3F8KA

Crystal structure of protein acetyltransferase (pat) from sulfolobus solfataricus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
131
Chain Sequence
IKIRKATKEDWEKIYQLYNSLSDEDLYLRFFHLYRITDHVTFLAEVDGKVVGEASLHKDGEFSLVVHRNYRTLGIGTLLVKTLIEEAKKSGLSTVKFYTLPENTPMIKIGRKLGFKMRFYEDEVYGEMRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein acetyltransferase
publication title Structure and Biochemical Characterization of Protein Acetyltransferase from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus p2
molecule tags Transferase
total genus 38
structure length 131
sequence length 142
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3f8kA00
2Z10A 5EC4A 3WR7A 3R9EA 2Z0ZA 3FYNA 4U9YA 1QSTA 2RC4A 4JD6A 5IX3A 2P6FA 3TO9A 4NCZA 4IUSA 4RI1A 4FD6A 2IL4A 1B87A 4JXQA 4EVYA 2X7BA 1VKCA 4KOTA 5F46A 4HNXB 4FD5A 1MJBA 2OB0A 1IIDA 2VQYA 2ZW7A 3D2MA 1KUVA 4X5KA 4IF5A 2K5TA 4QBJA 2ZPAA 4AG9A 2J8MA 2P0WA 5CNPA 2FE7A 4B5PA 2OZGA 1FY7A 2Z11A 4L8AA 1M44A 1KUXA 4FD4A 3FB3A 1M4DA 1L0CA 2H5MA 4Y49B 2OZHA 2R1IA 4UBRA 1Z4EA 3SHPA 1CJWA 4BMHA 4E8OA 1Z9UA 5EBVA 1PUAA 4ONUA 3JVNA 2OU2A 5IB0A 1NSLA 4PSWA 5KTDA 3S6GA 2D4PA 4QVTA 1B6BA 4F0YA 4MJ8A 1Q2CA 3F8KA 3BJ7A 4LX9A 4QC6A 1YR0A 2FXFA 2WPXA 3F5BA 4AVAA 3R95A 1BOBA 4MHDA 3FRMA 2VEZA 4CAXA 4R3LA 2Y0MA 2OZUA 3R9FA 3N7ZA 4JXRA 3K9UA 2HUZA 4YGOA 2B58A 2Q0YA 1QSRA 2VBQA 4U5YA 1MJ9A 2P6GA 4OAEA 4JWPA 2B3UA 4R87A 4E2AA 4MBUA 3R9GA 4HNWB 4PK3A 4XPLA 2VZZA 3FIXA 2AE6A 2ZXVA 4F6AA 2G0BA 2Q04A 4B5PB 1OZPA 3TT2A 4AVBA 4KOXA 1WWZA 3R96A 3EY5A 2REEA 4L89A 1LRZA 2Q4VA 3CXQA 2B5GA 4MI4A 4Y49C 1KUYA 3OWCA 1YLEA 4DNCA 2HQYA 4KORA 4R57A 4JJXA 2P6EA 2R98A 2ZW4A 4J3GA 4ZBGA 3C26A 1XEBA 1M1DA 1V0CA 4B5OA 4AB7A 5FVJA 1P4NA 2PC1A 2C27A 2G3AA 4UWIA 3P2HA 1XMTA 4KVOE 1J4JA 3TO6A 2BUEA 5ISVA 1RO5A 1YREA 3I3GA 3IGRA 5E96A 5GCNA 4KUAA 1QSOA 2PQ8A 4XNHC 2AJ6A 3TTHA 1XF8A 3S6HA 1S5KA 2ZW5A 3PP9A 2CNMA 4YRHA 5C88A 3DSBA 3T9YA 4JLYA 4YFJA 3JUWA 4FD7A 2JEVA 2NMTA 3MGDA 4KOUA 3TCVA 2FT0A 3T90A 4NSQA 4PK2A 3ZJ0A 3QAHA 5DWMA 1Q2YA 4R3KA 3D2PA 3FBUA 3DNSA 4KOWA 2EVNA 4NEXA 2FCKA 2Q7BA 4LUAA 1QSNA 4KOVA 1K4JA 2OH1A 2J8NA 2B5GB 5KTCA 1N71A 3TE4A 1IYKA 1SQHA 3NE7A 4XNHB 5I0CA 2JDDA 1PU9A 2B3VA 2Q44A 1Q2DA 2CNSA 4HKFA 4UA3A 2QMLA 3LODA 3LD2A 2QECA 3EFAA 1NMTA 4M3SA 1CM0A 3I9SA 1NE9A 1S7FA 1RXTA 2VXKA 2DXQA 5H84A 3IWGA 3R1KA 4KOYA 5HMNA 2REFA 3DR6A 4CRYB 2J8RA 1I12A 3SXNA 1IICA 3W6SA 2B4DA 3V8IA 1WK4A 3D3SA 3TOBA 3DDDA 3UY5A 4KLVA 4OADA 1IB1E 3D8PA 1YK3A 2R7HA 4MY0A 2PR1A 3TFYA 1XE4A 2QIRA 2JDCA 1Y7RA 2BSWA 4U9ZA 4CS0B 2FL4A 4OLLA 3BJ8A 4KLWA 1U6MA 5F48A 2PRBA 3FNCA 4H6ZA 4XPDB 1YX0A 3KKWA 1Y9WA 4AVCA 3EC4A 5DWNA 1S7LA 4KVXA 1R57A 4HNYB 3G3SA 5F47A 4NXYA 3TO7A 4R9MA 1KZFA 4NF1A 5H86A 3RYOA 4KOSA 3E0KA 3GYAA 3S6FA 1IYLA 2PDOA 4H89A 4CAWA 4QUSA 1P0HA 2GIVA 5KTAA 3GY9A 2O28A 4K30A 3GKRA 2BL1A 4PSXA 4MY3A 3TOAA 3W91A 2VZYA 5JPHA 1M4GA 2ATRA 2WPWA 4CRZB 3VWEA 4KVME 3B8GA 3EXNA 5J8FA 2B4BA 3BLNA 3SXOA 2G3TA 5C82A 2ARHA 1GHEA 3G8WA 2CY2A 3QB8A 2PR8A 2EUIA 3DR8A 1I21A 2Q4YA 1S7NA 2FSRA 2VI7A 3P2FA 2PSWA 3FXTA 1YVKA 2B4DB 3CXPA 2I79A 4M85A 4PV6A 1BO4A 1M4IA 2CNTA 4AG7A 3CXSA 2I00A 1S3ZA 1TIQA 3H4QA 2FIAA 2R8VA 4XPDC 5JQ4A 4H6UA 1I1DA 2GE3A 1UFHA 2ZW6A 2HV2A 3W6XA 1MJAA 2A4NA 4GS4A 3S6KA 4CAVA 3PZJA 2FIWA 5HH1A 4XPKA 1S7KA 2GANA 2KCWA 1ON0A 4QB9A 1VHSA 1Y9KA 3EO4A 2D4OA 1XIXA 3F0AA 4I49A 5J8CA 2BEIA 4RS2A 2FS5A 4KZTA 4UWJA 3PGPA 3ZZIA 1Z4RA 1YGHA 2F5IA 4E0AA 1YVOA 1QSMA 5F49A 5IV0A 4ORFA 1MK4A 3VWDA 4KUBA 4II9A 2JLMA 1S60A
chains in the Genus database with same CATH superfamily
2AFXA 2Z10A 5EC4A 4P4DA 3KGQA 3WR7A 3R9EA 2Z0ZA 5AG4A 4A33A 3FYNA 4U9YA 4A37A 1QSTA 2RC4A 2AFWA 4UF4A 4A38A 4JD6A 5IX3A 2P6FA 3TO9A 3GLJA 4IUSA 4NCZA 3FX6A 4RI1A 4DYOA 4FD6A 2PVVA 1LCPA 2IL4A 4B10A 1B87A 4JXQA 4OC2A 4EVYA 5JM6A 4Q38A 3QAYA 2PJ0A 2PIZA 4WWVA 3KL9A 5LRGA 2X7BA 1VKCA 4KOTA 4B6ZA 3HLPA 4MCQA 4ZGYB 5F46A 4HNXB 4FD5A 5JGFA 1MJBA 1F2PA 3IO1A 4MCRA 5BWAB 4YU9A 2OB0A 1IIDA 2VQYA 2ZW7A 3D2MA 1KUVA 3PEIA 4X5KA 2CXAA 2AFMA 2XEFA 4IF5A 3JTKA 4JYWA 1VIXA 2K5TA 4QBJA 2ZPAA 4AG9A 2J8MA 2P0WA 3D67A 1PCAA 5CNPA 1TXRA 3MN8A 1LFWA 2FE7A 2GU2A 4B5PA 3D7FA 1EE3P 2V8DA 3NH4A 1M4LA 1Q7LA 2OZGA 1FY7A 2Z11A 4L8AA 4ONWA 1M44A 1PYTB 1KUXA 4FD4A 3FB3A 2PJ3A 2BOAA 1M4DA 1L0CA 2H5MA 1NSAA 4TNUA 4Y49B 3WT4A 1DTDA 4LQ6A 2OZHA 3KASA 2R1IA 3B3SA 4KSAA 4UBRA 4YWYA 2Q43A 4UEZA 3KZWA 4UEFA 1Z4EA 2GFQA 3SHPA 5DS0A 4A32A 1CJWA 4BMHA 4UCMA 5A27A 4E8OA 1Z9UA 5EBVA 4CGLA 5G1ZA 1PUAA 3D7GA 3WABA 1DE4C 2Q4ZA 4ZX8A 4ONUA 3IC1A 5AG6A 3JVNA 4CYNA 2OU2A 5IB0A 4FAIA 4PQAA 3JRUA 2AFSA 2EWBA 4MHZA 4PXDA 2EK9A 1Z5RA 1IOFA 3CZXA 2Z3OA 1NSLA 3PFEA 3RO0A 5LYFA 4C7IA 4BD9A 2YNDA 2ZEPA 2V8HA 4PXEA 4PSWA 5KTDA 1GYTA 2Z3PA 1CBXA 4IK2A 3S6GA 2D4PA 3B3TA 4QVTA 1B6BA 4CGOA 4MJ8A 4F0YA 4MFPA 3KHZA 4MFKA 3LWUA 4PXBA 4CGMA 3SJEA 1Q2CA 3F8KA 3BJ7A 4LX9A 4NGMA 5G21A 4A94A 4C2XA 4EFDA 2PJBA 4QC6A 1IY7A 1YR0A 2FXFA 5AG7A 4ZI6A 4P4BA 2WPXA 4ZY1A 4ZY0A 3SI1A 5LRJA 3F5BA 5K8PA 1IGBA 4AVAA 3R95A 1BOBA 4MHDA 6CPAA 3B3WA 3FRMA 1ZLIA 2VEZA 4CAXA 4R3LA 2Y0MA 2OZUA 3R9FA 1X12A 3RNZA 4NJQA 3N7ZA 3GIUA 2YNCA 4JXRA 3K9UA 2HUZA 1TKHA 3VARA 1CG2A 1Z8WA 2EK8A 1LAPA 4EWTA 1ZG9A 4YGOA 2PJ2A 2CTCA 5HVFA 2B58A 2V77A 2Q0YA 1QSRA 2Q51A 1H8LA 1MJ9A 2PJ8A 2VBQA 2DPTA 2P6GA 1ELMP 4NGRA 4OAEA 2IMOA 4JWPA 4IHMA 2B3UA 2ZEFA 1X10A 4R87A 4E2AA 4MBUA 3R9GA 1TF8A 3HUVA 2XEIA 4HNWB 4NGQA 4PK3A 4BINA 4XPLA 4CGPA 3KR5A 2VZZA 3FIXA 2AE6A 2ZXVA 3H8EA 4F6AA 4RN7A 2G0BA 4OC1A 4R76A 5AGEA 2Q04A 3IFEA 4ZYQA 3T8WA 4B5PB 1OZPA 1F57A 2JBJA 2XEJA 3TT2A 5K8OA 4KS9A 4AVBA 3B35A 4KOXA 4CYOA 1WWZA 3R96A 3D7DA 1IOIA 1XRYA 1ZG8A 3EY5A 2REEA 3PB9X 4L89A 3SJFA 3VATA 1LRZA 2Q4VA 3BXMA 1TF9A 3CXQA 2B5GA 4M6HA 2ZEDA 4MI4A 4Z65A 4Y49C 3FECA 1KUYA 3OWCA 4IAVA 4BBHA 2C6PA 1HDUA 4CGNA 1YLEA 3D7HA 4DNCA 3TC8A 2C1CA 2HQYA 4ZY2A 4WJBA 2IQ6A 4GXHA 4KORA 2RFHA 4R57A 4X2TA 2ZENA 5AG5A 4A30A 4JJXA 2P6EA 3BHXA 2NYQA 3KR4A 2R98A 2ZW4A 3QNVA 3IIBA 4J3GA 3PBBA 3C26A 1XEBA 1M1DA 3FMCA 4GM5A 1V0CA 1Z8XA 4ZBGA 4B5OA 3WC7A 4AB7A 1ZO0A 2DF5A 5FVJA 4TWEA 3IU2A 3NFZA 3NE8A 1P4NA 2PC1A 3H8GA 3K2KA 1YSJA 3IU1A 3PB7X 5D29A 4K3NA 2C27A 2G3AA 4UWIA 3P2HA 5THWA 5EMIA 1LAMA 4CS0B 2Z3NA 1XMTA 4KVOE 1J4JA 3TO6A 2BUEA 1R3NA 5ISVA 4A39A 2AFOA 1RO5A 3FH4A 1YREA 3I3GA 3IGRA 5E96A 5GCNA 4PPZA 4KUAA 1QSOA 2PQ8A 4NJRA 2O4HA 1FT7A 1ZLHA 3PFOA 4XNHC 2AJ6A 2HC9A 3TTHA 3WC5A 1XF8A 2RB7A 3S6HA 1S5KA 2ZW5A 3PP9A 5CPAA 2CNMA 3CDXA 4YRHA 5C88A 4R7MA 3DSBA 3T9YA 4F9UA 4JLYA 4YFJA 3JUWA 2CTBA 4FD7A 2JEVA 2JEWA 2NMTA 2PJAA 3IWWA 3MGDA 4KOUA 4M6GA 4MXUA 4NGNA 3TCVA 4C2YA 4B14A 2C6CA 2FT0A 2GLFA 3T90A 4NSQA 4PK2A 3ZJ0A 4R6TA 3SJXA 3QAHA 5DWMA 4CPAA 1Q2YA 2YGWA 4R3KA 1RTQA 2PVWA 3D2PA 5G20A 5A28A 3FBUA 3DNSA 4KOWA 4B13A 2EVNA 4NEXA 4O23A 4P4EA 2FCKA 4A95A 2Q7BA 4LUAA 1QSNA 4MFQA 4KOVA 2J9AA 4KSIA 1TKFA 3SJGA 4LQGA 3ISZA 1K4JA 2OH1A 4MCPA 2J8NA 4FBEA 4B11A 2B5GB 2QJ8A 5KTCA 1QQ9A 4U5YA 4MFLA 3GUXA 1N71A 5LYIA 3TE4A 1IYKA 1SQHA 1Z2LA 1VHEA 5K8MA 2WYRA 3NE7A 3PB6X 4Q7AA 4HPSA 4XNHB 5I0CA 4OIDA 2JDDA 3IEHA 1PU9A 4X3RA 2B3VA 2Q44A 1Q2DA 2CNSA 4HKFA 4JZ0A 4UA3A 2QMLA 3LODA 2WSAA 1CX8A 4MRIA 1LANA 3LD2A 2QECA 3EFAA 1NMTA 3FF3A 3H8FA 2V8GA 1TKJA 4M3SA 4NGPA 1CM0A 3I9SA 2WZNA 1NE9A 2ABZA 1F2OA 1S7FA 4G1PA 1RXTA 2VXKA 1CP7A 2QVPA 3FEEA 2DXQA 5H84A 2EO8A 3IWGA 3FVLA 3R1KA 5LYDA 2OOTA 2HB6A 4KOYA 5HMNA 2REFA 3DR6A 4CRYB 4UCNA 2J8RA 4F9VA 4MHYA 2VL1A 1Y0RA 5G22A 3PB8X 5HVGA 1I12A 4CYQA 1R43A 3SXNA 2PJ7A 1IICA 3WC6A 5K8NA 5F09A 3W6SA 2B4DA 4OP4A 3V8IA 1WK4A 1YQEA 2WUUA 3S9LA 3B2YA 3D3SA 3D66A 4UEEA 3TOBA 2Z3LA 4H2KA 4FWUA 2YNCC 2Z3MA 2POKA 3IWEA 2NSMA 3DDDA 1HEEA 4KLVA 3K9TA 3NA6A 4OADA 1IB1E 3RBUA 3UY5A 4CYPA 3N5FA 3B3CA 3D8PA 4MHPA 4MCSA 1YK3A 2I3CA 2R7HA 3I1UA 4MY0A 2PR1A 2FVGA 1XOVA 2BCOA 2PCUA 1XE4A 2QIRA 2JDCA 1YLOA 1Y7RA 2BSWA 4U9ZA 3V38A 4C2ZA 2FL4A 2XEGA 4OLLA 2PJ9A 3BJ8A 4KLWA 4C7HA 2ZEGA 1U6MA 5F48A 2PRBA 3FNCA 4H6ZA 3FEDA 1YX0A 4XPDB 5I4MA 1AMPA 4R8FA 3KKWA 1Y9WA 3D4UA 1ARLA 4UCPA 4AVCA 3EC4A 5DWNA 1BPNA 4AXVA 5LRKA 1S7LA 4KVXA 1R57A 5ELYA 3TFYA 4HNYB 1XJOA 2ZEOA 3G3SA 4NXYA 4P4IA 5F47A 3TO7A 4R9MA 1ARMA 2ANPA 1KZFA 4NF1A 2ZOFA 5H86A 3RYOA 3PRTA 4KOSA 4OC3A 4EMEA 3E0KA 3CPXA 4MFJA 3GYAA 3S6FA 4Q36A 1IYLA 2PDOA 1AYEA 3S9NA 2GREA 4H89A 4CAWA 4QUSA 1P0HA 2GIVA 2QYVA 4PXCA 3GY9A 2O28A 4K30A 4MMOA 5KTAA 1QMUA 3GKRA 2BL1A 4PSXA 4MY3A 4P45A 3TOAA 3W91A 1Z8LA 2F8HA 2VZYA 1VHOA 5IB9A 5JPHA 1M4GA 3LACA 2ATRA 5JH9A 1XBUA 4MFZA 2WPWA 4P4JA 3CT9A 4CRZB 4NFRA 1YMEA 1BPMA 3B7IA 1BAVA 2PJ4A 3VWEA 4KVME 3B8GA 3DGVA 3EXNA 5J8FA 2ZELA 2B4BA 3BLNA 3SXOA 2G3TA 5C82A 2PJ6A 1IU8A 2ARHA 1GHEA 1JQGA 3G8WA 2CY2A 4OC0A 3QB8A 3NH8A 2PR8A 5HVHA 2EUIA 4RUHA 4P10A 2F7VA 2Q7SA 3DR8A 3KQXA 4OC5A 4P4FA 1HDQA 1FNOA 2PE3A 2GLJA 1I21A 3KQZA 4F8ZA 1CP6A 1ELLP 2Q4YA 4OMEA 4KSFA 1S7NA 3BI0A 3DLJA 2FSRA 1Y0YA 2VI7A 2PSWA 3P2FA 3NH5A 5LYLA 2Z3KA 1Z8TA 1YVKA 2B4DB 3FXTA 3SI0A 3RAMA 1ZG7A 1JWQA 3CXPA 2I79A 1BLLE 1AUGA 4M85A 1BO4A 1M4IA 4PV6A 3PBEA 5HXDA 4UIAA 3H5ZA 2CNTA 1UWYA 5CBMA 4A2ZA 4AG7A 1VGYA 3CXSA 1XMBA 2I00A 1S3ZA 1TIQA 1XFOA 4NGSA 3H4QA 3TX8A 5J1QA 2DEAA 2AFZA 2ODFA 2PIYA 3MRUA 2FIAA 4OC4A 2R8VA 4W9YA 4FUUA 4XPDC 5JQ4A 2EBJA 4H6UA 1I1DA 2GE3A 2YNEA 3BI1A 2PJ5A 2OR4A 3A9LA 1YW4A 2ZOGA 3ISXA 3B3VA 5D8NA 2DPSA 1UFHA 2ZW6A 2HV2A 3W6XA 4UFWA 1YW6A 1MJAA 2A4NA 4GS4A 3CPAA 4UFVA 4MHNA 2JBKA 1LOKA 4A31A 3S6KA 3L2NA 4X8IA 4ZX9A 4CAVA 2PRQA 3V7ZA 3PZJA 2FIWA 3RZAA 5HH1A 2IJZA 4P6YA 4M6IA 4XPKA 1A2ZA 1S7KA 2GANA 2KCWA 3KHXA 2PJ1A 1ON0A 2PJCA 4QB9A 1VHSA 1Y9KA 3S9MA 3D68A 2AFUA 1CPXA 2BO9A 2ZEHA 3EO4A 3FJUA 4B12A 2O53A 2D4OA 1XIXA 3KI9A 3F0AA 4I49A 4P44A 7CPAA 2V8VA 5J8CA 2CIJA 2BEIA 4RS2A 2ZEEA 4OIWA 4DUKA 2FS5A 4KZTA 4UIBA 1KWMA 4UWJA 3PGPA 3ZZIA 1Z4RA 1YGHA 3GB0A 3IJ3A 4NGTA 1OBRA 2F5IA 1Y7EA 4OKOA 4F0XA 4DJLA 4CAFA 4E0AA 3LMSA 1YVOA 1QSMA 2C6GA 2ZEMA 5F49A 2CF4A 3PB4X 1CPSA 2G9DA 3SI2A 4C68A 8CPAA 5IV0A 4ORFA 3VH9A 1MK4A 4CAEA 3VWDA 4KUBA 4II9A 4UFXA 2JLMA 1S60A
chains in the Genus database with same CATH topology
2Z10A 5EC4A 3WR7A 3R9EA 2Z0ZA 5AG4A 4A33A 3FYNA 4U9YA 1QSTA 2RC4A 4JD6A 5IX3A 2P6FA 3TO9A 4NCZA 4IUSA 4RI1A 4FD6A 2IL4A 4B10A 1B87A 4JXQA 4EVYA 4Q38A 2X7BA 1VKCA 4KOTA 4ZGYB 5F46A 4HNXB 4FD5A 1MJBA 5BWAB 2OB0A 1IIDA 2VQYA 3D2MA 2ZW7A 1KUVA 4X5KA 2CXAA 4IF5A 3JTKA 2K5TA 4QBJA 2ZPAA 4AG9A 2J8MA 2P0WA 5CNPA 2FE7A 4B5PA 2OZGA 1FY7A 2Z11A 4L8AA 1M44A 1KUXA 4FD4A 3FB3A 1M4DA 1L0CA 2H5MA 4Y49B 2OZHA 2R1IA 4KSAA 4UBRA 1Z4EA 3SHPA 4A32A 1CJWA 4BMHA 4UCMA 5A27A 4E8OA 1Z9UA 5EBVA 4CGLA 5G1ZA 1PUAA 4ONUA 5AG6A 4CYNA 3JVNA 2OU2A 5IB0A 2Z3OA 1NSLA 2YNDA 4PSWA 5KTDA 2Z3PA 3S6GA 2D4PA 4QVTA 4CGOA 1B6BA 4F0YA 4MJ8A 4MFPA 4MFKA 4CGMA 1Q2CA 3F8KA 3BJ7A 4LX9A 5G21A 4C2XA 4QC6A 1YR0A 2FXFA 5AG7A 2WPXA 3F5BA 4AVAA 3R95A 1BOBA 4MHDA 3FRMA 2VEZA 4CAXA 4R3LA 2Y0MA 2OZUA 3R9FA 3N7ZA 2YNCA 4JXRA 3K9UA 2HUZA 4YGOA 2B58A 2Q0YA 1QSRA 2VBQA 4U5YA 1MJ9A 2DPTA 2P6GA 4OAEA 4JWPA 2B3UA 4R87A 4E2AA 4MBUA 3R9GA 4HNWB 4PK3A 4XPLA 4CGPA 2VZZA 3FIXA 2AE6A 2ZXVA 4F6AA 2G0BA 5AGEA 2Q04A 4B5PB 1OZPA 3TT2A 4KS9A 4AVBA 4KOXA 4CYOA 1WWZA 3R96A 3EY5A 2REEA 4L89A 1LRZA 2Q4VA 3CXQA 2B5GA 4MI4A 4Y49C 1KUYA 3OWCA 4BBHA 4CGNA 1YLEA 4DNCA 2HQYA 4KORA 4R57A 5AG5A 4A30A 4JJXA 2P6EA 2R98A 2ZW4A 4J3GA 4ZBGA 3C26A 1XEBA 1M1DA 1V0CA 4B5OA 4AB7A 1ZO0A 5FVJA 3IU2A 1P4NA 2PC1A 3IU1A 2C27A 2G3AA 4UWIA 3P2HA 2Z3NA 1XMTA 4KVOE 1J4JA 3TO6A 2BUEA 5ISVA 1RO5A 1YREA 3I3GA 3IGRA 5E96A 5GCNA 4KUAA 1QSOA 2PQ8A 4XNHC 2AJ6A 3TTHA 1XF8A 3S6HA 1S5KA 2ZW5A 3PP9A 2CNMA 4YRHA 5C88A 3DSBA 3T9YA 4JLYA 4YFJA 3JUWA 4FD7A 2JEVA 2NMTA 3MGDA 4KOUA 3TCVA 4C2YA 4B14A 2FT0A 3T90A 4NSQA 4PK2A 3ZJ0A 3QAHA 5DWMA 1Q2YA 2YGWA 4R3KA 3D2PA 5G20A 5A28A 3FBUA 3DNSA 4KOWA 4B13A 2EVNA 4NEXA 2FCKA 4A95A 2Q7BA 4LUAA 1QSNA 4MFQA 4KOVA 1K4JA 2OH1A 2J8NA 4B11A 2B5GB 5KTCA 4MFLA 1N71A 3TE4A 1IYKA 1SQHA 3NE7A 4XNHB 5I0CA 2JDDA 1PU9A 2B3VA 2Q44A 1Q2DA 2CNSA 4HKFA 4UA3A 2QMLA 3LODA 2WSAA 3LD2A 2QECA 3EFAA 1NMTA 4M3SA 1CM0A 3I9SA 1NE9A 1S7FA 1RXTA 2VXKA 2DXQA 5H84A 3IWGA 3R1KA 4KOYA 5HMNA 2REFA 3DR6A 4CRYB 4UCNA 2J8RA 5G22A 1I12A 4CYQA 3SXNA 1IICA 3W6SA 2B4DA 3V8IA 1WK4A 2WUUA 3D3SA 3TOBA 2Z3LA 2YNCC 2Z3MA 3IWEA 3DDDA 3UY5A 4KLVA 4OADA 1IB1E 4CYPA 3D8PA 1YK3A 2R7HA 4MY0A 2PR1A 3TFYA 1XE4A 2QIRA 2JDCA 4C7IA 1Y7RA 2BSWA 4U9ZA 4C2ZA 4C7HA 2FL4A 4OLLA 4CS0B 3BJ8A 4KLWA 1U6MA 5F48A 2PRBA 3FNCA 4H6ZA 4XPDB 1YX0A 3KKWA 1Y9WA 4UCPA 4AVCA 3EC4A 5DWNA 1S7LA 4KVXA 1R57A 4HNYB 3G3SA 5F47A 4NXYA 3TO7A 4R9MA 1KZFA 4NF1A 5H86A 3RYOA 4KOSA 3E0KA 4MFJA 3GYAA 3S6FA 4Q36A 1IYLA 2PDOA 4H89A 4CAWA 4QUSA 1P0HA 2GIVA 5KTAA 3GY9A 2O28A 4K30A 3GKRA 2BL1A 4PSXA 4MY3A 3TOAA 3W91A 2VZYA 5JPHA 1M4GA 2ATRA 4MFZA 2WPWA 4CRZB 3VWEA 4KVME 3B8GA 3EXNA 5J8FA 2B4BA 3BLNA 3SXOA 2G3TA 5C82A 2ARHA 1GHEA 3G8WA 2CY2A 3QB8A 2PR8A 2EUIA 3DR8A 1I21A 2Q4YA 4KSFA 1S7NA 2FSRA 2VI7A 3P2FA 2PSWA 2Z3KA 3FXTA 1YVKA 2B4DB 3CXPA 2I79A 4M85A 4PV6A 1BO4A 1M4IA 3H5ZA 2CNTA 4A2ZA 4AG7A 3CXSA 2I00A 1S3ZA 1TIQA 3H4QA 2FIAA 2R8VA 4XPDC 5JQ4A 4H6UA 1I1DA 2GE3A 2YNEA 3A9LA 2DPSA 1UFHA 2ZW6A 2HV2A 3W6XA 4UFWA 1MJAA 2A4NA 4GS4A 4UFVA 4A31A 3S6KA 4CAVA 3PZJA 2FIWA 5HH1A 4XPKA 1S7KA 2GANA 2KCWA 1ON0A 4QB9A 1VHSA 1Y9KA 3EO4A 4B12A 2D4OA 1XIXA 3F0AA 4I49A 5J8CA 2BEIA 4RS2A 2FS5A 4KZTA 4UWJA 3PGPA 3ZZIA 1Z4RA 1YGHA 2F5IA 4F0XA 4CAFA 4E0AA 1YVOA 1QSMA 5F49A 4C68A 5IV0A 4ORFA 1MK4A 4CAEA 3VWDA 4KUBA 4II9A 4UFXA 2JLMA 1S60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z10 A;  5EC4 A;  3WR7 A;  3R9E A;  2Z0Z A;  3FYN A;  4U9Y A;  1QST A;  2RC4 A;  4JD6 A;  5IX3 A;  2P6F A;  3TO9 A;  4NCZ A;  4IUS A;  4RI1 A;  4FD6 A;  2IL4 A;  1B87 A;  4JXQ A;  4EVY A;  2X7B A;  1VKC A;  4KOT A;  5F46 A;  4HNX B;  4FD5 A;  1MJB A;  2OB0 A;  1IID A;  2VQY A;  2ZW7 A;  3D2M A;  1KUV A;  4X5K A;  4IF5 A;  2K5T A;  4QBJ A;  2ZPA A;  4AG9 A;  2J8M A;  2P0W A;  5CNP A;  2FE7 A;  4B5P A;  2OZG A;  1FY7 A;  2Z11 A;  4L8A A;  1M44 A;  1KUX A;  4FD4 A;  3FB3 A;  1M4D A;  1L0C A;  2H5M A;  4Y49 B;  2OZH A;  2R1I A;  4UBR A;  1Z4E A;  3SHP A;  1CJW A;  4BMH A;  4E8O A;  1Z9U A;  5EBV A;  1PUA A;  4ONU A;  3JVN A;  2OU2 A;  5IB0 A;  1NSL A;  4PSW A;  5KTD A;  3S6G A;  2D4P A;  4QVT A;  1B6B A;  4F0Y A;  4MJ8 A;  1Q2C A;  3F8K A;  3BJ7 A;  4LX9 A;  4QC6 A;  1YR0 A;  2FXF A;  2WPX A;  3F5B A;  4AVA A;  3R95 A;  1BOB A;  4MHD A;  3FRM A;  2VEZ A;  4CAX A;  4R3L A;  2Y0M A;  2OZU A;  3R9F A;  3N7Z A;  4JXR A;  3K9U A;  2HUZ A;  4YGO A;  2B58 A;  2Q0Y A;  1QSR A;  2VBQ A;  4U5Y A;  1MJ9 A;  2P6G A;  4OAE A;  4JWP A;  2B3U A;  4R87 A;  4E2A A;  4MBU A;  3R9G A;  4HNW B;  4PK3 A;  4XPL A;  2VZZ A;  3FIX A;  2AE6 A;  2ZXV A;  4F6A A;  2G0B A;  2Q04 A;  4B5P B;  1OZP A;  3TT2 A;  4AVB A;  4KOX A;  1WWZ A;  3R96 A;  3EY5 A;  2REE A;  4L89 A;  1LRZ A;  2Q4V A;  3CXQ A;  2B5G A;  4MI4 A;  4Y49 C;  1KUY A;  3OWC A;  1YLE A;  4DNC A;  2HQY A;  4KOR A;  4R57 A;  4JJX A;  2P6E A;  2R98 A;  2ZW4 A;  4J3G A;  4ZBG A;  3C26 A;  1XEB A;  1M1D A;  1V0C A;  4B5O A;  4AB7 A;  5FVJ A;  1P4N A;  2PC1 A;  2C27 A;  2G3A A;  4UWI A;  3P2H A;  1XMT A;  4KVO E;  1J4J A;  3TO6 A;  2BUE A;  5ISV A;  1RO5 A;  1YRE A;  3I3G A;  3IGR A;  5E96 A;  5GCN A;  4KUA A;  1QSO A;  2PQ8 A;  4XNH C;  2AJ6 A;  3TTH A;  1XF8 A;  3S6H A;  1S5K A;  2ZW5 A;  3PP9 A;  2CNM A;  4YRH A;  5C88 A;  3DSB A;  3T9Y A;  4JLY A;  4YFJ A;  3JUW A;  4FD7 A;  2JEV A;  2NMT A;  3MGD A;  4KOU A;  3TCV A;  2FT0 A;  3T90 A;  4NSQ A;  4PK2 A;  3ZJ0 A;  3QAH A;  5DWM A;  1Q2Y A;  4R3K A;  3D2P A;  3FBU A;  3DNS A;  4KOW A;  2EVN A;  4NEX A;  2FCK A;  2Q7B A;  4LUA A;  1QSN A;  4KOV A;  1K4J A;  2OH1 A;  2J8N A;  2B5G B;  5KTC A;  1N71 A;  3TE4 A;  1IYK A;  1SQH A;  3NE7 A;  4XNH B;  5I0C A;  2JDD A;  1PU9 A;  2B3V A;  2Q44 A;  1Q2D A;  2CNS A;  4HKF A;  4UA3 A;  2QML A;  3LOD A;  3LD2 A;  2QEC A;  3EFA A;  1NMT A;  4M3S A;  1CM0 A;  3I9S A;  1NE9 A;  1S7F A;  1RXT A;  2VXK A;  2DXQ A;  5H84 A;  3IWG A;  3R1K A;  4KOY A;  5HMN A;  2REF A;  3DR6 A;  4CRY B;  2J8R A;  1I12 A;  3SXN A;  1IIC A;  3W6S A;  2B4D A;  3V8I A;  1WK4 A;  3D3S A;  3TOB A;  3DDD A;  3UY5 A;  4KLV A;  4OAD A;  1IB1 E;  3D8P A;  1YK3 A;  2R7H A;  4MY0 A;  2PR1 A;  3TFY A;  1XE4 A;  2QIR A;  2JDC A;  1Y7R A;  2BSW A;  4U9Z A;  4CS0 B;  2FL4 A;  4OLL A;  3BJ8 A;  4KLW A;  1U6M A;  5F48 A;  2PRB A;  3FNC A;  4H6Z A;  4XPD B;  1YX0 A;  3KKW A;  1Y9W A;  4AVC A;  3EC4 A;  5DWN A;  1S7L A;  4KVX A;  1R57 A;  4HNY B;  3G3S A;  5F47 A;  4NXY A;  3TO7 A;  4R9M A;  1KZF A;  4NF1 A;  5H86 A;  3RYO A;  4KOS A;  3E0K A;  3GYA A;  3S6F A;  1IYL A;  2PDO A;  4H89 A;  4CAW A;  4QUS A;  1P0H A;  2GIV A;  5KTA A;  3GY9 A;  2O28 A;  4K30 A;  3GKR A;  2BL1 A;  4PSX A;  4MY3 A;  3TOA A;  3W91 A;  2VZY A;  5JPH A;  1M4G A;  2ATR A;  2WPW A;  4CRZ B;  3VWE A;  4KVM E;  3B8G A;  3EXN A;  5J8F A;  2B4B A;  3BLN A;  3SXO A;  2G3T A;  5C82 A;  2ARH A;  1GHE A;  3G8W A;  2CY2 A;  3QB8 A;  2PR8 A;  2EUI A;  3DR8 A;  1I21 A;  2Q4Y A;  1S7N A;  2FSR A;  2VI7 A;  3P2F A;  2PSW A;  3FXT A;  1YVK A;  2B4D B;  3CXP A;  2I79 A;  4M85 A;  4PV6 A;  1BO4 A;  1M4I A;  2CNT A;  4AG7 A;  3CXS A;  2I00 A;  1S3Z A;  1TIQ A;  3H4Q A;  2FIA A;  2R8V A;  4XPD C;  5JQ4 A;  4H6U A;  1I1D A;  2GE3 A;  1UFH A;  2ZW6 A;  2HV2 A;  3W6X A;  1MJA A;  2A4N A;  4GS4 A;  3S6K A;  4CAV A;  3PZJ A;  2FIW A;  5HH1 A;  4XPK A;  1S7K A;  2GAN A;  2KCW A;  1ON0 A;  4QB9 A;  1VHS A;  1Y9K A;  3EO4 A;  2D4O A;  1XIX A;  3F0A A;  4I49 A;  5J8C A;  2BEI A;  4RS2 A;  2FS5 A;  4KZT A;  4UWJ A;  3PGP A;  3ZZI A;  1Z4R A;  1YGH A;  2F5I A;  4E0A A;  1YVO A;  1QSM A;  5F49 A;  5IV0 A;  4ORF A;  1MK4 A;  3VWD A;  4KUB A;  4II9 A;  2JLM A;  1S60 A; 
#chains in the Genus database with same CATH topology
 2AFX A;  2Z10 A;  5EC4 A;  4P4D A;  3KGQ A;  3WR7 A;  3R9E A;  2Z0Z A;  5AG4 A;  4A33 A;  3FYN A;  4U9Y A;  4A37 A;  1QST A;  2RC4 A;  2AFW A;  4UF4 A;  4A38 A;  4JD6 A;  5IX3 A;  2P6F A;  3TO9 A;  3GLJ A;  4IUS A;  4NCZ A;  3FX6 A;  4RI1 A;  4DYO A;  4FD6 A;  2PVV A;  1LCP A;  2IL4 A;  4B10 A;  1B87 A;  4JXQ A;  4OC2 A;  4EVY A;  5JM6 A;  4Q38 A;  3QAY A;  2PJ0 A;  2PIZ A;  4WWV A;  3KL9 A;  5LRG A;  2X7B A;  1VKC A;  4KOT A;  4B6Z A;  3HLP A;  4MCQ A;  4ZGY B;  5F46 A;  4HNX B;  4FD5 A;  5JGF A;  1MJB A;  1F2P A;  3IO1 A;  4MCR A;  5BWA B;  4YU9 A;  2OB0 A;  1IID A;  2VQY A;  2ZW7 A;  3D2M A;  1KUV A;  3PEI A;  4X5K A;  2CXA A;  2AFM A;  2XEF A;  4IF5 A;  3JTK A;  4JYW A;  1VIX A;  2K5T A;  4QBJ A;  2ZPA A;  4AG9 A;  2J8M A;  2P0W A;  3D67 A;  1PCA A;  5CNP A;  1TXR A;  3MN8 A;  1LFW A;  2FE7 A;  2GU2 A;  4B5P A;  3D7F A;  1EE3 P;  2V8D A;  3NH4 A;  1M4L A;  1Q7L A;  2OZG A;  1FY7 A;  2Z11 A;  4L8A A;  4ONW A;  1M44 A;  1PYT B;  1KUX A;  4FD4 A;  3FB3 A;  2PJ3 A;  2BOA A;  1M4D A;  1L0C A;  2H5M A;  1NSA A;  4TNU A;  4Y49 B;  3WT4 A;  1DTD A;  4LQ6 A;  2OZH A;  3KAS A;  2R1I A;  3B3S A;  4KSA A;  4UBR A;  4YWY A;  2Q43 A;  4UEZ A;  3KZW A;  4UEF A;  1Z4E A;  2GFQ A;  3SHP A;  5DS0 A;  4A32 A;  1CJW A;  4BMH A;  4UCM A;  5A27 A;  4E8O A;  1Z9U A;  5EBV A;  4CGL A;  5G1Z A;  1PUA A;  3D7G A;  3WAB A;  1DE4 C;  2Q4Z A;  4ZX8 A;  4ONU A;  3IC1 A;  5AG6 A;  3JVN A;  4CYN A;  2OU2 A;  5IB0 A;  4FAI A;  4PQA A;  3JRU A;  2AFS A;  2EWB A;  4MHZ A;  4PXD A;  2EK9 A;  1Z5R A;  1IOF A;  3CZX A;  2Z3O A;  1NSL A;  3PFE A;  3RO0 A;  5LYF A;  4C7I A;  4BD9 A;  2YND A;  2ZEP A;  2V8H A;  4PXE A;  4PSW A;  5KTD A;  1GYT A;  2Z3P A;  1CBX A;  4IK2 A;  3S6G A;  2D4P A;  3B3T A;  4QVT A;  1B6B A;  4CGO A;  4MJ8 A;  4F0Y A;  4MFP A;  3KHZ A;  4MFK A;  3LWU A;  4PXB A;  4CGM A;  3SJE A;  1Q2C A;  3F8K A;  3BJ7 A;  4LX9 A;  4NGM A;  5G21 A;  4A94 A;  4C2X A;  4EFD A;  2PJB A;  4QC6 A;  1IY7 A;  1YR0 A;  2FXF A;  5AG7 A;  4ZI6 A;  4P4B A;  2WPX A;  4ZY1 A;  4ZY0 A;  3SI1 A;  5LRJ A;  3F5B A;  5K8P A;  1IGB A;  4AVA A;  3R95 A;  1BOB A;  4MHD A;  6CPA A;  3B3W A;  3FRM A;  1ZLI A;  2VEZ A;  4CAX A;  4R3L A;  2Y0M A;  2OZU A;  3R9F A;  1X12 A;  3RNZ A;  4NJQ A;  3N7Z A;  3GIU A;  2YNC A;  4JXR A;  3K9U A;  2HUZ A;  1TKH A;  3VAR A;  1CG2 A;  1Z8W A;  2EK8 A;  1LAP A;  4EWT A;  1ZG9 A;  4YGO A;  2PJ2 A;  2CTC A;  5HVF A;  2B58 A;  2V77 A;  2Q0Y A;  1QSR A;  2Q51 A;  1H8L A;  1MJ9 A;  2PJ8 A;  2VBQ A;  2DPT A;  2P6G A;  1ELM P;  4NGR A;  4OAE A;  2IMO A;  4JWP A;  4IHM A;  2B3U A;  2ZEF A;  1X10 A;  4R87 A;  4E2A A;  4MBU A;  3R9G A;  1TF8 A;  3HUV A;  2XEI A;  4HNW B;  4NGQ A;  4PK3 A;  4BIN A;  4XPL A;  4CGP A;  3KR5 A;  2VZZ A;  3FIX A;  2AE6 A;  2ZXV A;  3H8E A;  4F6A A;  4RN7 A;  2G0B A;  4OC1 A;  4R76 A;  5AGE A;  2Q04 A;  3IFE A;  4ZYQ A;  3T8W A;  4B5P B;  1OZP A;  1F57 A;  2JBJ A;  2XEJ A;  3TT2 A;  5K8O A;  4KS9 A;  4AVB A;  3B35 A;  4KOX A;  4CYO A;  1WWZ A;  3R96 A;  3D7D A;  1IOI A;  1XRY A;  1ZG8 A;  3EY5 A;  2REE A;  3PB9 X;  4L89 A;  3SJF A;  3VAT A;  1LRZ A;  2Q4V A;  3BXM A;  1TF9 A;  3CXQ A;  2B5G A;  4M6H A;  2ZED A;  4MI4 A;  4Z65 A;  4Y49 C;  3FEC A;  1KUY A;  3OWC A;  4IAV A;  4BBH A;  2C6P A;  1HDU A;  4CGN A;  1YLE A;  3D7H A;  4DNC A;  3TC8 A;  2C1C A;  2HQY A;  4ZY2 A;  4WJB A;  2IQ6 A;  4GXH A;  4KOR A;  2RFH A;  4R57 A;  4X2T A;  2ZEN A;  5AG5 A;  4A30 A;  4JJX A;  2P6E A;  3BHX A;  2NYQ A;  3KR4 A;  2R98 A;  2ZW4 A;  3QNV A;  3IIB A;  4J3G A;  3PBB A;  3C26 A;  1XEB A;  1M1D A;  3FMC A;  4GM5 A;  1V0C A;  1Z8X A;  4ZBG A;  4B5O A;  3WC7 A;  4AB7 A;  1ZO0 A;  2DF5 A;  5FVJ A;  4TWE A;  3IU2 A;  3NFZ A;  3NE8 A;  1P4N A;  2PC1 A;  3H8G A;  3K2K A;  1YSJ A;  3IU1 A;  3PB7 X;  5D29 A;  4K3N A;  2C27 A;  2G3A A;  4UWI A;  3P2H A;  5THW A;  5EMI A;  1LAM A;  4CS0 B;  2Z3N A;  1XMT A;  4KVO E;  1J4J A;  3TO6 A;  2BUE A;  1R3N A;  5ISV A;  4A39 A;  2AFO A;  1RO5 A;  3FH4 A;  1YRE A;  3I3G A;  3IGR A;  5E96 A;  5GCN A;  4PPZ A;  4KUA A;  1QSO A;  2PQ8 A;  4NJR A;  2O4H A;  1FT7 A;  1ZLH A;  3PFO A;  4XNH C;  2AJ6 A;  2HC9 A;  3TTH A;  3WC5 A;  1XF8 A;  2RB7 A;  3S6H A;  1S5K A;  2ZW5 A;  3PP9 A;  5CPA A;  2CNM A;  3CDX A;  4YRH A;  5C88 A;  4R7M A;  3DSB A;  3T9Y A;  4F9U A;  4JLY A;  4YFJ A;  3JUW A;  2CTB A;  4FD7 A;  2JEV A;  2JEW A;  2NMT A;  2PJA A;  3IWW A;  3MGD A;  4KOU A;  4M6G A;  4MXU A;  4NGN A;  3TCV A;  4C2Y A;  4B14 A;  2C6C A;  2FT0 A;  2GLF A;  3T90 A;  4NSQ A;  4PK2 A;  3ZJ0 A;  4R6T A;  3SJX A;  3QAH A;  5DWM A;  4CPA A;  1Q2Y A;  2YGW A;  4R3K A;  1RTQ A;  2PVW A;  3D2P A;  5G20 A;  5A28 A;  3FBU A;  3DNS A;  4KOW A;  4B13 A;  2EVN A;  4NEX A;  4O23 A;  4P4E A;  2FCK A;  4A95 A;  2Q7B A;  4LUA A;  1QSN A;  4MFQ A;  4KOV A;  2J9A A;  4KSI A;  1TKF A;  3SJG A;  4LQG A;  3ISZ A;  1K4J A;  2OH1 A;  4MCP A;  2J8N A;  4FBE A;  4B11 A;  2B5G B;  2QJ8 A;  5KTC A;  1QQ9 A;  4U5Y A;  4MFL A;  3GUX A;  1N71 A;  5LYI A;  3TE4 A;  1IYK A;  1SQH A;  1Z2L A;  1VHE A;  5K8M A;  2WYR A;  3NE7 A;  3PB6 X;  4Q7A A;  4HPS A;  4XNH B;  5I0C A;  4OID A;  2JDD A;  3IEH A;  1PU9 A;  4X3R A;  2B3V A;  2Q44 A;  1Q2D A;  2CNS A;  4HKF A;  4JZ0 A;  4UA3 A;  2QML A;  3LOD A;  2WSA A;  1CX8 A;  4MRI A;  1LAN A;  3LD2 A;  2QEC A;  3EFA A;  1NMT A;  3FF3 A;  3H8F A;  2V8G A;  1TKJ A;  4M3S A;  4NGP A;  1CM0 A;  3I9S A;  2WZN A;  1NE9 A;  2ABZ A;  1F2O A;  1S7F A;  4G1P A;  1RXT A;  2VXK A;  1CP7 A;  2QVP A;  3FEE A;  2DXQ A;  5H84 A;  2EO8 A;  3IWG A;  3FVL A;  3R1K A;  5LYD A;  2OOT A;  2HB6 A;  4KOY A;  5HMN A;  2REF A;  3DR6 A;  4CRY B;  4UCN A;  2J8R A;  4F9V A;  4MHY A;  2VL1 A;  1Y0R A;  5G22 A;  3PB8 X;  5HVG A;  1I12 A;  4CYQ A;  1R43 A;  3SXN A;  2PJ7 A;  1IIC A;  3WC6 A;  5K8N A;  5F09 A;  3W6S A;  2B4D A;  4OP4 A;  3V8I A;  1WK4 A;  1YQE A;  2WUU A;  3S9L A;  3B2Y A;  3D3S A;  3D66 A;  4UEE A;  3TOB A;  2Z3L A;  4H2K A;  4FWU A;  2YNC C;  2Z3M A;  2POK A;  3IWE A;  2NSM A;  3DDD A;  1HEE A;  4KLV A;  3K9T A;  3NA6 A;  4OAD A;  1IB1 E;  3RBU A;  3UY5 A;  4CYP A;  3N5F A;  3B3C A;  3D8P A;  4MHP A;  4MCS A;  1YK3 A;  2I3C A;  2R7H A;  3I1U A;  4MY0 A;  2PR1 A;  2FVG A;  1XOV A;  2BCO A;  2PCU A;  1XE4 A;  2QIR A;  2JDC A;  1YLO A;  1Y7R A;  2BSW A;  4U9Z A;  3V38 A;  4C2Z A;  2FL4 A;  2XEG A;  4OLL A;  2PJ9 A;  3BJ8 A;  4KLW A;  4C7H A;  2ZEG A;  1U6M A;  5F48 A;  2PRB A;  3FNC A;  4H6Z A;  3FED A;  1YX0 A;  4XPD B;  5I4M A;  1AMP A;  4R8F A;  3KKW A;  1Y9W A;  3D4U A;  1ARL A;  4UCP A;  4AVC A;  3EC4 A;  5DWN A;  1BPN A;  4AXV A;  5LRK A;  1S7L A;  4KVX A;  1R57 A;  5ELY A;  3TFY A;  4HNY B;  1XJO A;  2ZEO A;  3G3S A;  4NXY A;  4P4I A;  5F47 A;  3TO7 A;  4R9M A;  1ARM A;  2ANP A;  1KZF A;  4NF1 A;  2ZOF A;  5H86 A;  3RYO A;  3PRT A;  4KOS A;  4OC3 A;  4EME A;  3E0K A;  3CPX A;  4MFJ A;  3GYA A;  3S6F A;  4Q36 A;  1IYL A;  2PDO A;  1AYE A;  3S9N A;  2GRE A;  4H89 A;  4CAW A;  4QUS A;  1P0H A;  2GIV A;  2QYV A;  4PXC A;  3GY9 A;  2O28 A;  4K30 A;  4MMO A;  5KTA A;  1QMU A;  3GKR A;  2BL1 A;  4PSX A;  4MY3 A;  4P45 A;  3TOA A;  3W91 A;  1Z8L A;  2F8H A;  2VZY A;  1VHO A;  5IB9 A;  5JPH A;  1M4G A;  3LAC A;  2ATR A;  5JH9 A;  1XBU A;  4MFZ A;  2WPW A;  4P4J A;  3CT9 A;  4CRZ B;  4NFR A;  1YME A;  1BPM A;  3B7I A;  1BAV A;  2PJ4 A;  3VWE A;  4KVM E;  3B8G A;  3DGV A;  3EXN A;  5J8F A;  2ZEL A;  2B4B A;  3BLN A;  3SXO A;  2G3T A;  5C82 A;  2PJ6 A;  1IU8 A;  2ARH A;  1GHE A;  1JQG A;  3G8W A;  2CY2 A;  4OC0 A;  3QB8 A;  3NH8 A;  2PR8 A;  5HVH A;  2EUI A;  4RUH A;  4P10 A;  2F7V A;  2Q7S A;  3DR8 A;  3KQX A;  4OC5 A;  4P4F A;  1HDQ A;  1FNO A;  2PE3 A;  2GLJ A;  1I21 A;  3KQZ A;  4F8Z A;  1CP6 A;  1ELL P;  2Q4Y A;  4OME A;  4KSF A;  1S7N A;  3BI0 A;  3DLJ A;  2FSR A;  1Y0Y A;  2VI7 A;  2PSW A;  3P2F A;  3NH5 A;  5LYL A;  2Z3K A;  1Z8T A;  1YVK A;  2B4D B;  3FXT A;  3SI0 A;  3RAM A;  1ZG7 A;  1JWQ A;  3CXP A;  2I79 A;  1BLL E;  1AUG A;  4M85 A;  1BO4 A;  1M4I A;  4PV6 A;  3PBE A;  5HXD A;  4UIA A;  3H5Z A;  2CNT A;  1UWY A;  5CBM A;  4A2Z A;  4AG7 A;  1VGY A;  3CXS A;  1XMB A;  2I00 A;  1S3Z A;  1TIQ A;  1XFO A;  4NGS A;  3H4Q A;  3TX8 A;  5J1Q A;  2DEA A;  2AFZ A;  2ODF A;  2PIY A;  3MRU A;  2FIA A;  4OC4 A;  2R8V A;  4W9Y A;  4FUU A;  4XPD C;  5JQ4 A;  2EBJ A;  4H6U A;  1I1D A;  2GE3 A;  2YNE A;  3BI1 A;  2PJ5 A;  2OR4 A;  3A9L A;  1YW4 A;  2ZOG A;  3ISX A;  3B3V A;  5D8N A;  2DPS A;  1UFH A;  2ZW6 A;  2HV2 A;  3W6X A;  4UFW A;  1YW6 A;  1MJA A;  2A4N A;  4GS4 A;  3CPA A;  4UFV A;  4MHN A;  2JBK A;  1LOK A;  4A31 A;  3S6K A;  3L2N A;  4X8I A;  4ZX9 A;  4CAV A;  2PRQ A;  3V7Z A;  3PZJ A;  2FIW A;  3RZA A;  5HH1 A;  2IJZ A;  4P6Y A;  4M6I A;  4XPK A;  1A2Z A;  1S7K A;  2GAN A;  2KCW A;  3KHX A;  2PJ1 A;  1ON0 A;  2PJC A;  4QB9 A;  1VHS A;  1Y9K A;  3S9M A;  3D68 A;  2AFU A;  1CPX A;  2BO9 A;  2ZEH A;  3EO4 A;  3FJU A;  4B12 A;  2O53 A;  2D4O A;  1XIX A;  3KI9 A;  3F0A A;  4I49 A;  4P44 A;  7CPA A;  2V8V A;  5J8C A;  2CIJ A;  2BEI A;  4RS2 A;  2ZEE A;  4OIW A;  4DUK A;  2FS5 A;  4KZT A;  4UIB A;  1KWM A;  4UWJ A;  3PGP A;  3ZZI A;  1Z4R A;  1YGH A;  3GB0 A;  3IJ3 A;  4NGT A;  1OBR A;  2F5I A;  1Y7E A;  4OKO A;  4F0X A;  4DJL A;  4CAF A;  4E0A A;  3LMS A;  1YVO A;  1QSM A;  2C6G A;  2ZEM A;  5F49 A;  2CF4 A;  3PB4 X;  1CPS A;  2G9D A;  3SI2 A;  4C68 A;  8CPA A;  5IV0 A;  4ORF A;  3VH9 A;  1MK4 A;  4CAE A;  3VWD A;  4KUB A;  4II9 A;  4UFX A;  2JLM A;  1S60 A; 
#chains in the Genus database with same CATH homology
 2Z10 A;  5EC4 A;  3WR7 A;  3R9E A;  2Z0Z A;  5AG4 A;  4A33 A;  3FYN A;  4U9Y A;  1QST A;  2RC4 A;  4JD6 A;  5IX3 A;  2P6F A;  3TO9 A;  4NCZ A;  4IUS A;  4RI1 A;  4FD6 A;  2IL4 A;  4B10 A;  1B87 A;  4JXQ A;  4EVY A;  4Q38 A;  2X7B A;  1VKC A;  4KOT A;  4ZGY B;  5F46 A;  4HNX B;  4FD5 A;  1MJB A;  5BWA B;  2OB0 A;  1IID A;  2VQY A;  3D2M A;  2ZW7 A;  1KUV A;  4X5K A;  2CXA A;  4IF5 A;  3JTK A;  2K5T A;  4QBJ A;  2ZPA A;  4AG9 A;  2J8M A;  2P0W A;  5CNP A;  2FE7 A;  4B5P A;  2OZG A;  1FY7 A;  2Z11 A;  4L8A A;  1M44 A;  1KUX A;  4FD4 A;  3FB3 A;  1M4D A;  1L0C A;  2H5M A;  4Y49 B;  2OZH A;  2R1I A;  4KSA A;  4UBR A;  1Z4E A;  3SHP A;  4A32 A;  1CJW A;  4BMH A;  4UCM A;  5A27 A;  4E8O A;  1Z9U A;  5EBV A;  4CGL A;  5G1Z A;  1PUA A;  4ONU A;  5AG6 A;  4CYN A;  3JVN A;  2OU2 A;  5IB0 A;  2Z3O A;  1NSL A;  2YND A;  4PSW A;  5KTD A;  2Z3P A;  3S6G A;  2D4P A;  4QVT A;  4CGO A;  1B6B A;  4F0Y A;  4MJ8 A;  4MFP A;  4MFK A;  4CGM A;  1Q2C A;  3F8K A;  3BJ7 A;  4LX9 A;  5G21 A;  4C2X A;  4QC6 A;  1YR0 A;  2FXF A;  5AG7 A;  2WPX A;  3F5B A;  4AVA A;  3R95 A;  1BOB A;  4MHD A;  3FRM A;  2VEZ A;  4CAX A;  4R3L A;  2Y0M A;  2OZU A;  3R9F A;  3N7Z A;  2YNC A;  4JXR A;  3K9U A;  2HUZ A;  4YGO A;  2B58 A;  2Q0Y A;  1QSR A;  2VBQ A;  4U5Y A;  1MJ9 A;  2DPT A;  2P6G A;  4OAE A;  4JWP A;  2B3U A;  4R87 A;  4E2A A;  4MBU A;  3R9G A;  4HNW B;  4PK3 A;  4XPL A;  4CGP A;  2VZZ A;  3FIX A;  2AE6 A;  2ZXV A;  4F6A A;  2G0B A;  5AGE A;  2Q04 A;  4B5P B;  1OZP A;  3TT2 A;  4KS9 A;  4AVB A;  4KOX A;  4CYO A;  1WWZ A;  3R96 A;  3EY5 A;  2REE A;  4L89 A;  1LRZ A;  2Q4V A;  3CXQ A;  2B5G A;  4MI4 A;  4Y49 C;  1KUY A;  3OWC A;  4BBH A;  4CGN A;  1YLE A;  4DNC A;  2HQY A;  4KOR A;  4R57 A;  5AG5 A;  4A30 A;  4JJX A;  2P6E A;  2R98 A;  2ZW4 A;  4J3G A;  4ZBG A;  3C26 A;  1XEB A;  1M1D A;  1V0C A;  4B5O A;  4AB7 A;  1ZO0 A;  5FVJ A;  3IU2 A;  1P4N A;  2PC1 A;  3IU1 A;  2C27 A;  2G3A A;  4UWI A;  3P2H A;  2Z3N A;  1XMT A;  4KVO E;  1J4J A;  3TO6 A;  2BUE A;  5ISV A;  1RO5 A;  1YRE A;  3I3G A;  3IGR A;  5E96 A;  5GCN A;  4KUA A;  1QSO A;  2PQ8 A;  4XNH C;  2AJ6 A;  3TTH A;  1XF8 A;  3S6H A;  1S5K A;  2ZW5 A;  3PP9 A;  2CNM A;  4YRH A;  5C88 A;  3DSB A;  3T9Y A;  4JLY A;  4YFJ A;  3JUW A;  4FD7 A;  2JEV A;  2NMT A;  3MGD A;  4KOU A;  3TCV A;  4C2Y A;  4B14 A;  2FT0 A;  3T90 A;  4NSQ A;  4PK2 A;  3ZJ0 A;  3QAH A;  5DWM A;  1Q2Y A;  2YGW A;  4R3K A;  3D2P A;  5G20 A;  5A28 A;  3FBU A;  3DNS A;  4KOW A;  4B13 A;  2EVN A;  4NEX A;  2FCK A;  4A95 A;  2Q7B A;  4LUA A;  1QSN A;  4MFQ A;  4KOV A;  1K4J A;  2OH1 A;  2J8N A;  4B11 A;  2B5G B;  5KTC A;  4MFL A;  1N71 A;  3TE4 A;  1IYK A;  1SQH A;  3NE7 A;  4XNH B;  5I0C A;  2JDD A;  1PU9 A;  2B3V A;  2Q44 A;  1Q2D A;  2CNS A;  4HKF A;  4UA3 A;  2QML A;  3LOD A;  2WSA A;  3LD2 A;  2QEC A;  3EFA A;  1NMT A;  4M3S A;  1CM0 A;  3I9S A;  1NE9 A;  1S7F A;  1RXT A;  2VXK A;  2DXQ A;  5H84 A;  3IWG A;  3R1K A;  4KOY A;  5HMN A;  2REF A;  3DR6 A;  4CRY B;  4UCN A;  2J8R A;  5G22 A;  1I12 A;  4CYQ A;  3SXN A;  1IIC A;  3W6S A;  2B4D A;  3V8I A;  1WK4 A;  2WUU A;  3D3S A;  3TOB A;  2Z3L A;  2YNC C;  2Z3M A;  3IWE A;  3DDD A;  3UY5 A;  4KLV A;  4OAD A;  1IB1 E;  4CYP A;  3D8P A;  1YK3 A;  2R7H A;  4MY0 A;  2PR1 A;  3TFY A;  1XE4 A;  2QIR A;  2JDC A;  4C7I A;  1Y7R A;  2BSW A;  4U9Z A;  4C2Z A;  4C7H A;  2FL4 A;  4OLL A;  4CS0 B;  3BJ8 A;  4KLW A;  1U6M A;  5F48 A;  2PRB A;  3FNC A;  4H6Z A;  4XPD B;  1YX0 A;  3KKW A;  1Y9W A;  4UCP A;  4AVC A;  3EC4 A;  5DWN A;  1S7L A;  4KVX A;  1R57 A;  4HNY B;  3G3S A;  5F47 A;  4NXY A;  3TO7 A;  4R9M A;  1KZF A;  4NF1 A;  5H86 A;  3RYO A;  4KOS A;  3E0K A;  4MFJ A;  3GYA A;  3S6F A;  4Q36 A;  1IYL A;  2PDO A;  4H89 A;  4CAW A;  4QUS A;  1P0H A;  2GIV A;  5KTA A;  3GY9 A;  2O28 A;  4K30 A;  3GKR A;  2BL1 A;  4PSX A;  4MY3 A;  3TOA A;  3W91 A;  2VZY A;  5JPH A;  1M4G A;  2ATR A;  4MFZ A;  2WPW A;  4CRZ B;  3VWE A;  4KVM E;  3B8G A;  3EXN A;  5J8F A;  2B4B A;  3BLN A;  3SXO A;  2G3T A;  5C82 A;  2ARH A;  1GHE A;  3G8W A;  2CY2 A;  3QB8 A;  2PR8 A;  2EUI A;  3DR8 A;  1I21 A;  2Q4Y A;  4KSF A;  1S7N A;  2FSR A;  2VI7 A;  3P2F A;  2PSW A;  2Z3K A;  3FXT A;  1YVK A;  2B4D B;  3CXP A;  2I79 A;  4M85 A;  4PV6 A;  1BO4 A;  1M4I A;  3H5Z A;  2CNT A;  4A2Z A;  4AG7 A;  3CXS A;  2I00 A;  1S3Z A;  1TIQ A;  3H4Q A;  2FIA A;  2R8V A;  4XPD C;  5JQ4 A;  4H6U A;  1I1D A;  2GE3 A;  2YNE A;  3A9L A;  2DPS A;  1UFH A;  2ZW6 A;  2HV2 A;  3W6X A;  4UFW A;  1MJA A;  2A4N A;  4GS4 A;  4UFV A;  4A31 A;  3S6K A;  4CAV A;  3PZJ A;  2FIW A;  5HH1 A;  4XPK A;  1S7K A;  2GAN A;  2KCW A;  1ON0 A;  4QB9 A;  1VHS A;  1Y9K A;  3EO4 A;  4B12 A;  2D4O A;  1XIX A;  3F0A A;  4I49 A;  5J8C A;  2BEI A;  4RS2 A;  2FS5 A;  4KZT A;  4UWJ A;  3PGP A;  3ZZI A;  1Z4R A;  1YGH A;  2F5I A;  4F0X A;  4CAF A;  4E0A A;  1YVO A;  1QSM A;  5F49 A;  4C68 A;  5IV0 A;  4ORF A;  1MK4 A;  4CAE A;  3VWD A;  4KUB A;  4II9 A;  4UFX A;  2JLM A;  1S60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...