA A;  4BE2 A;  5FJ8 J;  4V19 K;  5BPI A;  4PGG A;  3HOT A;  2DMQ A;  4HW0 A;  4A3C J;  3A02 A;  3KP4 A;  1XPX A;  1YX3 A;  4C30 A;  3VWB A;  3H3V K;  1Z21 A;  4IX7 A;  2M34 A;  3PO2 J;  1QPI A;  1JTY A;  2M7A A;  1Y8Q B;  2F5C A;  1R00 A;  2DN0 A;  1BBY A;  4ZYH A;  4BH9 A;  3IH2 A;  3W6V A;  2LK2 A;  2PMZ A;  3S2H J;  1F1Z A;  1MBH A;  5K5O A;  2O61 A;  1XGS A;  4ZH4 F;  4F7Z A;  5CVI A;  3DLL F;  2OU2 A;  3GFJ A;  4LD5 A;  2HNH A;  1XGM A;  4CCM A;  3EUK L;  2V1U A;  3PL8 A;  2P0W A;  2RNJ A;  2JSC A;  2CGP A;  2E60 A;  3D5L A;  1BN5 A;  1IDZ A;  3ULQ B;  5J6X A;  4RLF A;  3T1B A;  2R7R A;  3DBH B;  4G8X A;  4DYC A;  4UV8 A;  3ZQF A;  1KZH A;  1PUE E;  1MMG A;  2UWM A;  5KAI C;  2H8R A;  4UVC A;  3WGH A;  1YX5 A;  2CS3 A;  2WAF A;  2E71 A;  4GO1 A;  1HOM A;  1QO0 D;  4D5C A;  2KIF A;  3L9F A;  4BAC A;  2V4J C;  2ZBK A;  4IO9 F;  3K2Z A;  2GXB A;  1ETK A;  3BOQ A;  4HAM A;  4F92 B;  5A2Q Z;  1VND A;  3NRV A;  2X1E A;  3MEX A;  1FPQ A;  5HS7 A;  2IS4 A;  3HZJ A;  3FXR A;  4Q47 A;  3HOV J;  4FTH A;  4UUV A;  2Y69 H;  3OS1 A;  3F0C A;  1V55 H;  1TT5 B;  1S7O A;  2R7U A;  3WHC A;  2R7F A;  1LEB A;  2HWV A;  3DPL C;  3HIF A;  1MBK A;  2MC3 A;  2IAI A;  4CCN A;  3JRB A;  1J09 A;  3R0A A;  1K6O A;  2X6Y A;  1OYW A;  2JTV A;  3FMS A;  2GLO A;  5FO5 A;  4EJU A;  1S3J A;  3H9Q A;  3KE2 A;  3O6B B;  1KON A;  2FA5 A;  3FKJ A;  1NG7 A;  1ZH5 A;  3DXJ F;  5H6R A;  5JHF A;  3A0B C;  1W0U A;  3L7W A;  4B4C A;  4LFU A;  2CWE A;  2XF5 A;  1D8J A;  4XBF A;  4YEJ A;  1IXC A;  2FQ4 A;  4XR6 A;  4E4H A;  4IKF A;  1WJA A;  3CZ6 A;  2TRT A;  3IRQ A;  3ZPL A;  3OL3 A;  3J81 K;  3NWT A;  2A68 F;  4RBO A;  5EZG A;  1T2K A;  3S3N A;  2H09 A;  5E3O A;  4HYE A;  1WPK A;  4XON A;  3N97 A;  5AON A;  4YG2 F;  2HQA A;  4MQV A;  5FB2 A;  1Y1V J;  2E5N A;  3IWZ A;  1MH4 A;  3ZN0 A;  2WV1 A;  4XQF A;  1FC3 A;  2VBY A;  2F48 A;  4KN7 X;  3LNQ A;  1IC8 A;  2EIN H;  1R71 A;  3JRD A;  3BR5 A;  1V5E A;  2HXI A;  1XC5 A;  3MKW B;  4S0H B;  5DD8 A;  3H3Z A;  1G8X A;  2EIM H;  3RQ4 A;  4RM2 A;  3HKZ A;  3HC7 A;  4I09 A;  1L3L A;  1OCC H;  2P4W A;  3KEY A;  2VUM J;  3IP4 B;  1ZR4 A;  2PMZ N;  4XN3 A;  2QLZ A;  4EM1 A;  1RNL A;  3ZGK A;  2XAG A;  4KIB A;  2KRC A;  5AIQ A;  1Z05 A;  1AHD P;  4D0P A;  5DM6 F;  1MJB A;  1S7E A;  5KAF C;  4A2U A;  1OCR H;  2CUF A;  4ESJ A;  5BS6 A;  3SQN A;  3C2G A;  4QIW N;  3LA3 A;  4M74 A;  3RIR A;  2DMN A;  4BU2 A;  3MKZ A;  3JTG A;  4E7S A;  4RAG A;  3H3U A;  4A3K J;  4HX7 A;  1R4M B;  4AC0 A;  2WAD A;  4KT5 C;  1K4S A;  3KP5 A;  4OOI A;  2CQK A;  2XDV A;  2QA4 I;  2VON A;  5BQT A;  3GFM A;  1OCZ H;  2DFF A;  3MVP A;  4ASN A;  1BIB A;  3P7N A;  1IUF A;  3G1L A;  5DS9 A;  2QF7 A;  4YIR X;  3CDI A;  3LAP A;  1U9N A;  2XAH A;  2LBF A;  2FSW A;  2YX4 A;  4GRI A;  4YEL A;  3ABL H;  3KZZ A;  1XMK A;  3PNT A;  2JN6 A;  3RYP A;  1A6Q A;  4FCY A;  1IN4 A;  3CJT B;  3K1N A;  2VQG A;  2DA4 A;  1SFO J;  1RUO A;  2ZSH B;  2ZME B;  4DQ2 A;  5D5W B;  3CJR B;  3KEO A;  5FLM J;  1F36 A;  2BGC A;  2BVM A;  5BNG A;  3ZQC A;  4RGX A;  4OIP F;  4BXX J;  1MGT A;  4PK4 A;  3HOS A;  5EYR A;  2PBI A;  2E2J J;  1W5S A;  3PNY A;  3EYI A;  4B3A A;  4HX8 A;  5D5V B;  3SZP A;  1RPW A;  2BYV E;  3BZC A;  2X51 A;  4ENK A;  4IZZ A;  4ZYG A;  4L9N A;  2ZNZ A;  3S32 A;  4MTD A;  1H9T A;  3G3Z A;  2BHY A;  4PGH A;  1HC8 A;  4ZDO A;  5TGT A;  1I6H J;  4BHC A;  2XF7 A;  3ZMU A;  9ANT A;  1BM9 A;  1E3P A;  2QYO A;  2RDP A;  2P5L C;  1WFX A;  2HFH A;  2HYJ A;  4KMF A;  1GVD A;  1WJE A;  4EM0 B;  3WG9 A;  2ZO4 A;  2HPI A;  1RR7 A;  1IN8 A;  3HPG A;  4E7Z A;  3ZP5 A;  2R5Z A;  3IL2 A;  1WGX A;  3LAJ A;  5FKO A;  4CHU A;  1Y0N A;  5FFX A;  3O3K A;  3OYE A;  1PP7 U;  1BI0 A;  4LLL A;  2L3D A;  3F6V A;  5HNF A;  2WB1 N;  1A6I A;  4OIR F;  4L18 B;  1X58 A;  1XB4 A;  4BJ5 C;  3WU2 C;  1PDN C;  1ITY A;  4AIK A;  2VQL A;  1U6G A;  3CCS I;  5L3F A;  1BC7 C;  2XGX A;  2MAB A;  2CO5 A;  3LA7 A;  3OYG A;  1F9N A;  4BJ6 C;  2E2H J;  2KRF A;  4XN0 A;  2STW A;  3E6C C;  1F43 A;  2G9W A;  2NAZ A;  3CLO A;  5ILS A;  2KFD A;  1YLF A;  1D8K A;  5K1Y A;  3A03 A;  1XMA A;  1YYV A;  1EV7 A;  4C3H J;  2R5Z B;  5L3D A;  2ELK A;  2OC6 A;  4EV0 A;  2OF7 A;  5D4S A;  1UMQ A;  3U2R A;  3GZ6 A;  4WCG A;  5DUI A;  3TED A;  3CCV I;  2XF6 A;  2ZKZ A;  2WWY A;  2A3S A;  1MNM C;  2HGC A;  3AG4 H;  2HQ5 A;  4HG2 A;  4IQ4 A;  1IV6 A;  4IXA A;  3RCO A;  2RVC A;  1UFM A;  3K4B A;  3LSR A;  4A3G J;  4EGY A;  1T98 A;  2KIQ A;  4JQF A;  4PDK A;  4RM3 A;  2M9H A;  2LRD A;  2O9L A;  2JVG A;  1TL8 A;  2DDB A;  5HLT A;  5ICF A;  4QSH A;  4FHT A;  3PQK A;  2GBY A;  3T8T A;  4EAT A;  3PSF A;  1J75 A;  2KJC A;  1MW7 A;  3TQN A;  3CO6 C;  2LKS A;  4XKB A;  4E7I A;  2EB7 A;  2EFN A;  2QQ8 A;  5DEQ A;  3GX4 X;  4IF4 A;  3GTG J;  3ASO H;  2D1V A;  4L5E A;  3ONQ A;  1ETV A;  2MLG A;  3FWE A;  3QOD A;  2DW4 A;  5DUK A;  3LQQ A;  4GGG A;  3HOZ J;  1Z6R A;  2DAO A;  2E1O A;  2I10 A;  2ZFU A;  2L9S A;  5JLX A;  2E1N A;  1TLH B;  3CJN A;  1ON2 A;  4RB3 C;  3OYI A;  2CUZ A;  3OOP A;  5ICG A;  2CRG A;  5IYD J;  2BXZ A;  4KIT B;  2VJJ A;  2V9P A;  2BY0 A;  6PAX A;  2Z2S B;  5K7H A;  1ZK8 A;  2DCE A;  4J19 A;  4KYW A;  2EZH A;  2Q1Z B;  2K9S A;  3L2U A;  2A6H F;  3ZCO A;  3MFK A;  2DYR H;  3BJ6 A;  3W2A A;  3OYH A;  4A5M A;  3T0Y A;  2A5W A;  2L7K A;  1WJD A;  2PMH A;  1VF9 A;  3E7L A;  4WXC A;  2VT3 A;  3IWF A;  3BG3 A;  4DYQ A;  1I27 A;  1XG1 A;  3AKZ A;  1U8B A;  1BJZ A;  1OYI A;  3AL0 C;  3LSI A;  3AG2 H;  2JMW A;  2OZ6 A;  3GO5 A;  2LDU A;  5CLS A;  2ETH A;  2R5Y B;  3L2C A;  1U78 A;  1IN6 A;  1BA5 A;  3JAM Z;  2ZXW H;  2EQR A;  2JVH A;  4G7H F;  2BVL A;  5E20 A;  3K0L A;  3JSO A;  3QOE A;  2IA0 A;  1BR4 A;  4L9T A;  4QPQ A;  4CH7 A;  4DBQ A;  3BZK A;  4GFB A;  3ZMT A;  2FE3 A;  2LTP A;  3DPU A;  3CC7 I;  3HB9 A;  2ECB A;  1CF7 B;  2EA4 A;  4F91 B;  5B66 C;  2Z33 A;  2DA5 A;  1K61 A;  2H1K A;  1XX5 A;  3REO A;  4EJT A;  1N78 A;  3GZN B;  2VAS A;  3PNV A;  4UUS B;  5KCM A;  1DGR M;  1H0M A;  3CCY A;  5TRD A;  2DQR A;  2GWR A;  2CQN A;  2UXN A;  3FXL A;  4QTR A;  1XCB A;  2F5V A;  5J1U A;  2DTZ A;  2LY1 A;  2XAS A;  3CQZ J;  1L0O C;  2KT0 A;  1SFK A;  4HQM A;  1GDT A;  1P9Q C;  1JT6 A;  2FU4 A;  2P6S A;  3HRS A;  1POG A;  3FXK A;  4GYI A;  1ZGJ A;  4CO8 A;  3FMR A;  3VPR A;  1GV5 A;  3QPS A;  5F1J A;  2KZG A;  4LJZ F;  4LLN A;  1KQ8 A;  3CDH A;  3QPT A;  1OYY A;  4CIC A;  1MD0 A;  2DBB A;  2Y75 A;  4HEA 2;  3K1M A;  1D0X A;  1MDM A;  2FNA A;  1RET A;  2L0K A;  2K9L A;  2M8G X;  4E7J A;  1FYM A;  2HS5 A;  2X48 A;  3BPV A;  4UB6 C;  4FX0 A;  4JP0 A;  1J9I A;  3TW6 A;  3WTY C;  1ONV A;  2TCT A;  1W1W E;  3NQO A;  2DXI A;  1UAA A;  4D5F A;  1GT0 C;  3C3W A;  4BEH A;  3CES A;  1U5T C;  3SZT A;  3F8C A;  1Z77 A;  2BV6 A;  2VJ4 A;  3GFI A;  2K4J A;  3QYB A;  5IYC J;  2WY8 Q;  3M8F A;  1YHQ I;  2XRL A;  2WY7 Q;  2ME6 A;  3HKZ N;  2L7M P;  1KQ0 A;  4LLG F;  1MH3 A;  4BHB A;  3RJP A;  2F2E A;  1ZAO A;  1LKX A;  3FXJ A;  3HOW J;  1WJC A;  2F4I A;  4BYY A;  1YW7 A;  2Y30 A;  3S2W A;  2E7X A;  2LOO A;  2NVT J;  2H8W A;  1OIS A;  1OJL A;  3OS2 A;  2L9R A;  3SEZ A;  1IUY A;  2VB6 A;  2PMU A;  4EQQ A;  3TOB A;  2VBW A;  2DMP A;  2PFB A;  5FD5 A;  2OPT A;  1MJA A;  2TDX A;  1AKH B;  2YU9 J;  2M2E A;  3RKX A;  3WU1 B;  4M3F A;  2ICW G;  3OR2 C;  2CV0 A;  4BEH B;  5EEH A;  3LL7 A;  2PQ8 A;  1IN5 A;  2L5Q A;  2DU9 A;  3FXM A;  3LST A;  2VE8 A;  2CV2 A;  4AVP A;  2BOL A;  3VFZ A;  2Y9Z A;  1X4O A;  1LE8 B;  2NS0 A;  3HDD A;  4OMY A;  4L0Z B;  2XB5 A;  3UKG A;  2EPF A;  1X2M A;  3HUG B;  2M30 A;  3KYD B;  3K70 C;  4ESB A;  5CYV A;  5BMZ A;  1KYW A;  4BE0 A;  5BPD A;  1X2N A;  4NC8 A;  1R1T A;  3EET A;  1B8I A;  1Y6I A;  4B44 A;  1KGS A;  1O3R A;  3DPT A;  5JHU A;  4M6V A;  1AKH A;  4AIH A;  4YRV A;  1PJR A;  1DGW Y;  5LEJ A;  1JXS A;  2P5K A;  1X1C A;  2O8K A;  2L02 A;  3BG9 A;  1W0T A;  2FMY A;  3ZQ7 A;  1FIP A;  3CMA I;  2N8G A;  1SAU A;  2XGD A;  5IYB J;  3ESW B;  2EFP A;  2BXY A;  3U21 A;  4UUS A;  4M6Y A;  2V1D A;  1MBJ A;  3IC7 A;  4JX5 A;  3ZR8 X;  2GIV A;  4OU0 A;  4PJL A;  4DW6 A;  3CCQ I;  5CVJ A;  4XIC A;  4KT6 A;  1IF1 A;  3BG7 A;  1V5G A;  1VQ5 I;  4KIG A;  3DKX A;  2K85 A;  3I58 A;  5HS8 A;  5J47 A;  4I2O A;  4I76 A;  3KPH A;  4ETS A;  3QPL A;  4IOA F;  3GTP J;  2L4A A;  3E97 A;  1SD4 A;  2ACJ A;  4B48 A;  3FIW A;  2IS2 A;  4O5V A;  3CCR I;  3CMM A;  3TGN A;  5HOO A;  5A2Q K;  1K83 J;  4IHW A;  1HW1 A;  3FXQ A;  3L2V A;  3S1M J;  4FET A;  2A61 A;  3G1M A;  3MZ8 A;  3TW7 A;  1W5T A;  1S72 I;  2EK5 A;  3JRC A;  2M8E A;  1QGP A;  3OSF A;  1OCP A;  2LF7 A;  3OYB A;  3HYI A;  1XGN A;  3S3M A;  1ZGW A;  2HVR A;  3BC8 A;  1FMW A;  4XLF A;  2CFO A;  2DK5 A;  5AIP A;  5E18 F;  2NVX J;  4XLA A;  5LGU A;  1SC7 A;  1E0E A;  1Z91 A;  2FBI A;  2L7Z A;  2P7C B;  2NYX A;  3W2W A;  2V6E A;  4KIS A;  3IV5 A;  4IQJ A;  3HOU J;  2JRT A;  5J8C A;  2EV5 A;  2VOD A;  1HBX G;  4WXH A;  2BW3 B;  2E7W A;  3OIP A;  3S8P A;  2Z1D A;  1TZL A;  4QPO A;  3CC4 I;  2NVU B;  4J00 A;  3BZ6 A;  3JSP A;  1TP4 A;  1D0Y A;  1YS7 A;  2KHM A;  2WC2 A;  3WU0 A;  4UB8 C;  1HW5 A;  3M1E A;  3V7R A;  3F21 A;  2NVQ J;  2R7O A;  4MEY F;  1BC8 C;  2LMD A;  3QRF F;  4ZC3 A;  1O7F A;  4XM3 A;  3FM5 A;  4Z6Y A;  1JTX A;  1YW9 A;  1H9G A;  1ZLJ A;  3BWG A;  3TL4 X;  1ETY A;  1TC3 C;  4OMZ A;  1RZ4 A;  2CFX A;  2ZJ2 A;  1FZP B;  5ED4 A;  4FE7 A;  4RDU A;  1ZN2 A;  3GLL A;  2XV4 S;  1USS A;  2HDD A;  1K79 A;  1HDD C;  1S6L A;  5J3L A;  5DCM B;  1U3E M;  2Q2E A;  2W85 A;  1S7A A;  2KIS A;  3KIO A;  5CKT A;  3M8J A;  3GTJ J;  3BR2 A;  3I71 A;  4UUT A;  5CQE A;  1P7J A;  4M3E A;  4L9J A;  2PJR A;  4XLE A;  4G6D A;  4M9S A;  2QQB A;  2EIK H;  1FT9 A;  2EBI A;  2GIZ A;  2JK3 A;  4CCL A;  3S16 J;  5F1R A;  3EQL F;  2A5Y B;  1T08 B;  3RKW A;  5HDN A;  2W84 A;  2UUZ A;  2QSG X;  2DA3 A;  4XOP A;  4JX4 A;  2LFB A;  1KU7 A;  1V5F A;  1GHC A;  4V2G A;  2COM A;  3ERM A;  4OWR B;  3BPX A;  2VIX A;  2DA6 A;  1FSE A;  2JA5 J;  1ZQ3 P;  3MAJ A;  4BQA A;  2FJ1 A;  1WRJ A;  3DP7 A;  4N0B A;  1VQM I;  3I55 I;  5E1X A;  3M7G A;  2QBY B;  1X3Z B;  5E8I A;  3E5X A;  4LGW A;  3FF5 A;  1OMI A;  4XLP F;  3OS0 A;  3N05 A;  2HZD A;  1FWZ A;  1OR7 C;  5F04 A;  5M5X J;  4LB6 B;  3TO9 A;  2UZK A;  3CDL A;  2DA7 A;  3O8G A;  1DPR A;  5D5X B;  2DT6 A;  3PM1 A;  1VI0 A;  2HPM A;  2K3F A;  3F9K A;  5FKL A;  3CUQ A;  3RDI A;  3TO6 A;  2L54 A;  3I59 B;  1EF4 A;  1XTA A;  1JGS A;  2EFQ A;  2QZ8 A;  5CVV A;  4ENJ A;  1B9M A;  1K7A A;  2OZU A;  3BG5 A;  3MMY B;  2LBF B;  1DDN A;  4AM3 A;  3H0G J;  5LHG A;  1UHM A;  3NAU A;  1BI1 A;  1G3Y A;  1KU9 A;  4E70 A;  1T8I A;  2XPW A;  1H88 C;  2E1C A;  2W4S A;  3NEU A;  1YO5 C;  4CZZ A;  2YR2 A;  3H5A A;  1HSJ A;  3L00 A;  2HDW A;  4QWQ A;  2OCE A;  3KP6 A;  2NVY J;  5LGT A;  1BOA A;  2IJL A;  3BY6 A;  1B72 B;  1RIO H;  4WWC A;  5KVR A;  1Y1W J;  2CQX A;  1T95 A;  2DA1 A;  2QVO A;  1SVL A;  3WE2 A;  2AS5 F;  3CTA A;  2AHQ A;  3IAS 2;  2OUM A;  2EFO A;  4ENN A;  3IAM 2;  3K4J A;  3SDB A;  5DM7 F;  1JI8 A;  1NH3 A;  5LHH A;  4U7B A;  2FEZ A;  4AD9 A;  3ASN H;  1VQ8 I;  2ZXH A;  3J7A O;  2MH2 A;  4XNF A;  2HYF A;  1FYK A;  5CJ9 A;  5DV5 A;  5EZH A;  1G3T A;  1RES A;  1SD6 A;  1EH8 A;  3GUD A;  1QU3 A;  2K9M A;  4MGR A;  4NHJ A;  3ZMS A;  2XPV A;  2EZI A;  1P4W A;  3SHF A;  2YS9 A;  4LK1 F;  2A69 F;  3I5U A;  1ZKG A;  1E2X A;  1MZB A;  1R5H A;  4UHT A;  3DTI A;  1VQO I;  4ESF A;  3MCZ A;  5C4X J;  4R79 A;  1WI9 A;  4KN4 X;  2X1D A;  4BQQ A;  4NB5 A;  2KRH A;  1FJL A;  1VFC A;  2HKX A;  3RTR A;  3ZQL A;  2VE9 A;  1B4A A;  1V3F A;  3V8K A;  1DPU A;  5FGM A;  4II2 A;  2R7X A;  2YSR A;  3D0S A;  1HF0 A;  3GEZ A;  2JUG A;  2X0L A;  1X3U A;  4JK1 X;  4S05 A;  2XGC A;  2EH3 A;  1YI2 I;  2MGQ A;  4ZYA A;  4M73 A;  2X6W A;  4IJA A;  2HYG D;  1BR1 A;  4S04 A;  1WJ5 A;  3S14 J;  3VYS B;  2J5P A;  1XSX A;  1R7J A;  2PX9 A;  4HNU A;  3CCU I;  3QQA A;  1Z1D A;  2NRA C;  1FP2 A;  3LSM A;  4U87 A;  3JRE A;  3RZD J;  1ZEL A;  4YFN F;  5FLV A;  1J7K A;  1IZ1 A;  2FXA A;  4U0W A;  3C2B A;  1I39 A;  1MMN A;  2GAU A;  4XRM A;  4XK4 A;  4U0Y A;  3H1C A;  1GXQ A;  4FQG A;  3GF2 A;  4GYG A;  2K4B A;  2DJN A;  3OL4 A;  4A0Z A;  2ISZ A;  3NAR A;  3HTS B;  1YS6 A;  3LSJ A;  3BQZ A;  3DWL E;  1SAX A;  2FRH A;  4EGZ A;  3AL0 B;  1YFH A;  1W7P D;  2ZB9 A;  1D1B A;  4NC7 A;  4RB0 A;  4W1U A;  3FXO A;  1HCR A;  3WTW C;  3OR1 C;  3K7A J;  1IJW C;  2ZJQ F;  2XKP A;  4MEX F;  2E34 A;  3EUH A;  3HXL A;  3SDG A;  1U8R A;  4F52 A;  3H92 A;  4RMN A;  4UVA A;  2CW7 A;  1T6S A;  4KJZ A;  4M6X A;  2LC2 A;  2B0L A;  2JPC A;  5GTI C;  4B1R A;  2CH0 A;  1W36 D;  3KEQ A;  3BR3 A;  1W5C C;  4BKX A;  2GA2 A;  5B1B H;  5HS9 A;  4WXD A;  1MSF C;  1LUJ B;  4AIJ A;  2WAQ A;  1MBF A;  3KYL A;  1F5T A;  1YE9 A;  2GZW A;  2RQQ A;  3OYL A;  2RV8 A;  1LFU P;  2Y48 A;  1XD7 A;  4XLN F;  1ZAR A;  1N77 A;  4IRI A;  4BY1 J;  1Y8R B;  5ICE A;  4I6Z A;  3RPU D;  1HDP A;  2M0M A;  1MMS A;  1TT0 A;  3L2Q A;  4MO7 A;  2H6C A;  5HDK A;  1KU3 A;  1HKT A;  2RN7 A;  3BR1 A;  1SMT A;  1K78 B;  1TW3 A;  4LIV A;  4XKV A;  2V1X A;  3JW4 A;  4DZP A;  2R5Y A;  1X1B A;  1IXR C;  1SVO A;  2DOA A;  4OIN F;  2BEO A;  1OCT C;  2MW8 A;  3ABK H;  4DIQ A;  2JUC A;  2QBY A;  3PQJ A;  5K5R A;  1Y56 A;  2RAE A;  3ZQI A;  2P81 A;  4JOM A;  5L3E A;  4O6J A;  1PYV A;  2I5U A;  2OJE D;  1J5Y A;  2FD5 A;  3WTT C;  1BI3 A;  2DPD A;  1DP7 P;  2IPQ X;  3KP2 A;  3VDX A;  2QCO A;  2YX7 A;  1NTC A;  2RNG A;  3L2W A;  2OBP A;  4GCV A;  3UR3 C;  3GWZ A;  4LB5 A;  2E19 A;  2FOW A;  3P9I A;  3H36 A;  1VQ6 I;  1E3H A;  1OQY A;  2IW5 A;  3KLO A;  4MTE A;  2K40 A;  1Z0X A;  1ZYR F;  3PSI A;  2GOM A;  5LEK A;  3I9V 2;  2VOP A;  2R7D A;  3GBG A;  1X4P A;  1U9O A;  2V7F A;  2CW0 F;  1CGP A;  3SFZ A;  1ETX A;  2KMU A;  4IHX A;  2E5Z A;  1SMY F;  1FTT A;  5F6F A;  1VQ9 I;  1ON1 A;  5D6F A;  4A12 A;  4AID A;  1FBS A;  2Y9Y A;  3DTE A;  3H9G A;  4CYD A;  1BJA A;  3BCA A;  5GAG J;  4HPQ A;  2V6C A;  5D8K B;  2R92 J;  2EWN A;  2Q2E B;  2OD5 A;  2W7N A;  2EA2 A;  4U88 A;  2LNB A;  3HHH A;  2HEO A;  4KUM A;  4LG3 A;  1WCM J;  4KA4 A;  4IEJ A;  3WTX C;  2LLK A;  4G6Q A;  2DA2 A;  2EZK A;  5IPA A;  3S2D J;  2FML A;  1O57 A;  3CCE I;  4HBL A;  2HKO A;  2PJR B;  1RI7 A;  1IW7 F;  2M4G A;  2BHZ A;  1XSD A;  5K7F A;  4B3X A;  1YQA A;  4N4N B;  2MD0 A;  4G7Z F;  3TP3 A;  4XSX F;  1MSE C;  3P9C A;  5F0C A;  3PUF A;  2OA4 A;  2LF8 A;  4KNY A;  2QQ9 A;  3WGI A;  1WWX A;  2GQQ A;  2P5V A;  2CQQ A;  3DEW A;  2QUF A;  4IRH A;  4I98 B;  1QZE A;  1K6Y A;  3X2Q H;  2KDO A;  2LSO A;  1TQI A;  3A2K A;  4KFC A;  2HOS A;  2PN6 A;  5LLQ A;  5LRS A;  2E1M C;  3VOD A;  3ZN1 A;  1QA6 A;  4XRS G;  5F08 A;  5HOD A;  2OTJ I;  2WAQ N;  2ME0 A;  2DMT A;  2K27 A;  1W7P B;  2DOF A;  4BDY A;  3JRH A;  2D1H A;  3DBR B;  2JSP A;  4ON0 A;  3F23 A;  4A5N A;  2HXO A;  2KL4 A;  5FKM A;  1QBJ A;  3RPQ A;  2VOO A;  3KYC B;  2AQE A;  4Y7N J;  4HLY A;  1QZZ A;  5B5E C;  4BBR J;  3K4C A;  2BY3 A;  5F0F A;  5H6Q A;  1J0R A;  5H20 A;  3V8J A;  4MNU A;  4X0G A;  5ILU A;  2X9D A;  2L4M A;  2R7W A;  1VQN I;  2M3A A;  4BAY A;  4MQ9 F;  1VTN C;  2VC1 A;  2XSD C;  1YRN B;  1ZTR A;  2LH9 A;  3PFY A;  5D8L B;  3K4M A;  3FXU A;  3I3L A;  4WX9 A;  1SVM A;  3N4M A;  1YG2 A;  5DYM A;  4KIF A;  3KP3 A;  3IKT A;  4PFO A;  4KDP A;  1JHH A;  2W82 A;  2K9N A;  3CUQ C;  4A3D J;  1I3A A;  4A6D A;  1XN7 A;  5ILV A;  3ABU A;  1TTY A;  1YJN I;  2EIJ H;  3LA2 A;  4BNC A;  1IDY A;  3B6C A;  4BL0 B;  4RB2 C;  3HEF A;  4A3I J;  2BE5 F;  4G6T B;  1MBG A;  3ECO A;  2MC4 A;  4IHV A;  2OAZ A;  1LJ9 A;  4RA2 A;  2ZJR F;  4IPA A;  3DV8 A;  3ECH A;  2VKD A;  5M3M J;  3RI4 A;  2VI6 A;  3U9G A;  4C3J J;  3ELK A;  3U1K A;  1IRF A;  2M1B A;  2COB A;  2NXN B;  2WB1 A;  1YRN A;  1ZRD A;  2W25 A;  1Z3X A;  2X1C A;  3G4S I;  3ZOB A;  4J01 A;  2HR3 A;  3M07 A;  1R5I D;  4DYR A;  3DKW A;  1FOX A;  1A04 A;  3FKI J;  2LY9 A;  2KPM A;  3CF5 F;  1FOY A;  4CA0 A;  2ZC2 A;  3HSR A;  2KLO A;  2RQP A;  2R7S A;  1JGG A;  4JYK A;  2ZJP F;  2G0E A;  5D5U B;  3DU5 A;  3C18 A;  3CLQ A;  1ZR2 A;  3GTQ J;  2H94 A;  3CMY A;  5J1Y A;  2NS8 A;  2VXD A;  2XAF A;  1QVT A;  1KQ9 A;  2VPL A;  1IN7 A;  3GTK J;  2MD5 A;  2XSJ C;  4HDV A;  1A5J A;  4XRS A;  1UG2 A;  1UEL B;  4MLO A;  4HV5 A;  1B72 A;  3CUQ B;  1OFC X;  3W3C A;  4BS9 A;  5HVQ C;  3GFL A;  1HST A;  4HX4 A;  3HPH A;  2ID6 A;  1UHS A;  2Z3Y A;  3E0J B;  2F4M B;  4BXF A;  3WHB A;  4RB1 A;  5DD4 A;  3Q9V A;  5CQG A;  1D1C A;  4ENM A;  3S1R J;  1ERD A;  2L9N A;  2O03 A;  1UG0 A;  4HF0 A;  4Y15 A;  1WHU A;  2DOE A;  3BJO A;  5E3N A;  3KFW X;  1JKQ C;  1U5T A;  3DEE A;  3D1N I;  2W48 A;  4BGD A;  3I4M J;  3EYY A;  3LSK A;  1FNN A;  2Y31 A;  2Z99 A;  4DGW B;  3OIQ A;  4C2U A;  2QEN A;  5J4Y A;  1T0F A;  5IP9 J;  1V54 H;  2OCC H;  3P5J A;  3MD2 A;  2K3P A;  2XAJ A;  1VQ7 I;  3TO7 A;  3VOE A;  1ETQ A;  4P55 A;  5EGO A;  2QSF X;  2VKE A;  1R6R A;  1FBU A;  4XKW A;  4Z2Y A;  3SEQ A;  1G59 A;  3OYM A;  1TW2 A;  4BHP A;  3DLA A;  3FX3 A;  1R9T J;  1YTY A;  2Z16 A;  5IT3 A;  3M4O J;  4PJ0 C;  4D7N A;  1G4D A;  4G9Y A;  1TQP A;  2MFZ A;  2F6C A;  1D5Y A;  3BCB A;  3MKL A;  1WVR A;  5H2F C;  1B59 A;  1RKT A;  3PIO F;  1TNT A;  3CD6 I;  3E3V A;  1Y0U A;  4GDF A;  1FLI A;  2Y2Z A;  1N75 A;  1SFU A;  1IGN A;  1FSH A;  2JWT A;  3JRA A;  2UXX A;  1ODD A;  2KIM A;  3M1C A;  3Q0V A;  3B6A A;  4CGZ A;  4IL6 C;  1FBQ A;  5LFA A;  1ZHF A;  4PSW A;  2Y0S N;  4ZZL A;  4ZJZ A;  2DFH A;  2DPU A;  2VL8 A;  4AYB N;  2M0C A;  4CYC B;  2NOJ B;  1G2H A;  4AUX A;  1TWH J;  1YIO A;  3GW2 A;  3RZO J;  2VJ5 A;  1MMA A;  2KDZ A;  2VT2 A;  4A93 J;  4F3Q A;  3FBI B;  4DOZ A;  2R7V A;  1SAN A;  1MBE A;  1S9H A;  2EJR A;  5LRR A;  1HW2 A;  2F5E A;  1GVJ A;  4LK0 F;  4UXN A;  2HZT A;  3ROU A;  1NG6 A;  3VSK A;  1STZ A;  3KET A;  4BUP A;  5JVT A;  3IH4 A;  1REP C;  2LG4 A;  4CUG A;  2WAE A;  3R61 A;  2VBZ A;  3HOX J;  3HBL A;  2IBD A;  2JQ7 A;  3BP8 A;  4I99 C;  5TJJ A;  4BXU A;  2K7L A;  1JUS A;  3BQY A;  4XRF A;  3A1Y A;  5DDG A;  2EFW A;  4NQW B;  2KP6 A;  1XS9 A;  2BY2 A;  2CMP A;  4A3B J;  3S15 J;  2Y0M A;  2ZXI A;  1PUF B;  5HLI A;  1IRX A;  5GAH J;  4A3L J;  5EEG A;  2IGN A;  4XLH A;  1D0Z A;  4A3F J;  3HSE A;  1E17 A;  3PUB A;  2O8X A;  2JA7 J;  1MIJ A;  2K5C A;  3WG7 H;  2VQC A;  3FHN A;  4ZTJ A;  1Q1V A;  4YII A;  2ELJ A;  3BTL A;  3NWS A;  4KMU X;  3QAH A;  4II3 A;  4B47 A;  3OYF A;  1BR2 A;  5F0H A;  3BRO A;  2HU9 A;  3EUH C;  3LFK A;  4ZDL A;  4ANJ A;  1FIA A;  1I1S A;  4HA8 A;  3J80 K;  1LNW A;  1QHH D;  4PZJ A;  2CQ7 A;  2F5D A;  2KQR A;  4CCJ A;  1WZ2 A;  2ZSI B;  2IGM A;  2NNN A;  4D7M A;  4ABZ A;  4HF2 A;  2VPR A; 
#chains in the Genus database with same CATH homology
 4EM2 A;  2MBF A;  3IKV A;  5D4R A;  4Y13 A;  2HQR A;  2A07 F;  2C6Y A;  2DLL A;  2V79 A;  2KKO A;  3E6M A;  3MZY A;  3F8B A;  4LMY A;  2MLK A;  1NHA A;  5ICC A;  3WTV C;  1SFE A;  3WOD F;  2JZY A;  2H27 A;  1TNS A;  1Z6T A;  3GVA A;  2GA1 A;  1UST A;  4P9F A;  1PP8 F;  3MWM A;  5IT9 K;  1JHF A;  3F72 A;  2FOK A;  3KLN A;  3HRM A;  2DI3 A;  2J5O A;  1U5T B;  3DQV C;  3E6D A;  1QQI A;  2D45 A;  5F64 A;  2NNY A;  1QPM A;  1EH7 A;  4Q4Z F;  1C0W A;  1ZGA A;  2XIG A;  5ERI A;  3J80 Z;  1LVA A;  3FHZ A;  2VC0 A;  4ZZD A;  4IHT A;  1G3S A;  3GXO A;  1ZRC A;  2BBY A;  2FBH A;  4RGS A;  3C1D A;  5KK1 A;  4RGU A;  3WTZ A;  5E1W A;  3B73 A;  1R22 A;  4LG0 A;  2PJP A;  3V4G A;  1Q1H A;  1KYZ A;  3HUG A;  1Z7U A;  3QU3 A;  4N9I A;  1B6A A;  1RUN A;  2Q8K A;  1IAW A;  1O3S A;  4I01 A;  1B1B A;  3WGG A;  2PEX A;  3ISP A;  1FYL A;  2V9V A;  3I53 A;  1R36 A;  3CO7 C;  3TKY A;  3F22 A;  2Z5U A;  1XDS A;  4I0B A;  3QU6 A;  1G3W A;  1S8N A;  2WTE A;  5E1Z B;  2K86 A;  2XAQ A;  3R6S A;  1S29 A;  2P8T A;  3QOP A;  4KIC A;  3Q5F A;  4P9U A;  4ZYE A;  3RKY A;  2DT5 A;  2ESN A;  3W6K B;  1LDK B;  3ZMV A;  1DUX C;  2MA3 A;  1F4K A;  3P9K A;  3KP7 A;  5HDG A;  3FZV A;  1D5V A;  2ELH A;  4R8H A;  2ZXJ A;  2FF4 A;  4P96 A;  2QM3 A;  1IRG A;  3MQ0 A;  3IRR A;  3I0T A;  3V8L A;  4QLC U;  5JI6 A;  3K69 A;  2IRF G;  2PLY A;  1Z9C A;  2HTS A;  1SFX A;  1SD5 A;  2OQR A;  1HKQ A;  3E5Q A;  1G6N A;  1XSV A;  3W6J B;  3F3X A;  2DK8 A;  1LEA A;  5L3G A;  2A6E F;  1FP1 D;  2XKO A;  1U2W A;  1WSU A;  1P4A A;  4UVB A;  5CVU A;  2VN2 A;  4H0E A;  3QP6 A;  1R58 A;  2D2W A;  1HXD A;  4EMS A;  2WV0 A;  1UB9 A;  5BOX A;  3G73 A;  3OV8 A;  3TOA A;  3R0J A;  3J81 Z;  3FMQ A;  4Q48 A;  5HLG A;  2YPR A;  3WE3 A;  2DQL A;  4Y17 A;  2XHK A;  4UV9 A;  1O7L A;  2ZCW A;  3GLX A;  2ZNY A;  3L09 A;  4FT8 A;  1SD7 A;  3V7S A;  1B9N A;  4G7O F;  4M71 A;  3QPH A;  1ZRE A;  4XSZ F;  3COA C;  2IA1 A;  5JFR A;  4OIO F;  1KA8 A;  2MH9 A;  3ZMZ A;  5K5Q A;  2XRO A;  3LWF A;  4EJO A;  4NQW A;  5L3B A;  3JTH A;  1W7P A;  3M8E A;  2DTR A;  2IT0 A;  3LQR A;  4I7H A;  4ZYD A;  1JE8 A;  1AOY A;  4IHS A;  2RGV A;  1J59 A;  2CG4 A;  3F6O A;  5E8G A;  2ESH A;  2G7H A;  2EV0 A;  3DEU A;  3ZMD A;  4L5J A;  4UNO A;  2OQG A;  4K2E A;  4RGR A;  1OKR A;  3GYH X;  5HLH A;  1EH6 A;  2O6G E;  2G7U A;  3T5X A;  4G94 A;  1FY7 A;  1ULY A;  3K1P A;  1AWC A;  1P6R A;  2W24 A;  3I54 A;  1GXP A;  1R5G A;  3I4P A;  4AWX B;  1MKM A;  4OIQ F;  2KJB A;  2DFI A;  4RS8 A;  4WF2 A;  3Q9S A;  4M72 A;  3O2P E;  4R1H A;  1BIA A;  5FFZ A;  1QNT A;  1ZG1 A;  1XCV A;  3JAM K;  4MHG A;  3ABT A;  4I02 A;  1UHW A;  3AAF A;  1MJ9 A;  4FX4 A;  4PCQ A;  4U0V A;  5JR3 A;  3E6B A;  1CF7 A;  2M5W A;  2P7V B;  2M45 A;  1LB2 A;  2R3S A;  3B02 A;  4B09 A;  1OR7 A;  1BI2 A;  1I5Z A;  1O3T A;  2ADU A;  3ERE D;  1OPC A;  2PI0 A;  2FBK A;  3SXY A;  3HHG A;  2K02 A;  1IXS B;  1HQC A;  4B8X A;  4M9X A;  2VBX A;  3TDZ C;  3CUO A;  1P4X A;  4JBA A;  2X4H A;  4U7D A;  2FQ3 A;  1XDU A;  3RYR A;  2EV6 A;  2CSO A;  2IA2 A;  4HZF A;  3TDU C;  1I6X A;  1XGO A;  3PFI A;  1P2F A;  3U1D A;  2O3F A;  4L9V A;  2STT A;  3WTS C;  2IP2 A;  1QZY A;  2HTJ A;  5DCF A;  3DFG A;  2DO7 A;  4WK8 F;  5LGN A;  4YFX F;  1R1V A;  2ZME A;  3F8N A;  2JPB A;  4I0A A;  3HTU A;  3VB2 A;  1LDD A;  5FLX K;  2QWW A;  4L5I A;  4YIF A;  4A6E A;  4EJW A;  2F5F A;  1T39 A;  4HV6 A;  4M9Z A;  4O3M A;  3QP5 A;  3EDP A;  4HDU A;  1ZLK A;  2ZFW A;  1K78 A;  2M87 A;  2JT1 A;  2YU3 A;  4HQE A;  1O3Q A;  3HRU A;  2FNP A;  4TV7 A;  4HOB A;  3BDD A;  2H6B A;  1WQ2 A;  1T38 A;  4GXO A;  4N9H A;  2LKP A;  2Z9O A;  2RC4 A;  3DF8 A;  4RAZ A;  2L01 A;  3I59 A;  4CXF A;  2IVM A;  2RKH A;  2HOE A;  1FOK A;  1LQ1 A;  1ZRF A;  2Q0O A;  2GXG A;  5FD6 A;  4IRG A;  5FLX Z;  2XUB A;  3IHU A;  1J2X A;  1D3Y A;  1TBX A;  3M9A A;  5L3C A;  2W57 A;  1MDM B;  2VXZ A;  1YW8 A;  5LBQ A;  4RAY A;  3V7C A;  1P92 A;  2KIU A;  2PG4 A;  2AXL A;  2QQA A;  5IT9 Z;  3HSF A;  4CDG A;  3HRT A;  4LG0 B;  3T8R A;  4IVN A;  1WKM A;  4P5O A;  4HF1 A;  4YFK F;  3BJA A;  1W4M A;  2ISY A;  2XVC A;  2HQN A;  3C7J A;  3KCC A;  5J8F A;  1UCR A;  5CVR A;  1LDJ A;  3MZH A;  4A0X A;  3ML6 A;  2XRN A;  3F8F A;  4DNC A;  3R60 A;  3WTU C;  4HLX A;  1FX7 A;  1V4R A;  3KZY A;  3K9T A;  5DCM A;  4EJV A;  1ZG3 A;  3R4K A;  3FM3 A;  5E17 F;  5D6E A;  5LHI A;  2P6T A;  3F8M A;  3RPU A;  1R1U A;  3I64 A;  2CYY A;  1TQM A;  4EVI A;  1I1G A;  3GZ5 A;  3E5U A;  2HDC A;  2O0Y A;  4A0Y A;  4L0Y B;  1R23 A;  4Q5S F;  3VEP A;  1ZG5 A;  1HKS A;  1KU2 A;  5BPI A;  4PGG A;  3HOT A;  4HW0 A;  3KP4 A;  2F5C A;  1R00 A;  1BBY A;  4ZYH A;  4BH9 A;  1F1Z A;  5K5O A;  2O61 A;  1XGS A;  4ZH4 F;  4F7Z A;  5CVI A;  2OU2 A;  3GFJ A;  4LD5 A;  1XGM A;  2V1U A;  2RNJ A;  2JSC A;  2CGP A;  3D5L A;  1BN5 A;  3ULQ B;  5J6X A;  3T1B A;  4G8X A;  4UV8 A;  1PUE E;  2UWM A;  4UVC A;  3WGH A;  4GO1 A;  1QO0 D;  2KIF A;  3L9F A;  2ZBK A;  3K2Z A;  2GXB A;  3BOQ A;  4HAM A;  5A2Q Z;  3NRV A;  3MEX A;  1FPQ A;  5HS7 A;  3FXR A;  4Q47 A;  4UUV A;  1S7O A;  2R7F A;  1LEB A;  2HWV A;  3DPL C;  3HIF A;  2MC3 A;  3R0A A;  1K6O A;  1OYW A;  2JTV A;  3FMS A;  5FO5 A;  4EJU A;  1S3J A;  3KE2 A;  3O6B B;  2FA5 A;  1ZH5 A;  3DXJ F;  5H6R A;  3L7W A;  4LFU A;  2CWE A;  1D8J A;  4XBF A;  1IXC A;  3IRQ A;  3ZPL A;  3J81 K;  2A68 F;  1T2K A;  2H09 A;  4HYE A;  3N97 A;  5AON A;  4YG2 F;  4MQV A;  5FB2 A;  3IWZ A;  3ZN0 A;  1FC3 A;  2VBY A;  4KN7 X;  5DD8 A;  3H3Z A;  4I09 A;  1L3L A;  2P4W A;  2QLZ A;  4EM1 A;  1RNL A;  2XAG A;  4KIB A;  5AIQ A;  1Z05 A;  4D0P A;  1MJB A;  4A2U A;  4ESJ A;  5BS6 A;  3SQN A;  3LA3 A;  4M74 A;  3RIR A;  3JTG A;  3H3U A;  4HX7 A;  4KT5 C;  3KP5 A;  4OOI A;  2CQK A;  2VON A;  5BQT A;  3GFM A;  4ASN A;  1BIB A;  3P7N A;  3LAP A;  2XAH A;  2FSW A;  2YX4 A;  3KZZ A;  1XMK A;  3RYP A;  1IN4 A;  3K1N A;  1RUO A;  2ZME B;  4DQ2 A;  5D5W B;  3KEO A;  2BGC A;  4RGX A;  4OIP F;  1MGT A;  3HOS A;  2PBI A;  1W5S A;  3EYI A;  4HX8 A;  5D5V B;  3SZP A;  2BYV E;  4ENK A;  4ZYG A;  4L9N A;  2ZNZ A;  4MTD A;  1H9T A;  3G3Z A;  4PGH A;  4BHC A;  3ZMU A;  1BM9 A;  2QYO A;  2RDP A;  2P5L C;  2HFH A;  4KMF A;  4EM0 B;  3WG9 A;  2ZO4 A;  1IN8 A;  3ZP5 A;  3IL2 A;  3LAJ A;  4CHU A;  5FFX A;  3O3K A;  1PP7 U;  1BI0 A;  4LLL A;  2L3D A;  3F6V A;  4OIR F;  4L18 B;  1XB4 A;  1PDN C;  4AIK A;  1U6G A;  5L3F A;  1BC7 C;  2XGX A;  2CO5 A;  3LA7 A;  1F9N A;  2STW A;  2KRF A;  3E6C C;  2G9W A;  2NAZ A;  3CLO A;  5ILS A;  1YLF A;  1D8K A;  5K1Y A;  1XMA A;  1YYV A;  1EV7 A;  5L3D A;  4EV0 A;  5D4S A;  3U2R A;  3GZ6 A;  4WCG A;  5DUI A;  2ZKZ A;  2WWY A;  2A3S A;  2HGC A;  4IXA A;  2RVC A;  1UFM A;  4EGY A;  1T98 A;  4JQF A;  4PDK A;  5ICF A;  4FHT A;  3PQK A;  3T8T A;  1J75 A;  2KJC A;  3TQN A;  3CO6 C;  2EB7 A;  2EFN A;  5DEQ A;  3GX4 X;  4IF4 A;  2D1V A;  2MLG A;  3FWE A;  2DW4 A;  5DUK A;  3LQQ A;  4GGG A;  1Z6R A;  2DAO A;  2E1N A;  1TLH B;  3CJN A;  1ON2 A;  4RB3 C;  3OOP A;  5ICG A;  6PAX A;  4KYW A;  2A6H F;  3MFK A;  3BJ6 A;  4A5M A;  3T0Y A;  2PMH A;  4WXC A;  2VT3 A;  3IWF A;  1I27 A;  1OYI A;  2OZ6 A;  3GO5 A;  2LDU A;  5CLS A;  2ETH A;  3L2C A;  1U78 A;  1IN6 A;  3JAM Z;  4G7H F;  5E20 A;  3K0L A;  3JSO A;  2IA0 A;  4L9T A;  3ZMT A;  2FE3 A;  1CF7 B;  2EA4 A;  2Z33 A;  4EJT A;  3REO A;  1H0M A;  5TRD A;  2DQR A;  2GWR A;  2UXN A;  1XCB A;  2XAS A;  1L0O C;  4HQM A;  2FU4 A;  2P6S A;  3HRS A;  4GYI A;  1ZGJ A;  4CO8 A;  3FMR A;  4LJZ F;  4LLN A;  3CDH A;  3QPT A;  1OYY A;  4CIC A;  1MD0 A;  2DBB A;  2Y75 A;  3K1M A;  1MDM A;  2FNA A;  1FYM A;  2HS5 A;  3BPV A;  1J9I A;  4FX0 A;  3WTY C;  1ONV A;  3NQO A;  3C3W A;  3SZT A;  1U5T C;  3F8C A;  2BV6 A;  3GFI A;  2K4J A;  3M8F A;  1KQ0 A;  4LLG F;  4BHB A;  3RJP A;  2F2E A;  1ZAO A;  4BYY A;  1YW7 A;  3S2W A;  2E7X A;  1IUY A;  2PMU A;  4EQQ A;  3TOB A;  2VBW A;  2PFB A;  5FD5 A;  1MJA A;  2TDX A;  3RKX A;  3WU1 B;  5EEH A;  2PQ8 A;  1IN5 A;  2DU9 A;  3LST A;  2VE8 A;  4AVP A;  3VFZ A;  4OMY A;  2NS0 A;  4L0Z B;  2M30 A;  4ESB A;  5CYV A;  5BMZ A;  1KYW A;  5BPD A;  1R1T A;  3EET A;  1KGS A;  1O3R A;  3DPT A;  5JHU A;  4AIH A;  1JXS A;  5LEJ A;  2P5K A;  2L02 A;  2FMY A;  3ZQ7 A;  2EFP A;  4M6Y A;  2V1D A;  3IC7 A;  2GIV A;  4OU0 A;  5CVJ A;  1IF1 A;  4KIG A;  3I58 A;  5HS8 A;  4I2O A;  4ETS A;  2L4A A;  3E97 A;  1SD4 A;  2ACJ A;  4O5V A;  3TGN A;  5HOO A;  5A2Q K;  1HW1 A;  3FXQ A;  2A61 A;  1W5T A;  2EK5 A;  2M8E A;  1QGP A;  2LF7 A;  3HYI A;  1XGN A;  2DK5 A;  5AIP A;  5E18 F;  5LGU A;  1Z91 A;  2FBI A;  2P7C B;  2NYX A;  2JRT A;  5J8C A;  2EV5 A;  2VOD A;  1HBX G;  4WXH A;  2E7W A;  3BZ6 A;  3JSP A;  1YS7 A;  2WC2 A;  3WU0 A;  1HW5 A;  3M1E A;  3V7R A;  3F21 A;  4MEY F;  1BC8 C;  3QRF F;  1O7F A;  3FM5 A;  1YW9 A;  1H9G A;  1ZLJ A;  3BWG A;  4OMZ A;  1RZ4 A;  2CFX A;  2ZJ2 A;  1FZP B;  5ED4 A;  1ZN2 A;  2XV4 S;  1USS A;  1K79 A;  1S6L A;  5DCM B;  1U3E M;  2Q2E A;  2W85 A;  1S7A A;  3I71 A;  4L9J A;  4G6D A;  4M9S A;  2QQB A;  1FT9 A;  5F1R A;  3EQL F;  2A5Y B;  3RKW A;  5HDN A;  2W84 A;  1KU7 A;  1GHC A;  2COM A;  3BPX A;  1FSE A;  3MAJ A;  4BQA A;  1WRJ A;  3DP7 A;  4N0B A;  5E1X A;  3M7G A;  2QBY B;  5E8I A;  3E5X A;  4LGW A;  3FF5 A;  1OMI A;  4XLP F;  1FWZ A;  4LB6 B;  3TO9 A;  2UZK A;  1DPR A;  5D5X B;  3RDI A;  3CUQ A;  3TO6 A;  2L54 A;  3I59 B;  1JGS A;  2EFQ A;  2QZ8 A;  5CVV A;  4ENJ A;  1B9M A;  1K7A A;  2OZU A;  1DDN A;  5LHG A;  1UHM A;  1BI1 A;  1G3Y A;  1KU9 A;  4E70 A;  2E1C A;  3NEU A;  1YO5 C;  4CZZ A;  2YR2 A;  1HSJ A;  3L00 A;  4QWQ A;  3KP6 A;  5LGT A;  1BOA A;  2IJL A;  3BY6 A;  1RIO H;  4WWC A;  5KVR A;  2QVO A;  2AS5 F;  3WE2 A;  3CTA A;  2EFO A;  4ENN A;  5LHH A;  4U7B A;  2FEZ A;  4AD9 A;  3J7A O;  2MH2 A;  2HYF A;  1FYK A;  5CJ9 A;  5DV5 A;  1G3T A;  1SD6 A;  1EH8 A;  3GUD A;  4MGR A;  4NHJ A;  3ZMS A;  1P4W A;  3SHF A;  4LK1 F;  2A69 F;  3I5U A;  1E2X A;  1MZB A;  1R5H A;  4UHT A;  4ESF A;  3MCZ A;  4R79 A;  4KN4 X;  1WI9 A;  4NB5 A;  2HKX A;  3RTR A;  2VE9 A;  1B4A A;  1V3F A;  3V8K A;  1DPU A;  5FGM A;  2YSR A;  3D0S A;  3GEZ A;  2X0L A;  1X3U A;  4JK1 X;  4S05 A;  4M73 A;  4IJA A;  2HYG D;  4S04 A;  2J5P A;  1XSX A;  1R7J A;  2NRA C;  1Z1D A;  1FP2 A;  4YFN F;  1J7K A;  1IZ1 A;  2FXA A;  4U0W A;  2GAU A;  4U0Y A;  1GXQ A;  4GYG A;  3GF2 A;  2K4B A;  4A0Z A;  2ISZ A;  3HTS B;  1YS6 A;  1SAX A;  2FRH A;  4EGZ A;  1YFH A;  1W7P D;  4RB0 A;  3WTW C;  2XKP A;  4MEX F;  3EUH A;  1U8R A;  3H92 A;  4UVA A;  1T6S A;  4M6X A;  2B0L A;  2JPC A;  3KEQ A;  2GA2 A;  5HS9 A;  4WXD A;  4AIJ A;  1F5T A;  2GZW A;  2RV8 A;  2Y48 A;  1XD7 A;  4XLN F;  1ZAR A;  4IRI A;  5ICE A;  1HKT A;  2H6C A;  5HDK A;  1KU3 A;  2RN7 A;  1SMT A;  1K78 B;  1TW3 A;  2V1X A;  3JW4 A;  1IXR C;  4OIN F;  2QBY A;  2BEO A;  3PQJ A;  5K5R A;  5L3E A;  4O6J A;  1J5Y A;  3WTT C;  1BI3 A;  2DPD A;  1DP7 P;  2IPQ X;  3KP2 A;  2YX7 A;  2OBP A;  4GCV A;  3GWZ A;  4LB5 A;  3P9I A;  2IW5 A;  3KLO A;  4MTE A;  1ZYR F;  5LEK A;  2VOP A;  2R7D A;  2CW0 F;  1CGP A;  3SFZ A;  1SMY F;  5F6F A;  1ON1 A;  5D6F A;  4A12 A;  1FBS A;  4CYD A;  1BJA A;  2V6C A;  5D8K B;  2EWN A;  2OD5 A;  2EA2 A;  4U88 A;  2LNB A;  3HHH A;  2HEO A;  4KUM A;  4KA4 A;  3WTX C;  4G6Q A;  2FML A;  1O57 A;  4HBL A;  2HKO A;  1RI7 A;  1IW7 F;  1XSD A;  1YQA A;  4G7Z F;  4XSX F;  3P9C A;  2OA4 A;  2LF8 A;  4KNY A;  2QQ9 A;  3WGI A;  1WWX A;  2GQQ A;  2P5V A;  2QUF A;  4IRH A;  4I98 B;  2LSO A;  1TQI A;  4KFC A;  2PN6 A;  5LLQ A;  5LRS A;  3VOD A;  3ZN1 A;  2K27 A;  1W7P B;  2D1H A;  4ON0 A;  3F23 A;  4A5N A;  1QBJ A;  3RPQ A;  2VOO A;  4HLY A;  1QZZ A;  5H6Q A;  1J0R A;  5H20 A;  3V8J A;  4MNU A;  5ILU A;  2L4M A;  4BAY A;  4MQ9 F;  1VTN C;  2VC1 A;  5D8L B;  3FXU A;  4WX9 A;  3N4M A;  1YG2 A;  5DYM A;  4KIF A;  3KP3 A;  3IKT A;  4KDP A;  1JHH A;  3CUQ C;  4A6D A;  1XN7 A;  5ILV A;  3ABU A;  1TTY A;  3LA2 A;  4BNC A;  4RB2 C;  2BE5 F;  3ECO A;  2OAZ A;  1LJ9 A;  4IPA A;  3DV8 A;  3ECH A;  3RI4 A;  3U9G A;  3ELK A;  1IRF A;  2M1B A;  1ZRD A;  2W25 A;  2HR3 A;  3DKW A;  1A04 A;  3HSR A;  2RQP A;  5D5U B;  3C18 A;  2H94 A;  2XAF A;  1KQ9 A;  1IN7 A;  2MD5 A;  4HDV A;  4HV5 A;  3CUQ B;  5HVQ C;  3GFL A;  1HST A;  4HX4 A;  2Z3Y A;  4RB1 A;  5DD4 A;  3Q9V A;  4ENM A;  2O03 A;  4HF0 A;  4Y15 A;  3BJO A;  3KFW X;  1U5T A;  3EYY A;  1FNN A;  2Z99 A;  2QEN A;  1T0F A;  2XAJ A;  3TO7 A;  3VOE A;  4P55 A;  1FBU A;  4Z2Y A;  1TW2 A;  4BHP A;  3FX3 A;  1YTY A;  5IT3 A;  1G4D A;  4G9Y A;  1TQP A;  1B59 A;  1TNT A;  3E3V A;  1Y0U A;  1FLI A;  1SFU A;  1FSH A;  2UXX A;  1ODD A;  2KIM A;  4CGZ A;  1FBQ A;  1ZHF A;  4ZZL A;  2DPU A;  1YIO A;  3GW2 A;  2VT2 A;  2EJR A;  1HW2 A;  5LRR A;  2F5E A;  1GVJ A;  4LK0 F;  4UXN A;  2HZT A;  3ROU A;  1STZ A;  3KET A;  5JVT A;  1REP C;  3R61 A;  2VBZ A;  3BP8 A;  5TJJ A;  4BXU A;  2K7L A;  4XRF A;  5DDG A;  2EFW A;  2Y0M A;  5HLI A;  5EEG A;  3HSE A;  1E17 A;  2O8X A;  4YII A;  4KMU X;  3QAH A;  3BRO A;  3LFK A;  1I1S A;  4HA8 A;  3J80 K;  1LNW A;  4PZJ A;  2F5D A;  2NNN A;  4HF2 A;  1KQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...