3F8RA

Crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two nadp molecules
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
310
structure length
308
Chain Sequence
VKPGEKFDVIIVGLGPAAYGAALYSARYMLKTLVIGETPGGQLTEAGIVDDYLGLIEIQASDMIKVFNKHIEKYEVPVLLDIVEKIENREFVVKTKRKGEFKADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAGDCTSAWLGFRQVITAVAQGAVAATSAYRYVTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and stability of a thioredoxin reductase from Sulfolobus solfataricus: a thermostable protein with two functions
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase (TrxB-3)
total genus 100
structure length 308
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 1.6.4.5: Transferred entry: 1.8.1.9.
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3f8rA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3f8rA02
2JBVA 4NTDA 2X8HA 2RGOA 1K0IA 4Z2TA 4OPDA 3OC4A 3VQRA 4J33A 4ZCDA 3UTGA 4C3YA 3AYLA 1PBDA 3OZ2A 4H4WA 3UKQA 4UDPA 5EOWA 4ZCCA 2BYBA 3CNPA 2WPFA 1FEBA 2XYOA 3M0OA 1GRHA 5IQ4A 3C4NA 2JAEA 3P4PA 3QVPA 1DOCA 2XLRA 3UOZA 1H81A 2DKIA 1PDHA 2JB3A 3C4AA 1NAAA 1LJ1A 2A87A 1DXLA 3DMEA 3P4SA 2EQ9A 2YLXA 1GRAA 1P2EA 3B6DA 4A6NA 2YLRA 2C3DA 3IC9A 1H84A 3NT6A 3SFDA 2RGHA 1ZP0A 3NK1X 3DJJA 1KNPA 4XXGA 1D4CA 1GESA 3CPHG 1B5QA 1PBEA 3DJDA 1V59A 5KXJA 2EQ7A 2BCGG 3QSSA 1S2YA 4D03A 4PABA 1KF6A 1Y56A 2NVKX 1HYUA 1K0JA 3JSKA 4AOSA 3D1CA 3UCLA 4RG3A 2UZZA 4CY6A 3G5QA 2Q0KA 1Q1RA 1PBFA 2YR4A 4H2NA 1KSSA 4GCMA 4BK3A 3AE9A 3GYIA 3P9UA 4TM3A 1N4VA 1D4EA 4H2QA 3B3RA 2WDVA 2XVFA 3BI5A 3GMBA 4Z43A 2VQ7A 4CNKA 4EMIA 2VQBA 1H7XA 4Y4NA 4EQWA 2H88A 4AOXA 5JCKA 2BS2A 3ITJA 1YQ3A 1CJ3A 3VR8A 3V3OA 2CULA 3ZDNA 1IUWA 1BWCA 5KVIA 4JN9A 1M6IA 3ATQA 3BNUA 3F8PA 1ZKQA 3DGHA 2XFUA 4X4JA 4XWRA 2X3NA 2VRMA 2Y6QA 2WOIA 4DGKA 2JB2A 4B69A 1GRFA 1DODA 2DKHA 4K5RA 4JQ9A 1FOHA 2V3AA 4A9WA 2QAEA 3G5SA 3LZWA 2OLNA 3P1WA 4A5LA 2OLOA 1F6MA 2QCUA 3ALMA 5KVHA 5C2TA 1ELIA 3DK4A 1D4DA 3L1RA 1YY5A 2WP6A 3CGEA 1IJHA 2Z5XA 1GERA 1IUXA 3QFAA 1CC6A 4BJYA 1JRYA 3NYEA 1X31B 3UKHA 2CDUA 2GVCA 4H2RA 3VRBA 1GV4A 3CTYA 4C77A 4OVIA 1ZDLA 3AEFA 3LZXA 2PHHA 5U25A 4NEVA 5HHFA 2QA2A 1H83A 2OALA 4U2TA 1EL7A 1CF3A 1GRBA 3CGBA 4X9MA 1L0VA 3DA1A 5M10A 3NH3X 4JNAA 3GRSA 1L9DA 3AD7B 2YVGA 1LTXR 1OJCA 3CN8A 2YG4A 1BZLA 4GDPA 1E7PA 4CNJA 2RGJA 5JCNA 1N4UA 4NEWA 2C65A 2BK5A 1TDNA 2B76A 3KKJA 1IUSA 4Z44A 4JNQA 3K7MX 3DH9A 4H4TA 4CY8A 3GD3A 3KU9A 3CNSA 4U8MA 4BV6A 3LXDA 1UKVG 3S61A 4U8NA 2GH5A 5BUKA 4PAAA 1GRTA 2BXSA 2YQUA 3AE1A 4Z24A 2WBAA 1JRZA 4J31A 3COXA 1PJ5A 1E1LA 4UDRA 1OJDA 2B7RA 4B63A 4N9XA 1QJDA 1H86A 4TM4A 2XVHA 4H4ZA 4XWZA 5FS9A 1EL9A 3UKAA 4Y4LA 1L9CA 2XLUA 1IUVA 1FL2A 2FJDA 1NPXA 5CKUA 1H6VA 4U8IA 5GRTA 2O9ZA 4AP3A 4YSZA 2GR2A 3H4KA 3M12A 4YTPA 5IQ1A 3PVCA 1PS9A 2FJAA 2BS4A 2GR3A 2TMDA 1GREA 3AEDA 3UTEA 3NYFA 4B1BA 2IVEA 2R4JA 2WS3A 2YG6A 2OAMA 2BS3A 2W0HA 2WDQA 3AE8A 2BABA 1REOA 1NDAA 1F3PA 2F5ZA 3L8KA 3UKLA 2AR8A 3RP7A 4CCQA 3ALLA 1Q1WA 1Z6LA 3AECA 3NKSA 1CL0A 1E1MA 2PYXA 3VRAA 4D04A 1KFYA 3ICTA 5BVAA 2Q7VA 2YLTA 4U8PA 3BI4A 1QLBA 4YKFA 1COYA 1LPFA 5L46A 2C72A 1NHPA 2ACZA 3F8RA 5U1OA 3E1TA 4CBQA 3IHGA 3NHOX 2V6OA 4Z2UA 1ZOYA 3NIXA 3NG7X 3URHA 4B68A 3UOYA 2YAUA 1DJQA 2BCPA 2NPXA 4U8KA 4HB9A 1CJ2A 1LV0A 1CHUA 4H50A 2C75A 1YKJA 3GWDA 4EQSA 4B66A 3GMCA 2WETA 5CQFA 3SGLA 2GF3A 2GQWA 4U8LA 2GMJA 2XFNA 1ZY8A 2IIDA 2QA1A 2X99A 3C96A 4K7ZA 4B67A 5J60A 3QVRA 5FMHA 1B8SA 1IUUA 2WP5A 3SFEA 4OPLA 3UKPA 2VVLG 2C3CA 2WEUA 4H4UA 2WHDA 3EPTA 4TM0A 1GXFA 1N1PA 4TLZA 1NENA 3RHAA 4GR1A 3LADA 3NYCA 3AE3A 3AYIA 1DOBA 4H4SA 2ZZCA 3AEEA 2HQMA 3K30A 4K8DA 2XFOA 3UP5A 1M64A 2OA1A 4TLXA 1JNRA 3UOXA 4U2LA 3NTDA 4I59A 3CIRA 1ZMCA 1BGJA 2WU5A 1KSUA 3FPZA 3FBSA 2GEWA 1FCDA 1TDKA 1CBOA 1TYPA 2E5VA 4YSXA 3EAOA 2WOVA 2X50A 1LVLA 1PXCA 2R0GA 3DK8A 1E6EA 5KOXA 1JOAA 1D5TA 5J7XA 2XVIA 2X8CA 1QO8A 2XDOA 5HY5A 4AT2A 2R4EA 3DK9A 2BK4A 3LB8A 4USRA 3AE4A 4GF7A 1TDEA 1VRQB 5IPYA 4A7AA 1CJCA 1EL8A 1PBCA 1E1KA 1OJ9A 4APNA 1GPEA 4UP3A 3ISHA 2V3BA 4NTCA 4NZHA 4H4QA 1H82A 3CGDA 4B65A 2B9WA 2R0PA 4BJZA 2WOWA 3RP8A 4J2WA 2C64A 4JY3A 1LQUA 2BA9A 4O5QA 4OPTA 2A89A 1GOSA 2VVMA 4AT0A 4FK1C 4YTNA 5JCIA 2C73A 4H4YA 2ZZ0A 1XANA 4BK1A 2EQ8A 2FBWA 3ALJA 3FG2P 1TYTA 3GDPA 2FJBA 2XFPA 2B9YA 1ZMDA 4USQA 5EBKA 1GT8A 3KD9A 3V76A 1BKWA 3K7QX 2WPCA 1NHRA 4HA6A 1S2QA 4WCTA 1CJ4A 1VDCA 3NN0X 4H4XA 1Q9IA 3EANA 3SQPA 4JDRA 1ZX9A 4EMJA 2AAQA 2H89A 3Q6JA 3DJEA 5BRTA 5C3JA 3GSIA 3PO7A 4GDEA 4I58A 4FDCB 1JU2A 1BGNA 4EM3A 2XLSA 2YR6A 2GAHB 1P2HA 2I0ZA 1OJAA 3IWAA 4U8OA 5EB4A 4KPRA 2B7SA 2VOUA 4LIIA 4ADWA 2YG7A 4FK1A 1JRXA 2C70A 2BK3A 2WP9A 3NRNA 3P4RA 3CNJA 3V3NA 1AOGA 2JK6A 4K2XA 2APGA 1GNDA 2GR1A 2BACA 5U63A 1TRBA 1DOEA 4CRTA 2BC1A 1BF3A 3GDNA 3S5WA 2FJEA 1DNCA 2YG3A 2YVJA 1XPQA 2ZZBA 3AB1A 3KLJA 3QSEA 4FX9A 1SEZA 1S3BA 4H4PA 4J56A 4AP1A 1K0LA 5HYMA 5TR3A 4H4RA 2YLZA 4CCRA 2J3NA 3NK2X 3NK0X 4EM4A 4EMWA 5LV9A 3AD8B 2V5ZA 4IVMB 4YKGA 1CC2A 3UOVA 3DJGX 1LQTA 1PN0A 3UP4A 4A99A 2YR5A 2YM2A 2YWLA 1D7LA 1GETA 3Q9TA 2X8GA 1NHSA 1PBBA 2WPEA 3AE6A 3CNDA 5ER0A 4U8JA 1KDGA 3II4A 3NNEA 1GTHA 4UDQA 4JY2A 5M0ZA 3AEBA 4J57A 1OJTA 3UTFA 3KA7A 2GRTA 1MXTA 3PS9A 4EIPA 4YSYA 2GMHA 3HZLA 1GTEA 2JB1A 4YXDA 2R45A 5FS6A 4RSLA 3QFBA 2WESA 3FMWA 3D8XA 3NGCX 5KOWA 3VRDB 1NHQA 3H8IA 1ONFA 1O5WA 1ZK7A 1O95A 3LOVA 4EQXA 3I3LA 4J34A 4H7UA 3O0HA 1NEKA 3UKFA 3ICSA 4TM1A 5BULA 1N4WA 2R46A 1B4VA 2C66A 3CGCA 4YWOA 3VR9A 4IVOB 4REKA 5HXIA 2C7GA 3ATRA 4A65A 1F8RA 1XDIA 5JCLA 5KRQA 1E1NA 4O5UA 2C76A 2V60A 3AYJA 3M13A 3NTAA 5JCMA 1KNRA 5KWFA 2C67A 4GUVA 4WX1A 2YM1A 2JKCA 4OPUA 2IVDA 2Y6RA 3AEAA 3NLCA 3CPJG 3KVEA 3UKKA 1W4XA 3BHFA 1H7WA 1MOKA 1EL5A 4H4VA 5EB5A 3T37A 4Z26A 1O94A 3AD9B 1CC4A 1B37A 1K4QA 3AEGA 1TDFA 3GWFA 4BURA 2YG5A 3UTHA 4KX6A 3CNTA 3ZYXA 1NG3A 1JNZA 2A8XA 2WDRA 2RABA 2WQYA 3FIMB 2B9XA 2GB0A 3GRTA 1YQZA 5GSNA 1RYIA 1PXAA 4DSHA 4YSHA 3I6DA 2YVFA 2YLSA 4X9NA 3H8LA 4OCGA 1PXBA 1RSGA 4ICYA 3AE5A 4C74A 3AXBA 2E1MA 3SM8A 1JEHA 5FS7A 1GSNA 1VG9A 3ABVA 3AWIA 1D7YA 4K5SA 1Y0PA 4OPCA 4Z25A 2XLPA 3K7TA 2Q0LA 3IF9A 3BI2A 3CPIG 4IA5A 4ZN0A 2GR0A 5FS8A 3AE7A 3NN6X 1PHHA 2BC0A 1S3EA 4K22A 4IA6A 2V61A 4OPGA 1YQ4A 2XLTA 3EF6A 5DBJA 1GRGA 2XCGA 3BHKA 1L9EA 4H2PA 1E39A 2CFYA 4A79A 2GAGB 1EBDA 4EIQA 2Z5YA 4MJWA 2R9ZA 1FECA 1TDOA 4C5OA 4Z2RA 3KPFA 3REDA 4A6NB 2ZBWA 4YT0A 2XVJA 4LU6A 1F8SA 3QJ4A 3LJPA 1GEUA 4GRTA 3BNMA 2ARDA 1XHCA 4LA1A 1VQWA 1NG4A 4NTEA 3IHMA 4RG4A 2E4GA 2VZ2A 1ZOVA 3ICRA 4U2SA 3RNMA 3WE0A 4EQRA 1Y56B 4ECHA 2GQFA 3AE2A 1FEAA 4OPIA 3GD4A 4E0VA 2Q6UA 1F8WA 2VRLA 2VVLA 3F8DA 3GYJA 2BXRA 3R9UA 4C3XA 2EQ6A 1IUTA 2XFQA 4M52A 3G5RA 2WU2A 2AQJA 4BK2A 2TPRA 3P4QA 4YTMA 4DNAA 2R0CA 3DGZA 1PJ6A 2CVJA 3ADAB 4P9SA 2GV8A 2YLWA 3RP6A 4DSGA 1RP0A 1MO9A 1PJ7A 4J36A 4IV9A 4Y4MA 1DJNA 2XVEA 1VG0A 4B64A 1GALA 3QSMA
chains in the Genus database with same CATH superfamily
2JBVA 4NTDA 4II3A 2X8HA 2RGOA 1K0IA 4Z2TA 4OPDA 3OC4A 3VQRA 4J33A 4ZCDA 3UTGA 4C3YA 3AYLA 1PBDA 3OZ2A 4H4WA 3UKQA 4UDPA 5EOWA 4ZCCA 2BYBA 3CNPA 2WPFA 1FEBA 2XYOA 3M0OA 1GRHA 5IQ4A 3C4NA 2JAEA 3P4PA 3QVPA 1DOCA 2XLRA 3UOZA 1H81A 2DKIA 1PDHA 2JB3A 3C4AA 3T2YA 1NAAA 1LJ1A 2A87A 1DXLA 3DMEA 3P4SA 2EQ9A 2YLXA 1GRAA 1P2EA 3B6DA 4A6NA 2YLRA 2C3DA 3IC9A 1H84A 3NT6A 4II2A 3SFDA 2RGHA 1ZP0A 3NK1X 3DJJA 1KNPA 4XXGA 1D4CA 1GESA 3CPHG 1B5QA 1PBEA 3DJDA 1V59A 5KXJA 2EQ7A 2BCGG 3QSSA 1S2YA 4D03A 4PABA 1KF6A 1Y56A 2NVKX 1HYUA 1K0JA 3JSKA 3SY4A 2C4CA 4AOSA 3D1CA 3UCLA 4RG3A 2UZZA 4CY6A 3G5QA 2Q0KA 1Q1RA 1PBFA 2YR4A 4H2NA 1KSSA 4GCMA 4BK3A 3AE9A 3GYIA 3P9UA 4TM3A 1N4VA 1D4EA 4H2QA 3B3RA 2WDVA 2XVFA 3BI5A 3GMBA 3GYXA 4Z43A 2VQ7A 4CNKA 4EMIA 2VQBA 1H7XA 4Y4NA 4EQWA 2H88A 4AOXA 5JCKA 2BS2A 3ITJA 1YQ3A 1CJ3A 3VR8A 3V3OA 4B63A 2CULA 4G73A 3ZDNA 1IUWA 1BWCA 5KVIA 4JN9A 1M6IA 3ATQA 3BNUA 3F8PA 1ZKQA 3DGHA 2XFUA 4X4JA 4XWRA 2X3NA 2VRMA 2Y6QA 2WOIA 4DGKA 2JB2A 4B69A 5KMSA 1GRFA 1DODA 2DKHA 4K5RA 4JQ9A 1FOHA 2V3AA 4A9WA 2QAEA 3G5SA 3LZWA 2OLNA 3P1WA 4A5LA 2OLOA 1F6MA 2QCUA 3KPKA 3ALMA 5KVHA 5C2TA 1ELIA 3DK4A 1D4DA 3L1RA 1YY5A 2WP6A 3CGEA 1IJHA 2Z5XA 1GERA 1IUXA 3QFAA 1CC6A 3T14A 4BJYA 1JRYA 3NYEA 1X31B 3UKHA 2CDUA 2GVCA 4H2RA 3VRBA 1GV4A 3CTYA 4C77A 4OVIA 1ZDLA 3AEFA 4NWZA 3LZXA 2PHHA 5U25A 4NEVA 5HHFA 2QA2A 1H83A 2OALA 4U2TA 1EL7A 1CF3A 1GRBA 3CGBA 4X9MA 1L0VA 3DA1A 5M10A 3NH3X 4JNAA 3GRSA 1L9DA 3AD7B 2YVGA 1LTXR 1OJCA 3CN8A 2YG4A 1BZLA 4GDPA 3SZFA 1E7PA 4CNJA 2RGJA 5JCNA 1N4UA 4NEWA 2C65A 2BK5A 1TDNA 2B76A 3KKJA 1IUSA 4Z44A 4JNQA 3K7MX 3DH9A 4H4TA 4CY8A 3GD3A 3KU9A 3CNSA 4U8MA 4BV6A 3LXDA 4G6GA 1UKVG 3S61A 4U8NA 2GH5A 5BUKA 4PAAA 1GRTA 2BXSA 2YQUA 3AE1A 4Z24A 2WBAA 1JRZA 4J31A 3COXA 1PJ5A 1E1LA 4UDRA 1OJDA 2B7RA 3SXIA 4N9XA 1QJDA 1H86A 4TM4A 2XVHA 4H4ZA 4XWZA 5FS9A 1EL9A 3UKAA 4Y4LA 1L9CA 2XLUA 1IUVA 1FL2A 2FJDA 1NPXA 5CKUA 1H6VA 3T2ZA 4U8IA 5GRTA 2O9ZA 4AP3A 4YSZA 2GR2A 3H4KA 3M12A 4YTPA 5KMQA 5IQ1A 3PVCA 1PS9A 2FJAA 2BS4A 2GR3A 2TMDA 1GREA 3AEDA 3UTEA 3NYFA 4B1BA 2IVEA 2R4JA 2WS3A 2YG6A 2OAMA 3HYVA 2BS3A 2W0HA 2WDQA 3AE8A 2BABA 1REOA 1NDAA 1F3PA 2F5ZA 3L8KA 3UKLA 2AR8A 3RP7A 4CCQA 3ALLA 1Q1WA 1Z6LA 3AECA 3NKSA 1CL0A 1E1MA 2PYXA 3VRAA 4D04A 1KFYA 3ICTA 5BVAA 2Q7VA 2YLTA 3SZ0A 4U8PA 3BI4A 1QLBA 4YKFA 1COYA 1LPFA 5L46A 2C72A 1NHPA 2ACZA 3F8RA 5U1OA 3E1TA 4CBQA 3IHGA 3NHOX 3SZCA 2V6OA 3SZWA 1ZOYA 3NIXA 4Z2UA 3NG7X 3URHA 4B68A 3UOYA 2YAUA 3T31A 1DJQA 2BCPA 2NPXA 4U8KA 4G6HA 4HB9A 1CJ2A 1LV0A 1CHUA 4H50A 2C75A 4G9KA 1YKJA 3GWDA 4GAPA 4B66A 3GMCA 4EQSA 2WETA 5CQFA 3SGLA 2GF3A 2GQWA 4U8LA 2GMJA 2XFNA 1ZY8A 2IIDA 2QA1A 2X99A 3C96A 4K7ZA 4B67A 5J60A 3QVRA 5FMHA 1B8SA 1IUUA 2WP5A 3SFEA 4OPLA 3UKPA 2VVLG 2C3CA 2WEUA 4H4UA 2WHDA 3EPTA 4TM0A 1GXFA 1N1PA 4TLZA 1NENA 3RHAA 4GR1A 3LADA 3NYCA 3AE3A 3AYIA 1DOBA 4H4SA 2ZZCA 3SYIA 3AEEA 2HQMA 3K30A 4K8DA 2XFOA 3UP5A 1M64A 2OA1A 4TLXA 1JNRA 3UOXA 4U2LA 3NTDA 4I59A 3CIRA 1ZMCA 1BGJA 2WU5A 1KSUA 3FPZA 3FBSA 2GEWA 1FCDA 1TDKA 1CBOA 1TYPA 2E5VA 4YSXA 3EAOA 2WOVA 2X50A 1LVLA 1PXCA 2R0GA 3DK8A 1E6EA 5KOXA 1JOAA 1D5TA 5J7XA 2XVIA 2X8CA 1QO8A 2XDOA 5HY5A 4AT2A 2R4EA 3DK9A 2BK4A 3LB8A 4USRA 3AE4A 4GF7A 1TDEA 1VRQB 5IPYA 4A7AA 1CJCA 1EL8A 1PBCA 1E1KA 1OJ9A 4APNA 1GPEA 4UP3A 3ISHA 2V3BA 4NTCA 4NZHA 4H4QA 1H82A 3CGDA 4B65A 2B9WA 2R0PA 3HYXA 4BJZA 2WOWA 3RP8A 4J2WA 2C64A 4JY3A 1LQUA 2BA9A 4O5QA 4OPTA 2A89A 1GOSA 2VVMA 4AT0A 4FK1C 4YTNA 5JCIA 2C73A 4H4YA 2ZZ0A 1XANA 4BK1A 2EQ8A 2FBWA 3ALJA 3FG2P 1TYTA 3GDPA 2FJBA 2XFPA 2B9YA 1ZMDA 4USQA 5EBKA 1GT8A 3KD9A 3V76A 1BKWA 3K7QX 2WPCA 1NHRA 4HA6A 1S2QA 4WCTA 1CJ4A 1VDCA 3NN0X 4H4XA 1Q9IA 3EANA 3SQPA 4JDRA 1ZX9A 4EMJA 2AAQA 2H89A 3Q6JA 3DJEA 5BRTA 5C3JA 3GSIA 3PO7A 4GDEA 4I58A 4FDCB 1JU2A 1BGNA 4EM3A 2XLSA 2YR6A 5KMRA 2GAHB 1P2HA 2I0ZA 1OJAA 3IWAA 4U8OA 5EB4A 4KPRA 2B7SA 2VOUA 4LIIA 4ADWA 2YG7A 4FK1A 1JRXA 2C70A 2BK3A 2WP9A 3NRNA 3P4RA 3CNJA 3V3NA 1AOGA 2JK6A 4K2XA 2APGA 1GNDA 2GR1A 2BACA 5U63A 1TRBA 1DOEA 4CRTA 2BC1A 1BF3A 3GDNA 3S5WA 2FJEA 1DNCA 2YG3A 2YVJA 1XPQA 2ZZBA 3AB1A 3KLJA 3QSEA 4FX9A 1SEZA 1S3BA 4H4PA 4J56A 4AP1A 1K0LA 5HYMA 5TR3A 4H4RA 2YLZA 4CCRA 2J3NA 3NK2X 3NK0X 4EM4A 4EMWA 5LV9A 3AD8B 2V5ZA 4IVMB 4YKGA 1CC2A 3UOVA 3DJGX 1LQTA 1PN0A 3UP4A 4A99A 2YR5A 2YM2A 2YWLA 1D7LA 2BRYA 1GETA 3Q9TA 2X8GA 1NHSA 1PBBA 2WPEA 3AE6A 3CNDA 5ER0A 4U8JA 1KDGA 3II4A 3NNEA 1GTHA 4UDQA 4JY2A 5M0ZA 3AEBA 4J57A 1OJTA 3UTFA 3KA7A 2GRTA 1MXTA 3PS9A 4EIPA 4YSYA 2GMHA 3HZLA 1GTEA 2JB1A 4YXDA 2R45A 5FS6A 4RSLA 3QFBA 2WESA 3FMWA 3D8XA 3NGCX 5KOWA 3VRDB 1NHQA 2BRAA 3H8IA 1ONFA 1O5WA 1ZK7A 1O95A 3LOVA 4EQXA 3I3LA 4J34A 4H7UA 3O0HA 1NEKA 3UKFA 3ICSA 4TM1A 5BULA 1N4WA 2R46A 1B4VA 2C66A 3CGCA 4NNJA 4YWOA 3VR9A 4IVOB 4REKA 5HXIA 3T2KA 2C7GA 3ATRA 4A65A 1F8RA 1XDIA 5JCLA 5KRQA 1E1NA 4O5UA 3SX6A 2C76A 2V60A 3AYJA 3M13A 3NTAA 5JCMA 1KNRA 5KWFA 2C67A 4GUVA 4WX1A 2YM1A 2JKCA 4OPUA 2IVDA 2Y6RA 3AEAA 3NLCA 3CPJG 3KVEA 3UKKA 1W4XA 3BHFA 1H7WA 1MOKA 1EL5A 4H4VA 5EB5A 3T37A 4Z26A 1O94A 3AD9B 1CC4A 1B37A 1K4QA 3AEGA 1TDFA 3GWFA 3HYWA 2YG5A 4BURA 5KMPA 3UTHA 4G74A 4KX6A 3CNTA 3ZYXA 1NG3A 1JNZA 2A8XA 2WDRA 2RABA 2WQYA 3FIMB 2B9XA 2GB0A 3GRTA 1YQZA 4GAVA 1RYIA 1PXAA 5GSNA 4DSHA 4YSHA 3I6DA 2YVFA 5KNLA 2YLSA 4X9NA 3H8LA 4OCGA 1PXBA 1RSGA 4ICYA 3AE5A 4C74A 3AXBA 2E1MA 3SM8A 1JEHA 5FS7A 1GSNA 1VG9A 3ABVA 3AWIA 1D7YA 4K5SA 1Y0PA 4OPCA 4Z25A 2XLPA 3K7TA 2Q0LA 3IF9A 3BI2A 3CPIG 4IA5A 4ZN0A 2GR0A 5FS8A 3AE7A 3NN6X 1PHHA 2BC0A 1S3EA 4K22A 4IA6A 2V61A 4OPGA 1YQ4A 2XLTA 3EF6A 5DBJA 1GRGA 2XCGA 3BHKA 1L9EA 4H2PA 1E39A 2CFYA 4A79A 2GAGB 1EBDA 4EIQA 2Z5YA 4MJWA 2R9ZA 1FECA 1TDOA 4C5OA 4Z2RA 3KPFA 3REDA 4A6NB 2ZBWA 4YT0A 2XVJA 4LU6A 1F8SA 3QJ4A 3LJPA 1GEUA 4GRTA 3BNMA 2ARDA 1XHCA 4LA1A 1VQWA 1NG4A 4NTEA 3IHMA 4RG4A 2E4GA 2VZ2A 1ZOVA 3ICRA 4U2SA 3RNMA 3WE0A 4EQRA 1Y56B 4ECHA 2GQFA 3CMMA 3AE2A 1FEAA 4OPIA 3GD4A 3T0KA 4E0VA 2Q6UA 1F8WA 2VRLA 2VVLA 3F8DA 3GYJA 2BXRA 3R9UA 4C3XA 2EQ6A 1IUTA 2XFQA 4M52A 3G5RA 2WU2A 2AQJA 4BK2A 2TPRA 3P4QA 4YTMA 4DNAA 2R0CA 3DGZA 1PJ6A 2CVJA 3ADAB 4P9SA 2GV8A 2YLWA 3RP6A 4DSGA 1RP0A 1MO9A 1PJ7A 4J36A 4IV9A 4Y4MA 1DJNA 2XVEA 1VG0A 4B64A 1GALA 3QSMA
chains in the Genus database with same CATH topology
2JBVA 4NTDA 4II3A 2X8HA 2RGOA 1K0IA 4Z2TA 4OPDA 3OC4A 3VQRA 4J33A 4ZCDA 3UTGA 4C3YA 3AYLA 1PBDA 3OZ2A 4H4WA 3UKQA 4UDPA 5EOWA 4ZCCA 2BYBA 3CNPA 2WPFA 1FEBA 2XYOA 3M0OA 1GRHA 5IQ4A 3C4NA 2JAEA 3P4PA 3QVPA 1DOCA 2XLRA 3UOZA 1H81A 2DKIA 1PDHA 2JB3A 3C4AA 3T2YA 1NAAA 1LJ1A 2A87A 1DXLA 3DMEA 3P4SA 2EQ9A 2YLXA 1GRAA 1P2EA 3B6DA 4A6NA 2YLRA 2C3DA 3IC9A 1H84A 3NT6A 4II2A 3SFDA 2RGHA 1ZP0A 3NK1X 3DJJA 1KNPA 4XXGA 1D4CA 1GESA 3CPHG 1B5QA 1PBEA 3DJDA 1V59A 5KXJA 2EQ7A 2BCGG 3QSSA 1S2YA 4D03A 4PABA 1KF6A 1Y56A 2NVKX 1HYUA 1K0JA 3JSKA 3SY4A 2C4CA 4AOSA 3D1CA 3UCLA 4RG3A 2UZZA 4CY6A 3G5QA 2Q0KA 1Q1RA 1PBFA 2YR4A 4H2NA 1KSSA 4GCMA 4BK3A 3AE9A 3GYIA 3P9UA 4TM3A 1N4VA 1D4EA 4H2QA 3B3RA 2WDVA 2XVFA 3BI5A 3GMBA 3GYXA 4Z43A 2VQ7A 4CNKA 4EMIA 2VQBA 1H7XA 4Y4NA 4EQWA 2H88A 4AOXA 5JCKA 2BS2A 3ITJA 1YQ3A 1CJ3A 3VR8A 3V3OA 4B63A 2CULA 4G73A 3ZDNA 1IUWA 1BWCA 5KVIA 4JN9A 1M6IA 3ATQA 3BNUA 3F8PA 1ZKQA 3DGHA 2XFUA 4X4JA 4XWRA 2X3NA 2VRMA 2Y6QA 2WOIA 4DGKA 2JB2A 4B69A 5KMSA 1GRFA 1DODA 2DKHA 4K5RA 4JQ9A 1FOHA 2V3AA 4A9WA 2QAEA 3G5SA 3LZWA 2OLNA 3P1WA 4A5LA 2OLOA 1F6MA 2QCUA 3KPKA 3ALMA 5KVHA 5C2TA 1ELIA 3DK4A 1D4DA 3L1RA 1YY5A 2WP6A 3CGEA 1IJHA 2Z5XA 1GERA 1IUXA 3QFAA 1CC6A 3T14A 4BJYA 1JRYA 3NYEA 1X31B 3UKHA 2CDUA 2GVCA 4H2RA 3VRBA 1GV4A 3CTYA 4C77A 4OVIA 1ZDLA 3AEFA 4NWZA 3LZXA 2PHHA 5U25A 4NEVA 5HHFA 2QA2A 1H83A 2OALA 4U2TA 1EL7A 1CF3A 1GRBA 3CGBA 4X9MA 1L0VA 3DA1A 5M10A 3NH3X 4JNAA 3GRSA 1L9DA 3AD7B 2YVGA 1LTXR 1OJCA 3CN8A 2YG4A 1BZLA 4GDPA 3SZFA 1E7PA 4CNJA 2RGJA 5JCNA 1N4UA 4NEWA 2C65A 2BK5A 1TDNA 2B76A 3KKJA 1IUSA 4Z44A 4JNQA 3K7MX 3DH9A 4H4TA 4CY8A 3GD3A 3KU9A 3CNSA 4U8MA 4BV6A 3LXDA 4G6GA 1UKVG 3S61A 4U8NA 2GH5A 5BUKA 4PAAA 1GRTA 2BXSA 2YQUA 3AE1A 4Z24A 2WBAA 1JRZA 4J31A 3COXA 1PJ5A 1E1LA 4UDRA 1OJDA 2B7RA 3SXIA 4N9XA 1QJDA 1H86A 4TM4A 2XVHA 4H4ZA 4XWZA 5FS9A 1EL9A 3UKAA 4Y4LA 1L9CA 2XLUA 1IUVA 1FL2A 2FJDA 1NPXA 5CKUA 1H6VA 3T2ZA 4U8IA 5GRTA 2O9ZA 4AP3A 4YSZA 2GR2A 3H4KA 3M12A 4YTPA 5KMQA 5IQ1A 3PVCA 1PS9A 2FJAA 2BS4A 2GR3A 2TMDA 1GREA 3AEDA 3UTEA 3NYFA 4B1BA 2IVEA 2R4JA 2WS3A 2YG6A 2OAMA 3HYVA 2BS3A 2W0HA 2WDQA 3AE8A 2BABA 1REOA 1NDAA 1F3PA 2F5ZA 3L8KA 3UKLA 2AR8A 3RP7A 4CCQA 3ALLA 1Q1WA 1Z6LA 3AECA 3NKSA 1CL0A 1E1MA 2PYXA 3VRAA 4D04A 1KFYA 3ICTA 5BVAA 2Q7VA 2YLTA 3SZ0A 4U8PA 3BI4A 1QLBA 4YKFA 1COYA 1LPFA 5L46A 2C72A 1NHPA 2ACZA 3F8RA 5U1OA 3E1TA 4CBQA 3IHGA 3NHOX 3SZCA 2V6OA 3SZWA 1ZOYA 3NIXA 4Z2UA 3NG7X 3URHA 4B68A 3UOYA 2YAUA 3T31A 1DJQA 2BCPA 2NPXA 4U8KA 4G6HA 4HB9A 1CJ2A 1LV0A 1CHUA 4H50A 2C75A 4G9KA 1YKJA 3GWDA 4GAPA 4B66A 3GMCA 4EQSA 2WETA 5CQFA 3SGLA 2GF3A 2GQWA 4U8LA 2GMJA 2XFNA 1ZY8A 2IIDA 2QA1A 2X99A 3C96A 4K7ZA 4B67A 5J60A 3QVRA 5FMHA 1B8SA 1IUUA 2WP5A 3SFEA 4OPLA 3UKPA 2VVLG 2C3CA 2WEUA 4H4UA 2WHDA 3EPTA 4TM0A 1GXFA 1N1PA 4TLZA 1NENA 3RHAA 4GR1A 3LADA 3NYCA 3AE3A 3AYIA 1DOBA 4H4SA 2ZZCA 3SYIA 3AEEA 2HQMA 3K30A 4K8DA 2XFOA 3UP5A 1M64A 2OA1A 4TLXA 1JNRA 3UOXA 4U2LA 3NTDA 4I59A 3CIRA 1ZMCA 1BGJA 2WU5A 1KSUA 3FPZA 3FBSA 2GEWA 1FCDA 1TDKA 1CBOA 1TYPA 2E5VA 4YSXA 3EAOA 2WOVA 2X50A 1LVLA 1PXCA 2R0GA 3DK8A 1E6EA 5KOXA 1JOAA 1D5TA 5J7XA 2XVIA 2X8CA 1QO8A 2XDOA 5HY5A 4AT2A 2R4EA 3DK9A 2BK4A 3LB8A 4USRA 3AE4A 4GF7A 1TDEA 1VRQB 5IPYA 4A7AA 1CJCA 1EL8A 1PBCA 1E1KA 1OJ9A 4APNA 1GPEA 4UP3A 3ISHA 2V3BA 4NTCA 4NZHA 4H4QA 1H82A 3CGDA 4B65A 2B9WA 2R0PA 3HYXA 4BJZA 2WOWA 3RP8A 4J2WA 2C64A 4JY3A 1LQUA 2BA9A 4O5QA 4OPTA 2A89A 1GOSA 2VVMA 4AT0A 4FK1C 4YTNA 5JCIA 2C73A 4H4YA 2ZZ0A 1XANA 4BK1A 2EQ8A 2FBWA 3ALJA 3FG2P 1TYTA 3GDPA 2FJBA 2XFPA 2B9YA 1ZMDA 4USQA 5EBKA 1GT8A 3KD9A 3V76A 1BKWA 3K7QX 2WPCA 1NHRA 4HA6A 1S2QA 4WCTA 1CJ4A 1VDCA 3NN0X 4H4XA 1Q9IA 3EANA 3SQPA 4JDRA 1ZX9A 4EMJA 2AAQA 2H89A 3Q6JA 3DJEA 5BRTA 5C3JA 3GSIA 3PO7A 4GDEA 4I58A 4FDCB 1JU2A 1BGNA 4EM3A 2XLSA 2YR6A 5KMRA 2GAHB 1P2HA 2I0ZA 1OJAA 3IWAA 4U8OA 5EB4A 4KPRA 2B7SA 2VOUA 4LIIA 4ADWA 2YG7A 4FK1A 1JRXA 2C70A 2BK3A 2WP9A 3NRNA 3P4RA 3CNJA 3V3NA 1AOGA 2JK6A 4K2XA 2APGA 1GNDA 2GR1A 2BACA 5U63A 1TRBA 1DOEA 4CRTA 2BC1A 1BF3A 3GDNA 3S5WA 2FJEA 1DNCA 2YG3A 2YVJA 1XPQA 2ZZBA 3AB1A 3KLJA 3QSEA 4FX9A 1SEZA 1S3BA 4H4PA 4J56A 4AP1A 1K0LA 5HYMA 5TR3A 4H4RA 2YLZA 4CCRA 2J3NA 3NK2X 3NK0X 4EM4A 4EMWA 5LV9A 3AD8B 2V5ZA 4IVMB 4YKGA 1CC2A 3UOVA 3DJGX 1LQTA 1PN0A 3UP4A 4A99A 2YR5A 2YM2A 2YWLA 1D7LA 2BRYA 1GETA 3Q9TA 2X8GA 1NHSA 1PBBA 2WPEA 3AE6A 3CNDA 5ER0A 4U8JA 1KDGA 3II4A 3NNEA 1GTHA 4UDQA 4JY2A 5M0ZA 3AEBA 4J57A 1OJTA 3UTFA 3KA7A 2GRTA 1MXTA 3PS9A 4EIPA 4YSYA 2GMHA 3HZLA 1GTEA 2JB1A 4YXDA 2R45A 5FS6A 4RSLA 3QFBA 2WESA 3FMWA 3D8XA 3NGCX 5KOWA 3VRDB 1NHQA 2BRAA 3H8IA 1ONFA 1O5WA 1ZK7A 1O95A 3LOVA 4EQXA 3I3LA 4J34A 4H7UA 3O0HA 1NEKA 3UKFA 3ICSA 4TM1A 5BULA 1N4WA 2R46A 1B4VA 2C66A 3CGCA 4NNJA 4YWOA 3VR9A 4IVOB 4REKA 5HXIA 3T2KA 2C7GA 3ATRA 4A65A 1F8RA 1XDIA 5JCLA 5KRQA 1E1NA 4O5UA 3SX6A 2C76A 2V60A 3AYJA 3M13A 3NTAA 5JCMA 1KNRA 5KWFA 2C67A 4GUVA 4WX1A 2YM1A 2JKCA 4OPUA 2IVDA 2Y6RA 3AEAA 3NLCA 3CPJG 3KVEA 3UKKA 1W4XA 3BHFA 1H7WA 1MOKA 1EL5A 4H4VA 5EB5A 3T37A 4Z26A 1O94A 3AD9B 1CC4A 1B37A 1K4QA 3AEGA 1TDFA 3GWFA 3HYWA 2YG5A 4BURA 5KMPA 3UTHA 4G74A 4KX6A 3CNTA 3ZYXA 1NG3A 1JNZA 2A8XA 2WDRA 2RABA 2WQYA 3FIMB 2B9XA 2GB0A 3GRTA 1YQZA 4GAVA 1RYIA 1PXAA 5GSNA 4DSHA 4YSHA 3I6DA 2YVFA 5KNLA 2YLSA 4X9NA 3H8LA 4OCGA 1PXBA 1RSGA 4ICYA 3AE5A 4C74A 3AXBA 2E1MA 3SM8A 1JEHA 5FS7A 1GSNA 1VG9A 3ABVA 3AWIA 1D7YA 4K5SA 1Y0PA 4OPCA 4Z25A 2XLPA 3K7TA 2Q0LA 3IF9A 3BI2A 3CPIG 4IA5A 4ZN0A 2GR0A 5FS8A 3AE7A 3NN6X 1PHHA 2BC0A 1S3EA 4K22A 4IA6A 2V61A 4OPGA 1YQ4A 2XLTA 3EF6A 5DBJA 1GRGA 2XCGA 3BHKA 1L9EA 4H2PA 1E39A 2CFYA 4A79A 2GAGB 1EBDA 4EIQA 2Z5YA 4MJWA 2R9ZA 1FECA 1TDOA 4C5OA 4Z2RA 3KPFA 3REDA 4A6NB 2ZBWA 4YT0A 2XVJA 4LU6A 1F8SA 3QJ4A 3LJPA 1GEUA 4GRTA 3BNMA 2ARDA 1XHCA 4LA1A 1VQWA 1NG4A 4NTEA 3IHMA 4RG4A 2E4GA 2VZ2A 1ZOVA 3ICRA 4U2SA 3RNMA 3WE0A 4EQRA 1Y56B 4ECHA 2GQFA 3CMMA 3AE2A 1FEAA 4OPIA 3GD4A 3T0KA 4E0VA 2Q6UA 1F8WA 2VRLA 2VVLA 3F8DA 3GYJA 2BXRA 3R9UA 4C3XA 2EQ6A 1IUTA 2XFQA 4M52A 3G5RA 2WU2A 2AQJA 4BK2A 2TPRA 3P4QA 4YTMA 4DNAA 2R0CA 3DGZA 1PJ6A 2CVJA 3ADAB 4P9SA 2GV8A 2YLWA 3RP6A 4DSGA 1RP0A 1MO9A 1PJ7A 4J36A 4IV9A 4Y4MA 1DJNA 2XVEA 1VG0A 4B64A 1GALA 3QSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JBV A;  4NTD A;  2X8H A;  2RGO A;  1K0I A;  4Z2T A;  4OPD A;  3OC4 A;  3VQR A;  4J33 A;  4ZCD A;  3UTG A;  4C3Y A;  3AYL A;  1PBD A;  3OZ2 A;  4H4W A;  3UKQ A;  4UDP A;  5EOW A;  4ZCC A;  2BYB A;  3CNP A;  2WPF A;  1FEB A;  2XYO A;  3M0O A;  1GRH A;  5IQ4 A;  3C4N A;  2JAE A;  3P4P A;  3QVP A;  1DOC A;  2XLR A;  3UOZ A;  1H81 A;  2DKI A;  1PDH A;  2JB3 A;  3C4A A;  1NAA A;  1LJ1 A;  2A87 A;  1DXL A;  3DME A;  3P4S A;  2EQ9 A;  2YLX A;  1GRA A;  1P2E A;  3B6D A;  4A6N A;  2YLR A;  2C3D A;  3IC9 A;  1H84 A;  3NT6 A;  3SFD A;  2RGH A;  1ZP0 A;  3NK1 X;  3DJJ A;  1KNP A;  4XXG A;  1D4C A;  1GES A;  3CPH G;  1B5Q A;  1PBE A;  3DJD A;  1V59 A;  5KXJ A;  2EQ7 A;  2BCG G;  3QSS A;  1S2Y A;  4D03 A;  4PAB A;  1KF6 A;  1Y56 A;  2NVK X;  1HYU A;  1K0J A;  3JSK A;  4AOS A;  3D1C A;  3UCL A;  4RG3 A;  2UZZ A;  4CY6 A;  3G5Q A;  2Q0K A;  1Q1R A;  1PBF A;  2YR4 A;  4H2N A;  1KSS A;  4GCM A;  4BK3 A;  3AE9 A;  3GYI A;  3P9U A;  4TM3 A;  1N4V A;  1D4E A;  4H2Q A;  3B3R A;  2WDV A;  2XVF A;  3BI5 A;  3GMB A;  4Z43 A;  2VQ7 A;  4CNK A;  4EMI A;  2VQB A;  1H7X A;  4Y4N A;  4EQW A;  2H88 A;  4AOX A;  5JCK A;  2BS2 A;  3ITJ A;  1YQ3 A;  1CJ3 A;  3VR8 A;  3V3O A;  2CUL A;  3ZDN A;  1IUW A;  1BWC A;  5KVI A;  4JN9 A;  1M6I A;  3ATQ A;  3BNU A;  3F8P A;  1ZKQ A;  3DGH A;  2XFU A;  4X4J A;  4XWR A;  2X3N A;  2VRM A;  2Y6Q A;  2WOI A;  4DGK A;  2JB2 A;  4B69 A;  1GRF A;  1DOD A;  2DKH A;  4K5R A;  4JQ9 A;  1FOH A;  2V3A A;  4A9W A;  2QAE A;  3G5S A;  3LZW A;  2OLN A;  3P1W A;  4A5L A;  2OLO A;  1F6M A;  2QCU A;  3ALM A;  5KVH A;  5C2T A;  1ELI A;  3DK4 A;  1D4D A;  3L1R A;  1YY5 A;  2WP6 A;  3CGE A;  1IJH A;  2Z5X A;  1GER A;  1IUX A;  3QFA A;  1CC6 A;  4BJY A;  1JRY A;  3NYE A;  1X31 B;  3UKH A;  2CDU A;  2GVC A;  4H2R A;  3VRB A;  1GV4 A;  3CTY A;  4C77 A;  4OVI A;  1ZDL A;  3AEF A;  3LZX A;  2PHH A;  5U25 A;  4NEV A;  5HHF A;  2QA2 A;  1H83 A;  2OAL A;  4U2T A;  1EL7 A;  1CF3 A;  1GRB A;  3CGB A;  4X9M A;  1L0V A;  3DA1 A;  5M10 A;  3NH3 X;  4JNA A;  3GRS A;  1L9D A;  3AD7 B;  2YVG A;  1LTX R;  1OJC A;  3CN8 A;  2YG4 A;  1BZL A;  4GDP A;  1E7P A;  4CNJ A;  2RGJ A;  5JCN A;  1N4U A;  4NEW A;  2C65 A;  2BK5 A;  1TDN A;  2B76 A;  3KKJ A;  1IUS A;  4Z44 A;  4JNQ A;  3K7M X;  3DH9 A;  4H4T A;  4CY8 A;  3GD3 A;  3KU9 A;  3CNS A;  4U8M A;  4BV6 A;  3LXD A;  1UKV G;  3S61 A;  4U8N A;  2GH5 A;  5BUK A;  4PAA A;  1GRT A;  2BXS A;  2YQU A;  3AE1 A;  4Z24 A;  2WBA A;  1JRZ A;  4J31 A;  3COX A;  1PJ5 A;  1E1L A;  4UDR A;  1OJD A;  2B7R A;  4B63 A;  4N9X A;  1QJD A;  1H86 A;  4TM4 A;  2XVH A;  4H4Z A;  4XWZ A;  5FS9 A;  1EL9 A;  3UKA A;  4Y4L A;  1L9C A;  2XLU A;  1IUV A;  1FL2 A;  2FJD A;  1NPX A;  5CKU A;  1H6V A;  4U8I A;  5GRT A;  2O9Z A;  4AP3 A;  4YSZ A;  2GR2 A;  3H4K A;  3M12 A;  4YTP A;  5IQ1 A;  3PVC A;  1PS9 A;  2FJA A;  2BS4 A;  2GR3 A;  2TMD A;  1GRE A;  3AED A;  3UTE A;  3NYF A;  4B1B A;  2IVE A;  2R4J A;  2WS3 A;  2YG6 A;  2OAM A;  2BS3 A;  2W0H A;  2WDQ A;  3AE8 A;  2BAB A;  1REO A;  1NDA A;  1F3P A;  2F5Z A;  3L8K A;  3UKL A;  2AR8 A;  3RP7 A;  4CCQ A;  3ALL A;  1Q1W A;  1Z6L A;  3AEC A;  3NKS A;  1CL0 A;  1E1M A;  2PYX A;  3VRA A;  4D04 A;  1KFY A;  3ICT A;  5BVA A;  2Q7V A;  2YLT A;  4U8P A;  3BI4 A;  1QLB A;  4YKF A;  1COY A;  1LPF A;  5L46 A;  2C72 A;  1NHP A;  2ACZ A;  3F8R A;  5U1O A;  3E1T A;  4CBQ A;  3IHG A;  3NHO X;  2V6O A;  4Z2U A;  1ZOY A;  3NIX A;  3NG7 X;  3URH A;  4B68 A;  3UOY A;  2YAU A;  1DJQ A;  2BCP A;  2NPX A;  4U8K A;  4HB9 A;  1CJ2 A;  1LV0 A;  1CHU A;  4H50 A;  2C75 A;  1YKJ A;  3GWD A;  4EQS A;  4B66 A;  3GMC A;  2WET A;  5CQF A;  3SGL A;  2GF3 A;  2GQW A;  4U8L A;  2GMJ A;  2XFN A;  1ZY8 A;  2IID A;  2QA1 A;  2X99 A;  3C96 A;  4K7Z A;  4B67 A;  5J60 A;  3QVR A;  5FMH A;  1B8S A;  1IUU A;  2WP5 A;  3SFE A;  4OPL A;  3UKP A;  2VVL G;  2C3C A;  2WEU A;  4H4U A;  2WHD A;  3EPT A;  4TM0 A;  1GXF A;  1N1P A;  4TLZ A;  1NEN A;  3RHA A;  4GR1 A;  3LAD A;  3NYC A;  3AE3 A;  3AYI A;  1DOB A;  4H4S A;  2ZZC A;  3AEE A;  2HQM A;  3K30 A;  4K8D A;  2XFO A;  3UP5 A;  1M64 A;  2OA1 A;  4TLX A;  1JNR A;  3UOX A;  4U2L A;  3NTD A;  4I59 A;  3CIR A;  1ZMC A;  1BGJ A;  2WU5 A;  1KSU A;  3FPZ A;  3FBS A;  2GEW A;  1FCD A;  1TDK A;  1CBO A;  1TYP A;  2E5V A;  4YSX A;  3EAO A;  2WOV A;  2X50 A;  1LVL A;  1PXC A;  2R0G A;  3DK8 A;  1E6E A;  5KOX A;  1JOA A;  1D5T A;  5J7X A;  2XVI A;  2X8C A;  1QO8 A;  2XDO A;  5HY5 A;  4AT2 A;  2R4E A;  3DK9 A;  2BK4 A;  3LB8 A;  4USR A;  3AE4 A;  4GF7 A;  1TDE A;  1VRQ B;  5IPY A;  4A7A A;  1CJC A;  1EL8 A;  1PBC A;  1E1K A;  1OJ9 A;  4APN A;  1GPE A;  4UP3 A;  3ISH A;  2V3B A;  4NTC A;  4NZH A;  4H4Q A;  1H82 A;  3CGD A;  4B65 A;  2B9W A;  2R0P A;  4BJZ A;  2WOW A;  3RP8 A;  4J2W A;  2C64 A;  4JY3 A;  1LQU A;  2BA9 A;  4O5Q A;  4OPT A;  2A89 A;  1GOS A;  2VVM A;  4AT0 A;  4FK1 C;  4YTN A;  5JCI A;  2C73 A;  4H4Y A;  2ZZ0 A;  1XAN A;  4BK1 A;  2EQ8 A;  2FBW A;  3ALJ A;  3FG2 P;  1TYT A;  3GDP A;  2FJB A;  2XFP A;  2B9Y A;  1ZMD A;  4USQ A;  5EBK A;  1GT8 A;  3KD9 A;  3V76 A;  1BKW A;  3K7Q X;  2WPC A;  1NHR A;  4HA6 A;  1S2Q A;  4WCT A;  1CJ4 A;  1VDC A;  3NN0 X;  4H4X A;  1Q9I A;  3EAN A;  3SQP A;  4JDR A;  1ZX9 A;  4EMJ A;  2AAQ A;  2H89 A;  3Q6J A;  3DJE A;  5BRT A;  5C3J A;  3GSI A;  3PO7 A;  4GDE A;  4I58 A;  4FDC B;  1JU2 A;  1BGN A;  4EM3 A;  2XLS A;  2YR6 A;  2GAH B;  1P2H A;  2I0Z A;  1OJA A;  3IWA A;  4U8O A;  5EB4 A;  4KPR A;  2B7S A;  2VOU A;  4LII A;  4ADW A;  2YG7 A;  4FK1 A;  1JRX A;  2C70 A;  2BK3 A;  2WP9 A;  3NRN A;  3P4R A;  3CNJ A;  3V3N A;  1AOG A;  2JK6 A;  4K2X A;  2APG A;  1GND A;  2GR1 A;  2BAC A;  5U63 A;  1TRB A;  1DOE A;  4CRT A;  2BC1 A;  1BF3 A;  3GDN A;  3S5W A;  2FJE A;  1DNC A;  2YG3 A;  2YVJ A;  1XPQ A;  2ZZB A;  3AB1 A;  3KLJ A;  3QSE A;  4FX9 A;  1SEZ A;  1S3B A;  4H4P A;  4J56 A;  4AP1 A;  1K0L A;  5HYM A;  5TR3 A;  4H4R A;  2YLZ A;  4CCR A;  2J3N A;  3NK2 X;  3NK0 X;  4EM4 A;  4EMW A;  5LV9 A;  3AD8 B;  2V5Z A;  4IVM B;  4YKG A;  1CC2 A;  3UOV A;  3DJG X;  1LQT A;  1PN0 A;  3UP4 A;  4A99 A;  2YR5 A;  2YM2 A;  2YWL A;  1D7L A;  1GET A;  3Q9T A;  2X8G A;  1NHS A;  1PBB A;  2WPE A;  3AE6 A;  3CND A;  5ER0 A;  4U8J A;  1KDG A;  3II4 A;  3NNE A;  1GTH A;  4UDQ A;  4JY2 A;  5M0Z A;  3AEB A;  4J57 A;  1OJT A;  3UTF A;  3KA7 A;  2GRT A;  1MXT A;  3PS9 A;  4EIP A;  4YSY A;  2GMH A;  3HZL A;  1GTE A;  2JB1 A;  4YXD A;  2R45 A;  5FS6 A;  4RSL A;  3QFB A;  2WES A;  3FMW A;  3D8X A;  3NGC X;  5KOW A;  3VRD B;  1NHQ A;  3H8I A;  1ONF A;  1O5W A;  1ZK7 A;  1O95 A;  3LOV A;  4EQX A;  3I3L A;  4J34 A;  4H7U A;  3O0H A;  1NEK A;  3UKF A;  3ICS A;  4TM1 A;  5BUL A;  1N4W A;  2R46 A;  1B4V A;  2C66 A;  3CGC A;  4YWO A;  3VR9 A;  4IVO B;  4REK A;  5HXI A;  2C7G A;  3ATR A;  4A65 A;  1F8R A;  1XDI A;  5JCL A;  5KRQ A;  1E1N A;  4O5U A;  2C76 A;  2V60 A;  3AYJ A;  3M13 A;  3NTA A;  5JCM A;  1KNR A;  5KWF A;  2C67 A;  4GUV A;  4WX1 A;  2YM1 A;  2JKC A;  4OPU A;  2IVD A;  2Y6R A;  3AEA A;  3NLC A;  3CPJ G;  3KVE A;  3UKK A;  1W4X A;  3BHF A;  1H7W A;  1MOK A;  1EL5 A;  4H4V A;  5EB5 A;  3T37 A;  4Z26 A;  1O94 A;  3AD9 B;  1CC4 A;  1B37 A;  1K4Q A;  3AEG A;  1TDF A;  3GWF A;  4BUR A;  2YG5 A;  3UTH A;  4KX6 A;  3CNT A;  3ZYX A;  1NG3 A;  1JNZ A;  2A8X A;  2WDR A;  2RAB A;  2WQY A;  3FIM B;  2B9X A;  2GB0 A;  3GRT A;  1YQZ A;  5GSN A;  1RYI A;  1PXA A;  4DSH A;  4YSH A;  3I6D A;  2YVF A;  2YLS A;  4X9N A;  3H8L A;  4OCG A;  1PXB A;  1RSG A;  4ICY A;  3AE5 A;  4C74 A;  3AXB A;  2E1M A;  3SM8 A;  1JEH A;  5FS7 A;  1GSN A;  1VG9 A;  3ABV A;  3AWI A;  1D7Y A;  4K5S A;  1Y0P A;  4OPC A;  4Z25 A;  2XLP A;  3K7T A;  2Q0L A;  3IF9 A;  3BI2 A;  3CPI G;  4IA5 A;  4ZN0 A;  2GR0 A;  5FS8 A;  3AE7 A;  3NN6 X;  1PHH A;  2BC0 A;  1S3E A;  4K22 A;  4IA6 A;  2V61 A;  4OPG A;  1YQ4 A;  2XLT A;  3EF6 A;  5DBJ A;  1GRG A;  2XCG A;  3BHK A;  1L9E A;  4H2P A;  1E39 A;  2CFY A;  4A79 A;  2GAG B;  1EBD A;  4EIQ A;  2Z5Y A;  4MJW A;  2R9Z A;  1FEC A;  1TDO A;  4C5O A;  4Z2R A;  3KPF A;  3RED A;  4A6N B;  2ZBW A;  4YT0 A;  2XVJ A;  4LU6 A;  1F8S A;  3QJ4 A;  3LJP A;  1GEU A;  4GRT A;  3BNM A;  2ARD A;  1XHC A;  4LA1 A;  1VQW A;  1NG4 A;  4NTE A;  3IHM A;  4RG4 A;  2E4G A;  2VZ2 A;  1ZOV A;  3ICR A;  4U2S A;  3RNM A;  3WE0 A;  4EQR A;  1Y56 B;  4ECH A;  2GQF A;  3AE2 A;  1FEA A;  4OPI A;  3GD4 A;  4E0V A;  2Q6U A;  1F8W A;  2VRL A;  2VVL A;  3F8D A;  3GYJ A;  2BXR A;  3R9U A;  4C3X A;  2EQ6 A;  1IUT A;  2XFQ A;  4M52 A;  3G5R A;  2WU2 A;  2AQJ A;  4BK2 A;  2TPR A;  3P4Q A;  4YTM A;  4DNA A;  2R0C A;  3DGZ A;  1PJ6 A;  2CVJ A;  3ADA B;  4P9S A;  2GV8 A;  2YLW A;  3RP6 A;  4DSG A;  1RP0 A;  1MO9 A;  1PJ7 A;  4J36 A;  4IV9 A;  4Y4M A;  1DJN A;  2XVE A;  1VG0 A;  4B64 A;  1GAL A;  3QSM A; 
#chains in the Genus database with same CATH topology
 2JBV A;  4NTD A;  4II3 A;  2X8H A;  2RGO A;  1K0I A;  4Z2T A;  4OPD A;  3OC4 A;  3VQR A;  4J33 A;  4ZCD A;  3UTG A;  4C3Y A;  3AYL A;  1PBD A;  3OZ2 A;  4H4W A;  3UKQ A;  4UDP A;  5EOW A;  4ZCC A;  2BYB A;  3CNP A;  2WPF A;  1FEB A;  2XYO A;  3M0O A;  1GRH A;  5IQ4 A;  3C4N A;  2JAE A;  3P4P A;  3QVP A;  1DOC A;  2XLR A;  3UOZ A;  1H81 A;  2DKI A;  1PDH A;  2JB3 A;  3C4A A;  3T2Y A;  1NAA A;  1LJ1 A;  2A87 A;  1DXL A;  3DME A;  3P4S A;  2EQ9 A;  2YLX A;  1GRA A;  1P2E A;  3B6D A;  4A6N A;  2YLR A;  2C3D A;  3IC9 A;  1H84 A;  3NT6 A;  4II2 A;  3SFD A;  2RGH A;  1ZP0 A;  3NK1 X;  3DJJ A;  1KNP A;  4XXG A;  1D4C A;  1GES A;  3CPH G;  1B5Q A;  1PBE A;  3DJD A;  1V59 A;  5KXJ A;  2EQ7 A;  2BCG G;  3QSS A;  1S2Y A;  4D03 A;  4PAB A;  1KF6 A;  1Y56 A;  2NVK X;  1HYU A;  1K0J A;  3JSK A;  3SY4 A;  2C4C A;  4AOS A;  3D1C A;  3UCL A;  4RG3 A;  2UZZ A;  4CY6 A;  3G5Q A;  2Q0K A;  1Q1R A;  1PBF A;  2YR4 A;  4H2N A;  1KSS A;  4GCM A;  4BK3 A;  3AE9 A;  3GYI A;  3P9U A;  4TM3 A;  1N4V A;  1D4E A;  4H2Q A;  3B3R A;  2WDV A;  2XVF A;  3BI5 A;  3GMB A;  3GYX A;  4Z43 A;  2VQ7 A;  4CNK A;  4EMI A;  2VQB A;  1H7X A;  4Y4N A;  4EQW A;  2H88 A;  4AOX A;  5JCK A;  2BS2 A;  3ITJ A;  1YQ3 A;  1CJ3 A;  3VR8 A;  3V3O A;  4B63 A;  2CUL A;  4G73 A;  3ZDN A;  1IUW A;  1BWC A;  5KVI A;  4JN9 A;  1M6I A;  3ATQ A;  3BNU A;  3F8P A;  1ZKQ A;  3DGH A;  2XFU A;  4X4J A;  4XWR A;  2X3N A;  2VRM A;  2Y6Q A;  2WOI A;  4DGK A;  2JB2 A;  4B69 A;  5KMS A;  1GRF A;  1DOD A;  2DKH A;  4K5R A;  4JQ9 A;  1FOH A;  2V3A A;  4A9W A;  2QAE A;  3G5S A;  3LZW A;  2OLN A;  3P1W A;  4A5L A;  2OLO A;  1F6M A;  2QCU A;  3KPK A;  3ALM A;  5KVH A;  5C2T A;  1ELI A;  3DK4 A;  1D4D A;  3L1R A;  1YY5 A;  2WP6 A;  3CGE A;  1IJH A;  2Z5X A;  1GER A;  1IUX A;  3QFA A;  1CC6 A;  3T14 A;  4BJY A;  1JRY A;  3NYE A;  1X31 B;  3UKH A;  2CDU A;  2GVC A;  4H2R A;  3VRB A;  1GV4 A;  3CTY A;  4C77 A;  4OVI A;  1ZDL A;  3AEF A;  4NWZ A;  3LZX A;  2PHH A;  5U25 A;  4NEV A;  5HHF A;  2QA2 A;  1H83 A;  2OAL A;  4U2T A;  1EL7 A;  1CF3 A;  1GRB A;  3CGB A;  4X9M A;  1L0V A;  3DA1 A;  5M10 A;  3NH3 X;  4JNA A;  3GRS A;  1L9D A;  3AD7 B;  2YVG A;  1LTX R;  1OJC A;  3CN8 A;  2YG4 A;  1BZL A;  4GDP A;  3SZF A;  1E7P A;  4CNJ A;  2RGJ A;  5JCN A;  1N4U A;  4NEW A;  2C65 A;  2BK5 A;  1TDN A;  2B76 A;  3KKJ A;  1IUS A;  4Z44 A;  4JNQ A;  3K7M X;  3DH9 A;  4H4T A;  4CY8 A;  3GD3 A;  3KU9 A;  3CNS A;  4U8M A;  4BV6 A;  3LXD A;  4G6G A;  1UKV G;  3S61 A;  4U8N A;  2GH5 A;  5BUK A;  4PAA A;  1GRT A;  2BXS A;  2YQU A;  3AE1 A;  4Z24 A;  2WBA A;  1JRZ A;  4J31 A;  3COX A;  1PJ5 A;  1E1L A;  4UDR A;  1OJD A;  2B7R A;  3SXI A;  4N9X A;  1QJD A;  1H86 A;  4TM4 A;  2XVH A;  4H4Z A;  4XWZ A;  5FS9 A;  1EL9 A;  3UKA A;  4Y4L A;  1L9C A;  2XLU A;  1IUV A;  1FL2 A;  2FJD A;  1NPX A;  5CKU A;  1H6V A;  3T2Z A;  4U8I A;  5GRT A;  2O9Z A;  4AP3 A;  4YSZ A;  2GR2 A;  3H4K A;  3M12 A;  4YTP A;  5KMQ A;  5IQ1 A;  3PVC A;  1PS9 A;  2FJA A;  2BS4 A;  2GR3 A;  2TMD A;  1GRE A;  3AED A;  3UTE A;  3NYF A;  4B1B A;  2IVE A;  2R4J A;  2WS3 A;  2YG6 A;  2OAM A;  3HYV A;  2BS3 A;  2W0H A;  2WDQ A;  3AE8 A;  2BAB A;  1REO A;  1NDA A;  1F3P A;  2F5Z A;  3L8K A;  3UKL A;  2AR8 A;  3RP7 A;  4CCQ A;  3ALL A;  1Q1W A;  1Z6L A;  3AEC A;  3NKS A;  1CL0 A;  1E1M A;  2PYX A;  3VRA A;  4D04 A;  1KFY A;  3ICT A;  5BVA A;  2Q7V A;  2YLT A;  3SZ0 A;  4U8P A;  3BI4 A;  1QLB A;  4YKF A;  1COY A;  1LPF A;  5L46 A;  2C72 A;  1NHP A;  2ACZ A;  3F8R A;  5U1O A;  3E1T A;  4CBQ A;  3IHG A;  3NHO X;  3SZC A;  2V6O A;  3SZW A;  1ZOY A;  3NIX A;  4Z2U A;  3NG7 X;  3URH A;  4B68 A;  3UOY A;  2YAU A;  3T31 A;  1DJQ A;  2BCP A;  2NPX A;  4U8K A;  4G6H A;  4HB9 A;  1CJ2 A;  1LV0 A;  1CHU A;  4H50 A;  2C75 A;  4G9K A;  1YKJ A;  3GWD A;  4GAP A;  4B66 A;  3GMC A;  4EQS A;  2WET A;  5CQF A;  3SGL A;  2GF3 A;  2GQW A;  4U8L A;  2GMJ A;  2XFN A;  1ZY8 A;  2IID A;  2QA1 A;  2X99 A;  3C96 A;  4K7Z A;  4B67 A;  5J60 A;  3QVR A;  5FMH A;  1B8S A;  1IUU A;  2WP5 A;  3SFE A;  4OPL A;  3UKP A;  2VVL G;  2C3C A;  2WEU A;  4H4U A;  2WHD A;  3EPT A;  4TM0 A;  1GXF A;  1N1P A;  4TLZ A;  1NEN A;  3RHA A;  4GR1 A;  3LAD A;  3NYC A;  3AE3 A;  3AYI A;  1DOB A;  4H4S A;  2ZZC A;  3SYI A;  3AEE A;  2HQM A;  3K30 A;  4K8D A;  2XFO A;  3UP5 A;  1M64 A;  2OA1 A;  4TLX A;  1JNR A;  3UOX A;  4U2L A;  3NTD A;  4I59 A;  3CIR A;  1ZMC A;  1BGJ A;  2WU5 A;  1KSU A;  3FPZ A;  3FBS A;  2GEW A;  1FCD A;  1TDK A;  1CBO A;  1TYP A;  2E5V A;  4YSX A;  3EAO A;  2WOV A;  2X50 A;  1LVL A;  1PXC A;  2R0G A;  3DK8 A;  1E6E A;  5KOX A;  1JOA A;  1D5T A;  5J7X A;  2XVI A;  2X8C A;  1QO8 A;  2XDO A;  5HY5 A;  4AT2 A;  2R4E A;  3DK9 A;  2BK4 A;  3LB8 A;  4USR A;  3AE4 A;  4GF7 A;  1TDE A;  1VRQ B;  5IPY A;  4A7A A;  1CJC A;  1EL8 A;  1PBC A;  1E1K A;  1OJ9 A;  4APN A;  1GPE A;  4UP3 A;  3ISH A;  2V3B A;  4NTC A;  4NZH A;  4H4Q A;  1H82 A;  3CGD A;  4B65 A;  2B9W A;  2R0P A;  3HYX A;  4BJZ A;  2WOW A;  3RP8 A;  4J2W A;  2C64 A;  4JY3 A;  1LQU A;  2BA9 A;  4O5Q A;  4OPT A;  2A89 A;  1GOS A;  2VVM A;  4AT0 A;  4FK1 C;  4YTN A;  5JCI A;  2C73 A;  4H4Y A;  2ZZ0 A;  1XAN A;  4BK1 A;  2EQ8 A;  2FBW A;  3ALJ A;  3FG2 P;  1TYT A;  3GDP A;  2FJB A;  2XFP A;  2B9Y A;  1ZMD A;  4USQ A;  5EBK A;  1GT8 A;  3KD9 A;  3V76 A;  1BKW A;  3K7Q X;  2WPC A;  1NHR A;  4HA6 A;  1S2Q A;  4WCT A;  1CJ4 A;  1VDC A;  3NN0 X;  4H4X A;  1Q9I A;  3EAN A;  3SQP A;  4JDR A;  1ZX9 A;  4EMJ A;  2AAQ A;  2H89 A;  3Q6J A;  3DJE A;  5BRT A;  5C3J A;  3GSI A;  3PO7 A;  4GDE A;  4I58 A;  4FDC B;  1JU2 A;  1BGN A;  4EM3 A;  2XLS A;  2YR6 A;  5KMR A;  2GAH B;  1P2H A;  2I0Z A;  1OJA A;  3IWA A;  4U8O A;  5EB4 A;  4KPR A;  2B7S A;  2VOU A;  4LII A;  4ADW A;  2YG7 A;  4FK1 A;  1JRX A;  2C70 A;  2BK3 A;  2WP9 A;  3NRN A;  3P4R A;  3CNJ A;  3V3N A;  1AOG A;  2JK6 A;  4K2X A;  2APG A;  1GND A;  2GR1 A;  2BAC A;  5U63 A;  1TRB A;  1DOE A;  4CRT A;  2BC1 A;  1BF3 A;  3GDN A;  3S5W A;  2FJE A;  1DNC A;  2YG3 A;  2YVJ A;  1XPQ A;  2ZZB A;  3AB1 A;  3KLJ A;  3QSE A;  4FX9 A;  1SEZ A;  1S3B A;  4H4P A;  4J56 A;  4AP1 A;  1K0L A;  5HYM A;  5TR3 A;  4H4R A;  2YLZ A;  4CCR A;  2J3N A;  3NK2 X;  3NK0 X;  4EM4 A;  4EMW A;  5LV9 A;  3AD8 B;  2V5Z A;  4IVM B;  4YKG A;  1CC2 A;  3UOV A;  3DJG X;  1LQT A;  1PN0 A;  3UP4 A;  4A99 A;  2YR5 A;  2YM2 A;  2YWL A;  1D7L A;  2BRY A;  1GET A;  3Q9T A;  2X8G A;  1NHS A;  1PBB A;  2WPE A;  3AE6 A;  3CND A;  5ER0 A;  4U8J A;  1KDG A;  3II4 A;  3NNE A;  1GTH A;  4UDQ A;  4JY2 A;  5M0Z A;  3AEB A;  4J57 A;  1OJT A;  3UTF A;  3KA7 A;  2GRT A;  1MXT A;  3PS9 A;  4EIP A;  4YSY A;  2GMH A;  3HZL A;  1GTE A;  2JB1 A;  4YXD A;  2R45 A;  5FS6 A;  4RSL A;  3QFB A;  2WES A;  3FMW A;  3D8X A;  3NGC X;  5KOW A;  3VRD B;  1NHQ A;  2BRA A;  3H8I A;  1ONF A;  1O5W A;  1ZK7 A;  1O95 A;  3LOV A;  4EQX A;  3I3L A;  4J34 A;  4H7U A;  3O0H A;  1NEK A;  3UKF A;  3ICS A;  4TM1 A;  5BUL A;  1N4W A;  2R46 A;  1B4V A;  2C66 A;  3CGC A;  4NNJ A;  4YWO A;  3VR9 A;  4IVO B;  4REK A;  5HXI A;  3T2K A;  2C7G A;  3ATR A;  4A65 A;  1F8R A;  1XDI A;  5JCL A;  5KRQ A;  1E1N A;  4O5U A;  3SX6 A;  2C76 A;  2V60 A;  3AYJ A;  3M13 A;  3NTA A;  5JCM A;  1KNR A;  5KWF A;  2C67 A;  4GUV A;  4WX1 A;  2YM1 A;  2JKC A;  4OPU A;  2IVD A;  2Y6R A;  3AEA A;  3NLC A;  3CPJ G;  3KVE A;  3UKK A;  1W4X A;  3BHF A;  1H7W A;  1MOK A;  1EL5 A;  4H4V A;  5EB5 A;  3T37 A;  4Z26 A;  1O94 A;  3AD9 B;  1CC4 A;  1B37 A;  1K4Q A;  3AEG A;  1TDF A;  3GWF A;  3HYW A;  2YG5 A;  4BUR A;  5KMP A;  3UTH A;  4G74 A;  4KX6 A;  3CNT A;  3ZYX A;  1NG3 A;  1JNZ A;  2A8X A;  2WDR A;  2RAB A;  2WQY A;  3FIM B;  2B9X A;  2GB0 A;  3GRT A;  1YQZ A;  4GAV A;  1RYI A;  1PXA A;  5GSN A;  4DSH A;  4YSH A;  3I6D A;  2YVF A;  5KNL A;  2YLS A;  4X9N A;  3H8L A;  4OCG A;  1PXB A;  1RSG A;  4ICY A;  3AE5 A;  4C74 A;  3AXB A;  2E1M A;  3SM8 A;  1JEH A;  5FS7 A;  1GSN A;  1VG9 A;  3ABV A;  3AWI A;  1D7Y A;  4K5S A;  1Y0P A;  4OPC A;  4Z25 A;  2XLP A;  3K7T A;  2Q0L A;  3IF9 A;  3BI2 A;  3CPI G;  4IA5 A;  4ZN0 A;  2GR0 A;  5FS8 A;  3AE7 A;  3NN6 X;  1PHH A;  2BC0 A;  1S3E A;  4K22 A;  4IA6 A;  2V61 A;  4OPG A;  1YQ4 A;  2XLT A;  3EF6 A;  5DBJ A;  1GRG A;  2XCG A;  3BHK A;  1L9E A;  4H2P A;  1E39 A;  2CFY A;  4A79 A;  2GAG B;  1EBD A;  4EIQ A;  2Z5Y A;  4MJW A;  2R9Z A;  1FEC A;  1TDO A;  4C5O A;  4Z2R A;  3KPF A;  3RED A;  4A6N B;  2ZBW A;  4YT0 A;  2XVJ A;  4LU6 A;  1F8S A;  3QJ4 A;  3LJP A;  1GEU A;  4GRT A;  3BNM A;  2ARD A;  1XHC A;  4LA1 A;  1VQW A;  1NG4 A;  4NTE A;  3IHM A;  4RG4 A;  2E4G A;  2VZ2 A;  1ZOV A;  3ICR A;  4U2S A;  3RNM A;  3WE0 A;  4EQR A;  1Y56 B;  4ECH A;  2GQF A;  3CMM A;  3AE2 A;  1FEA A;  4OPI A;  3GD4 A;  3T0K A;  4E0V A;  2Q6U A;  1F8W A;  2VRL A;  2VVL A;  3F8D A;  3GYJ A;  2BXR A;  3R9U A;  4C3X A;  2EQ6 A;  1IUT A;  2XFQ A;  4M52 A;  3G5R A;  2WU2 A;  2AQJ A;  4BK2 A;  2TPR A;  3P4Q A;  4YTM A;  4DNA A;  2R0C A;  3DGZ A;  1PJ6 A;  2CVJ A;  3ADA B;  4P9S A;  2GV8 A;  2YLW A;  3RP6 A;  4DSG A;  1RP0 A;  1MO9 A;  1PJ7 A;  4J36 A;  4IV9 A;  4Y4M A;  1DJN A;  2XVE A;  1VG0 A;  4B64 A;  1GAL A;  3QSM A; 
#chains in the Genus database with same CATH homology
 2JBV A;  4NTD A;  4II3 A;  2X8H A;  2RGO A;  1K0I A;  4Z2T A;  4OPD A;  3OC4 A;  3VQR A;  4J33 A;  4ZCD A;  3UTG A;  4C3Y A;  3AYL A;  1PBD A;  3OZ2 A;  4H4W A;  3UKQ A;  4UDP A;  5EOW A;  4ZCC A;  2BYB A;  3CNP A;  2WPF A;  1FEB A;  2XYO A;  3M0O A;  1GRH A;  5IQ4 A;  3C4N A;  2JAE A;  3P4P A;  3QVP A;  1DOC A;  2XLR A;  3UOZ A;  1H81 A;  2DKI A;  1PDH A;  2JB3 A;  3C4A A;  3T2Y A;  1NAA A;  1LJ1 A;  2A87 A;  1DXL A;  3DME A;  3P4S A;  2EQ9 A;  2YLX A;  1GRA A;  1P2E A;  3B6D A;  4A6N A;  2YLR A;  2C3D A;  3IC9 A;  1H84 A;  3NT6 A;  4II2 A;  3SFD A;  2RGH A;  1ZP0 A;  3NK1 X;  3DJJ A;  1KNP A;  4XXG A;  1D4C A;  1GES A;  3CPH G;  1B5Q A;  1PBE A;  3DJD A;  1V59 A;  5KXJ A;  2EQ7 A;  2BCG G;  3QSS A;  1S2Y A;  4D03 A;  4PAB A;  1KF6 A;  1Y56 A;  2NVK X;  1HYU A;  1K0J A;  3JSK A;  3SY4 A;  2C4C A;  4AOS A;  3D1C A;  3UCL A;  4RG3 A;  2UZZ A;  4CY6 A;  3G5Q A;  2Q0K A;  1Q1R A;  1PBF A;  2YR4 A;  4H2N A;  1KSS A;  4GCM A;  4BK3 A;  3AE9 A;  3GYI A;  3P9U A;  4TM3 A;  1N4V A;  1D4E A;  4H2Q A;  3B3R A;  2WDV A;  2XVF A;  3BI5 A;  3GMB A;  3GYX A;  4Z43 A;  2VQ7 A;  4CNK A;  4EMI A;  2VQB A;  1H7X A;  4Y4N A;  4EQW A;  2H88 A;  4AOX A;  5JCK A;  2BS2 A;  3ITJ A;  1YQ3 A;  1CJ3 A;  3VR8 A;  3V3O A;  4B63 A;  2CUL A;  4G73 A;  3ZDN A;  1IUW A;  1BWC A;  5KVI A;  4JN9 A;  1M6I A;  3ATQ A;  3BNU A;  3F8P A;  1ZKQ A;  3DGH A;  2XFU A;  4X4J A;  4XWR A;  2X3N A;  2VRM A;  2Y6Q A;  2WOI A;  4DGK A;  2JB2 A;  4B69 A;  5KMS A;  1GRF A;  1DOD A;  2DKH A;  4K5R A;  4JQ9 A;  1FOH A;  2V3A A;  4A9W A;  2QAE A;  3G5S A;  3LZW A;  2OLN A;  3P1W A;  4A5L A;  2OLO A;  1F6M A;  2QCU A;  3KPK A;  3ALM A;  5KVH A;  5C2T A;  1ELI A;  3DK4 A;  1D4D A;  3L1R A;  1YY5 A;  2WP6 A;  3CGE A;  1IJH A;  2Z5X A;  1GER A;  1IUX A;  3QFA A;  1CC6 A;  3T14 A;  4BJY A;  1JRY A;  3NYE A;  1X31 B;  3UKH A;  2CDU A;  2GVC A;  4H2R A;  3VRB A;  1GV4 A;  3CTY A;  4C77 A;  4OVI A;  1ZDL A;  3AEF A;  4NWZ A;  3LZX A;  2PHH A;  5U25 A;  4NEV A;  5HHF A;  2QA2 A;  1H83 A;  2OAL A;  4U2T A;  1EL7 A;  1CF3 A;  1GRB A;  3CGB A;  4X9M A;  1L0V A;  3DA1 A;  5M10 A;  3NH3 X;  4JNA A;  3GRS A;  1L9D A;  3AD7 B;  2YVG A;  1LTX R;  1OJC A;  3CN8 A;  2YG4 A;  1BZL A;  4GDP A;  3SZF A;  1E7P A;  4CNJ A;  2RGJ A;  5JCN A;  1N4U A;  4NEW A;  2C65 A;  2BK5 A;  1TDN A;  2B76 A;  3KKJ A;  1IUS A;  4Z44 A;  4JNQ A;  3K7M X;  3DH9 A;  4H4T A;  4CY8 A;  3GD3 A;  3KU9 A;  3CNS A;  4U8M A;  4BV6 A;  3LXD A;  4G6G A;  1UKV G;  3S61 A;  4U8N A;  2GH5 A;  5BUK A;  4PAA A;  1GRT A;  2BXS A;  2YQU A;  3AE1 A;  4Z24 A;  2WBA A;  1JRZ A;  4J31 A;  3COX A;  1PJ5 A;  1E1L A;  4UDR A;  1OJD A;  2B7R A;  3SXI A;  4N9X A;  1QJD A;  1H86 A;  4TM4 A;  2XVH A;  4H4Z A;  4XWZ A;  5FS9 A;  1EL9 A;  3UKA A;  4Y4L A;  1L9C A;  2XLU A;  1IUV A;  1FL2 A;  2FJD A;  1NPX A;  5CKU A;  1H6V A;  3T2Z A;  4U8I A;  5GRT A;  2O9Z A;  4AP3 A;  4YSZ A;  2GR2 A;  3H4K A;  3M12 A;  4YTP A;  5KMQ A;  5IQ1 A;  3PVC A;  1PS9 A;  2FJA A;  2BS4 A;  2GR3 A;  2TMD A;  1GRE A;  3AED A;  3UTE A;  3NYF A;  4B1B A;  2IVE A;  2R4J A;  2WS3 A;  2YG6 A;  2OAM A;  3HYV A;  2BS3 A;  2W0H A;  2WDQ A;  3AE8 A;  2BAB A;  1REO A;  1NDA A;  1F3P A;  2F5Z A;  3L8K A;  3UKL A;  2AR8 A;  3RP7 A;  4CCQ A;  3ALL A;  1Q1W A;  1Z6L A;  3AEC A;  3NKS A;  1CL0 A;  1E1M A;  2PYX A;  3VRA A;  4D04 A;  1KFY A;  3ICT A;  5BVA A;  2Q7V A;  2YLT A;  3SZ0 A;  4U8P A;  3BI4 A;  1QLB A;  4YKF A;  1COY A;  1LPF A;  5L46 A;  2C72 A;  1NHP A;  2ACZ A;  3F8R A;  5U1O A;  3E1T A;  4CBQ A;  3IHG A;  3NHO X;  3SZC A;  2V6O A;  3SZW A;  1ZOY A;  3NIX A;  4Z2U A;  3NG7 X;  3URH A;  4B68 A;  3UOY A;  2YAU A;  3T31 A;  1DJQ A;  2BCP A;  2NPX A;  4U8K A;  4G6H A;  4HB9 A;  1CJ2 A;  1LV0 A;  1CHU A;  4H50 A;  2C75 A;  4G9K A;  1YKJ A;  3GWD A;  4GAP A;  4B66 A;  3GMC A;  4EQS A;  2WET A;  5CQF A;  3SGL A;  2GF3 A;  2GQW A;  4U8L A;  2GMJ A;  2XFN A;  1ZY8 A;  2IID A;  2QA1 A;  2X99 A;  3C96 A;  4K7Z A;  4B67 A;  5J60 A;  3QVR A;  5FMH A;  1B8S A;  1IUU A;  2WP5 A;  3SFE A;  4OPL A;  3UKP A;  2VVL G;  2C3C A;  2WEU A;  4H4U A;  2WHD A;  3EPT A;  4TM0 A;  1GXF A;  1N1P A;  4TLZ A;  1NEN A;  3RHA A;  4GR1 A;  3LAD A;  3NYC A;  3AE3 A;  3AYI A;  1DOB A;  4H4S A;  2ZZC A;  3SYI A;  3AEE A;  2HQM A;  3K30 A;  4K8D A;  2XFO A;  3UP5 A;  1M64 A;  2OA1 A;  4TLX A;  1JNR A;  3UOX A;  4U2L A;  3NTD A;  4I59 A;  3CIR A;  1ZMC A;  1BGJ A;  2WU5 A;  1KSU A;  3FPZ A;  3FBS A;  2GEW A;  1FCD A;  1TDK A;  1CBO A;  1TYP A;  2E5V A;  4YSX A;  3EAO A;  2WOV A;  2X50 A;  1LVL A;  1PXC A;  2R0G A;  3DK8 A;  1E6E A;  5KOX A;  1JOA A;  1D5T A;  5J7X A;  2XVI A;  2X8C A;  1QO8 A;  2XDO A;  5HY5 A;  4AT2 A;  2R4E A;  3DK9 A;  2BK4 A;  3LB8 A;  4USR A;  3AE4 A;  4GF7 A;  1TDE A;  1VRQ B;  5IPY A;  4A7A A;  1CJC A;  1EL8 A;  1PBC A;  1E1K A;  1OJ9 A;  4APN A;  1GPE A;  4UP3 A;  3ISH A;  2V3B A;  4NTC A;  4NZH A;  4H4Q A;  1H82 A;  3CGD A;  4B65 A;  2B9W A;  2R0P A;  3HYX A;  4BJZ A;  2WOW A;  3RP8 A;  4J2W A;  2C64 A;  4JY3 A;  1LQU A;  2BA9 A;  4O5Q A;  4OPT A;  2A89 A;  1GOS A;  2VVM A;  4AT0 A;  4FK1 C;  4YTN A;  5JCI A;  2C73 A;  4H4Y A;  2ZZ0 A;  1XAN A;  4BK1 A;  2EQ8 A;  2FBW A;  3ALJ A;  3FG2 P;  1TYT A;  3GDP A;  2FJB A;  2XFP A;  2B9Y A;  1ZMD A;  4USQ A;  5EBK A;  1GT8 A;  3KD9 A;  3V76 A;  1BKW A;  3K7Q X;  2WPC A;  1NHR A;  4HA6 A;  1S2Q A;  4WCT A;  1CJ4 A;  1VDC A;  3NN0 X;  4H4X A;  1Q9I A;  3EAN A;  3SQP A;  4JDR A;  1ZX9 A;  4EMJ A;  2AAQ A;  2H89 A;  3Q6J A;  3DJE A;  5BRT A;  5C3J A;  3GSI A;  3PO7 A;  4GDE A;  4I58 A;  4FDC B;  1JU2 A;  1BGN A;  4EM3 A;  2XLS A;  2YR6 A;  5KMR A;  2GAH B;  1P2H A;  2I0Z A;  1OJA A;  3IWA A;  4U8O A;  5EB4 A;  4KPR A;  2B7S A;  2VOU A;  4LII A;  4ADW A;  2YG7 A;  4FK1 A;  1JRX A;  2C70 A;  2BK3 A;  2WP9 A;  3NRN A;  3P4R A;  3CNJ A;  3V3N A;  1AOG A;  2JK6 A;  4K2X A;  2APG A;  1GND A;  2GR1 A;  2BAC A;  5U63 A;  1TRB A;  1DOE A;  4CRT A;  2BC1 A;  1BF3 A;  3GDN A;  3S5W A;  2FJE A;  1DNC A;  2YG3 A;  2YVJ A;  1XPQ A;  2ZZB A;  3AB1 A;  3KLJ A;  3QSE A;  4FX9 A;  1SEZ A;  1S3B A;  4H4P A;  4J56 A;  4AP1 A;  1K0L A;  5HYM A;  5TR3 A;  4H4R A;  2YLZ A;  4CCR A;  2J3N A;  3NK2 X;  3NK0 X;  4EM4 A;  4EMW A;  5LV9 A;  3AD8 B;  2V5Z A;  4IVM B;  4YKG A;  1CC2 A;  3UOV A;  3DJG X;  1LQT A;  1PN0 A;  3UP4 A;  4A99 A;  2YR5 A;  2YM2 A;  2YWL A;  1D7L A;  2BRY A;  1GET A;  3Q9T A;  2X8G A;  1NHS A;  1PBB A;  2WPE A;  3AE6 A;  3CND A;  5ER0 A;  4U8J A;  1KDG A;  3II4 A;  3NNE A;  1GTH A;  4UDQ A;  4JY2 A;  5M0Z A;  3AEB A;  4J57 A;  1OJT A;  3UTF A;  3KA7 A;  2GRT A;  1MXT A;  3PS9 A;  4EIP A;  4YSY A;  2GMH A;  3HZL A;  1GTE A;  2JB1 A;  4YXD A;  2R45 A;  5FS6 A;  4RSL A;  3QFB A;  2WES A;  3FMW A;  3D8X A;  3NGC X;  5KOW A;  3VRD B;  1NHQ A;  2BRA A;  3H8I A;  1ONF A;  1O5W A;  1ZK7 A;  1O95 A;  3LOV A;  4EQX A;  3I3L A;  4J34 A;  4H7U A;  3O0H A;  1NEK A;  3UKF A;  3ICS A;  4TM1 A;  5BUL A;  1N4W A;  2R46 A;  1B4V A;  2C66 A;  3CGC A;  4NNJ A;  4YWO A;  3VR9 A;  4IVO B;  4REK A;  5HXI A;  3T2K A;  2C7G A;  3ATR A;  4A65 A;  1F8R A;  1XDI A;  5JCL A;  5KRQ A;  1E1N A;  4O5U A;  3SX6 A;  2C76 A;  2V60 A;  3AYJ A;  3M13 A;  3NTA A;  5JCM A;  1KNR A;  5KWF A;  2C67 A;  4GUV A;  4WX1 A;  2YM1 A;  2JKC A;  4OPU A;  2IVD A;  2Y6R A;  3AEA A;  3NLC A;  3CPJ G;  3KVE A;  3UKK A;  1W4X A;  3BHF A;  1H7W A;  1MOK A;  1EL5 A;  4H4V A;  5EB5 A;  3T37 A;  4Z26 A;  1O94 A;  3AD9 B;  1CC4 A;  1B37 A;  1K4Q A;  3AEG A;  1TDF A;  3GWF A;  3HYW A;  2YG5 A;  4BUR A;  5KMP A;  3UTH A;  4G74 A;  4KX6 A;  3CNT A;  3ZYX A;  1NG3 A;  1JNZ A;  2A8X A;  2WDR A;  2RAB A;  2WQY A;  3FIM B;  2B9X A;  2GB0 A;  3GRT A;  1YQZ A;  4GAV A;  1RYI A;  1PXA A;  5GSN A;  4DSH A;  4YSH A;  3I6D A;  2YVF A;  5KNL A;  2YLS A;  4X9N A;  3H8L A;  4OCG A;  1PXB A;  1RSG A;  4ICY A;  3AE5 A;  4C74 A;  3AXB A;  2E1M A;  3SM8 A;  1JEH A;  5FS7 A;  1GSN A;  1VG9 A;  3ABV A;  3AWI A;  1D7Y A;  4K5S A;  1Y0P A;  4OPC A;  4Z25 A;  2XLP A;  3K7T A;  2Q0L A;  3IF9 A;  3BI2 A;  3CPI G;  4IA5 A;  4ZN0 A;  2GR0 A;  5FS8 A;  3AE7 A;  3NN6 X;  1PHH A;  2BC0 A;  1S3E A;  4K22 A;  4IA6 A;  2V61 A;  4OPG A;  1YQ4 A;  2XLT A;  3EF6 A;  5DBJ A;  1GRG A;  2XCG A;  3BHK A;  1L9E A;  4H2P A;  1E39 A;  2CFY A;  4A79 A;  2GAG B;  1EBD A;  4EIQ A;  2Z5Y A;  4MJW A;  2R9Z A;  1FEC A;  1TDO A;  4C5O A;  4Z2R A;  3KPF A;  3RED A;  4A6N B;  2ZBW A;  4YT0 A;  2XVJ A;  4LU6 A;  1F8S A;  3QJ4 A;  3LJP A;  1GEU A;  4GRT A;  3BNM A;  2ARD A;  1XHC A;  4LA1 A;  1VQW A;  1NG4 A;  4NTE A;  3IHM A;  4RG4 A;  2E4G A;  2VZ2 A;  1ZOV A;  3ICR A;  4U2S A;  3RNM A;  3WE0 A;  4EQR A;  1Y56 B;  4ECH A;  2GQF A;  3CMM A;  3AE2 A;  1FEA A;  4OPI A;  3GD4 A;  3T0K A;  4E0V A;  2Q6U A;  1F8W A;  2VRL A;  2VVL A;  3F8D A;  3GYJ A;  2BXR A;  3R9U A;  4C3X A;  2EQ6 A;  1IUT A;  2XFQ A;  4M52 A;  3G5R A;  2WU2 A;  2AQJ A;  4BK2 A;  2TPR A;  3P4Q A;  4YTM A;  4DNA A;  2R0C A;  3DGZ A;  1PJ6 A;  2CVJ A;  3ADA B;  4P9S A;  2GV8 A;  2YLW A;  3RP6 A;  4DSG A;  1RP0 A;  1MO9 A;  1PJ7 A;  4J36 A;  4IV9 A;  4Y4M A;  1DJN A;  2XVE A;  1VG0 A;  4B64 A;  1GAL A;  3QSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...