3F90A

Desulfovibrio desulfuricans (atcc 29577) semiquinone flavodoxin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
SKVLIVFGSSTGNTESIAQKLEELIAAGGHEVTLLNAADASAENLADGYDAVLFGCSAWGMEDLEMQDDFLSLFEEFDRIGLAGRKVAAFASGDQEYEHFCGAVPAIEERAKELGATIIAEGLKMEGDASNDPEAVASFAEDVLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Desulfovibrio desulfuricans (ATCC 29577) flavodoxin in the semiquinone state
rcsb
source organism Desulfovibrio desulfuricans
molecule tags Electron transport
molecule keywords Flavodoxin
total genus 49
structure length 147
sequence length 147
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3f90A00
2BN4A 1FUEA 1J9ZA 2QMZA 4XDGA 3OX3A 3GFQA 2OHIA 2FAXA 4C76A 4ESEA 1XYVA 1SQSA 2BF4A 1RLIA 2FOXA 5A4KA 1TLLA 1BVYF 4M0CA 4YALA 3NHFA 4HS4A 2OHHA 3QFCA 3K1YA 3F90A 4CF6A 2HNBA 3W77A 3K20A 3KLBA 3R6WA 1V4BA 1TIKA 1FX1A 2FVXA 1CZUA 2QMYA 2QX8A 4Y7CA 1B1CA 2Z9CA 1J9GA 1DXQA 5BUCA 4Y9UA 4YAUA 2RG1A 3OJXA 4YQEA 1D04A 1CZKA 1JA1A 1XT6A 1ZWKA 3GAMA 2B3DA 4NULA 1YRHA 4OXXA 5EMNA 4LAFA 3N3BC 3RPEA 2FLVA 2MWMA 4YAWA 3OVMA 3LCMA 3NHPA 3SVLA 3NHJA 3N3AC 3B6KA 3HA2A 4FGLA 1QBGA 1XI2A 3U7RA 1GG5A 2Z9BA 1CZLA 1NNI1 5FA6A 3HR4A 3KAQA 2FZ5A 1OBVA 3N39C 1FLAA 4BMOB 2N1MA 4D02A 1H66A 1RTTA 2D5IA 2MOKA 1C7FA 3EYWA 4F8YA 1YDGA 2MTBA 3NHKA 4J8PA 4ZVKA 4C14A 2BMVA 3F6SA 2KQUA 3NHRA 1E5DA 2ZKIA 4N9QA 1XYYA 4QOGA 5EA2A 1DXOA 1VMEA 2OYSA 2QX6A 4FGKA 1AKRA 1FTGA 3ESXA 3ESYA 1H69A 3LT5A 4LTDA 4R81A 2FZVA 1FLVA 4XDHA 3JSXA 3UXEA 1AKTA 3O2NA 2KLBA 4LTNA 2V9CA 3UXHA 1RLJA 3OX2A 1WSBA 1AKVA 3QE2A 2FDXA 3EDOA 3NLLA 1ZWLA 2Q9UA 2XOEA 3NHSA 4FGJA 5FUQA 2V5VA 2W5UA 2F1OA 1BU5A 1C7EA 1ZX1A 1D03A 3L9XA 1QRDA 3FVWA 2OHJA 3OJWA 1AG9A 1YOBA 4HEQA 4YAOA 5EAIA 1JA0A 1RCFA 2QX9A 1F4PA 3O73A 3D7NA 5JROA 4NLLA 2HPVA 2QX4A 4GI5A 3NHLA 4QOIA 1T0IA 4QOJA 2AMJA 4QOEA 1AMOA 2QWXA 1AKQA 1J9EA 2Z9DA 4CETA 1QHEA 1CZHA 2X2OA 2R96A 1CZOA 3FJOA 3L9WA 1I1OA 3OWXA 5LBUA 6NULA 4N65A 3OX1A 1CZNA 1FLNA 3FW1A 5LLDA 1YCHA 1SG0A 2Q62A 3P0RA 4GR9A 2HNAA 4ZVLA 1AZLA 2ARKA 4GQIA 4ICIA 3B6MA 3KAPA 1D4AA 4H6PA 4U7HA 4LA4A 1AKUA 3ZHOA 5FX2A 3NFRA 2V5UA 4Y9RA 5TGZA 5NLLA 3F6RA 2BZSA 2Z98A 1FVXA 3HLYA 4S24A 5B3KA 1OFVA 3ESZA 3F2VA 3TZBA 4ZVMA 4PTZA 5B3LA 1YCGA 3B6IA 3OWHA 1DX9A 3W7AA 1J8QA 4LTMA 1WSWA 3NHYA 2A5LA 2XODA 1OBOA 3NHUA 4U7GA 1AKWA 4DIKA 3NHWA 3QFRA 3W78A 1YCFA 2FCRA 5LJIA 5F12A 5LVAA 4ZVNA 4FX2A 4U7FA 3S2YA 3TEMA 2WC1A 1X77A 2M6SA 2X2PA 4QOFA 2R97A 4DILA 4QODA 3KEGA 3B6JA 4N82A 3ES9A 4C0WA 4DY4A 5ULLA 5LBTA 3U7IA 3FNIA 1KBQA 1YKGA 2GSWA 2M6RA 2BPOA 3FX2A 4YAFA 4QOHA 4H2DA 2MT9A 5NULA 4C0XA 4BMPB 3GFRA 4PTYA 5LMCA 1AHNA 2QR2A 3TE7A 1KBOA 5F4BA 3W79A 1CZRA 5F51A 5LJLA 1QR2A 2FX2A 3GFSA 4PU0A 1T5BA 1FLDA 3G5MA
chains in the Genus database with same CATH superfamily
1EQUA 3K94A 4MRMB 4WK2B 5DLQC 3TSYA 4UUPA 5JNUA 1Z39A 3BZWA 1KQNA 2BVNA 2PJDA 3G88A 3CRVA 3G7NA 3GP5A 4P1ZA 4C04A 3C70A 1X6VA 4HGZA 1PL6A 4YLGA 3EPRA 3D4NA 4UD6A 3UKOA 3ZDEA 4TYNA 1FRZA 5E6UA 4BFTA 1SD5A 2IU3A 3FVRA 2XB9A 2XTNA 3A14A 1EU1A 3PB3A 4GKVA 1QOPB 1XPRA 5TB5A 1GU7A 2Q0HA 3AY6A 3WK4A 1TMOA 2HA5A 4WCVA 5LYJA 3OJXA 4C4RA 1AXRA 2CJPA 2CVZA 4NULA 3U3JA 4CV3A 4AECA 1JB9A 1PZEA 4GE0A 2D1FA 3JD0A 4DV1B 2OGWA 1MR3F 3DW3X 5ES3A 4MIEA 5T4FA 3LDGA 5FI5A 5KU1A 3MCVA 3FOZA 1Q22A 3IAEA 1QRAA 1NUAA 2DPYA 1DBPA 4ZJPA 2YJ5A 3BULA 3GRAA 3H05A 1M73E 4D4LA 5DNEA 4NX2A 3IX7A 1KSJA 3ZOZA 3PUIA 2WWRA 5LDHA 3HRKA 4B4UA 2BGRA 1IEXA 1ETHA 2DULA 2JPDA 2WP0A 1MP0A 2WSSD 1ZRMA 2NZVG 5EXDA 2GTIA 5C8YB 2AG8A 1VC2A 1H6AA 4UPVA 2ERXA 3PC6A 5M2QA 1UFVA 2EEZA 3VNAA 5JAZA 2GN0A 1P2SA 2M6KA 4DYDA 5KSOA 1ZS9A 2WY2D 3PT5A 1L5HB 4N5NA 1RRPA 1X1SA 4HAIA 2CBGA 3K0EA 2HCTA 1Y9AA 4J0JA 4WESA 1G20B 3KQSA 4R16A 4BP9A 1A9OA 2FA9A 4F38A 5L45A 5ENVA 2BGLA 5EHQA 4C06A 2RK4A 5AVVA 1FPMA 3TLKA 4QPPA 3UMYA 4QL3A 5FYQA 1P6UA 4NZMA 1MAUA 1Q1BA 1DAIA 2Q29A 5HF8A 3HVRA 3UMFA 5EP4A 3UJCA 2R66A 4LDZA 2RHDA 1XDSA 2F1JA 1CUCA 3QBTA 5EEHA 3TJZA 3RUPA 4CL8A 3W9SA 1Y1PA 3T52A 2G77B 5IVPA 3WB0A 1CRWG 2IIBA 4G0UA 3IDAA 4Z99A 3E61A 5K4HA 1DXYA 1RIIA 2N47A 3JWGA 1DEXA 1EM6A 1XQ1A 2V7EA 4OU5A 1Q0TA 1ANKA 1CJVC 1THMA 2O0KA 3O47A 4PYNA 4Y8VA 1OKKA 5EERA 3UB2A 4CTMA 2XECA 4BYGA 5JS2A 5FPSA 1Y34E 1Q16A 1MFPA 2QQ5A 3G17A 2QVXX 3GLQA 5AJWA 4P0PB 4U7WA 4Y2GA 1BU8A 4WZAB 3CFYA 3TJRA 1EAYA 3O38A 2H7XA 2I67A 2V1UA 4X95A 3EGCA 4Z9AA 5EE9A 4EY7A 4DRZA 1YZHA 2CMDA 2IWHA 3WKEA 2V45A 4NI5A 3F6CA 4NEGA 4Q3LA 4IVNA 3FETA 2G83A 4RMIA 4TVKA 4N5HX 1WF6A 1H9AA 3DJFA 1Q74A 1U5AA 2YN4A 4LZWA 3U60B 1T26A 2GS9A 3D0QA 3Q6IA 2WTXA 2P67A 5BW8A 1IUOA 4RZQA 3TAXA 2C8KA 3GRFA 3EJ6A 5ED0A 3IIMA 3ADKA 4D8WA 3KCNA 5C9ZA 3UICA 4JOSA 4LYDA 1ZNWA 3RJ9A 5FPYA 5BNFA 1MX5A 1IFXA 1ECCA 1XFAA 3MMXA 4RF5A 4GYJA 3USCS 3D8RA 4ITRC 1Z4QA 2I2DA 3WGYA 2HJRA 5IT5A 4O5AA 3WLIA 2ES4A 3COVA 4RZXA 3ZW8A 2IP2A 5ARDA 1W5EA 4F2HA 1QRUA 1KARA 4NXNB 4JGGA 2WYIA 4F2DA 2GN1A 4L22A 1YD7A 2FHSA 1OB5A 4ZOAA 2QG9A 2RAUA 1QYVA 4Q18A 1SUWA 3SR4A 5BMOA 1KJZA 3H7IA 2PIAA 1E1CB 3W77A 3GELA 4LVNA 1G6Q1 1MDFA 1DC5A 2NN3C 4J4BA 1JXQA 2YXLA 4RUKA 3WRYA 1X7WB 4WT7A 1EG2A 2IW3A 1TAHA 2FWNA 3GRPA 1JV2B 1EK1A 1FYXA 1T5HX 2H92A 4X1KB 3JS5A 2H4XA 2C5BA 2GZMA 3NB0A 4CEHB 4QRIA 4BNWA 1SEVA 1IBCA 5I7HA 4Y2QA 1UK9A 5FWNA 3KOMA 4NBUA 4B8ZA 4RAOA 2XD4A 3VPFA 2VDVE 1XV5A 4PS0A 1J21A 2IE0A 3KXPA 4R6XA 4BQPA 9LDBA 1HV8A 3AFHA 3M89A 4JSRA 4KQ1A 2J6BA 5AUOB 1OTHA 2VRCA 2PX5A 1R4ZA 1U2TA 3EXIA 3FYTA 4ZQFA 1IB0A 4GPBA 4MVJF 5JSKA 1HKHA 3TPCA 2CV0A 1KHTA 2M98A 3OCYA 4O3MA 2J31A 1HY3A 1QHIA 1WCV1 1OC2A 1KO7A 1OJ7A 2XWQA 4LYYA 1DELA 4NBSA 3TW8B 4KXMA 1LJUA 3C4QA 4CVNA 1E0SA 1SKUA 2BFWA 2GBLA 3RVBA 1NTRA 3OX2A 4IP0A 4TXJA 3UXHA 2VYFA 3BMNA 3H5NA 4B3SB 4AZVA 2PBZA 2F9FA 3BZBA 1GQSA 2H85A 3I9NA 5DRYA 3TMYA 4AN4A 2XF8A 1GPUA 4M7RA 1RABA 3ANXA 4ZODA 3FHTA 4FYVA 4M0UA 4S35A 3RSFA 3RYCB 1RZRA 1QF9A 4XEHA 4ALMA 4QFMA 4I46A 5K8JB 2GMWA 2XGOA 4YTEA 3GUUA 1CUJA 3GIWA 3H17A 1VJTA 4YXFA 1DAKA 4Z53A 3G1UA 4E2FA 3TOVA 2BGMA 1Y3DE 3ZU3A 1A9ZA 5AM0A 3ADDA 1Y8QA 3JVDA 4F5ZA 4LRQA 4BE7B 2W90A 4I8DA 4JT4A 4CM9D 4OQFA 3N0RA 1BTOA 4G97A 2J4DA 3K5IA 5F3DA 3OH8A 3FUUA 4XX1A 4Z4HA 4MCHA 3V4PB 2IH5A 2HXGA 3BGDA 4LI0A 2XCQA 1LVGA 2Y0PA 1N2IA 3A11A 1DJMA 2D7CA 4CCSA 1OGYA 2B4YA 3K0KA 4ZZ2A 2I8CA 5KVCA 4MV7A 2LDBA 1MV8A 2AZDA 4MJXA 3UGQA 2C8LA 5KU7A 4YX9A 3GCGA 2AQKA 1E6LA 1VHWA 2Y05A 4AJNA 4JOBA 4KDFA 4ZA2A 2PGXA 5IAAA 2EIHA 3EIWA 4FKBA 1L2TA 4FEGA 3JWJA 4LMPA 4PF1A 3L7MA 3RC2A 2BRUC 4PY2A 3W5DA 2Z1DA 2V4UA 5ALSA 2IIVA 3ZWWA 5HFNA 4Q34A 4G25A 2BKEA 3IAUA 3W5JA 3EDRA 3E5RA 1OXMA 2NVUA 1GPH1 3I73A 3I53A 3WO0A 4HWKA 2I78A 4M0DA 4GKJB 2QAIA 4K9QA 3RLIA 2XT6A 5T64A 1ZIYA 4HFMA 4K0KB 2ET6A 3GFQA 5EFZA 2II6A 4JL8A 3DE0X 5EQFA 3EUFA 2DQKA 2J9XB 4DL9A 3S2EA 3QOYA 2Z2YA 4ESEA 2XGMA 4AD8A 5AHWA 5HCUA 1IUPA 1NJ6A 2WHQA 3EWIA 4UNQA 3HFGA 3TOXA 5A4KA 2KMLA 5HS4A 2FR0A 4G6ZA 4DDVA 1USWA 1CP3A 2GPAA 2XEDA 3A1UA 3FMIA 5K0EA 2B6HA 3BHJA 1U9ZA 4FS8A 2X42A 4OKNA 4QTTB 1E1CA 4B75A 2K4MA 3H2BA 3R9KA 4WFQA 2V7UA 1E7YA 4WGGA 3NJ8A 2JHFA 1G59A 1NFRA 1FJHA 2UZIR 4IDOA 2ANBA 2I71A 4INPA 4TTSA 3TOSA 4L2IA 2Z2JA 1RYBA 1WV1A 3OE5A 2VF7A 2ZUBA 4FMCF 1OE0A 5G0SA 1YBAA 5DGXA 2E49A 1K8YB 3O4HA 3VR5H 3V1NA 5HJ5A 2IZ7A 4JWTA 1C7FA 4XJXA 3RT7A 2QYSA 4QO8A 3U7FB 1XTRA 4KMOA 3KU1A 5G0UA 1M75A 5E6SA 5AW2A 3T94A 4D0NA 3GPLA 2OM6A 2NZXA 4X84A 5T67A 4K40A 4UM8B 3EVAA 1R27A 4KREA 3HXOA 1KI7A 3NIWA 2E6KA 3TRKA 5KTTA 1A8SA 3IODA 1HLGA 2W6QA 2A9RA 2ERYA 1DKUA 2CNLA 3ET4A 4O2AB 1E3JA 1RWVA 4R8VA 4X5OA 5AK0A 2Q1UA 3L7KA 1LDEA 2GBGA 1E3WA 1QTNA 1WXXA 5FI0B 1SNYA 2AIRA 5FBWB 3R9IA 3TTYA 2HPVA 4GSKA 1P4GA 1V7QA 2A7QA 3HI4A 3PUJA 5JUWA 1EFVA 4LQDA 3MWYW 4EGFA 5H4GA 4GM4A 1ZXBA 3QPUA 4RS3A 2EF1A 3KYDA 4AJ4A 3LT1A 4AY2A 3S3TA 2ODQA 2FB9A 1HH4A 3KVNA 1JNYA 3OFNA 3PXXA 4MQEA 4TT3A 3DFZA 3EXHC 4K1XA 1JQDA 2Z95A 5AJHA 2PSJA 1E18A 4KWEA 4A0QA 1QFXA 1U2DC 2H9IA 5F2NA 3L77A 3R3UA 1H05A 4ZVPA 3P9ZA 4LJLA 1C9NA 1CDOA 2KS6A 4HWOA 5GIPE 3DBOB 2VUSA 3I5AA 5DP2A 4BN0A 3SS7X 3NYIA 4ER0A 2G25A 3KZ1E 4TXLA 3ZQJA 2O8DB 5KVQA 4EDFA 4JBNA 3DF9A 3MWEB 4D26A 1ZR4A 3HKBB 3KQWA 2ZAOA 4KIFA 4MAMA 4XSHA 4YROA 1IN4A 1BGVA 4GL4A 5IJ0B 1GKUB 1RYMA 3Q0EA 4PM4A 2EG5A 4A6EA 2OL4A 2MYTA 3TPFA 5BYBA 4U6NA 1MRSA 2NSDA 5CFPA 3WLEA 4M1TA 3VTZA 3GLIA 1CR2A 3PXDA 4A0RA 2R8EA 3BTSA 4QYTA 3KUXA 3ZY5A 3GFOA 3H2GA 1L8OA 3C5WP 3OZSA 1ZMXA 3RKRA 3E9MA 4ZVUA 3PEEA 2JAXA 5C8YA 4E5NA 2QLLA 4MW7A 1R9NA 2HBRA 3LE8A 3M33A 2FW0A 3VTKA 1MPXA 1DCFA 1LLCA 2XNJA 3PI7A 3ANSA 1NUHA 3CNNA 3QUQA 2EFGA 4PHFA 1AN9A 4BNKA 3WA7A 1NT2A 4JEUA 1W44A 1PSWA 5DGCA 2ZBVA 1BVYF 5CVJA 3CG4A 4FEYA 3RVNA 4E2WA 1ZM9A 2HHHB 2Z08A 4MI1A 1SBTA 4HNQA 5C34B 1DPGA 3SBDA 3TQOA 5LQUA 1IBLB 3ADOA 2FDCA 5I9IA 1EESA 4DA7A 1EX1A 1GAQA 2P4QA 1JQLB 3JQFC 3RQSA 1NM5A 1J00A 1LSUA 4GYWA 4N6GA 1T1JA 4L4XA 1EX6A 5KJ6A 4E94A 3OPYB 4TTTS 2Z9CA 4EQ6B 3DEYX 4RQAA 4YCCA 5I9NA 4HOYA 5LC1A 4JLMA 2C84A 4DIEA 2GEJA 3DEJA 3OLCX 3ISJA 3HL4A 1CLUA 1CX9B 1Z62A 3REFA 4OFZA 2E2WA 3GJ6A 1LK0A 2XVZA 3I01M 5AKHA 5SY4A 4E03A 5D3MA 5DTRA 1IZ7A 5CA1B 1XDUA 2JRLA 4NXMB 5HRCA 2FU5C 3HYSA 4ROSA 221PA 2YVLA 5FO1A 3N9IA 1L6IA 2V7QD 2OP1A 4DSAA 1ZHOA 3THRA 2FKNA 1OXSC 2FZVA 2D6FA 5LFAA 2VDRB 3PG5A 1V71A 4YJGA 3V42A 5KNCH 5CLQA 2GEVA 3D0OA 4Y2XA 3OM0A 5ADHA 6ADHA 4Z7QB 1P3DA 3NBMA 2X15A 4II2A 2IZOA 1Y5MA 1TFUA 2C4VA 5DT9A 1KS2A 4K6OA 1RLOA 2WILA 1MOSA 1JN0A 1TA0A 3DGEC 4R2HA 3UEOA 2G0TA 1E6WA 3OLZA 2DG2A 3TLZA 1T0IA 4ACAA 1A2BA 1C9KA 1N0HA 5BWCA 1J2UA 3W2TA 5C7YA 1YQGA 5ERYA 1UR5A 3EWSA 3TZHA 1J2TA 1I1OA 1UH5A 1ZC3A 4OJQA 2Z5LA 3V6MA 1HGXA 2O2IA 1BA2A 2QLFA 2VKTA 5KO2A 2QBYA 1XA0A 1Q44A 4RPCA 3DO8A 2D2XA 4Q7LA 1E3DA 4ZVLA 2AFIE 3ENVA 3KTOA 3RSZA 3ZTWA 4YT8A 1KE2A 1Z6TA 2R7KA 2PRKA 2ZM6B 3HCWA 1XELA 3RD5A 3OFSA 1Z12A 2QU8A 4RJLA 4R8LA 4V0NA 4UUNA 2C42A 4DIFA 3I72A 4PIMA 1JAHA 5CDUA 4DLRA 5GAJA 4C4OA 3T7JA 5ILQA 4R8MA 1YR7A 1JI3A 1CV2A 1N2HA 1NASA 2X5OA 5KYVA 3U3XA 1S2OA 1GIAA 4DV7B 1QDLB 3UW3A 4PAGA 4PLHA 2VDKB 5ALHA 2R1TB 1ILEA 3BE8A 4DM4A 5LP6B 4PO1A 3K2IA 4AYXA 3RO7A 4MOWA 3BGVA 3SLGA 1NY6A 1T3TA 4AO6A 4DV3B 2JCYA 4G56A 5U9CA 1MZPA 4HNHA 1A5ZA 1EBUA 3GRRA 3OT5A 5FFNA 4ZFNA 5IJ9A 3IMFA 5AOCA 4HFRA 5A4IS 2A0WA 2YL2A 4OXQA 4B8YA 5JY1A 5DFAA 4ENRA 3OO1A 2YXPX 3GP3A 1EK0A 2ZUTA 1ZCAA 1KKUA 2BPOA 1P9WA 3UAXA 3Q1KA 4NP6A 4BO5A 4ZI2A 5LKRA 1BMTA 5LNK1 1V2GA 3EVDA 3T7IA 5KTYA 3R3VA 1T9DA 1JIXA 4UU7A 5K8TA 1O97C 3EMVA 1FQJA 1O95C 2JLYA 2J1LA 5EESA 1MEOA 5FJJA 4BEWA 2AJCA 2ZM5A 1LY1A 4LDRA 3W3AH 3PHHA 3B6ZA 2D8AA 5E1OA 1M5UA 5L4NA 2BKVA 4G8JA 2JIMA 2YH2A 4ARZB 5I01A 2BKXA 5HNKA 1U9IA 1ZOIA 5LIRA 1HG1A 2IOFK 3BGOS 1J2RA 1WXGA 1YACA 3FTDA 3NHAA 4NU5A 4II7A 1JAYA 4RDCA 3ZPXA 1SCNE 2V03A 1BZYA 2C9BA 2WNIA 4TL6A 1VLMA 4Y9UA 5E6SB 2EWVA 1Q0QA 1ZHFA 5AR1A 1DS6A 1ZSNA 3T4UA 3LGSA 4KR6A 1WJGA 1YB4A 1IZYA 2AMFA 3IQDB 2OGZA 4LVOA 2HMUA 3BMXA 4JYBA 1TRHA 3ELYA 4LJRA 4L8FA 3HY4A 3BJZA 1OI3A 4E5YA 3U7RA 5LQKA 1FJXA 3QVJA 1PR5A 3DZJA 1FLAA 3GEMA 1RTTA 1PR2A 1E9AA 2C3MA 2NGRA 2Y9MB 4HQ6A 3V00A 4NONA 3MINB 2Q4BA 3QE9Y 2V3WA 1P5JA 3PUHA 1KU6A 3AP1A 1IQRA 4C1NA 3BA1A 3KBBA 3ESXA 1P4JA 2ATVA 4UUBA 3TI9A 3WSWA 4CKWA 4YK7A 2UV8A 3JSXA 1C3VA 2AFRA 1CS0B 4ZAXA 3HB0A 3CZCA 1GADO 2RAVA 4NJOA 4FDVA 5F5NA 4N41A 1QF6A 1U1IA 4DLNA 4BP8A 1XLUA 3U31A 1IJEA 1G3RA 5IDVA 5IANA 1NMZA 5LQCA 1P17A 2OFWA 4M1OA 5JXJA 4ZYZA 4PICA 1K5PA 2BELA 1M6VA 3AC0A 1XZHA 1AKMA 1S2DA 1S8OA 4FC6A 4GU5A 2QRVA 2IXEA 4YRNA 2ZE6A 3UMCA 3KNZA 2HIMA 3ECSA 3F8TA 5BWNA 2XQJA 2OBBA 4M9RA 3L02A 2WDZA 3O1IC 1RZVA 4PLZA 4C0KA 3VHLB 5A71A 3THWB 2IYYA 2W2NA 1MNAA 4X6YA 1PU2A 3NATA 1F9EA 3AUUA 5LLSA 2GCOB 3AG6A 2Q5HA 2O0JA 3FUTA 4EA7A 3O95A 4Z4CA 1Q12A 1SRRA 4NNJA 3QFHA 2R6R1 1A4IA 3R75A 4EQZA 5HUQA 3MFQA 2CWDA 5CFRA 3D3NA 4EG4A 2DXIA 1C81A 3I5MA 3FOEC 1M6VB 3QMPA 4XSVA 1SUAA 3DHEA 2YYSA 3ZD8A 1EWKA 4R7ZA 4BUCA 3WDSA 2PQ6A 4LJ5A 2D4HA 3T35A 1FFHA 2JZOA 3LRXA 3C1TA 4GWLA 4RKEA 1AUPA 3E4DA 3PQDA 1HDRA 3QOWA 3NUZA 5DXFA 4BKMA 1JFTA 1MABB 1SM4A 5KOJB 4RD4A 3MUNA 1UMBB 2C0CA 3I3SR 4OIMA 2P7HA 4H3SA 2HMVA 1T1RA 2X5NA 3LX5A 4QUKA 2WIAA 4BJ5A 2HXYA 4P6VF 4X93A 1Y8QB 1KYQA 2JIZD 4LUCA 4A8TA 5EIBD 2A9OA 4GP9A 1VI5A 16PKA 5EHXA 3N8IA 5G02A 3UAVA 3EEBA 1GGFA 3KTAB 3FLBA 1Y4AE 2X4GA 1GVHA 1I24A 3ILHA 4KQ2A 5CRIA 3NAGA 4J1TA 2HA2A 3KPYA 1XXLA 3OTIA 4G81A 2NZUG 3T12A 4C7JA 2JJ1A 4MVJP 4RZ3A 3SR0A 4GNRA 2XVAA 1TPYA 3DD1A 1L4UA 1O95A 3F7TA 3T1NA 2R44A 3OC6A 2BF4A 1A2QA 2VAMA 1YA4A 2CB9A 3FNQA 2I3DA 4FMCB 4H1UA 1OVGA 5H5JA 1PK8A 2R4UA 3GFPA 4BQFA 5G1PA 2E48A 2CT8A 4JIGA 2ZZNA 3DE7X 4L75A 4PZUA 1FP1D 3ZV7A 5IVHA 1D0SA 4OQPA 2C4UA 1R12A 2IVFA 2YZ7A 3RRYA 1GRCA 4MV9A 2ICAA 1Y3IA 4H18A 3G79A 4POOA 1EVYA 1CNMA 2D0IA 3G1WA 3HJAA 2HMTA 1DKQA 2WI8A 4FDMA 1IEQA 1TEXA 5C35A 3JQBA 5K0FA 4BASA 4GR4A 4WSOA 3U3RA 1SBNE 5KQRA 3EG9B 3O2SB 4OY3A 3TD9A 4E08A 5GZ3A 3NBYC 1ZOPA 1P7ZA 2OCKA 4JVSB 2XVMA 1PR3A 5CAEB 1PHPA 2MHCA 1G38A 1E0JA 3QX7A 4POAA 2EX4A 3U2QA 2AKYA 4QOHA 1QHYA 2H31A 3C74A 4QDKA 1PX0A 1E2QA 2ZRAA 4X8LA 4LF6B 2IUEA 2EF0A 2XBLA 1V8ZA 3IVAA 1L4BA 1NE2A 2ZAMA 3WWCA 7ADHA 1V3QE 4WWHA 1FYEA 2PX2A 2QM0A 2PRIA 1I36A 2M6LA 3K6KA 4MJ7A 2JI9A 3LAWA 5CCEA 3URKA 1F4PA 3F5QA 2EP5A 3KOOA 4J2TA 3KT3A 2Z58A 4RX1A 2JCVA 5JMTA 1VYVA 2GI4A 2PFSA 3E3LA 4CW7A 2NO0A 1TJPB 1G0OA 1UM9A 1Y5LA 5B1IA 2ATCA 1SZCA 3LCUA 1WMEA 4X92A 3VPAA 3ZXYA 2GM4A 2UZ3A 4AX8A 4Z51A 4KZPA 4LDJA 5I47A 3E5MA 3QPBA 2JFYA 3P0RA 3RCBA 1P4HA 3KQVA 3V7FA 5EZYB 4LXGA 3KAJA 1VL8A 2OO7A 4RTMA 1NSTA 5H16A 1H94A 1EMDA 1NKTA 1UBGA 1KSGA 3STXA 4B81A 1VLQA 4EMTA 4ND6A 3U56A 2I66A 3A4YA 4G4IA 4IJQA 4U7JA 4F04A 2LP4Y 3PC3A 4RKQA 3CTMA 1SVUA 5H4HA 2AXNA 1A98A 2QTNA 3PHGA 2FFQA 4KN5A 5KJEA 2FMIA 1JI0A 4G0PA 2JLQA 1Y8RB 2CVOA 3K9GA 4JODA 2WQZA 2AI3A 3FWPA 4ZAWA 3UYLA 1LI7A 4HUQB 2FSHA 1K2WA 2XB8A 3HFSA 3OAAA 1CERA 4V0LA 5FUBA 4DUYB 2RHMA 4BNTA 1B14A 2EYQA 1MAVA 3VYTB 1F0KA 3SMQA 2NU6B 1C0LA 1YJ5A 5HJEA 3MBOA 3E3MA 3SKYA 1Z6QA 3V2GA 3WRXA 1I7NA 5ALYA 1UEXC 3C48A 1PSDA 1R3UA 4J0IA 2I62A 4QFCA 4I81A 5BSUA 2A0YA 3DZFA 1X74A 3TE7A 2ID8A 3BWDD 5ALFA 1SRQA 5LUBA 3U13A 5EIAA 2YN0A 2OV3A 1IHXA 3D2CA 3VH3A 1POXA 2QE6A 1WXQA 1K8RA 1B15A 2ST1A 2WU8A 2A9FA 3RTEA 3WLSA 3KALA 1ORWA 5CUQA 1GR0A 2YY5A 5CGQB 1QUEA 2DBRA 4PLGA 3MRXA 3HUDA 2JHCA 2YICA 4NE9A 1ZD1A 2IYSA 2JK0A 1CRPA 1ND5A 4Z4EA 1LPAB 3LWDA 1IONA 5FR2A 3DTVA 2OILA 2RAFA 3A36A 4KX3A 4B85A 2AMLA 4R6WA 4WADA 1E6KA 1M8PA 4C2UA 2GF9A 3WY9A 5HF9A 4S1PA 4F6LA 3PQ4A 3ZH9B 5HTKA 1QGAA 1FNBA 1YZKA 4EMBA 2MYNA 3WWOA 2OMKA 1N9GB 2RGCA 1P8JA 1K6IA 1W9MA 2TMKA 4GUDA 1N3YA 3HA2A 3SNKA 2VDOB 1LDGA 2IBMA 3BIWA 1E2KA 1ZL0A 2GAJA 1X7YB 4JC0A 1DTSA 4UQOA 2PLWA 2JGKA 2JGLA 4MDEA 2QQFA 5DPMA 4F11A 5IBQA 2QVCA 4CMEA 1EFPB 2ZWOA 1K66A 1MXHA 3T4XA 2AQIA 1PD0A 2FPXA 2QQEA 3DF7A 4OTZA 3RT9A 5EUCA 4YCDA 5AW6A 5F51A 1FTGA 3AJRA 3K9HA 2QL6A 5HEKA 5L3RA 2NVBA 4UZEA 2HBYA 2IYLD 3BB3A 2Q9UA 3P4XA 3JPWA 3U7EB 3RU7A 3BHNA 4I0WB 1PFQA 1TJ5A 1JZQA 2HWKA 3I0MA 3JQCA 2O07A 1Q19A 1FUKA 3E22B 1UDBA 4MS3A 4B3IA 4JBIA 1HL7A 1UZMA 1SIOA 3M6MD 3PIIA 2FKAA 5MDHA 3ZWYA 3S0JA 2OQIA 1UJ6A 1NDHA 4KLAA 4WDRA 2AFVA 3SQOA 5LLDA 2C7GA 2HXSA 2CNOA 3C41J 4Y2PA 3ZDRA 4AWXA 1O03A 4Z7NB 2H0AA 5EXXA 2EZTA 4W9NA 3FH0A 3RS4A 3NBAA 1QQ5A 1XPOA 3FCSB 4Z49A 4HATA 1F8XA 2FTKE 4G67A 4PG7A 3E18A 4LRWA 3CLRD 2HMYB 1QP8A 2PKRA 5EP1A 1BXRA 2ORYA 1KVRA 4P9NA 1LK5A 2N0SA 4MYUA 2NLOA 5KDOA 5CITA 2ZZMA 4NC9A 4NZZA 1P1JA 3OKAA 4RLFA 4S3MA 1XJ0A 1V6SA 3HO8A 4JHLA 5H7XA 2P5TB 1TKBA 5IDYA 4BLRA 3C98A 4P35A 2VI5A 2BHTA 2R1VA 3VO9A 1ZRHA 3IHLA 4C2AA 1ZZEA 2BFFB 2MYPA 3BXGA 3H9EO 3BIJA 1O58A 3FBGA 4PLFA 1RWNA 1GJRA 2TECE 1XQVA 3IV6A 2RE8A 1Q1ZA 3G0OA 3UK0A 1KJIA 1Z4KA 2IQ5A 4PG4A 1NV8A 2G1JA 3K8ZA 3UT5B 4A3SA 3ZGYA 5IH7A 2BGJA 5F9HA 3ORRA 2ZR7A 4MA0A 1NP6A 1RU3A 4NJEB 2O8FA 2JHPA 3K7EA 4HLUC 2MSDB 3HLTA 2A5FA 3EZ2A 5I8ZA 3U3ZA 2EGHA 4MI3A 3FSRA 3D0RA 2H0RA 1DC8A 3F67A 4TT8A 3WWZA 1QHSA 5IJWA 4EJSC 2AE2A 1LSSA 1Q14A 1KDVA 2WIBA 4RELA 4LRXA 5LP6A 7MDHA 3G8YA 3HA3A 5TDHA 4CGZA 1ISRA 4Z9FA 4M8LA 5K3FA 2Z43A 2D00A 3R8XA 1OA0A 3KHSA 5A1TA 5BY2A 3B7PA 3GT7A 3M1LA 2VSFA 2G67A 4WQMA 4ZC1A 1F2UB 4Y9DA 3GVPA 2BE9A 2FF7A 3WGZA 3PP8A 1P72A 4MPJA 5TPWB 1RAIA 1YNSA 2CFIA 2LR0A 2W93A 3NHPA 3RWMB 4BO2A 4BQSA 4QVIA 1S1MA 2EKPA 2YJ4A 1PJLA 4OHFA 4B7XA 3FFXA 1C1DB 4A4DA 2GBIA 4UBMA 3SC3A 4ERNA 1KZ7B 5AW9A 2G7ZA 5JD3A 1V16B 2ZT8A 4Q03A 2WQ7A 2MOKA 2G80A 3RF6A 1NC1A 2P8JA 2VZ0A 1WP9A 1LD3A 2B1QA 3EVEA 3PPIA 1XAHA 1Z83A 1RQLA 2DSTA 2NUPB 2QXYA 3G49A 4J0KA 2O6HA 1UAAA 1USIA 2AWNA 2XUJA 3JYPA 4HQKA 3V8MA 4BNFA 2ZJ0A 3P9PA 1WB6A 3HKDA 1G5TA 2VPTA 2VHEA 3HRHA 3VR6A 4CG1A 5BN5B 3AW8A 2ZATA 1ULHA 3Q8LA 1XCBA 1NDQA 2AOVA 2O2EA 3BJMA 4KNVA 3UWKA 3A2MA 3UJ9A 2QSJA 1KJNA 2H2FA 2Z5FA 2WAOA 1N7HA 1UINA 4Q66C 4YCJA 1XMVA 4B9AA 3WAJA 1KC1A 2HTFA 3VZSA 4D6XA 4UHEA 5C8DA 1GWNA 3LQFA 1XMIA 1CIPA 1XXHE 3S2IA 1U80A 2ONYA 2ZT5A 2QD2A 3K5WA 4YCNA 4FIZA 2W43A 3QYJA 1MG5A 3BWMA 3QVGA 1PYOA 4CIAA 3C16C 4KQ6A 4RANA 1F5NA 1ESDA 1WEHA 2QD4A 2GFIA 3K1AB 5GQSA 2D7DA 3KLPX 3OSUA 3PHBE 3SZ3A 1G8JA 3NUQA 1K4MA 1QTQA 2QGNA 4L0CA 5I8WA 5I7EA 3H4TA 1CSEE 2CNWA 2M9MA 3IPCA 1XMXA 1U7WA 1ORTA 3JWIA 2A4MA 1Z8HA 2JRCA 5C1DA 5FOVA 1IHYA 4F3CA 4OMDA 4BVLA 2RHRA 3F6PA 4X8MA 4FKZA 5SYAA 4Q7EA 4EFKA 4EQ6A 4LZLA 2VP5A 3CE6A 4JBYA 5IYZB 3ED1A 2YV5A 3GH3A 5K1ZA 2CSXA 1NW4A 4J0CA 4V0QA 2E18A 4KFUA 1G21B 2JEZA 1LCIA 4WZBA 4Y6QA 3L3BA 2GCOA 5BORA 5KX5A 2DQ4A 3SOZA 1PL0A 2DX7A 3T3IA 3AXSA 1XP5A 1FTNA 1ML3A 2IHYA 2OGUA 2PCJA 3LG2A 1H2YA 1J97A 2GTPA 4RM2A 1KBQA 4GYYA 5HPYB 1ZOOA 2RHGB 3RHZA 1Z16A 4H2DA 1J49A 5SYMA 1P7PA 3NNDA 4GC9A 3R8CA 1U9JA 2NAPA 1YU6A 2PT6A 4HDKB 4B46A 1YC2A 3EE6A 3KL4A 3QEKA 3N2ZB 3S27A 1VI6A 2C2MA 1TJNA 3OKPA 4AS1A 5BSFA 4ISCA 2C58A 3P71T 1GUAA 3ANYB 3TUZC 4JOCA 4LWZA 4YRJA 3OUTA 4AXBA 2WG2A 4N7BA 1H2WA 4CM9A 3PCTA 1FNNA 1J0AA 2WUVA 2J0VA 2H16A 4HWRA 5BQ5A 4ZO7A 5CYOA 2O52A 1W5AA 3QTBA 4DLSA 4DMFA 3VVBA 4E3WA 5KYNA 3D3WA 1KY5A 2G9QA 2R8PA 2JLCA 1DDIA 3DBLB 3QMVA 4CE6A 1PV2A 1KY3A 3MWEA 3IB3A 3UG7A 3MINA 3OE4A 1ULBA 2FSGA 4I1YA 2ZUWA 2P1RA 5E8RA 2CNKA 5DIFA 3ZHVA 3T5TA 3K05A 2QGZA 3W5CA 1J5XA 2VSNA 1UMDB 1FRFS 3WXMA 4QVGA 1GGVA 5BN3B 5FTNA 4V1CB 1NP3A 1FMJA 3BE5A 4NCIA 1T0PA 1G9XA 2O8FB 1DSSG 2GAOA 2ZQ5A 3CH6A 4BFCA 5HUJA 2IKQA 1WU8A 3DO5A 1QK4A 3DVRX 1EWVA 2VNSA 4UM5A 3LCVB 2Q6TA 2X0RA 3UT5A 4QQFA 5CNKA 4LYAA 4RH0A 2GBLC 2IHVA 2O54A 3U3MA 3WX0A 3SJUA 1QZTA 5AVTA 3IBYA 4NCBA 1CE8A 2I1WA 3EC7A 3O8CA 5EJ5A 1CWUA 2XOEA 4EPYA 5FT9A 4NBWA 3W2HA 1WBBA 5J4YA 4S2EA 5GVRA 1YSCA 1DBWA 1KQOA 1MC1A 1RXEA 3HR8A 4WUVA 2CFCA 4IAOA 2EW1A 1NX9A 3A4IA 4IR7A 3FMFA 3PQ8A 4YYEA 3AF1A 1WHTA 1OKKD 1GGEA 1FSGA 2F48A 2GRUA 2X4LA 2DECA 4GICA 5J23A 4HTAA 4WOJA 1R6DA 1PJTA 3PPWA 1ICEA 4RW0A 4HB4A 4AJHA 3FJYA 3MJEA 3RRMA 4D9GA 3P9SA 4IXDA 4KOEC 1AZLA 1KF0A 2XUIA 1JQBA 2UVQA 1TM5E 2F3SA 3DA8A 2HA6A 1AKUA 4ZAGA 5JSHA 1W0CA 1JR4A 1OAKA 2G07A 2HF9A 2W00A 1KK0A 3PCRB 3V4ZA 3ZZ0A 1U3DA 3FNBA 5LIPA 4JJ8A 1P3Y1 2AE1A 3L7NA 2PRYA 4C4PA 5IZ4A 3ZWMA 4JJKA 4X63A 1VSQA 3G9QA 4JJEA 3TSZA 4FE3A 5JNTA 2C2KA 3B6IA 3VKUA 1ZOLA 2PJRA 3DMRA 2GN9A 3AY3A 1H3NA 1M2OB 1FW8A 1ZJ5A 2OG1A 2LV8A 3IOBA 1EVLA 3GFVA 4OI4A 3AHHA 4LXIA 3ROZA 1CK4A 4BZWA 5IVKA 4QGSA 1WTAA 1BGWA 1T36B 4WVFA 3JXEA 5JWOA 4G5QA 4BFUA 1DBVO 3OZXA 3EVFA 3ZS9A 2VK4A 3VKFA 4LJ9A 5CVCA 4ZHQF 1NUPA 4OMFG 5FLXA 4FJ1A 4HDKA 3W6PA 1E2FA 3CCCA 1ESCA 5JVDB 3UFXB 1KDYA 3HP1A 3UHOA 2FP4A 3TK1A 3LA6A 3V33A 3ABOB 3NDJA 4HLUA 2V7WA 3QU9A 5CX4A 1EYZA 2OBLA 2BE7A 3NTQA 1AU9A 4GZ6A 3V1KA 1XPUA 4OJKA 1ADCA 2JJQA 4D97A 2VAXA 4JQOA 4NZPA 2CHFA 3WBFA 1XRNA 1YK0A 4MR8A 2AN4A 4UAUA 1I0IA 3NOXA 1MU0A 4QBFA 4MWSA 2CCJA 4PPQA 3IPLA 2IHZA 1U3WA 3ENKA 2C1ZA 2IY9A 5LYJB 1BE8A 2GCGA 3FKSD 4Q93A 3TR6A 5A3VA 4WKOA 4OLAA 1EHIA 3O2JA 4IIJB 4ILKA 2H4WA 5AXAA 4LFAB 4ND2A 1PKXA 2WJAA 3L1UA 5AI4A 3GJ5A 4XGQA 5DXJA 3VDNB 1USVA 1Z4LA 1FU4A 2AK3A 4DEXA 2JLZA 1Y7TA 5I45A 3WL6A 1SY7A 4PCUA 1L9KA 4GF5A 1XQYA 3UK1A 5DGHA 1CIVA 2GLXA 3JYHA 4L27A 2KW5A 3KXIA 2DBZA 1XHFA 4LQCA 3UOGA 1N78A 3AVPA 3E5HA 4IQ4A 1S8AA 3L79A 3V2HA 4F3RA 2P0AA 4YT4A 3MS2A 1GZ3A 3BEDA 4XPIA 4Y2UA 4HNAA 2XTZA 1FIUA 4X1IB 3F6SA 4LC0A 4HDSB 2NU8A 4D9JA 1EWTA 3N75A 1I2BA 4EA8A 4F60A 2JJ2A 1N9ZA 1NU8A 5DM0A 1UDRA 2ZIEA 3F7NA 2O0LA 4R31A 4BZQA 4GS5A 3H84A 4N3CA 1SVLA 2GZ1A 2VRBA 4P36A 4BV3A 2CFSA 4NCJA 1EFTA 1NW7A 1QQAA 1PDVA 3L46A 3W2GA 5IH3A 2R6DA 2GZ2A 3E15A 1O0BA 2R8XA 3ZWNA 2VP0A 3KB2A 1EP9A 4X00A 1UCFA 1GNRA 4WIAA 1P2FA 2NXEA 4C6TB 3LBIA 3HK2A 4BU0A 5KYKA 1HURA 3RAFC 4ACBA 3BSYA 2GK7A 4ZK2A 3KZNA 4PLTA 1LPSA 3WP1B 3HCCA 5ESRA 4I3GA 1CP2A 3ICWA 1ZXXA 2Q62A 2IU4A 4DDKA 1W2GA 3T41A 2VDMB 3AVQA 1MIOA 4PS1A 4DCOA 4Y18A 4ZEXA 4M1QA 2X0FA 3VR5A 1ZJZA 2Q21A 4UM9B 3LZDA 4GMFA 4YMSA 4AFNA 2P9YA 1EA5A 2HJWA 1AQYA 4CCYA 4D4IA 1J09A 3CUWA 3GVIA 3ONNA 4QUHA 2JI7A 1GT91 2QF7A 2QGFA 3FDFA 3HC7A 3H0EA 4TSRA 1R0KA 3H4MA 3IULA 4JBXA 2P11A 2UZAA 2BMWA 4TQUS 1FDIA 1Y63A 5K3FB 5UKDA 3WA6A 2PV7A 1K97A 1PS8A 1SQ5A 3EQ7A 4NE2A 2CXQA 4IZOA 4KIJA 4QYWA 5F12A 2V7BA 4GVLA 1GVNB 5ECWA 4AIRA 4NYIQ 4RLHA 3VR5D 3K35A 3K1ZA 1U6JA 2JNWA 3MW8A 3CBQA 3N86A 4OBBA 4G24A 3RROA 4XVCA 4XM1A 1A4XA 1KZHA 4D0LB 3VYVA 1F0NA 3FF1A 2C8JA 3D6TB 5EXTA 4I9FA 1AM4D 1W4CA 1II8A 1B8NA 2ZIGA 4FCVA 2RBGA 3H1AA 4FKMA 3QBDA 4KZKA 4PO8A 2QRNA 4WASA 4KXLA 3WQQA 4EOGA 4UMVA 4F93B 3AT1A 1NM5C 4N0PA 1E20A 3J80A 4JQCA 1PW5A 3AINA 4IQGA 3L0ZA 1ESNA 3SYTA 5F4BA 3W79A 5AVUA 3Q6MA 1M74A 3A1DA 5CM9C 3HXMA 2FX2A 1DT3A 2EKZA 2QW8A 1FUEA 2OBYA 1JILA 2E4UA 1VB3A 1OLOA 1VZ3A 1IJBA 5A9RA 1NW8A 4UAVA 2EL9A 2F55A 5CVUA 2C94A 4QU9A 4TV9A 5AJXA 4CL3A 2FSIA 3QXCA 2PVPA 1Y9JA 1Y4ZA 3C85A 3CSDA 1FFEA 1OY1A 3DTTA 3RRBA 3I9LA 3WLJA 5I4KA 1AE1A 1I6MA 2I3BA 1VDMA 3MXTA 1BO6A 3O8DA 4QXRA 4DG8A 4DUGD 3I5YA 1XTSA 2ZIFA 3AB8A 1M5TA 2NWQA 1IPHA 1Y7PA 4ZQGA 2Z6VA 4KVFA 3EODA 5EQJB 4P4GA 4Q4AB 3R77A 1PK9A 1XEXA 5J63A 1N0IA 4PLCA 1RQ7A 4L2IB 5DX1A 1TL7C 3AZQA 2WMDA 2H1VA 4HZUB 2J9RA 1DNPA 5BR1A 3AF0A 5H1YA 1CUWA 1BFKA 2AG5A 1VJDA 2NPIA 3FMOB 5JDIA 2H08A 1TMGE 2WM9B 3VHXB 1AUOA 1Y1TA 4L3VA 5CNMA 4EVQA 4C22A 4G0MA 3RIXA 1HSOA 3PE3A 1E9VA 1DV1A 1LBEA 4H7FA 2I80A 4IOKA 2BCJQ 1CKEA 4EPRA 5JAMA 3ZE7A 3L8CA 4EPVA 5THKA 3SEQA 3QE2A 3M6LA 3BHIA 3TRFA 4AAYA 4Z0HO 1Q2XA 1UXJA 2JBAA 4JLWA 3UC9A 5JROA 2IHBA 4RFSB 2BUCA 2AX4A 2R7AA 2ZSHA 4FZRA 3MT8A 2I5PO 1EGVB 1VMAA 2ZIAA 3KOZA 3Q9LA 4RADA 5EWLB 4ATNA 5DOZA 1PJ4A 1HMPA 4UU0A 5HBRA 5IXJA 1YZVA 2PBRA 3EEOA 4CPDA 2PN1A 2QT1A 2X2FA 3ISVA 5BOVA 4KOAA 1EIWA 1AS3A 3D54D 5EZQA 2YWBA 2CNBA 1NBME 3OJFA 4TS1A 2QTFA 2VSYA 1NF2A 4EATA 1W73A 3LD9A 4FNMA 2MSEB 7GPBA 1AMNA 3FGOA 1UPAA 3DZGA 1R37A 1U3FA 3IKJA 1A27A 2OCYC 1Z28A 3QK7A 4OXRA 3ZE9A 1EB8A 2A7XA 1KP3A 1MOPA 5LXTB 4MI6A 3GF4A 2GZAA 4EZBA 5JARA 3HNOA 3HLYA 3EOZA 3BOSA 4AG6A 3BDVA 4HVTA 2UUBB 1G18A 2I4LA 4GBED 1PUXA 2VNAA 4LOKA 2PTGA 2A30A 3F3KA 2ORVA 1AS0A 5L9AA 2CK3D 3NVDA 2YC4C 2WUFA 2E82A 4NHOA 4UASA 4BWVA 1F7UA 4W1QA 1H2EA 4RVFA 4DDWA 3H65A 3ROGA 3DCJA 5TVKA 2OBNA 5JC1A 3LUDA 2QXTA 4B3DA 1KYZA 3V7NA 1DFGA 1J8VA 1IBSA 2EDAA 3GZNA 2PCLA 5CA0A 4NYJR 4C4AA 2R97A 1K0UA 3OQVA 3DD5A 3LKZA 4OAQA 4WI1A 3M3DA 1WX1A 3DSRA 1SXJA 1JHXA 3HGMA 3ZGVA 2AVDA 3DHVA 3BFJA 1U04A 2X8LA 1ODFA 3S7ZA 4BY9E 3K1JA 4D9CA 1CF4A 2QTBA 1G8GA 4RULA 2C2ZA 4HSEA 3SQNA 5K0BA 2WB4A 2YDXA 3RV3A 4Z9XA 1QGUA 4E13A 4FNGA 5CXUA 1JJ7A 2XNSA 1JIIA 2SECE 2DQZA 3IQEA 1Q2UA 5REQB 4AP5A 2DETA 4G41A 4NKRA 2EFHB 4FEAA 3AL2A 1SEPA 2Q3LA 1XO1A 2D1SA 2Q3MA 1ZM3A 3IB6A 4UZFA 2X13A 3R40A 4DDUA 2L18A 1QS0B 1XVUA 1YBVA 4ZEMA 4M0MA 3A58B 1C9DB 3QQ5A 2FN7A 2W7TA 3TTWA 5C5EA 2WYVA 1L5OA 2WAYA 3SQXA 2F67A 4O1MA 3AESB 1X1DA 3QBEA 4FHGA 1NYRA 4KUGA 1UJBA 2FUEA 4P92A 4DLXA 3EPHA 1XJ5A 1P19A 1T3GA 2OE2A 4UJ5A 3ADPA 2RKBA 2QNBA 3B1YA 3B2QA 2ZIXA 4DR3B 1DMSA 2WT4A 1CEXA 4BL5A 1RSZA 1L5RA 1T36A 2P2YA 1B3RA 2DAPA 1AMUA 2IEGA 1L4MA 2HRZA 4WNIA 1R9MA 4YGYA 1KYIA 3O21A 2KYRA 1GSAA 1T0UA 3CR7A 1KMIY 3LHSA 3ZHCA 3P9KA 3ZX4A 4UTPA 3KAKA 2P9CA 3Q5DA 5CB4F 4TUYB 1AIPA 2ZEJA 2KI5A 1TD1A 4GOMD 4AJIA 1XUOA 3G23A 1QX3A 4FZVA 4H7IA 1TQ6A 3VZRA 3KJQA 1OZFA 2IYOA 3UENA 1KI4A 1EXDA 3N6RA 2NZWA 2RI1A 3NIFB 2ZYAA 3CRW1 2XKAA 5I9MA 3OF2A 2PUDA 1MW9X 1E66A 2AJLI 1K7XB 3BE6A 4EB8A 2PYIA 3FPEA 4XTRA 3ZJ4A 4I1OA 2IXAA 3P2EA 3TEFA 1GUYA 1Z68A 3KRTA 1DVRA 1ORIA 2IODA 3HBAA 4MGZR 3DXZA 5AQEA 2GTHA 5B4VA 3QIVA 1T0BA 2GD2A 2GK6A 3X44A 5EWMB 3OEHD 1F1BA 4N65A 3QMMA 2BEJA 5CM8B 3L4EA 3OEED 5DLDA 2XSZD 4PSVA 4JGIA 3V8QA 2ONKA 4N8DA 1Z2OX 4LMRA 1CJBA 2R8BA 3DPUA 2FUG6 3EQ9A 4C0LA 3NFRA 5I7AA 4MKZA 4LCEA 1IDN1 2UXCB 4ZV9A 1MW8X 3VO8A 4WFKA 2R1VB 2FSUA 2QJFA 2XQFA 4OIFA 3SXUA 1YE5A 1WUYA 4J0GA 2K2QB 5AW8A 2PKQP 4QYIA 4U7TB 1YTUA 4P93A 3WO1A 2FLWA 1R8YA 4QUJA 4R1UA 5F2EA 2V7TA 5CM2Z 1YIAA 1GM5A 4RYLA 2GJSA 1LDMA 2DVMA 3S5UA 3C1AA 2EJUA 2WHPB 4IINA 4WN9B 3T3PB 3CRNA 4DZRA 1XTKA 2XCUA 1YL7A 1YQUA 3QW4B 1RS0A 3AKZA 2CNWD 2FPIA 2PE5A 1JR3A 3UO8B 2XA2A 3GG9A 2ON6A 2BR4A 3PNLA 1EG7A 2NUTA 4BB6A 2G1KA 2UYHA 2ZI9A 2BFDA 5INTA 4N82A 4R05A 4C0WA 2CL0X 2P2DA 3BILA 3NTLA 1I3CA 1KEWA 3OM9A 1XQXA 3QU7A 1ZD2P 3EXFB 4K9KA 4Q0MA 5DASA 3BBPA 1U7PA 1LS1A 2AR0A 3PXEA 2YZGA 3HUEA 4EAQA 3MTGA 4KQCA 4IGEA 3ZCXA 4ZRNA 4L6IA 5K0ZA 2JG3A 4WUTA 4IV0A 3WL3A 1C14A 2H2HA 3DULA 2EFJA 1QP7A 4CM6A 1UXGA 3D6JA 1Z4JA 1FSPA 4UEKA 3V34A 4IMRA 4Q7JB 2QV7A 1TB4A 2ZRGA 4MVXA 1ISIA 4NEHB 4BLQA 1YZTA 1EH5A 1PQYA 4PPYA 3S5JA 3AI3A 1WMFA 4OHUA 5C8ZA 2AN1A 3GL9A 2JS7A 4R3UC 2FHPA 4I2NA 1A8IA 1PR1A 5DXAA 3CPJB 1B93A 4RGVA 1YT5A 3SC6A 2FWMX 3ORHA 1IB6A 2RGRA 3BRWD 3DGFC 3D8SA 1OAOC 4C7XA 2CUZA 1YRHA 4J91A 2XGGA 1K5HA 1XIVA 5CVVA 3HNPA 5BT9A 1MHTA 5DWDA 2H9YA 1CFJA 4FBLA 4DJFC 3SC4A 1WP4A 3NHJA 4QDXA 2OAEA 2WF5A 1SBQA 2FRDC 1IDOA 3F78A 4P08A 3UUWA 4MHSA 1Z5WA 5FUWA 3WLPA 2QPOA 2R7NA 3H5LA 3AKDA 4IDFA 1AJEA 4GLBA 3ZE6A 1N4AA 1QKKA 3VHRA 1JDSA 1QV6A 3C7CB 1OIXA 1H6BA 2O06A 4FD3A 4BNHA 4F8YA 2XI4A 4FD2A 2EXXA 3LBYA 3CIOA 3TIIA 1V9LA 4URHA 3PL1A 4OHYA 2X0JA 4RF3A 1QQTA 1R50A 4YDHB 2I1QA 5EG5A 2R4QA 4M2LA 5IABA 3KIPA 4HDRB 2WINI 1G16A 1R5OA 4RH3A 2G8NA 5BW5A 3C4JA 1J0XO 2ZE8A 4X94A 2GX6A 4EEZA 2WJIA 4YAOA 3WR5A 3PS9A 4BNIA 3C5CA 3HCNA 1R3DA 3K5HA 3QNMA 4HVLA 3OJEA 2EC5A 4Z9BA 1SBHA 1OWLA 1VSUA 5KTRA 4F3TA 3SVZA 5DNYB 1QC5B 2PPLA 2KE5A 2GBFA 3IC5A 3QVGB 3UCFA 4FHFA 3HBJA 2K7FA 2ZK7A 4PC1A 1T9GS 4U9HS 3L7BA 3GLHA 3PUYA 5DF1A 3FYUC 2D54A 3LY5A 2BFDB 4HZUA 1ZEMA 3E23A 4L0QA 4D0GA 5DHQA 1AZTA 4LY6A 2XKBA 1DUIA 1Z6GA 2XMPA 2CLLB 2PFKA 3A37A 3A1NA 3BZUA 1NW9B 3GEHA 5KTNA 5LQMA 1VE7A 2HWWA 2PS3A 2ZTSA 2ZVJA 4QNNA 4WXEA 5CPBA 4R8SA 5GONF 2ZWPA 2J33A 4BN4A 5BYKA 3AFIA 3BH0A 1AVTA 1YS4A 4QBTA 5D7BA 3T3MB 2IEDA 1PJBA 2H5JA 5A05A 5JADA 1J8QA 1JIVA 2OB2A 3I58A 2RAPA 2IWRA 3NHYA 4UXHA 3RTBA 1RNLA 4S1TA 4QYIB 1CIJA 3EULA 4QPJC 4ZO8A 4K28A 1WEKA 4AZ3B 2P27A 4EF4A 5IJZA 5LLTA 1TLFA 1DTWA 2I0FA 1IHDA 3B82A 1NBOA 3VU1A 4BB9A 4CDGA 1T43A 1ZH4A 3DZKA 4X45A 1CRZA 3BDIA 1GZ7A 2QRPA 4KWIA 4M60A 4O2BF 4CM5A 1M72A 1W0JA 2ISQA 4U0KA 1G0NA 3ORYA 5IAGA 3R7WB 3GDFA 3PWSA 3PFFA 4QYXA 5MGNA 1V5WA 1OIVA 2EKBA 4LSZA 1WF3A 1PL7A 3GQVA 4L5JA 1H93A 1C0KA 1PS0A 1WMSA 2FG5A 2O4CA 3FHCB 4QDTA 3W34A 4YRKA 5BMVF 1AQUA 4P3PA 1JJFA 3MWGA 4NABA 2LBPA 3ZW7A 4KXQA 4DBZA 3PQ5A 1H5UA 2R4TA 4TV8F 4XDHA 5JSUA 3EG5A 3IEMA 2PL9A 2Z8YA 3DR5A 4DWOA 3AEQB 3KG2A 3AXTA 3CEPB 2XMSA 2AN5A 4G0ZA 1HQKA 5B2FA 2QK4A 3ZIAD 2OWEA 3ZV6A 4OGFA 4C5BA 2XQIA 1RP7A 3VGPA 5LNK6 1WUHS 2QLTA 3RSCA 1JJBA 4DAEA 4W7IA 4CQNA 3DBLA 3BORA 4LIPD 5FI1B 5IKXA 2FXIA 1N2SA 3K70B 1N0VC 4RTPA 3P9RA 1MQSA 2DWOA 3LI2A 1Z38A 5HQTA 1UKAA 2ADMA 4DQ0A 2WKRA 3BK2A 3DEIA 4PSKA 5CIWA 4D9IA 5MHTA 1RI3A 3HEBA 4WMLA 3D31A 2VHVA 4XWTA 3QMWA 2IBSA 3L1KA 3NBKA 1KGDA 1SB9A 4TX1A 2OMEA 1SQ0A 3IQWA 2XT0A 4MWOA 5B1EA 3KAQA 4E14A 2ZRMA 2HHLA 3EZ9A 3LCCA 3NJRA 3TRJA 5JO0A 3W1EA 1EUZA 4KXWA 2XRZA 3GIDA 4K3VA 3ED5A 4QLOA 4BGEA 3GZ4A 1QGYA 3HN7A 4URFA 2YW9A 4Q39A 3GBVA 1ACLA 1FMCA 2AQHA 1X14A 2RK6A 3BRQA 4KU4A 1ZYUA 3IMGA 3JASA 2ZS8A 5FBQB 1JDTA 3ZVKA 4ZO6A 2DU8A 1C3OB 1Z88A 2F1OA 5CLGA 2XDWA 5BMVB 2JLWA 1XMOB 3FCUB 1K27A 3JYNA 2VTBB 1TQHA 1V95A 1TOAA 1KTIA 2BLLA 2E1PA 3WIVA 4OOFA 3V8RA 4S12A 4XB6B 1CR4A 4ZEOA 2JGAA 4KKVA 1VIDA 3G8AA 5C1PA 3KM0A 3FGNA 3MT0A 4HL6A 5JY6A 2A9VA 2HIAA 1E6MA 2OXCA 3EXHB 3H6GA 3TL3A 3LRPA 3TECE 4GRDA 4N0DA 1GSOA 3RM3A 3ASVA 2H2AA 3PICA 4XPIB 4BVFA 2ZJ5A 3MRVA 3ZDDA 2YV4A 3DTNA 2HRRA 1LW6E 1V37A 2WM3A 3UMSA 3HWX1 4AURA 1Q7GA 5C5CA 4N76A 1UMBA 5FEUA 4B47A 5LPNA 2CV1A 2WJYA 3KEMA 4HR7A 4NICA 3N7TA 4GOJA 3RLFA 3ZGXA 3L8MA 1W19A 3F9RA 4ND3A 4WV3A 3AKEA 2IS4A 3GRCA 2M1ZA 4XX0B 2REBA 5C52B 3I23A 1U3UA 3NVMB 1G8SA 2FOLA 4ID3A 1A9QA 1NBEA 3KJHA 4ZGWA 2AC7A 2ZBDA 2DSNA 3E9ZA 4XCVA 3L43A 3C8UA 3F74A 1NMSA 1WKCA 4UNNA 1U1CA 3GFGA 5ELMA 1JH8A 1MBZA 1NI4B 3R5KA 2YNMD 2OCPA 3R0JA 1Y7LA 3VO1A 1GCUA 1YGPA 2P2NA 3UMBA 3ZHXA 2Y1GA 4L5BA 1IY0A 4P82A 4FI3F 1FX0A 4PIPA 3SU8A 3L4JA 2ZREA 1YONA 4OHWA 3HTXA 1AUQA 1Y3FE 3D64A 1I2ZA 4GM1A 4MCJA 5HE9A 5DLEA 1ST2A 2C7VA 3TSWA 3VDRA 4EI9A 3RYHB 5DCLA 3PGJA 2W48A 4U9IS 1MRNA 5IULC 3ZI7A 1WBJB 4I55A 3GHHA 2AFHB 4CWAA 3NIDB 4TN1A 3KK0A 2GD0A 5DHUA 3I4CA 3F97A 4DCGA 3I9JA 1EGAA 2LD4A 2PH1A 4R1NA 4M1YA 2ZI6A 5KSPA 4AT1A 1NHGA 1OFTA 2V65A 4IH1A 5DTIA 3UB4A 1RYEA 3CYFA 3I92A 3T06B 2WWWA 3JQBC 2E6UX 3U6KA 3IHWA 4XCXA 4JMPA 1JVBA 4AO8A 1CY4A 3I8XA 4IKOA 4JCCA 4L15A 5GV7A 3ST7A 3ZBTA 1W75A 3DDOA 1XLTA 1QE5A 3C3AA 4GFDA 3TNYA 2CE2X 1AT1A 1A9SA 1JXMA 2IPAB 1KYXA 2D3TA 3CRRA 4L72A 4DVJA 1O94C 5HHTA 5KQPA 2AD1A 1UDWA 4RIHA 3HU5A 1QH9A 4G4SO 1MQ8B 3NUGA 3PDHA 3GT3A 4J4TA 3ZXXA 2DFTA 1KI6B 4CMBA 4UHKA 2QAJA 4OI1A 1WQ3A 1P5HA 3D8HA 1KQPA 1LTKA 2HZ7A 1C7QA 3GLIE 4IUYA 4ECEA 3G0CA 3B60A 3CZ4A 1M34A 1NXQA 2C07A 2LKCA 1Y8RA 4WN9A 4TZKA 1U5CA 1ZIDA 5CFLA 4HPXB 3U3OA 2QX6A 3F5DA 2B2CA 1NP7A 3K72B 2ZI5A 2FP3A 3WRYC 5EN4A 2IDMA 3TIGA 1M0SA 3HDVA 4Z4IA 4JGBA 4GL2A 1QH8A 5F78A 1N33B 2BEUA 5FPTA 3DDZX 1R6BX 1ZESA 4DR7B 1U6KA 4BKOA 4CGYA 1KYVA 1S7CA 2XR1A 3CZ5A 5AKJA 1V3VA 2FPPA 1MG0A 4G65A 1NI3A 4RHYA 5B6IA 5KEIA 4HYEA 1T9AA 4PV7A 4EY5A 4KPYA 3BHMA 4JVLA 1XNHA 1T5IA 3DV2A 5LU8A 1L7DA 2I6TA 4OJMX 2R96A 1X8LA 1N2GA 3FJOA 3TQCA 4LKOA 3EZ6A 5BOSA 3MAJA 3NFYA 2R47A 1UPUA 3A1VA 4N8SA 1NNSA 3AERA 5FTWA 4CF3A 3WGHA 3Q3IA 1ZR2A 1FFBA 2JB9A 4NOKA 5AM1A 5CDTA 5DI9A 3B3FA 4JP5A 3SBXA 2QPLA 3LX4A 4NPAA 5I7FA 1QTIA 1T6YA 1ZA1A 2QRHA 2ZZKA 2XPCA 3A6HA 4LVUA 5F76A 2NXJA 3DMTC 3LOQA 5AKYA 3PPVA 5ALGA 2XZDA 3FPJA 3O8BA 5KPJA 5CT4A 4UDXX 1E0AA 1G7TA 3G9TA 1PTJC 2FQWA 1YCGA 2POCA 3R5SA 5CCBA 4IW3B 1K4YA 5DM2A 1MNQA 1T29A 3CRMA 4R9RA 5K5EA 1DCTA 3B36A 5DX0A 4UMEA 2J9FA 1OBOA 3MSXA 3PNQA 2IX3A 5GINE 2W6ID 4UEJA 4WESB 2NX2A 2IGTA 4DA6A 5KQMA 1YO6A 3CUEF 2BRUA 1SK8A 4REOA 4ZT7A 1UPXA 4B84A 4PGGA 3U4CA 1XXHB 2R11A 2B92A 1L1FA 4U7FA 4G63A 3IUPA 3R7LA 1SXJC 3EGDB 5JRZA 1F9AA 3AHIA 2XCOA 1XG5A 3R9XA 2B61A 1OC4A 1XTTA 4HQNA 4L4YA 1VSBA 3FNIA 4GMGA 1ZAYA 1FYDA 3RFFA 2NQ2C 3D1VA 4BVGA 4DHWA 2J48A 3DCYA 3WB9A 3A25A 3ZJUA 2ZYTX 1EE2A 4E0BA 1V1RB 1Z0JA 3FRJA 3NPMA 3RU2A 3U26A 5F7OA 1P2GA 5SZJA 3UKJA 5I4IA 2Z4SA 3O1JC 3WYDA 1CZRA 1G8PA 1KWKA 4KQEA 1CJMA 3RJTA 1MHPA 2HX1A 4RS4A 1JFFA 5PNTA 3VOBA 3GDWA 2CLMB 3U61B 2FPMA 1RAEA 1RTKA 4UVEA 2PXAA 2QU7A 1IM8A 3D6HA 3LLVA 4PAQA 2FJ0A 2ZTLA 4BKQA 2FVYA 4B40A 5F64A 2H17A 1GOTA 2G4VA 3RSOA 2CBZA 4DKXA 4HWPA 2Y0BA 1V4BA 3CG0A 3IT3A 3ODGA 4FYWA 4QT0A 3VR4H 2VPZA 1WZCA 4IMJB 4ED9A 1M0TA 1FVOA 5CLLA 3R3JA 5HK8A 4EY8A 4D80A 1VKZA 4TLCA 3PQ2A 3WBJA 4KQIA 4EYSA 3QEMA 3C43A 2FW1A 3D6FA 1P18A 3KZKA 5DM70 3QEMB 4QLAA 2J5XA 3UFBA 4AN0A 3UV6A 2DUMA 1ARZA 1T10A 5TEVA 4KHPB 3WYBA 3NALA 1HOXA 2OOSA 2Z04A 4OFWA 4HH1A 4D41A 4MZXA 2CHEA 2BMAA 4YR9A 5FFMA 3HB5X 5I9SA 4D99A 1VE6A 2BHLA 1RKVA 2GPBA 4KYIB 3SJBA 4F85A 1P73A 3KYCB 3ESYA 13PKA 1DQRA 1YQWA 4RVNA 4Y2JA 4DB4A 3BD7A 1Y8AA 2Q0SA 3EPPA 1J99A 3ID6C 4FK8A 4HDQB 3KE9A 1JHOA 1RYDA 2PZBA 3PUWA 4IMPA 4WBXC 2OA0A 3TXYA 1GUDA 3NONA 5CB4A 2Y0EA 4ZAFA 2HJSA 4ZXFA 3RC9A 1A77A 2JK1A 1N5JA 3EQZA 4K9SA 1QRDA 1OLSB 4BATA 1SJ9A 5LXTA 1ZGCA 4JKIA 1YFKA 2QVZX 3WG9A 4ND4A 1TZBA 3LU1A 1TYDE 2F1IA 2JZNA 5TVGA 4DOMA 2PLRA 3PE6A 4XLLA 3FPCA 2QWXA 3Q4GA 1E5VA 4K8RB 3AOEC 4Z54A 2H8KA 1UBLS 2H4JA 2ADFA 2ZRFA 3IE1A 3QVOA 5EQTA 2BP7B 4PFJA 1EIZA 4JXXA 4UBJA 5FX2A 1KOLA 3Q9SA 2WWXA 1EZ1A 2AOUB 3RTAA 3RARA 3UC5A 4D45A 2EW2A 4IHKA 1VYHA 4G09A 4JK3A 1HDCA 1F2UA 3IIEA 1Y81A 3V4VB 2YMMA 5BMVA 4P86A 3PWTA 5LYJF 1ZMBA 3ER9A 5G3ZA 4G26A 2TMDA 4QUAA 4AO7A 4BLUA 4Q37A 1K98A 4ID9A 2CSUA 1K7EB 1XZFA 3BTUA 5BSVA 1PWXA 1H85A 4GH5A 5JO9A 4HX2A 1G42A 3SSNA 5E7IA 5KC8A 2BM8A 5KYTA 1MT3A 4ZYWA 1SWWA 5L3VA 1JP7A 4BNZA 3FZYA 1A50B 1Z5GA 1JHMA 5DGIA 2DLCX 4MUEA 2ZSAA 1BDJA 4AZSA 1KXJA 2BEKA 4WERA 3NRCA 2P1DA 4E3ZA 1QV7A 3INGA 4JBLA 3IV9A 1LVHA 4MR9B 2QN8A 5LMZA 1F5SA 2CHUA 4DCPA 2UYGA 4LE1A 3U16A 3AM1A 4I1SA 4ZOLA 4KBGA 4MCAA 2ZTVA 2I3GA 2GEDA 3R7WA 4DV6B 3AVWA 4XDGA 4F4FA 2IIPA 5I5GA 3AHEA 2J5KA 4JEMA 3RYFA 1KOJA 2XXJA 1PAUA 2EIXA 3COSA 3T5DA 3ZVLA 1T8PA 1TLLA 3D4LA 3R24A 2X9VA 3EBLA 3R3YA 3KO8A 4BO8A 2Z2KA 3B51X 6PFKA 2Z1MA 3HSYA 3OMLA 3MWFA 5EJ4A 2GXAA 1Z6ZA 1U0FA 2HCFA 4PO9A 1SFRA 3RVQA 1EE1A 5EYPB 3FCOA 3I64A 3H3JA 4EJSB 2FW9A 5BR8B 4JI6B 1QFJA 1TCAA 1QHHA 1T9GR 3KDSE 4H3HB 4RTSA 4YMWA 5HW0A 3A32A 3BL5A 5LQJA 1TTPB 3W8DA 2B0JA 3EQ2A 1R00A 5SY6A 4J3JA 4RD0A 1Z5NA 3G02A 3WLKX 3DVLA 5DV9A 4DABA 5BSWA 2X7JA 3W3AA 1MENA 4REMA 3CV3A 1IM5A 5G0VA 2PQMA 1DCMA 4RKRA 3ZS8A 1W0JD 3V55A 5HMMA 1L1QA 5JD4A 1V5EA 2YVKA 3OT1B 1NKVA 2PSEA 3A3YA 3P19A 5JZSA 3HJFA 3ULKA 1HLDA 1KH1A 1FNCA 5DYNA 4XD7A 4CU5A 1S6YA 3E22A 2EFYA 5JFGA 3ZIDA 1RZRD 1UJCA 3UAGA 2HV9A 4E6EA 1JU3A 4RK7A 5C4GB 5KS2A 1Z74A 2FZWA 4MWBA 1L5HA 3U4GA 4Z7OB 5A5VA 3SQLA 1SBIA 4AICA 1RJFA 2BM9A 4J07A 1C1XA 1YZYA 3CM0A 4DNQA 5GJVC 1I4LD 2IOFA 3FUWA 1XF1A 5DHSA 5FOXA 2JANA 3I2YX 1KEUA 1DRVA 1VA5A 1KEPA 2VXCA 3ESBA 1K8QA 4C6SA 4L5IA 4CTJA 2ZU6A 2JEYA 4RZIA 2WT9A 4CXMA 4B3GA 3OQIB 1LTQA 3EA5A 3FKSA 2IFTA 2W2QA 3I37X 4QTZA 1PEKE 1O08A 3TW0A 1I7SB 2NYAA 4CF5A 1NBMA 2V8BA 4W63A 1T9KA 1UJ5A 3AZOA 2DHQA 3C8MA 4OQ4A 4TM7A 3WGOA 4P0TA 3ZY4A 4DJAA 3MJCA 3ZD6A 4LNAA 1CYEA 5B4TA 4OXIA 3HZRA 1FVXA 2QORA 1TZCA 3AI7A 4OXYA 1DINA 2AEEA 3AP3A 2ZB2A 4BOYA 2RKOA 4HFJA 4ARSA 4DDTA 4MW6A 1LS6A 1P9NA 4EUEA 4AUNA 2PXXA 4IF4A 2ETVA 2I4MA 2JAHA 1SIUA 2MSKA 1RACA 4BJHB 2DQYA 2XITA 4Y1GA 4ZCLA 1A8UA 1QP0A 3ZDBA 2OSVA 5T8KA 1NF9A 1LLDA 3WYFA 1AQLA 1Z2EA 3NDPA 4QDUA 2YXDA 3KSZO 3OFND 4TT3D 4WEQA 2FPSA 3AU8A 3N2EA 4J7AA 1ONOA 5E3HA 4H6WA 1Q17A 3T7EA 1YFZA 1WVGA 4CKWB 5DK4A 4DFDA 5IK2D 4D9KA 5B1SA 2H3EA 3ADBA 1DEHA 3OLXA 4FFDA 2X6QA 1Y8ZA 3WWEA 4DLZA 3AFGA 1GPBA 2DKNA 2F4NA 2HTEA 3QTLA 3WGUA 3LO8A 5AWFC 3GWZA 3IVRA 4JKOA 2QSUA 5I48A 2GLTA 2M32A 3KSDO 4UREA 5F1KA 5HZMA 3IURA 4RLSA 5HZHA 3LHKA 4AQ7A 4W9RA 1E6UA 1N9KA 2XZTA 1C9EA 4Q16A 1V11B 4RCYA 1N0UA 2O2JA 2P30A 4UAJA 4B1FA 4RSHA 4UCQA 4C4TA 2O5RA 3NCTA 3ND9A 2ZETA 3KQTA 3LBHA 4V0RA 3ZW9A 1VIYA 4KLRA 3G5UA 1AK9A 3EPJA 5JCZA 3FOFC 2CLFB 3QGMA 3K73O 4TV9F 3FYDA 1EDZA 2G76A 4Q4CA 4YH1A 4I1PA 1TK9A 1C30B 1TQDA 3VISA 2E1RA 2OYRA 3PFHA 3KT0A 1UP7A 1I9CA 3R6LA 4MVWA 4QUIA 1QIHA 2AJBA 2RH9B 1DIRA 3D02A 4LX8A 5FORA 2WZQA 4AW9A 4EIWA 4X41A 1Y82A 4X71A 4Y9TA 3SQMA 4AJ1A 4RV9A 3IL2A 3LT2A 2X9GA 3SG0A 1CEEA 3LKVA 1UDXA 4F9EA 2N1MA 1HQDA 1FEZA 1XBTA 4X7PA 3Q3CA 2JFFA 1T2AA 1T1EA 3VVLA 3GJ8A 3IE2A 4JI8B 4PAWA 3WP0A 4D8TA 2VQ3A 1ZVKA 3L82B 4BQOA 2VYVA 1UXHA 1MB0A 1Q1GA 3GJ0A 1E8MA 1CHDA 1KETA 1VLZA 4AB1A 5LOVF 4JT8A 2VYND 4UCWA 2C04A 3ZWKA 3OI7A 4KR3A 1E99A 1ZX1A 2G17A 5HM6A 5FL3A 3GJSA 1NUSA 1J8DA 3DAGA 3CBGA 4LMBA 4QDJA 3ZY3A 4P31A 4HEA1 1BYUA 5J40A 3LM8A 1TT7A 4I4LA 4H77A 4ZOEA 3REGA 1EGQA 1DQNA 3PFBA 3RS2A 3DL2A 3GR6A 4IXWA 4BMCA 5CEEA 1Y48E 1JKJA 2X2OA 5A04A 5BOSB 3EFOB 2RH4A 3V2UA 3LV8A 1JNXX 1QG0A 2F17A 3WNCA 2YWHA 4KSCA 2ZSEA 1EFVB 2ZRPA 3R3WA 1XRPA 4Q3NA 4YLEA 3W3AD 1VCNA 3SICE 1BX3A 1NXSA 5IAJA 1RC8A 4KV7A 1NZDA 1UPBA 2P35A 1JVNA 4PC2A 1W85A 4C6RA 4EUNA 5H81A 1G1AA 4E88A 2A94A 4ZQEA 3EVBA 1UWKA 3QOXA 5I3CA 2O20A 1AQJA 2NZ2A 1KO8A 4KWTA 1E1RA 2VOJA 4EUSA 4HXYA 4UFNA 4KVGA 2GHIA 4J43A 4RTQA 1JLSA 4X3OA 3F6EX 5TQ2A 2NTNA 3AM4A 3PZRA 4HGOA 4NIMA 1S2LA 3DQZA 1Z5UA 3DDSA 3QKUA 5G0TA 4CKCB 5K09A 2XWBF 4DV5B 4E2ZA 3FUXA 2I9PA 1CQIA 2BLNA 2J45A 2ZRLA 1TU0A 1BCRB 2R8YA 1UZUA 2YWJA 1A8PA 4B7UA 3FXAA 5EL0A 4E5VA 1HE3A 1NQ5A 1E5TA 4G9BA 4YFYA 1SCJA 1XWIA 2EJTA 1WD7A 2QZPA 2RJOA 2ZBUA 2COUA 3B20A 3L06A 3UYKA 3ITDA 2WYOA 3N8DA 4QGAA 4YRCA 5HIJA 4CQMD 5T4EA 1WLSA 4EARA 2O2YA 1ZGGA 2W6NA 1U0RA 2O1EA 5AKEA 5EE3A 3S55A 4E5UA 5AVWA 4WCFC 4GP6A 4CTNA 1M54A 1AHIA 1Q6YA 1QR2A 3F1LA 2C31A 5BVHB 2FR8A 3G7SA 2WA2A 2X4IA 1MMFB 4I5FA 2CEKA 4H6VA 2CMKA 2E4WA 1XNQB 1MABA 4PYOA 3RGGA 4C6HA 1TUBB 3IAS1 4RK0A 1DV2A 3CPSA 4L85A 1JDPA 5BV0A 4BTLA 1PRYA 4DJDC 2A1UB 4CYMA 1MGPA 2Q8PA 3RG8A 4WA7A 2C2BA 4D42A 5AQ1A 1LLQA 1X13A 3PJRA 1B1CA 3TO5A 3MGGA 4BVBA 1DC7A 2ILVA 1EFPA 3ZD7A 1U2SA 3PHCA 2H54A 4UBIA 2R65A 2VRCD 2PZAA 3LFHA 4MA4A 4AQYB 2HGZA 4JOQA 1B6GA 1IHOA 1JFFB 1RYYA 4RHUA 5CH5A 3QKRB 3FVQA 3RSSA 1BVRA 4C29A 4DPMA 1DWUA 2PMDA 3HDJA 4YUVA 3Q8WA 1N9GA 3A6LA 4COOA 1G21A 1OH8A 3L4KA 2IJGX 1R0SA 3DT6A 3PUZA 2XE6A 4JU8A 4A5OA 4BV9A 5JFOA 1JDJA 4ZVKA 2VTKA 4MEBA 1H4SA 2Y6VA 4F4UA 2AB0A 3QITA 2IYTA 4G1FA 4DDHA 4J1SA 4Y2TA 5C53B 4ZV4A 1DRJA 4EL0A 1BS9A 5JVDF 1OBFO 1R0BA 2QJWA 4UOQA 2GFQA 3USES 3LDHA 2AW5A 1KJYA 4PBTA 4IYJA 1VMKA 3RBAA 3VC3A 2YJ3A 4JYCA 5LOVA 5TLSA 3MHPA 5EUQB 1L5WA 3DE3X 3E84A 4R4JA 2P9QA 3H97A 2P77A 3UMGA 4DR1B 5KKCA 1ZA2A 4O3FA 1IQUA 1H2HA 4MVJE 3DM5A 3L7OA 1B2LA 1NIPA 2ZSKA 5EY5B 4GLFA 3MQFA 1EFDN 3Q88A 1ZITA 5THQA 3TZ6A 4Z7JA 3GGSA 3MCTA 5ICGA 5AKLA 2IYNA 2PU7A 5CURA 1LBSA 2WJPA 3Q10A 4V3CA 3PA6A 3KQPA 3T9FA 4UDNA 3SZRA 4B5KA 1OFIA 3DR3A 4H7PA 3DDCA 4EMUA 5JQWA 4V02A 1Q91A 3TM4A 3E1SA 4Y9RA 2O2HA 1S96A 1IN6A 1CS4C 2VNJA 4NF2A 5EUMA 5G2OA 2O7SA 3FDZB 2E87A 3GUHA 4R2KA 1CU1A 2BHNA 3DJYA 3TZBA 3I9MA 2IUFA 2QX7A 1I13A 1QFYA 3LT0A 4H35A 1TUEA 4IMIB 5DRTA 3T5AA 4KFTA 1Z25A 3FZGA 5TT1A 4GT1A 1ORDA 4UOZA 1G5RA 1VKHA 4H31A 3A10A 2C0PA 2XTMA 4YWHA 1G5FA 4AULA 1Y7HA 5TT0A 1K7SN 5DSTA 4EB0A 1CE8B 1G6KA 2FEMA 4DILA 4E51A 3CVYA 3F73A 4XB2A 1LA2A 4YDSA 4YAFA 3S6JA 3EIFA 5CIQA 2C3PA 3OTQA 3Q1LA 2X22A 5H59A 2YINC 1JKJB 3IBTA 3LOUA 2C8VA 2W11A 2POQX 1Y1QA 1YCDA 1FNDA 2PYDA 4P2BA 3V4RA 3OFJA 2AN9A 4Q9DA 2PWPA 4WKPA 4ZO9A 4V1CA 2R7MA 1YF3A 3LMKA 5DW0A 4MWCA 1JSZA 4P7JA 3N1UA 2WE7A 1VOTA 1T3LA 3PEUA 3BE4A 3C8DA 1ZZGA 2E4VA 1OTXA 3MTAA 4COKA 4NEQA 4M0CA 1ZDMA 2HRDA 3OIDA 3PGMA 2OHHA 3JD1A 3G5TA 1WUTA 2HDHA 4N5DA 3TLJA 1HE5A 1UMCB 2HQSA 2OVBA 2VFAA 4JLSA 5EVJA 1ZD5A 3KP1A 3KSRA 4I08A 4MV5A 1E1QA 1KEKA 4TL9A 2MDTA 1Z6XA 3DYBA 3FZNA 2OENG 1I7DA 5AW7A 4DCNA 1I2MA 2QNIA 2X5XA 3NG1A 3W9YA 1A9PA 3N0XA 1VL5A 4KGVA 3RVKA 3QOFA 1H2FA 3ZQKA 3L7JA 3C5VA 2EX1A 1IK6A 2W37A 2Y0DA 4E31A 3BX1A 1U8XX 4BNMA 3D5QA 3ZNQA 1JU4A 5ICEA 2ZIXB 2FZCA 2C95A 3UUGA 3TDMA 3LGAA 4Z1OA 1O7JA 1OBVA 5HBGA 3ZNNA 3GEDA 1FDWA 1O6FA 5LA6F 1A04A 1ZGJA 1CPYA 1HFEL 1TEVA 5JCPA 2UVPA 2C3YA 5DB4A 5TIIA 2NVUB 4FXPA 2YWXA 3EBOA 3IUSA 4NESA 1A9RA 4RPLA 2ZJ4A 3L8EA 2QUJA 5JECA 5KINB 2HU8A 4MW9A 2C92A 2FEXA 3AQIA 2WOOA 2HL6A 4IJ6A 3PC4A 3RBZA 4C0HA 3KSAC 1QS0A 4ZJZA 3LCRA 5HZGA 1BXRB 2GR9A 3ECCA 3VU8A 1MB4A 2HSWA 5KNLA 1F3OA 1OAOA 5DCWA 4FGJA 4L8YA 3UG6A 5AICA 4OM7A 4OB8A 3ETCA 1C7EA 2PY6A 4WCDA 3TMKA 3JYOA 2O1WA 4QXQA 2QX9A 3HJTA 2QPAA 1BS2A 4QATA 4U02A 1RI5A 4ZCPA 1W7AA 2QTCA 1U0BB 3SSAA 3EISA 3K6JA 5KWSA 3EJWA 2V7VA 1QG6A 3HVUA 1KVTA 1QHFA 1ZK3A 1SHUX 1UBMS 2Q3BA 2ZUCA 4QNMA 5IS2A 2Y1DA 3D8TA 1EXWA 3T3OA 4ZTUB 1ETUA 1I6KA 4MVJD 1RFLA 5F21A 2W6OA 4KVZA 1DX4A 5I7RA 4CKBA 1PJSA 1Q0ZA 2OWDA 4FBGA 5IARA 1K6XA 1VG8A 5JQGF 3U4IA 1SPBS 4TLLB 4DPKA 3T3EA 4DNOA 1I10A 2EW8A 5JJ5A 5KWEA 3SQWA 2QSZA 1WO8A 2VTEA 1E9RA 1EQ2A 1ZI8A 4JT2A 5JDCC 2ZWMA 4YP9A 3IEIA 2PUFA 1XVIA 3KEQA 1FSFA 5FLYA 1FMTA 2F3QA 2DFKB 3Q5GA 4XJVA 1SIBE 3NT5A 4OV6B 4EBBA 4DIKA 3EY4A 3GEEA 2ORWA 1T8TA 5CB6A 4LXQA 2R8ZA 2FMUA 2GASA 2I8AA 2YDYA 3C87A 3G85A 3I2KA 4JBWA 2OVFA 4KWCA 4KV9A 4CNBA 3PRKE 1N6RA 3B1FA 3C5HA 5DN6D 5TARA 3E7PA 5D85A 4BWGA 4NBLA 3IKLA 1J5PA 4OJTA 4U2EA 4YASA 4BV8A 3UK7A 1PJQA 1T6BY 1E6CA 1HUQA 2AT1A 2BIFA 1HFWA 1V1RA 3JZAA 1QCYA 1ZU4A 1AQ6A 5TMBA 5DO9A 2CC2A 1RJDA 2CDCA 3M4JA 2JFQA 4RJIA 5AKIA 3SFZA 3FYSA 3L5KA 3DC2A 3PNOA 4EZIA 1O9HA 1FRVA 5ISMA 2ZLBA 4R0NA 3LRTA 3Q87B 5CDFE 3F4KA 2ZSJA 2X7XA 1T8YA 3ROTA 5IBRA 1ZGZA 3OZBA 4M36A 1GRRA 3K1YA 1P44A 3B9QA 1S4QA 4EYOA 2ZYGA 4X7RA 2IYXA 4HNRA 1NY5A 2EJWA 3BN3A 1P62B 4HX9A 1E32A 2EHJA 1VXRA 2HWXA 2OBMA 2Y2VA 2ZJBA 3IT0A 4OHVA 5A3QA 1LPPA 1OI7A 1TK2A 1O97D 2F43B 1O95D 1NXVA 1ZSYA 3PIDA 4AUKA 4F46A 3NOVA 5CPFA 5ALRA 5FL7D 1Z36A 4BQNA 1MRZA 4KJZA 1E9BA 1XEXB 1LSJA 1PZXA 4N0EA 4RNCA 1WKVA 3M8KA 1AN0A 2AEMA 4L76A 2QNRA 3EYWA 4UD2A 2MTBA 3GEPA 1K5DA 3NJ4A 4F4IA 2YJNA 3MTEA 2BDUA 2GNPA 1XMJA 2QMEA 1Q7EA 1WOMA 4V38A