3F8JB

Mouse uhrf1 sra domain bound with hemi-methylated cpg, crystal structure in space group c222(1)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
206
structure length
206
Chain Sequence
b'IVPANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQYPEGYLEALANK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title UHRF1, a modular multi-domain protein, regulates replication-coupled crosstalk between DNA methylation and histone modifications.
pubmed rcsb
source organism Mus musculus
molecule tags Ligase/dna
total genus 64
structure length 206
sequence length 206
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02182 SAD_SRA SAD/SRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.10 Mainly Beta Roll PUA domain-like SRA-YDG 3f8jB01
2ZO0B 2ZKDA 3F8IA 2ZKFA 3DWHA 4PW7A 2ZKEA 3F8JB 3BI7A 3OLNA 3CLZA 4PW5A 2PB7A 2ZKGA 2ZO1B 3FDEA 4NJ5A 2ZO2B 4PW6A
chains in the Genus database with same CATH superfamily
2ZO0B 4F0PA 4F0QA 2ZKDA 3F8IA 3Q0BX 2ZKFA 4R28A 3Q0DA 4PW7A 2ZKEA 3F8JB 3BI7A 4YGIA 4OC8A 3OLNA 3CLZA 2ZO2B 2PB7A 4PW5A 3Q0CA 3Q0FA 2ZKGA 4RZLA 2ZO1B 3FDEA 4NJ5A 3DWHA 4PW6A
chains in the Genus database with same CATH topology
2ZO0B 2ZKDA 3F8IA 2ZKFA 3DWHA 4PW7A 2ZKEA 3F8JB 3BI7A 3OLNA 3CLZA 4PW5A 2PB7A 2ZKGA 2ZO1B 3FDEA 4NJ5A 2ZO2B 4PW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZO0 B;  2ZKD A;  3F8I A;  2ZKF A;  3DWH A;  4PW7 A;  2ZKE A;  3F8J B;  3BI7 A;  3OLN A;  3CLZ A;  4PW5 A;  2PB7 A;  2ZKG A;  2ZO1 B;  3FDE A;  4NJ5 A;  2ZO2 B;  4PW6 A; 
#chains in the Genus database with same CATH topology
 2ZO0 B;  4F0P A;  4F0Q A;  2ZKD A;  3F8I A;  3Q0B X;  2ZKF A;  4R28 A;  3Q0D A;  4PW7 A;  2ZKE A;  3F8J B;  3BI7 A;  4YGI A;  4OC8 A;  3OLN A;  3CLZ A;  2ZO2 B;  2PB7 A;  4PW5 A;  3Q0C A;  3Q0F A;  2ZKG A;  4RZL A;  2ZO1 B;  3FDE A;  4NJ5 A;  3DWH A;  4PW6 A; 
#chains in the Genus database with same CATH homology
 2ZO0 B;  2ZKD A;  3F8I A;  2ZKF A;  3DWH A;  4PW7 A;  2ZKE A;  3F8J B;  3BI7 A;  3OLN A;  3CLZ A;  4PW5 A;  2PB7 A;  2ZKG A;  2ZO1 B;  3FDE A;  4NJ5 A;  2ZO2 B;  4PW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...