3F9DA

Crystal structure of the r132k:r111l:t54e mutant of cellular retinoic acid-binding protein ii complexed with c15-aldehyde (a retinal analog) at 2.00 angstrom resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
137
structure length
137
Chain Sequence
b'PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKESTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELILTMTADDVVCTKVYVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinoic acid-binding protein 2
publication title Two distinctive orientations of binding determined by a single mutation in the CRABPII mutant-C15-aldehyde complexes
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 32
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3f9dA00
4QGVA 2FR2A 3APUA 5DPQA 5FFHA 2MO5A 4I9SA 1LPJA 4D6BA 3FR4A 3B2LA 3NADA 4QYNA 5F6BA 3WJGA 1IKEA 4ZCBA 3CBSA 5F58A 4TLJA 1KXOA 2OFRX 1X8OA 1MX8A 2K23A 3BRNA 5EDBA 3P6FA 1XKIA 2MM3A 2WQ9A 2LB6A 4R0BA 4YFPA 1QFTA 4XMCA 1X71A 3CQNA 1ACDA 4NYQA 3IA8A 2QM9A 4ZH6A 2HYSA 4ES7A 1QY1A 1A18A 1D3SA 3C78X 1HMRA 3TGAA 3FA7A 3GAQA 2AH7X 3TGBA 3NX2A 4UU2A 1QY0A 2CZTA 4GH7A 4YGHA 4LZUA 2JU3A 1OBUA 2X46A 3KFFA 2FS6A 1MX7A 2O62A 5HA0A 5BVQA 4Y0RA 3U03A 5LJGA 2XSTA 1IFCA 2R73A 1GT3A 4I3DA 2HMBA 3K3LA 5EEEA 3JSQA 5KIDA 2XKLA 1SA8A 4DQ4A 3STNA 1GKAA 4AZRA 2W2FA 1AQBA 4UU3A 1HQPA 1S2PA 3RSWA 1YWAA 5HA1A 1BEBA 1Z24A 1GKAB 5H8TA 3VG5A 1LF7A 4ODDA 3L4RA 5BVSA 2JN3A 5DG4A 4OS3A 3APXA 3PH6A 2QO6A 4ZH9A 1H91A 3ZQ3A 4AZMA 2FT9A 3VG3A 2G78A 3UEWA 1ICNA 3F8AA 5H9LA 2GC9A 1QWDA 1DV9A 3VG6A 2AT5X 3EM0A 4EEJA 3BX8A 1KT5A 4YGZA 4GNYA 1CBSA 3CBCA 1TOUA 3AKNA 1I04A 4I9RA 1YP7A 4LZVA 2F73A 2ANSA 4XMGA 2RCQA 4ALOA 1KQWA 4WFVA 4IAXA 3JS1A 1X8PA 4CK4A 4ORRA 5HZ8A 3I0AA 1ERBA 1TXLA 1ZNLA 2A2GA 1TVQA 1JYDA 4EDEA 4NNSA 5KICA 1CRBA 4TNNA 3TF6A 2LFOA 4RUUA 2A13A 1HN2A 1BSQA 4LKTA 2G79A 4YBUA 5K06A 4DQ3A 1KZWA 1UREA 1JJJA 1A2DA 5D47A 3FELA 5HZ6A 5LJBA 4EXZA 4HPBA 3WJBA 5IO5A 2WR6A 1ICMA 3O22A 1X89A 1FEMA 3ZUIA 1HMSA 2CBRA 1KT6A 1DZPA 5FAZA 2Q2MA 2CM9A 3CQRA 2X45A 1A57A 2FS7A 2L5PA 3FEKA 2CZUA 1KOIA 1JJXA 4PSQA 2FTBA 2HLVA 2P8GA 3UEUA 5H9AA 2Q4NA 3CMPA 4N7CA 5EZ2A 2N93A 3U9PC 1ML7A 4GRJA 2A2UA 3FEPA 3O19A 4YCHA 3FMZA 1NP1A 2BLGA 5BVTA 1YIVA 1EUOA 1E06A 2WQAE 3STMX 3DSZA 1PEEA 5D45A 5C0NA 4QZUA 4AZQA 1OBPA 3EMMA 1LFOA 4YDAA 3PEDA 1I4UA 4IMNA 3MVFA 1QY2A 3EBWA 5L8NA 3KFIA 3D96A 3NP1A 3CR6A 4GNWA 1VPRA 1E00A 5F6ZA 1B4MA 2L67A 2LKKA 3G7XA 4AZNA 1ADLA 5HCDC 3QKGA 5LKFA 2GTFX 1FDQA 3O2YA 1EALA 3OJYC 1DZJA 5EDCA 2KT4B 1S7DA 3UEXA 2OZQA 1DFVA 2RA6A 1HBPA 3UEVA 3U0DA 1MDCA 4AZPA 2NNDA 3B2JA 4XMFA 1SY2A 1JV4A 2L68A 2HZRA 1SY0A 5D4AA 3F9DA 1EIOA 3DTQA 3BLGA 4IB6A 3AKMA 2CBSA 1BRQA 4ORYA 5HZ5A 3TGCA 5HCEC 1CJ5A 1D2UA 1CBIA 4ZHHA 4YGGA 1VYFA 3BY0A 4YH0A 4BOEA 1FENA 3VG2A 1KT3A 4ORXA 2W2BA 4WFUA 2DM5A 1EXSA 2ALLX 5F7GA 5KHPA 1LIBA 3BX7A 1ZRYA 4TKBA 5HWZA 1O1UA 2EU7X 2PY1A 1QG5A 1UZ2X 2ACOA 1G85A 2R74A 4I3BA 3APWA 1BWYA 3FENA 1X8NA 1S44A 2OFMX 3MBTA 1GGLA 4A8ZA 1LIDA 4HPDA 1U17A 4ZGUA 4YFQA 1YWBA 2WWPA 1FELA 1LICA 1DZMA 1SXWA 1A3YA 5HTEA 3EBKA 2FLJA 4QYPA 1SXXA 2K62A 5LJCA 5HBSA 2JU7A 2Q39A 4ORWA 2MJIA 1LIEA 4XMEA 5LKEA 2FR3A 4TKJA 5D48A 4YKMA 2QO5A 1NP4A 2AT8X 5H9KA 2FRSA 4ZHGA 2OVAA 1G5WA 1O1VA 1SY3A 1U0XA 4KIIA 4TKHA 3STKA 1YWCA 4LKPA 1DC9A 2WSJA 2AT0X 2QOSC 1KQXA 5EEDA 3FIQA 3FW4A 3HWEA 4MVKA 4XMDA 1B0OA 1X8QA 3ELZA 5AQ6A 3KFGA 2RQ0A 1BLRA 2E4JA 2WEXA 3P6DA 1B56A 5IO7A 3BS2A 4ZHCA 1BSYA 1TW4A 4IAWA 4NLJA 1FTPA 1U18A 2A0AA 5L8OA 1X8UA 1XCAA 3VG4A 2HZQA 1RLBE 1B8EA 4N7DA 3NX1A 1SY1A 2G7BA 4XMHA 4HFOA 2L9CA 3NPOA 1YP6A 3NQ9A 4IB8A 1KGLA 1E02A 3B2KA 1ZNGA 4NP1A 1HBQA 3C77X 5LJHA 1N0SA 3WBGA 1JBHA 5HZ9A 1DZKA 1HMTA 4K19A 1BM5A 5D8JA 5LJDA 1T8VA 3T1DA 4Y0QA 4OS8A 3BU1A 1OBQA 4EFGA 4WBKA 5HTDA 3FLLA 4M6SA 2LBVA 4ZHFA 5B27A 3EYCA 3FR2A 1GT4A 4YDBA 1OPBA 4AYHA 2OVEA 1AVGI 4ZR2A 3VG7A 1GM6A 2RCTA 3NR3A 1AELA 3PECA 4HPCA 1I05A 3WVMA 4GKCA 3KFHA 1MUPA 4OS0A 3PH5A 5HAEA 1I06A 5LJKA 4YMYA 4NNTA 1GT1A 1T0VA 1KZXA 3SAOA 4ALBA 2Q2PA 3P6GA 3WJDA 2RD7C 2AT3X 1IW2A 5L8IA 4ZFXA 4RUNA 1PM1X 3HWGA 1LKEA 2JOZA 4NLIA 4YCEA 1ERXA 4TQ2A 1CBRA 4OMXA 3RZYA 1OEEA 1PMPA 1ZNKA 4IB7A 1OPAA 4GE1A 3C76X 3FA6A 1GX8A 1AB0A 5CE4A 3WXQA 2QO4A 5IO6A 3ZUOA 4AW8A 3D95A 5H9NA 1GXAA 1NGLA 1IFBA 3BSZE 2NNQA 4YFRA 3BDRA 4BQUA 4A1HA 2NP1A 1KT4A 3FA8A 3Q6LA 1E5PA 5JR8A 3APVA 4YBPA 1L6MA 2NNEA 2LBAA 1FE3A 2POAA 1QQSA 3FR5A 3P6EA 4AZOA 1EQDA 1KT7A 5B29A 4IB9A 5FENA 4IBAA 1G7NA 3ELXA 2AT6X 2ASNX 1QABE 4QZTA 4D6AA 2KTDA 1SXYA 4QGXA 3S26A 1GX9A 1EW3A 4M7MA 2IFBA 4QAEA 2AMMX 1PBOA 4TJZA 2A3FX 1YUPA 2ACPX 1JZUA 1RBPA 4ARHA 1ZNHA 4YKOA 2W2AA 2JU8A 1P6PA 4BVMA 1IIUA 1LIFA 3WJFA 3WJCA 1G74A 3IFBA 4A1YA 2Q9SA 1JYJA 1LNMA 5F1EA 2WEWA 1O8VA 3P6HA 4ORSA 3WJEA 3PPTA 1OEKA 2FWVA 3HWDA 4Y0SA 5EPQA 3I17A 4O9SA 4HPAA 5LJEA 1EIIA 2AL0X 1T68X 4ZJ0A 1BBPA 3TZSA 3PP6A 1YWDA 1SXUA 4GETA 1VYGA 5HCCC 1EPBA 1ZNDA 2WUTA 4A60A 1BJ7A 3B2IA 3B2HA 3FW5A 3KQ0A 1IKJA 1ALBA 2CM4A 4NYRA 1CBQA 3CWKA 2OVDA 2R56A 1EPAA 4Y0PA 4ZHDA 4QGWA 3KZAA 4IMOA 4MVIA 2GJ5A 1TOWA 1GT5A 1BSOA 3P6CA 2HNXA 2YG2A 1OEJA 3BU9A 1QFVA 1MVGA 2AKQA 3HWFA 3NQ3A 4I3CA 4MVLA 3HK1A 5HZQA 3FA9A 3D97A 1BRPA 1ZNEA 1DF3A 4OMWA 1R0UA 4ORUA
chains in the Genus database with same CATH superfamily
4QGVA 2FR2A 3APUA 5DPQA 3T6LA 1RAVA 4CPHA 5FFHA 2A5BA 2Y32A 2RTFB 1LUQA 2MO5A 4I9SA 1LPJA 4D6BA 3FR4A 3B2LA 3NADA 1GX3A 4QYNA 4QRLA 5F6BA 3WJGA 1IKEA 4YVBA 3VE2A 4ZCBA 4CPHB 3CBSA 5F58A 4TLJA 3ZWEA 1KXOA 4KC7A 2OFRX 1X8OA 4GZVA 1MX8A 2K23A 5JD2A 2LA7A 3BRNA 1JIWI 5EDBA 3ZW2A 3P6FA 1XKIA 2MM3A 2WQ9A 2LB6A 4R0BA 4PJ2A 4U46A 4YFPA 1QFTA 1HY2A 4MEEA 3RDSA 4OKAA 1X71A 2G8CO 4XMCA 2A5CA 3CQNA 1VWLB 2GTLO 1ACDA 4NYQA 3IA8A 2QM9A 4ZH6A 2HYSA 1VWGB 2IZJA 3HOEA 3ZI8A 2RTMA 1QY1A 1A18A 1D3SA 3C78X 4QNIA 2RTDB 1HMRA 4B55A 3TGAA 2BT9A 3FA7A 3QQ2A 2RTQB 3GAQA 2AH7X 3CKGA 3PDFA 4KCAA 4YBUA 3TGBA 3NX2A 3OD9A 4ON1A 4UU2A 1QY0A 2CZTA 2AF5A 3EW1A 4GH7A 4YGHA 4LZUA 2JU3A 1N4JA 1OBUA 1SMPI 2M4LA 2X46A 3JQOA 2FS6A 3KFFA 1MX7A 3MM0A 4MVEA 2O62A 5AEOA 5HA0A 5BVQA 4Y0RA 4O4OA 4Z2PA 3PQSA 1N9YA 3U03A 5LJGA 1LDQA 2XSTA 1IFCA 2R73A 2IZHB 1GT3A 4I3DA 4Z28A 3VHHA 2HMBA 3K3LA 5EEEA 3WZNA 3T2WA 3JSQA 5KIDA 1SWKA 2XKLA 5B5GA 1SA8A 4DQ4A 3STNA 1GKAA 1LELA 2RTOB 4AZRA 4BX5A 2W2FA 1AQBA 4UU3A 1HQPA 1S2PA 4DCBA 4IABA 3KVNA 3Q34A 3RSWA 4O3ZA 4JNJA 3SLJA 1YWAA 3T6FA 2VFCA 1SWRA 1Y52X 5CHKA 2GH7A 3X00A 4FBVA 1BEBA 1Z24A 5HA1A 1GKAB 4BX5B 5H8TA 3SZJA 3VG5A 1LF7A 4ODDA 3L4RA 5BVSA 2VFBA 2JN3A 5DG4A 4OS3A 2BS6A 3APXA 2X8FA 3PH6A 4Z2OA 2QO6A 1SWAA 4ZH9A 2X32A 4FBOA 1SRHA 1H91A 3ZQ3A 1SLEB 4AZMA 1OSPO 2FT9A 3FDCA 3VG3A 2G78A 3UEWA 4BBOA 1ICNA 2QOMA 3F8AA 5H9LA 2GC9A 1QWDA 1DV9A 3VG6A 1HXLA 2AT5X 1WBIA 3CKFA 3EM0A 1HXZA 4EEJA 5FQ6E 3BX8A 1KT5A 4YGZA 4GNYA 1CBSA 1SWHA 1TOUA 3AKNA 1I04A 3CBCA 1YP7A 4I9RA 4LZVA 3VHIA 2F73A 2ANSA 4XMGA 2RCQA 4ALOA 1KQWA 1Y55X 2IZLB 1SLDB 4IAXA 4WFVA 3JS1A 1X8PA 4CK4A 4ORRA 5HZ8A 2IZDB 2JW1A 2IZBA 3I0AA 1ERBA 2BHVA 4CDFA 1SREA 1TXLA 1ZNLA 1K24A 3WOVA 2A2GA 1KFFA 1TVQA 1JYDA 4EDEA 4NNSA 5KICA 1CRBA 1VWIB 4TNNA 3TF6A 3RDQA 1G5WA 4ZFXA 1JMZA 2LFOA 2RTGB 4RUUA 4WHIA 3VHMA 3ZZVA 1LCVA 2A13A 1HN2A 1BSQA 2GTLM 2G79A 2UYWA 2C1SA 3EW2A 4FGIB 4LKTA 1UREA 1PBYA 3VE1A 4GUZA 2OVSA 4DQ3A 1JJJA 2FHLA 1A2DA 2WPUA 2OY5O 5D47A 3V8UA 4BX7B 1SWSA 3FELA 4U9CA 3ZW0A 1SWDA 2F01A 5HZ6A 5LJBA 4Z6JA 4EXZA 4HPBA 4ID2A 3WJBA 5IO5A 2WR6A 1SLGB 1ICMA 1AVDA 3O22A 1KL5A 5FQ8E 1X89A 2RTPB 4GDZA 1FEMA 3ZUIA 1HMSA 2OY7A 3RY2A 2AVIA 2CBRA 1LCWA 2FGSA 3FYFA 1KT6A 1DZPA 4L3RA 5FAZA 3SZHA 2A8GA 2CM9A 2Q2MA 3CQRA 2JMBA 1AVEA 2X45A 4LQZA 4NV7A 1SRJA 4U3QA 2FS7A 2L5PA 3FEKA 1A57A 2CZUA 3RY1A 1KOIA 4MISA 2IZGB 1JJXA 4PSQA 2FTBA 5IRAA 4GD9A 1VYOA 2HLVA 2P8GA 2X4MA 3RDMA 3SLTA 3UEUA 5H9AA 2RTAA 2Q4NA 3CMPA 4N7CA 5EZ2A 1RSTB 2N93A 2X8TA 5FQ7E 3U9PC 1ML7A 1VWCB 4GRJA 2A2UA 3FEPA 3O19A 1KL4A 3FMZA 1NP1A 2BLGA 4YCHA 1MM9A 5BVTA 1YIVA 1JQPA 1EUOA 4O3YA 1E06A 2WQAE 3D4RA 3DSZA 5CYBA 1PEEA 3STMX 4U8UN 5D45A 5C0NA 4QZUA 4AZQA 1OBPA 5B5FA 3EMMA 1NQNA 1LFOA 4YDAA 2IZFB 3PEDA 1I4UA 3SOTA 4IMNA 3MVFA 1QY2A 3EBWA 4ZGFA 2IZKA 1Y9TA 4NV8A 5L8NA 3KFIA 3RWXA 3D96A 3VGWA 3NP1A 3CR6A 4GNWA 1VPRA 1E00A 5F6ZA 5K06A 1B4MA 2L67A 2LKKA 2I5VO 3G7XA 1ADLA 4O4SA 4ML7B 2DJFA 4AZNA 5HCDC 3QKGA 3HTYA 4O4XA 4JO6A 5IRUA 5LKFA 2GTFX 1FDQA 3O2YA 1EALA 3OJYC 1DZJA 5EDCA 2KT4B 1S7DA 3UEXA 2OZQA 1DFVA 2RA6A 1HBPA 3UEVA 3U0DA 1SWTA 5AJBA 2PI3O 1MDCA 1VWHB 1VWRB 2OF8A 4AZPA 5L3YA 2NNDA 3B2JA 4JHQA 4XMFA 2X34A 1SY2A 1JV4A 2L68A 2HZRA 2OY1O 1SY0A 5D4AA 3F9DA 1EIOA 2RTRB 3H3IA 3DTQA 4U8UO 3BLGA 4IB6A 3AKMA 2CBSA 1BRQA 1DF8A 2BSZA 4ORYA 4BCSA 5HZ5A 3TGCA 1KL3A 5HCEC 1CJ5A 1D2UA 1CBIA 2OL6O 4ZHHA 4YGGA 1VYFA 4GK9A 3BY0A 4YH0A 4BOEA 1FENA 3VG2A 4CDCA 1KT3A 4COTA 4ORXA 1NC9A 2W2BA 4WFUA 5B3MO 2DM5A 1EXSA 1SWJA 2ALLX 5F7GA 4JGLA 5KHPA 1LIBA 2RTCB 3BX7A 1ZRYA 5CSEA 2QCBA 4TKBA 2X8SA 4I6SA 1O1UA 5HWZA 2RTNB 2EU7X 2PY1A 1QG5A 1UZ2X 5IXGA 2ACOA 1G85A 1SRFA 2R74A 2YMSA 3APWA 4I3BA 1MEPA 3FENA 4FBRA 1BWYA 1X8NA 1EI5A 3HPEA 1S44A 2RTEB 1VWFB 2OFMX 3MBTA 1GGLA 4A8ZA 1LIDA 4HPDA 1U17A 4CPEA 4YFQA 1YWBA 2WWPA 4ZGUA 4KH8A 1FELA 1LICA 1DZMA 1SXWA 1A3YA 5F2BA 5HTEA 3EBKA 4GJVA 3WYPA 2FLJA 4ES7A 1Y9LA 1SXXA 2K62A 4QYPA 5B10O 3VPJE 1SWLA 2BS5A 3E3CA 5HBSA 5BYPA 5LJCA 2JU7A 2MF6A 2Q39A 4ORWA 2MJIA 1LIEA 2CAMA 4XMEA 3P24A 1W6FA 5LKEA 2FR3A 4TKJA 5D48A 4YKMA 2QO5A 1NP4A 2AT8X 5H9KA 1VWDB 2FRSA 4ZHGA 2OVAA 4GDAA 1VWOB 3WYQA 1O1VA 1SY3A 4CDDA 4BX7A 1U0XA 4KIIA 4TKHA 3STKA 1UYNX 1YWCA 1RXKA 1DC9A 3PQUA 4LKPA 2WSJA 4FQBB 2AT0X 2QOSC 1KQXA 5EEDA 4OELA 1SWFA 2OL7A 3FIQA 5IRWA 3FW4A 3HWEA 4MVKA 4XMDA 1B0OA 4Z27A 1X8QA 3ELZA 2X56A 3WZOA 5AQ6A 5B11O 3KFGA 2RQ0A 1BLRA 2E4JA 2WEXA 3P6DA 1B56A 5IO7A 3BS2A 3HOLA 1VWJB 4ZHCA 1BSYA 1TW4A 2VDFA 4CSBA 4IAWA 1SWBA 1MK5A 4NLJA 1SWUA 1FTPA 1LCZA 1U18A 2A0AA 4O4UA 4CPIA 1SWEA 1X8UA 1PTSA 1XCAA 2HZQA 3VG4A 5L8OA 4EKVA 4C5PA 1RLBE 1N43A 1B8EA 4N7DA 3NX1A 1SY1A 2G7BA 2C4IA 3SZIA 4XMHA 1STPA 2L9CA 3NPOA 1YP6A 3NQ9A 4HFOA 1MOYA 1E02A 4IB8A 3VU1A 1KGLA 4U8UM 3B2KA 1ZNGA 4NP1A 1NBXA 1HBQA 3C77X 1LDOA 5LJHA 1N0SA 3WBGA 4RUNA 1JBHA 1SWOA 5HZ9A 1DZKA 3N91A 4I60A 1HMTA 1W5RA 4K19A 1BM5A 2HKDA 2MWHA 2Z4IA 1T8VA 5D8JA 4Y0QA 5LJDA 3S60A 3MG5A 3T1DA 4OS8A 1JJUA 1SWPA 3BU1A 1OBQA 4EFGA 3MX7A 4WBKA 5HTDA 3FLLA 3LHNA 4M6SA 4KC8A 2LBVA 4BX6A 4ZHFA 5B27A 3EYCA 2RTBB 3GE2A 3FR2A 1GT4A 1SWGA 3RBYA 4YDBA 1OPBA 4AYHA 2OVEA 4GU8A 1AVGI 2OY8A 4ZR2A 2DJGA 3VG7A 1GM6A 2RCTA 1JMXA 3NR3A 4CPFA 2FKGA 1AELA 3PECA 4HPCA 1I05A 4BX6B 2UZ2A 3WVMA 4GKCA 3KFHA 1MUPA 4OS0A 3PH5A 5HAEA 1I06A 5LJKA 4YMYA 2BC3A 2ZAGA 4NNTA 1GT1A 3F6ZB 1T0VA 1KZXA 1IJ8A 3SAOA 2Q2PA 1Y53X 4I95A 4ALBA 3P6GA 3WJDA 2Y3EA 1I78A 2AT3X 1IW2A 2RD7C 3AUMO 5L8IA 4L1NA 4GGZA 1PM1X 3HWGA 1LKEA 3OE3A 2JOZA 4GGRA 4NLIA 2Z4HA 4GGTA 1ERXA 4YCEA 3WZPA 4TQ2A 1CBRA 2JGSA 2IZAA 4OMXA 2RTLA 3RZYA 1OEEA 1PMPA 1ZNKA 4IB7A 3RDOA 1OPAA 4GE1A 3C76X 2I5ZO 3FA6A 1GX8A 1AB0A 3S5VA 5CE4A 1NQMA 2FHNX 2QO4A 3WXQA 5IO6A 2ZAIA 2KD2A 4IRWA 3ZUOA 4AW8A 3D95A 5H9NA 2RTJA 4Y5DA 3RDXA 1GXAA 1NGLA 1IFBA 5K68A 3BSZE 2NNQA 1Y0GA 1RXHA 4BJ8A 3BDRA 4YFRA 5AJCA 2C1QA 4A1HA 2RN4A 4Y59A 4BQUA 2NP1A 1KT4A 3FA8A 3Q6LA 3NQKA 1E5PA 5JR8A 1STRB 1RXJA 3APVA 4YBPA 2IZIA 4MIRA 1L6MA 2NNEA 1RSUB 2LBAA 2OFAA 1FE3A 2POAA 1QQSA 3FR5A 3D9WA 3P6EA 4AZOA 1E2TA 1EQDA 1KT7A 5B29A 4HWMA 4IB9A 2OYBO 4BGFA 3RE5A 5FENA 2OL8O 4IBAA 1G7NA 4CDEA 1FJ1E 2KTSA 3ELXA 2AT6X 4Z2VA 4KT5A 4O3XB 2ASNX 3S5XA 2RTHB 2OFBA 1QABE 4QZTA 1SWCA 2ZSCA 3SLOA 4D6AA 2KTDA 1SXYA 4QGXA 3WZQA 3S26A 3AEHA 2IZCB 1GX9A 1EW3A 2QMIA 1VWNB 4M7MA 2IFBA 4QAEA 2AMMX 1PBOA 3EC5A 4TJZA 2A3FX 1YUPA 2ACPX 3RKGA 1JZUA 1RBPA 3RE6A 4ARHA 1VWMB 1K3BA 1ZNHA 4YKOA 2W2AA 2JU8A 1P6PA 4BVMA 1IIUA 1LIFA 3WJFA 3WJCA 2MHDA 3OBLA 2RTIB 1G74A 4CV7A 3IFBA 1VWPB 1VWBB 2FKJA 4A1YA 2Q9SA 1JYJA 1LNMA 2G5LA 1SWQA 5F1EA 2WEWA 1N9MA 1O8VA 5B2AO 4OEMA 3P02A 2KW1A 3P6HA 4ORSA 2OF9A 3WJEA 3PK2A 3PPTA 1OEKA 2FWVA 3HWDA 4Y0SA 5EPQA 3I17A 3LTWA 4O9SA 4HPAA 3T2XA 5LJEA 1EIIA 2RTKA 2AL0X 1T68X 1W4TA 4ZJ0A 1BBPA 4NW4A 3PP6A 4O3WA 3ZW1A 1HQQA 3TZSA 1YWDA 3UAQA 1SXUA 4GETA 4INNA 1VYGA 1I9HA 2Y3FA 1EPBA 5HCCC 1ZNDA 2WUTA 4A60A 1BJ7A 1VWEB 1VWAB 3B2HA 3B2IA 3FW5A 1IKJA 1ALBA 2CM4A 3KQ0A 4NYRA 4EQAC 1KZWA 1CBQA 3CWKA 3ZW1B 1VWKB 2OVDA 1STSB 1WUBA 4GJSA 2R56A 1EPAA 4Y0PA 4ZHDA 4QGWA 3KZAA 1SWNA 4IMOA 1SLFB 3NBXX 4MVIA 4QQ1A 2GJ5A 1TOWA 3RDUA 1GT5A 1BSOA 2F09A 1N7YA 3LV4A 3P6CA 2HNXA 1UYOX 2YG2A 5K67A 3FIDA 1OEJA 3BU9A 1QFVA 1MVGA 1NDJA 1VWQB 2AKQA 3HWFA 4O49A 3NQ3A 4I3CA 2GTLN 1SRGA 1SRIA 4DNEA 4MVLA 3HK1A 2IZEB 5HZQA 3ZW0B 3FA9A 3D97A 2X55A 1BRPA 1ZNEA 1DF3A 4OMWA 1R0UA 4ORUA
chains in the Genus database with same CATH topology
4QGVA 2FR2A 3APUA 5DPQA 5FFHA 2MO5A 4I9SA 1LPJA 4D6BA 3FR4A 3B2LA 3NADA 4QYNA 4QRLA 5F6BA 3WJGA 1IKEA 3VE2A 4ZCBA 3CBSA 5F58A 4TLJA 3ZWEA 1KXOA 4KC7A 2OFRX 1X8OA 4GZVA 1MX8A 2K23A 2LA7A 3BRNA 1JIWI 5EDBA 3ZW2A 3P6FA 1XKIA 2MM3A 2WQ9A 2LB6A 4R0BA 4PJ2A 4YFPA 1QFTA 4XMCA 1X71A 3CQNA 2GTLO 1ACDA 4NYQA 3IA8A 2QM9A 4ZH6A 2HYSA 3HOEA 4ES7A 3ZI8A 1QY1A 1A18A 1D3SA 3C78X 4QNIA 1HMRA 3TGAA 2BT9A 3FA7A 3GAQA 2AH7X 3TGBA 4KCAA 3NX2A 3OD9A 4ON1A 4UU2A 1QY0A 2CZTA 4GH7A 4YGHA 4LZUA 2JU3A 4FGIB 1OBUA 1SMPI 2M4LA 2X46A 3JQOA 2FS6A 3KFFA 1MX7A 4MVEA 5AEOA 2O62A 5HA0A 5BVQA 4Y0RA 4O4OA 3PQSA 3U03A 5LJGA 2XSTA 1IFCA 2R73A 1GT3A 4I3DA 2HMBA 3K3LA 5EEEA 3JSQA 5KIDA 2XKLA 1SA8A 4DQ4A 3STNA 1GKAA 4AZRA 2W2FA 1AQBA 4UU3A 1HQPA 1S2PA 4IABA 3RSWA 4O3ZA 1YWAA 4FBVA 1BEBA 1Z24A 5HA1A 1GKAB 5H8TA 3VG5A 1LF7A 4ODDA 3L4RA 5BVSA 2JN3A 5DG4A 4OS3A 2BS6A 3APXA 2X8FA 3PH6A 2QO6A 4ZH9A 4FBOA 1H91A 3ZQ3A 4AZMA 2FT9A 3VG3A 2G78A 3UEWA 1ICNA 3F8AA 5H9LA 2GC9A 1QWDA 1DV9A 3VG6A 2AT5X 3EM0A 4EEJA 5FQ6E 3BX8A 1KT5A 4YGZA 4GNYA 1CBSA 3CBCA 1TOUA 3AKNA 1I04A 4I9RA 1YP7A 4LZVA 2F73A 2ANSA 4XMGA 2RCQA 4ALOA 1KQWA 4WFVA 4IAXA 3JS1A 1X8PA 4CK4A 4ORRA 5HZ8A 2JW1A 3I0AA 1ERBA 2BHVA 1TXLA 1ZNLA 3WOVA 2A2GA 1TVQA 1JYDA 4EDEA 4NNSA 5KICA 1CRBA 4TNNA 3TF6A 2LFOA 4WHIA 4RUUA 3ZZVA 2A13A 1HN2A 1BSQA 2GTLM 2G79A 4LKTA 4YBUA 4DQ3A 5K06A 1KZWA 1UREA 3VE1A 2OVSA 1JJJA 1A2DA 5D47A 3V8UA 3FELA 4U9CA 3ZW0A 5HZ6A 5LJBA 4EXZA 4HPBA 4ID2A 3WJBA 5IO5A 2WR6A 1ICMA 3O22A 5FQ8E 1X89A 4GDZA 1FEMA 3ZUIA 1HMSA 2CBRA 3FYFA 1KT6A 1DZPA 4L3RA 5FAZA 2Q2MA 2CM9A 3CQRA 2JMBA 2X45A 4LQZA 4U3QA 1A57A 2FS7A 2L5PA 3FEKA 2CZUA 1KOIA 4MISA 1JJXA 4PSQA 2FTBA 2HLVA 2P8GA 3UEUA 5H9AA 2Q4NA 3CMPA 4N7CA 5EZ2A 2N93A 2X8TA 5FQ7E 3U9PC 1ML7A 4GRJA 2A2UA 3FEPA 3O19A 4YCHA 3FMZA 1NP1A 2BLGA 5BVTA 1YIVA 1EUOA 4O3YA 1E06A 2WQAE 3D4RA 3DSZA 5CYBA 1PEEA 3STMX 4U8UN 5D45A 5C0NA 4QZUA 4AZQA 1OBPA 3EMMA 1LFOA 4YDAA 3PEDA 3SOTA 1I4UA 4IMNA 3MVFA 1QY2A 3EBWA 4ZGFA 1Y9TA 5L8NA 3KFIA 3RWXA 3D96A 3NP1A 3CR6A 4GNWA 1VPRA 1E00A 5F6ZA 1B4MA 2L67A 2LKKA 3G7XA 4O4SA 1ADLA 4AZNA 4ML7B 5HCDC 3QKGA 3HTYA 4O4XA 5LKFA 2GTFX 1FDQA 3O2YA 1EALA 3OJYC 1DZJA 5EDCA 2KT4B 1S7DA 3UEXA 2OZQA 1DFVA 2RA6A 1HBPA 3UEVA 3U0DA 5AJBA 1MDCA 4AZPA 2NNDA 3B2JA 4XMFA 1SY2A 1JV4A 2L68A 2HZRA 1SY0A 5D4AA 3F9DA 1EIOA 3H3IA 3DTQA 4U8UO 3BLGA 4IB6A 3AKMA 2CBSA 1BRQA 4ORYA 5HZ5A 3TGCA 5HCEC 1CJ5A 1D2UA 1CBIA 4ZHHA 4YGGA 1VYFA 4GK9A 3BY0A 4YH0A 4BOEA 1FENA 3VG2A 1KT3A 4COTA 4ORXA 2W2BA 4WFUA 2DM5A 1EXSA 2ALLX 5F7GA 4JGLA 5KHPA 1LIBA 3BX7A 1ZRYA 4TKBA 2X8SA 4I6SA 1O1UA 5HWZA 2EU7X 2PY1A 1QG5A 1UZ2X 2ACOA 1G85A 2R74A 2YMSA 3APWA 4I3BA 4FBRA 1BWYA 3FENA 1X8NA 1EI5A 1S44A 2OFMX 3MBTA 1GGLA 4A8ZA 1LIDA 4HPDA 1U17A 4ZGUA 4YFQA 1YWBA 2WWPA 4KH8A 1FELA 1LICA 1DZMA 1SXWA 1A3YA 5HTEA 3EBKA 2FLJA 1Y9LA 1SXXA 2K62A 4QYPA 3VPJE 5LJCA 2BS5A 3E3CA 5HBSA 2JU7A 2Q39A 4ORWA 2MJIA 1LIEA 4XMEA 3P24A 5LKEA 2FR3A 4TKJA 5D48A 4YKMA 2QO5A 1NP4A 2AT8X 5H9KA 2FRSA 4ZHGA 2OVAA 1G5WA 1O1VA 1SY3A 1U0XA 4KIIA 4TKHA 3STKA 1YWCA 4LKPA 3PQUA 1DC9A 2WSJA 4FQBB 2AT0X 2QOSC 1KQXA 5EEDA 3FIQA 3FW4A 3HWEA 4MVKA 4XMDA 1B0OA 1X8QA 3ELZA 5AQ6A 3KFGA 2RQ0A 1BLRA 2E4JA 2WEXA 3P6DA 1B56A 5IO7A 3BS2A 3HOLA 4ZHCA 1BSYA 1TW4A 4CSBA 4IAWA 4NLJA 4O4UA 1FTPA 1U18A 2A0AA 5BYPA 5L8OA 1X8UA 1XCAA 3VG4A 2HZQA 1RLBE 1B8EA 4N7DA 3NX1A 1SY1A 2G7BA 4XMHA 4HFOA 2L9CA 3NPOA 1YP6A 3NQ9A 4IB8A 3VU1A 1E02A 1KGLA 4U8UM 3B2KA 1ZNGA 4NP1A 1HBQA 3C77X 5LJHA 1N0SA 3WBGA 1JBHA 5HZ9A 1DZKA 3N91A 1HMTA 4K19A 1BM5A 2MWHA 2Z4IA 1T8VA 5D8JA 4Y0QA 5LJDA 3S60A 3T1DA 4OS8A 3BU1A 1OBQA 4EFGA 3MX7A 4WBKA 5HTDA 3FLLA 3LHNA 4M6SA 4KC8A 2LBVA 4ZHFA 5B27A 3EYCA 3GE2A 3FR2A 1GT4A 3RBYA 4YDBA 1OPBA 4AYHA 2OVEA 4GU8A 1AVGI 4ZR2A 3VG7A 1GM6A 2RCTA 3NR3A 1AELA 3PECA 4HPCA 1I05A 3WVMA 4GKCA 3KFHA 1MUPA 4OS0A 3PH5A 5HAEA 1I06A 5LJKA 4YMYA 2ZAGA 4NNTA 1GT1A 3F6ZB 1T0VA 1KZXA 3SAOA 4ALBA 2Q2PA 4I95A 3P6GA 3WJDA 2RD7C 2AT3X 1IW2A 5L8IA 4L1NA 4RUNA 1PM1X 3HWGA 1LKEA 3OE3A 2JOZA 4NLIA 4ZFXA 2Z4HA 4YCEA 1ERXA 4TQ2A 1CBRA 4OMXA 3RZYA 1OEEA 1PMPA 1ZNKA 4IB7A 1OPAA 4GE1A 3C76X 3FA6A 1GX8A 1AB0A 3S5VA 5CE4A 3WXQA 2QO4A 5IO6A 2ZAIA 2KD2A 3ZUOA 4AW8A 3D95A 5H9NA 1GXAA 1NGLA 1IFBA 3BSZE 2NNQA 4YFRA 3BDRA 5AJCA 4BQUA 4A1HA 2RN4A 2NP1A 1KT4A 3FA8A 3Q6LA 3NQKA 1E5PA 5JR8A 3APVA 4YBPA 4MIRA 1L6MA 2NNEA 2LBAA 1FE3A 2POAA 1QQSA 3FR5A 3P6EA 4AZOA 1EQDA 1KT7A 5B29A 4HWMA 4IB9A 5FENA 4IBAA 1G7NA 2KTSA 3ELXA 2AT6X 4KT5A 4O3XB 2ASNX 3S5XA 1QABE 4QZTA 4D6AA 2KTDA 1SXYA 4QGXA 3S26A 1GX9A 1EW3A 2QMIA 4M7MA 2IFBA 4QAEA 2AMMX 1PBOA 4TJZA 2A3FX 1YUPA 2ACPX 3RKGA 1JZUA 1RBPA 4ARHA 1ZNHA 4YKOA 2W2AA 2JU8A 1P6PA 4BVMA 1IIUA 1LIFA 3WJFA 3WJCA 2MHDA 3OBLA 1G74A 4CV7A 3IFBA 4A1YA 2Q9SA 1JYJA 1LNMA 5F1EA 2WEWA 1O8VA 3P02A 2KW1A 3P6HA 4ORSA 3WJEA 3PPTA 1OEKA 2FWVA 3HWDA 4Y0SA 5EPQA 3I17A 4O9SA 4HPAA 5LJEA 1EIIA 2AL0X 1T68X 4ZJ0A 1BBPA 4NW4A 3PP6A 4O3WA 3ZW1A 3TZSA 1YWDA 3UAQA 1SXUA 4GETA 4INNA 1VYGA 5HCCC 1EPBA 1ZNDA 2WUTA 4A60A 1BJ7A 3B2IA 3B2HA 3FW5A 3KQ0A 1IKJA 1ALBA 2CM4A 4EQAC 4NYRA 1CBQA 3CWKA 3ZW1B 2OVDA 2R56A 1EPAA 4Y0PA 4ZHDA 4QGWA 3KZAA 4IMOA 3NBXX 4MVIA 4QQ1A 2GJ5A 1TOWA 1GT5A 1BSOA 2F09A 3LV4A 3P6CA 2HNXA 2YG2A 1OEJA 3BU9A 1QFVA 1MVGA 2AKQA 3HWFA 4O49A 3NQ3A 4I3CA 2GTLN 4MVLA 3HK1A 5HZQA 3ZW0B 3FA9A 3D97A 1BRPA 1ZNEA 1DF3A 4OMWA 1R0UA 4ORUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QGV A;  2FR2 A;  3APU A;  5DPQ A;  5FFH A;  2MO5 A;  4I9S A;  1LPJ A;  4D6B A;  3FR4 A;  3B2L A;  3NAD A;  4QYN A;  5F6B A;  3WJG A;  1IKE A;  4ZCB A;  3CBS A;  5F58 A;  4TLJ A;  1KXO A;  2OFR X;  1X8O A;  1MX8 A;  2K23 A;  3BRN A;  5EDB A;  3P6F A;  1XKI A;  2MM3 A;  2WQ9 A;  2LB6 A;  4R0B A;  4YFP A;  1QFT A;  4XMC A;  1X71 A;  3CQN A;  1ACD A;  4NYQ A;  3IA8 A;  2QM9 A;  4ZH6 A;  2HYS A;  4ES7 A;  1QY1 A;  1A18 A;  1D3S A;  3C78 X;  1HMR A;  3TGA A;  3FA7 A;  3GAQ A;  2AH7 X;  3TGB A;  3NX2 A;  4UU2 A;  1QY0 A;  2CZT A;  4GH7 A;  4YGH A;  4LZU A;  2JU3 A;  1OBU A;  2X46 A;  3KFF A;  2FS6 A;  1MX7 A;  2O62 A;  5HA0 A;  5BVQ A;  4Y0R A;  3U03 A;  5LJG A;  2XST A;  1IFC A;  2R73 A;  1GT3 A;  4I3D A;  2HMB A;  3K3L A;  5EEE A;  3JSQ A;  5KID A;  2XKL A;  1SA8 A;  4DQ4 A;  3STN A;  1GKA A;  4AZR A;  2W2F A;  1AQB A;  4UU3 A;  1HQP A;  1S2P A;  3RSW A;  1YWA A;  5HA1 A;  1BEB A;  1Z24 A;  1GKA B;  5H8T A;  3VG5 A;  1LF7 A;  4ODD A;  3L4R A;  5BVS A;  2JN3 A;  5DG4 A;  4OS3 A;  3APX A;  3PH6 A;  2QO6 A;  4ZH9 A;  1H91 A;  3ZQ3 A;  4AZM A;  2FT9 A;  3VG3 A;  2G78 A;  3UEW A;  1ICN A;  3F8A A;  5H9L A;  2GC9 A;  1QWD A;  1DV9 A;  3VG6 A;  2AT5 X;  3EM0 A;  4EEJ A;  3BX8 A;  1KT5 A;  4YGZ A;  4GNY A;  1CBS A;  3CBC A;  1TOU A;  3AKN A;  1I04 A;  4I9R A;  1YP7 A;  4LZV A;  2F73 A;  2ANS A;  4XMG A;  2RCQ A;  4ALO A;  1KQW A;  4WFV A;  4IAX A;  3JS1 A;  1X8P A;  4CK4 A;  4ORR A;  5HZ8 A;  3I0A A;  1ERB A;  1TXL A;  1ZNL A;  2A2G A;  1TVQ A;  1JYD A;  4EDE A;  4NNS A;  5KIC A;  1CRB A;  4TNN A;  3TF6 A;  2LFO A;  4RUU A;  2A13 A;  1HN2 A;  1BSQ A;  4LKT A;  2G79 A;  4YBU A;  5K06 A;  4DQ3 A;  1KZW A;  1URE A;  1JJJ A;  1A2D A;  5D47 A;  3FEL A;  5HZ6 A;  5LJB A;  4EXZ A;  4HPB A;  3WJB A;  5IO5 A;  2WR6 A;  1ICM A;  3O22 A;  1X89 A;  1FEM A;  3ZUI A;  1HMS A;  2CBR A;  1KT6 A;  1DZP A;  5FAZ A;  2Q2M A;  2CM9 A;  3CQR A;  2X45 A;  1A57 A;  2FS7 A;  2L5P A;  3FEK A;  2CZU A;  1KOI A;  1JJX A;  4PSQ A;  2FTB A;  2HLV A;  2P8G A;  3UEU A;  5H9A A;  2Q4N A;  3CMP A;  4N7C A;  5EZ2 A;  2N93 A;  3U9P C;  1ML7 A;  4GRJ A;  2A2U A;  3FEP A;  3O19 A;  4YCH A;  3FMZ A;  1NP1 A;  2BLG A;  5BVT A;  1YIV A;  1EUO A;  1E06 A;  2WQA E;  3STM X;  3DSZ A;  1PEE A;  5D45 A;  5C0N A;  4QZU A;  4AZQ A;  1OBP A;  3EMM A;  1LFO A;  4YDA A;  3PED A;  1I4U A;  4IMN A;  3MVF A;  1QY2 A;  3EBW A;  5L8N A;  3KFI A;  3D96 A;  3NP1 A;  3CR6 A;  4GNW A;  1VPR A;  1E00 A;  5F6Z A;  1B4M A;  2L67 A;  2LKK A;  3G7X A;  4AZN A;  1ADL A;  5HCD C;  3QKG A;  5LKF A;  2GTF X;  1FDQ A;  3O2Y A;  1EAL A;  3OJY C;  1DZJ A;  5EDC A;  2KT4 B;  1S7D A;  3UEX A;  2OZQ A;  1DFV A;  2RA6 A;  1HBP A;  3UEV A;  3U0D A;  1MDC A;  4AZP A;  2NND A;  3B2J A;  4XMF A;  1SY2 A;  1JV4 A;  2L68 A;  2HZR A;  1SY0 A;  5D4A A;  3F9D A;  1EIO A;  3DTQ A;  3BLG A;  4IB6 A;  3AKM A;  2CBS A;  1BRQ A;  4ORY A;  5HZ5 A;  3TGC A;  5HCE C;  1CJ5 A;  1D2U A;  1CBI A;  4ZHH A;  4YGG A;  1VYF A;  3BY0 A;  4YH0 A;  4BOE A;  1FEN A;  3VG2 A;  1KT3 A;  4ORX A;  2W2B A;  4WFU A;  2DM5 A;  1EXS A;  2ALL X;  5F7G A;  5KHP A;  1LIB A;  3BX7 A;  1ZRY A;  4TKB A;  5HWZ A;  1O1U A;  2EU7 X;  2PY1 A;  1QG5 A;  1UZ2 X;  2ACO A;  1G85 A;  2R74 A;  4I3B A;  3APW A;  1BWY A;  3FEN A;  1X8N A;  1S44 A;  2OFM X;  3MBT A;  1GGL A;  4A8Z A;  1LID A;  4HPD A;  1U17 A;  4ZGU A;  4YFQ A;  1YWB A;  2WWP A;  1FEL A;  1LIC A;  1DZM A;  1SXW A;  1A3Y A;  5HTE A;  3EBK A;  2FLJ A;  4QYP A;  1SXX A;  2K62 A;  5LJC A;  5HBS A;  2JU7 A;  2Q39 A;  4ORW A;  2MJI A;  1LIE A;  4XME A;  5LKE A;  2FR3 A;  4TKJ A;  5D48 A;  4YKM A;  2QO5 A;  1NP4 A;  2AT8 X;  5H9K A;  2FRS A;  4ZHG A;  2OVA A;  1G5W A;  1O1V A;  1SY3 A;  1U0X A;  4KII A;  4TKH A;  3STK A;  1YWC A;  4LKP A;  1DC9 A;  2WSJ A;  2AT0 X;  2QOS C;  1KQX A;  5EED A;  3FIQ A;  3FW4 A;  3HWE A;  4MVK A;  4XMD A;  1B0O A;  1X8Q A;  3ELZ A;  5AQ6 A;  3KFG A;  2RQ0 A;  1BLR A;  2E4J A;  2WEX A;  3P6D A;  1B56 A;  5IO7 A;  3BS2 A;  4ZHC A;  1BSY A;  1TW4 A;  4IAW A;  4NLJ A;  1FTP A;  1U18 A;  2A0A A;  5L8O A;  1X8U A;  1XCA A;  3VG4 A;  2HZQ A;  1RLB E;  1B8E A;  4N7D A;  3NX1 A;  1SY1 A;  2G7B A;  4XMH A;  4HFO A;  2L9C A;  3NPO A;  1YP6 A;  3NQ9 A;  4IB8 A;  1KGL A;  1E02 A;  3B2K A;  1ZNG A;  4NP1 A;  1HBQ A;  3C77 X;  5LJH A;  1N0S A;  3WBG A;  1JBH A;  5HZ9 A;  1DZK A;  1HMT A;  4K19 A;  1BM5 A;  5D8J A;  5LJD A;  1T8V A;  3T1D A;  4Y0Q A;  4OS8 A;  3BU1 A;  1OBQ A;  4EFG A;  4WBK A;  5HTD A;  3FLL A;  4M6S A;  2LBV A;  4ZHF A;  5B27 A;  3EYC A;  3FR2 A;  1GT4 A;  4YDB A;  1OPB A;  4AYH A;  2OVE A;  1AVG I;  4ZR2 A;  3VG7 A;  1GM6 A;  2RCT A;  3NR3 A;  1AEL A;  3PEC A;  4HPC A;  1I05 A;  3WVM A;  4GKC A;  3KFH A;  1MUP A;  4OS0 A;  3PH5 A;  5HAE A;  1I06 A;  5LJK A;  4YMY A;  4NNT A;  1GT1 A;  1T0V A;  1KZX A;  3SAO A;  4ALB A;  2Q2P A;  3P6G A;  3WJD A;  2RD7 C;  2AT3 X;  1IW2 A;  5L8I A;  4ZFX A;  4RUN A;  1PM1 X;  3HWG A;  1LKE A;  2JOZ A;  4NLI A;  4YCE A;  1ERX A;  4TQ2 A;  1CBR A;  4OMX A;  3RZY A;  1OEE A;  1PMP A;  1ZNK A;  4IB7 A;  1OPA A;  4GE1 A;  3C76 X;  3FA6 A;  1GX8 A;  1AB0 A;  5CE4 A;  3WXQ A;  2QO4 A;  5IO6 A;  3ZUO A;  4AW8 A;  3D95 A;  5H9N A;  1GXA A;  1NGL A;  1IFB A;  3BSZ E;  2NNQ A;  4YFR A;  3BDR A;  4BQU A;  4A1H A;  2NP1 A;  1KT4 A;  3FA8 A;  3Q6L A;  1E5P A;  5JR8 A;  3APV A;  4YBP A;  1L6M A;  2NNE A;  2LBA A;  1FE3 A;  2POA A;  1QQS A;  3FR5 A;  3P6E A;  4AZO A;  1EQD A;  1KT7 A;  5B29 A;  4IB9 A;  5FEN A;  4IBA A;  1G7N A;  3ELX A;  2AT6 X;  2ASN X;  1QAB E;  4QZT A;  4D6A A;  2KTD A;  1SXY A;  4QGX A;  3S26 A;  1GX9 A;  1EW3 A;  4M7M A;  2IFB A;  4QAE A;  2AMM X;  1PBO A;  4TJZ A;  2A3F X;  1YUP A;  2ACP X;  1JZU A;  1RBP A;  4ARH A;  1ZNH A;  4YKO A;  2W2A A;  2JU8 A;  1P6P A;  4BVM A;  1IIU A;  1LIF A;  3WJF A;  3WJC A;  1G74 A;  3IFB A;  4A1Y A;  2Q9S A;  1JYJ A;  1LNM A;  5F1E A;  2WEW A;  1O8V A;  3P6H A;  4ORS A;  3WJE A;  3PPT A;  1OEK A;  2FWV A;  3HWD A;  4Y0S A;  5EPQ A;  3I17 A;  4O9S A;  4HPA A;  5LJE A;  1EII A;  2AL0 X;  1T68 X;  4ZJ0 A;  1BBP A;  3TZS A;  3PP6 A;  1YWD A;  1SXU A;  4GET A;  1VYG A;  5HCC C;  1EPB A;  1ZND A;  2WUT A;  4A60 A;  1BJ7 A;  3B2I A;  3B2H A;  3FW5 A;  3KQ0 A;  1IKJ A;  1ALB A;  2CM4 A;  4NYR A;  1CBQ A;  3CWK A;  2OVD A;  2R56 A;  1EPA A;  4Y0P A;  4ZHD A;  4QGW A;  3KZA A;  4IMO A;  4MVI A;  2GJ5 A;  1TOW A;  1GT5 A;  1BSO A;  3P6C A;  2HNX A;  2YG2 A;  1OEJ A;  3BU9 A;  1QFV A;  1MVG A;  2AKQ A;  3HWF A;  3NQ3 A;  4I3C A;  4MVL A;  3HK1 A;  5HZQ A;  3FA9 A;  3D97 A;  1BRP A;  1ZNE A;  1DF3 A;  4OMW A;  1R0U A;  4ORU A; 
#chains in the Genus database with same CATH topology
 4QGV A;  2FR2 A;  3APU A;  5DPQ A;  3T6L A;  1RAV A;  4CPH A;  5FFH A;  2A5B A;  2Y32 A;  2RTF B;  1LUQ A;  2MO5 A;  4I9S A;  1LPJ A;  4D6B A;  3FR4 A;  3B2L A;  3NAD A;  1GX3 A;  4QYN A;  4QRL A;  5F6B A;  3WJG A;  1IKE A;  4YVB A;  3VE2 A;  4ZCB A;  4CPH B;  3CBS A;  5F58 A;  4TLJ A;  3ZWE A;  1KXO A;  4KC7 A;  2OFR X;  1X8O A;  4GZV A;  1MX8 A;  2K23 A;  5JD2 A;  2LA7 A;  3BRN A;  1JIW I;  5EDB A;  3ZW2 A;  3P6F A;  1XKI A;  2MM3 A;  2WQ9 A;  2LB6 A;  4R0B A;  4PJ2 A;  4U46 A;  4YFP A;  1QFT A;  1HY2 A;  4MEE A;  3RDS A;  4OKA A;  1X71 A;  2G8C O;  4XMC A;  2A5C A;  3CQN A;  1VWL B;  2GTL O;  1ACD A;  4NYQ A;  3IA8 A;  2QM9 A;  4ZH6 A;  2HYS A;  1VWG B;  2IZJ A;  3HOE A;  3ZI8 A;  2RTM A;  1QY1 A;  1A18 A;  1D3S A;  3C78 X;  4QNI A;  2RTD B;  1HMR A;  4B55 A;  3TGA A;  2BT9 A;  3FA7 A;  3QQ2 A;  2RTQ B;  3GAQ A;  2AH7 X;  3CKG A;  3PDF A;  4KCA A;  4YBU A;  3TGB A;  3NX2 A;  3OD9 A;  4ON1 A;  4UU2 A;  1QY0 A;  2CZT A;  2AF5 A;  3EW1 A;  4GH7 A;  4YGH A;  4LZU A;  2JU3 A;  1N4J A;  1OBU A;  1SMP I;  2M4L A;  2X46 A;  3JQO A;  2FS6 A;  3KFF A;  1MX7 A;  3MM0 A;  4MVE A;  2O62 A;  5AEO A;  5HA0 A;  5BVQ A;  4Y0R A;  4O4O A;  4Z2P A;  3PQS A;  1N9Y A;  3U03 A;  5LJG A;  1LDQ A;  2XST A;  1IFC A;  2R73 A;  2IZH B;  1GT3 A;  4I3D A;  4Z28 A;  3VHH A;  2HMB A;  3K3L A;  5EEE A;  3WZN A;  3T2W A;  3JSQ A;  5KID A;  1SWK A;  2XKL A;  5B5G A;  1SA8 A;  4DQ4 A;  3STN A;  1GKA A;  1LEL A;  2RTO B;  4AZR A;  4BX5 A;  2W2F A;  1AQB A;  4UU3 A;  1HQP A;  1S2P A;  4DCB A;  4IAB A;  3KVN A;  3Q34 A;  3RSW A;  4O3Z A;  4JNJ A;  3SLJ A;  1YWA A;  3T6F A;  2VFC A;  1SWR A;  1Y52 X;  5CHK A;  2GH7 A;  3X00 A;  4FBV A;  1BEB A;  1Z24 A;  5HA1 A;  1GKA B;  4BX5 B;  5H8T A;  3SZJ A;  3VG5 A;  1LF7 A;  4ODD A;  3L4R A;  5BVS A;  2VFB A;  2JN3 A;  5DG4 A;  4OS3 A;  2BS6 A;  3APX A;  2X8F A;  3PH6 A;  4Z2O A;  2QO6 A;  1SWA A;  4ZH9 A;  2X32 A;  4FBO A;  1SRH A;  1H91 A;  3ZQ3 A;  1SLE B;  4AZM A;  1OSP O;  2FT9 A;  3FDC A;  3VG3 A;  2G78 A;  3UEW A;  4BBO A;  1ICN A;  2QOM A;  3F8A A;  5H9L A;  2GC9 A;  1QWD A;  1DV9 A;  3VG6 A;  1HXL A;  2AT5 X;  1WBI A;  3CKF A;  3EM0 A;  1HXZ A;  4EEJ A;  5FQ6 E;  3BX8 A;  1KT5 A;  4YGZ A;  4GNY A;  1CBS A;  1SWH A;  1TOU A;  3AKN A;  1I04 A;  3CBC A;  1YP7 A;  4I9R A;  4LZV A;  3VHI A;  2F73 A;  2ANS A;  4XMG A;  2RCQ A;  4ALO A;  1KQW A;  1Y55 X;  2IZL B;  1SLD B;  4IAX A;  4WFV A;  3JS1 A;  1X8P A;  4CK4 A;  4ORR A;  5HZ8 A;  2IZD B;  2JW1 A;  2IZB A;  3I0A A;  1ERB A;  2BHV A;  4CDF A;  1SRE A;  1TXL A;  1ZNL A;  1K24 A;  3WOV A;  2A2G A;  1KFF A;  1TVQ A;  1JYD A;  4EDE A;  4NNS A;  5KIC A;  1CRB A;  1VWI B;  4TNN A;  3TF6 A;  3RDQ A;  1G5W A;  4ZFX A;  1JMZ A;  2LFO A;  2RTG B;  4RUU A;  4WHI A;  3VHM A;  3ZZV A;  1LCV A;  2A13 A;  1HN2 A;  1BSQ A;  2GTL M;  2G79 A;  2UYW A;  2C1S A;  3EW2 A;  4FGI B;  4LKT A;  1URE A;  1PBY A;  3VE1 A;  4GUZ A;  2OVS A;  4DQ3 A;  1JJJ A;  2FHL A;  1A2D A;  2WPU A;  2OY5 O;  5D47 A;  3V8U A;  4BX7 B;  1SWS A;  3FEL A;  4U9C A;  3ZW0 A;  1SWD A;  2F01 A;  5HZ6 A;  5LJB A;  4Z6J A;  4EXZ A;  4HPB A;  4ID2 A;  3WJB A;  5IO5 A;  2WR6 A;  1SLG B;  1ICM A;  1AVD A;  3O22 A;  1KL5 A;  5FQ8 E;  1X89 A;  2RTP B;  4GDZ A;  1FEM A;  3ZUI A;  1HMS A;  2OY7 A;  3RY2 A;  2AVI A;  2CBR A;  1LCW A;  2FGS A;  3FYF A;  1KT6 A;  1DZP A;  4L3R A;  5FAZ A;  3SZH A;  2A8G A;  2CM9 A;  2Q2M A;  3CQR A;  2JMB A;  1AVE A;  2X45 A;  4LQZ A;  4NV7 A;  1SRJ A;  4U3Q A;  2FS7 A;  2L5P A;  3FEK A;  1A57 A;  2CZU A;  3RY1 A;  1KOI A;  4MIS A;  2IZG B;  1JJX A;  4PSQ A;  2FTB A;  5IRA A;  4GD9 A;  1VYO A;  2HLV A;  2P8G A;  2X4M A;  3RDM A;  3SLT A;  3UEU A;  5H9A A;  2RTA A;  2Q4N A;  3CMP A;  4N7C A;  5EZ2 A;  1RST B;  2N93 A;  2X8T A;  5FQ7 E;  3U9P C;  1ML7 A;  1VWC B;  4GRJ A;  2A2U A;  3FEP A;  3O19 A;  1KL4 A;  3FMZ A;  1NP1 A;  2BLG A;  4YCH A;  1MM9 A;  5BVT A;  1YIV A;  1JQP A;  1EUO A;  4O3Y A;  1E06 A;  2WQA E;  3D4R A;  3DSZ A;  5CYB A;  1PEE A;  3STM X;  4U8U N;  5D45 A;  5C0N A;  4QZU A;  4AZQ A;  1OBP A;  5B5F A;  3EMM A;  1NQN A;  1LFO A;  4YDA A;  2IZF B;  3PED A;  1I4U A;  3SOT A;  4IMN A;  3MVF A;  1QY2 A;  3EBW A;  4ZGF A;  2IZK A;  1Y9T A;  4NV8 A;  5L8N A;  3KFI A;  3RWX A;  3D96 A;  3VGW A;  3NP1 A;  3CR6 A;  4GNW A;  1VPR A;  1E00 A;  5F6Z A;  5K06 A;  1B4M A;  2L67 A;  2LKK A;  2I5V O;  3G7X A;  1ADL A;  4O4S A;  4ML7 B;  2DJF A;  4AZN A;  5HCD C;  3QKG A;  3HTY A;  4O4X A;  4JO6 A;  5IRU A;  5LKF A;  2GTF X;  1FDQ A;  3O2Y A;  1EAL A;  3OJY C;  1DZJ A;  5EDC A;  2KT4 B;  1S7D A;  3UEX A;  2OZQ A;  1DFV A;  2RA6 A;  1HBP A;  3UEV A;  3U0D A;  1SWT A;  5AJB A;  2PI3 O;  1MDC A;  1VWH B;  1VWR B;  2OF8 A;  4AZP A;  5L3Y A;  2NND A;  3B2J A;  4JHQ A;  4XMF A;  2X34 A;  1SY2 A;  1JV4 A;  2L68 A;  2HZR A;  2OY1 O;  1SY0 A;  5D4A A;  3F9D A;  1EIO A;  2RTR B;  3H3I A;  3DTQ A;  4U8U O;  3BLG A;  4IB6 A;  3AKM A;  2CBS A;  1BRQ A;  1DF8 A;  2BSZ A;  4ORY A;  4BCS A;  5HZ5 A;  3TGC A;  1KL3 A;  5HCE C;  1CJ5 A;  1D2U A;  1CBI A;  2OL6 O;  4ZHH A;  4YGG A;  1VYF A;  4GK9 A;  3BY0 A;  4YH0 A;  4BOE A;  1FEN A;  3VG2 A;  4CDC A;  1KT3 A;  4COT A;  4ORX A;  1NC9 A;  2W2B A;  4WFU A;  5B3M O;  2DM5 A;  1EXS A;  1SWJ A;  2ALL X;  5F7G A;  4JGL A;  5KHP A;  1LIB A;  2RTC B;  3BX7 A;  1ZRY A;  5CSE A;  2QCB A;  4TKB A;  2X8S A;  4I6S A;  1O1U A;  5HWZ A;  2RTN B;  2EU7 X;  2PY1 A;  1QG5 A;  1UZ2 X;  5IXG A;  2ACO A;  1G85 A;  1SRF A;  2R74 A;  2YMS A;  3APW A;  4I3B A;  1MEP A;  3FEN A;  4FBR A;  1BWY A;  1X8N A;  1EI5 A;  3HPE A;  1S44 A;  2RTE B;  1VWF B;  2OFM X;  3MBT A;  1GGL A;  4A8Z A;  1LID A;  4HPD A;  1U17 A;  4CPE A;  4YFQ A;  1YWB A;  2WWP A;  4ZGU A;  4KH8 A;  1FEL A;  1LIC A;  1DZM A;  1SXW A;  1A3Y A;  5F2B A;  5HTE A;  3EBK A;  4GJV A;  3WYP A;  2FLJ A;  4ES7 A;  1Y9L A;  1SXX A;  2K62 A;  4QYP A;  5B10 O;  3VPJ E;  1SWL A;  2BS5 A;  3E3C A;  5HBS A;  5BYP A;  5LJC A;  2JU7 A;  2MF6 A;  2Q39 A;  4ORW A;  2MJI A;  1LIE A;  2CAM A;  4XME A;  3P24 A;  1W6F A;  5LKE A;  2FR3 A;  4TKJ A;  5D48 A;  4YKM A;  2QO5 A;  1NP4 A;  2AT8 X;  5H9K A;  1VWD B;  2FRS A;  4ZHG A;  2OVA A;  4GDA A;  1VWO B;  3WYQ A;  1O1V A;  1SY3 A;  4CDD A;  4BX7 A;  1U0X A;  4KII A;  4TKH A;  3STK A;  1UYN X;  1YWC A;  1RXK A;  1DC9 A;  3PQU A;  4LKP A;  2WSJ A;  4FQB B;  2AT0 X;  2QOS C;  1KQX A;  5EED A;  4OEL A;  1SWF A;  2OL7 A;  3FIQ A;  5IRW A;  3FW4 A;  3HWE A;  4MVK A;  4XMD A;  1B0O A;  4Z27 A;  1X8Q A;  3ELZ A;  2X56 A;  3WZO A;  5AQ6 A;  5B11 O;  3KFG A;  2RQ0 A;  1BLR A;  2E4J A;  2WEX A;  3P6D A;  1B56 A;  5IO7 A;  3BS2 A;  3HOL A;  1VWJ B;  4ZHC A;  1BSY A;  1TW4 A;  2VDF A;  4CSB A;  4IAW A;  1SWB A;  1MK5 A;  4NLJ A;  1SWU A;  1FTP A;  1LCZ A;  1U18 A;  2A0A A;  4O4U A;  4CPI A;  1SWE A;  1X8U A;  1PTS A;  1XCA A;  2HZQ A;  3VG4 A;  5L8O A;  4EKV A;  4C5P A;  1RLB E;  1N43 A;  1B8E A;  4N7D A;  3NX1 A;  1SY1 A;  2G7B A;  2C4I A;  3SZI A;  4XMH A;  1STP A;  2L9C A;  3NPO A;  1YP6 A;  3NQ9 A;  4HFO A;  1MOY A;  1E02 A;  4IB8 A;  3VU1 A;  1KGL A;  4U8U M;  3B2K A;  1ZNG A;  4NP1 A;  1NBX A;  1HBQ A;  3C77 X;  1LDO A;  5LJH A;  1N0S A;  3WBG A;  4RUN A;  1JBH A;  1SWO A;  5HZ9 A;  1DZK A;  3N91 A;  4I60 A;  1HMT A;  1W5R A;  4K19 A;  1BM5 A;  2HKD A;  2MWH A;  2Z4I A;  1T8V A;  5D8J A;  4Y0Q A;  5LJD A;  3S60 A;  3MG5 A;  3T1D A;  4OS8 A;  1JJU A;  1SWP A;  3BU1 A;  1OBQ A;  4EFG A;  3MX7 A;  4WBK A;  5HTD A;  3FLL A;  3LHN A;  4M6S A;  4KC8 A;  2LBV A;  4BX6 A;  4ZHF A;  5B27 A;  3EYC A;  2RTB B;  3GE2 A;  3FR2 A;  1GT4 A;  1SWG A;  3RBY A;  4YDB A;  1OPB A;  4AYH A;  2OVE A;  4GU8 A;  1AVG I;  2OY8 A;  4ZR2 A;  2DJG A;  3VG7 A;  1GM6 A;  2RCT A;  1JMX A;  3NR3 A;  4CPF A;  2FKG A;  1AEL A;  3PEC A;  4HPC A;  1I05 A;  4BX6 B;  2UZ2 A;  3WVM A;  4GKC A;  3KFH A;  1MUP A;  4OS0 A;  3PH5 A;  5HAE A;  1I06 A;  5LJK A;  4YMY A;  2BC3 A;  2ZAG A;  4NNT A;  1GT1 A;  3F6Z B;  1T0V A;  1KZX A;  1IJ8 A;  3SAO A;  2Q2P A;  1Y53 X;  4I95 A;  4ALB A;  3P6G A;  3WJD A;  2Y3E A;  1I78 A;  2AT3 X;  1IW2 A;  2RD7 C;  3AUM O;  5L8I A;  4L1N A;  4GGZ A;  1PM1 X;  3HWG A;  1LKE A;  3OE3 A;  2JOZ A;  4GGR A;  4NLI A;  2Z4H A;  4GGT A;  1ERX A;  4YCE A;  3WZP A;  4TQ2 A;  1CBR A;  2JGS A;  2IZA A;  4OMX A;  2RTL A;  3RZY A;  1OEE A;  1PMP A;  1ZNK A;  4IB7 A;  3RDO A;  1OPA A;  4GE1 A;  3C76 X;  2I5Z O;  3FA6 A;  1GX8 A;  1AB0 A;  3S5V A;  5CE4 A;  1NQM A;  2FHN X;  2QO4 A;  3WXQ A;  5IO6 A;  2ZAI A;  2KD2 A;  4IRW A;  3ZUO A;  4AW8 A;  3D95 A;  5H9N A;  2RTJ A;  4Y5D A;  3RDX A;  1GXA A;  1NGL A;  1IFB A;  5K68 A;  3BSZ E;  2NNQ A;  1Y0G A;  1RXH A;  4BJ8 A;  3BDR A;  4YFR A;  5AJC A;  2C1Q A;  4A1H A;  2RN4 A;  4Y59 A;  4BQU A;  2NP1 A;  1KT4 A;  3FA8 A;  3Q6L A;  3NQK A;  1E5P A;  5JR8 A;  1STR B;  1RXJ A;  3APV A;  4YBP A;  2IZI A;  4MIR A;  1L6M A;  2NNE A;  1RSU B;  2LBA A;  2OFA A;  1FE3 A;  2POA A;  1QQS A;  3FR5 A;  3D9W A;  3P6E A;  4AZO A;  1E2T A;  1EQD A;  1KT7 A;  5B29 A;  4HWM A;  4IB9 A;  2OYB O;  4BGF A;  3RE5 A;  5FEN A;  2OL8 O;  4IBA A;  1G7N A;  4CDE A;  1FJ1 E;  2KTS A;  3ELX A;  2AT6 X;  4Z2V A;  4KT5 A;  4O3X B;  2ASN X;  3S5X A;  2RTH B;  2OFB A;  1QAB E;  4QZT A;  1SWC A;  2ZSC A;  3SLO A;  4D6A A;  2KTD A;  1SXY A;  4QGX A;  3WZQ A;  3S26 A;  3AEH A;  2IZC B;  1GX9 A;  1EW3 A;  2QMI A;  1VWN B;  4M7M A;  2IFB A;  4QAE A;  2AMM X;  1PBO A;  3EC5 A;  4TJZ A;  2A3F X;  1YUP A;  2ACP X;  3RKG A;  1JZU A;  1RBP A;  3RE6 A;  4ARH A;  1VWM B;  1K3B A;  1ZNH A;  4YKO A;  2W2A A;  2JU8 A;  1P6P A;  4BVM A;  1IIU A;  1LIF A;  3WJF A;  3WJC A;  2MHD A;  3OBL A;  2RTI B;  1G74 A;  4CV7 A;  3IFB A;  1VWP B;  1VWB B;  2FKJ A;  4A1Y A;  2Q9S A;  1JYJ A;  1LNM A;  2G5L A;  1SWQ A;  5F1E A;  2WEW A;  1N9M A;  1O8V A;  5B2A O;  4OEM A;  3P02 A;  2KW1 A;  3P6H A;  4ORS A;  2OF9 A;  3WJE A;  3PK2 A;  3PPT A;  1OEK A;  2FWV A;  3HWD A;  4Y0S A;  5EPQ A;  3I17 A;  3LTW A;  4O9S A;  4HPA A;  3T2X A;  5LJE A;  1EII A;  2RTK A;  2AL0 X;  1T68 X;  1W4T A;  4ZJ0 A;  1BBP A;  4NW4 A;  3PP6 A;  4O3W A;  3ZW1 A;  1HQQ A;  3TZS A;  1YWD A;  3UAQ A;  1SXU A;  4GET A;  4INN A;  1VYG A;  1I9H A;  2Y3F A;  1EPB A;  5HCC C;  1ZND A;  2WUT A;  4A60 A;  1BJ7 A;  1VWE B;  1VWA B;  3B2H A;  3B2I A;  3FW5 A;  1IKJ A;  1ALB A;  2CM4 A;  3KQ0 A;  4NYR A;  4EQA C;  1KZW A;  1CBQ A;  3CWK A;  3ZW1 B;  1VWK B;  2OVD A;  1STS B;  1WUB A;  4GJS A;  2R56 A;  1EPA A;  4Y0P A;  4ZHD A;  4QGW A;  3KZA A;  1SWN A;  4IMO A;  1SLF B;  3NBX X;  4MVI A;  4QQ1 A;  2GJ5 A;  1TOW A;  3RDU A;  1GT5 A;  1BSO A;  2F09 A;  1N7Y A;  3LV4 A;  3P6C A;  2HNX A;  1UYO X;  2YG2 A;  5K67 A;  3FID A;  1OEJ A;  3BU9 A;  1QFV A;  1MVG A;  1NDJ A;  1VWQ B;  2AKQ A;  3HWF A;  4O49 A;  3NQ3 A;  4I3C A;  2GTL N;  1SRG A;  1SRI A;  4DNE A;  4MVL A;  3HK1 A;  2IZE B;  5HZQ A;  3ZW0 B;  3FA9 A;  3D97 A;  2X55 A;  1BRP A;  1ZNE A;  1DF3 A;  4OMW A;  1R0U A;  4ORU A; 
#chains in the Genus database with same CATH homology
 4QGV A;  2FR2 A;  3APU A;  5DPQ A;  5FFH A;  2MO5 A;  4I9S A;  1LPJ A;  4D6B A;  3FR4 A;  3B2L A;  3NAD A;  4QYN A;  4QRL A;  5F6B A;  3WJG A;  1IKE A;  3VE2 A;  4ZCB A;  3CBS A;  5F58 A;  4TLJ A;  3ZWE A;  1KXO A;  4KC7 A;  2OFR X;  1X8O A;  4GZV A;  1MX8 A;  2K23 A;  2LA7 A;  3BRN A;  1JIW I;  5EDB A;  3ZW2 A;  3P6F A;  1XKI A;  2MM3 A;  2WQ9 A;  2LB6 A;  4R0B A;  4PJ2 A;  4YFP A;  1QFT A;  4XMC A;  1X71 A;  3CQN A;  2GTL O;  1ACD A;  4NYQ A;  3IA8 A;  2QM9 A;  4ZH6 A;  2HYS A;  3HOE A;  4ES7 A;  3ZI8 A;  1QY1 A;  1A18 A;  1D3S A;  3C78 X;  4QNI A;  1HMR A;  3TGA A;  2BT9 A;  3FA7 A;  3GAQ A;  2AH7 X;  3TGB A;  4KCA A;  3NX2 A;  3OD9 A;  4ON1 A;  4UU2 A;  1QY0 A;  2CZT A;  4GH7 A;  4YGH A;  4LZU A;  2JU3 A;  4FGI B;  1OBU A;  1SMP I;  2M4L A;  2X46 A;  3JQO A;  2FS6 A;  3KFF A;  1MX7 A;  4MVE A;  5AEO A;  2O62 A;  5HA0 A;  5BVQ A;  4Y0R A;  4O4O A;  3PQS A;  3U03 A;  5LJG A;  2XST A;  1IFC A;  2R73 A;  1GT3 A;  4I3D A;  2HMB A;  3K3L A;  5EEE A;  3JSQ A;  5KID A;  2XKL A;  1SA8 A;  4DQ4 A;  3STN A;  1GKA A;  4AZR A;  2W2F A;  1AQB A;  4UU3 A;  1HQP A;  1S2P A;  4IAB A;  3RSW A;  4O3Z A;  1YWA A;  4FBV A;  1BEB A;  1Z24 A;  5HA1 A;  1GKA B;  5H8T A;  3VG5 A;  1LF7 A;  4ODD A;  3L4R A;  5BVS A;  2JN3 A;  5DG4 A;  4OS3 A;  2BS6 A;  3APX A;  2X8F A;  3PH6 A;  2QO6 A;  4ZH9 A;  4FBO A;  1H91 A;  3ZQ3 A;  4AZM A;  2FT9 A;  3VG3 A;  2G78 A;  3UEW A;  1ICN A;  3F8A A;  5H9L A;  2GC9 A;  1QWD A;  1DV9 A;  3VG6 A;  2AT5 X;  3EM0 A;  4EEJ A;  5FQ6 E;  3BX8 A;  1KT5 A;  4YGZ A;  4GNY A;  1CBS A;  3CBC A;  1TOU A;  3AKN A;  1I04 A;  4I9R A;  1YP7 A;  4LZV A;  2F73 A;  2ANS A;  4XMG A;  2RCQ A;  4ALO A;  1KQW A;  4WFV A;  4IAX A;  3JS1 A;  1X8P A;  4CK4 A;  4ORR A;  5HZ8 A;  2JW1 A;  3I0A A;  1ERB A;  2BHV A;  1TXL A;  1ZNL A;  3WOV A;  2A2G A;  1TVQ A;  1JYD A;  4EDE A;  4NNS A;  5KIC A;  1CRB A;  4TNN A;  3TF6 A;  2LFO A;  4WHI A;  4RUU A;  3ZZV A;  2A13 A;  1HN2 A;  1BSQ A;  2GTL M;  2G79 A;  4LKT A;  4YBU A;  4DQ3 A;  5K06 A;  1KZW A;  1URE A;  3VE1 A;  2OVS A;  1JJJ A;  1A2D A;  5D47 A;  3V8U A;  3FEL A;  4U9C A;  3ZW0 A;  5HZ6 A;  5LJB A;  4EXZ A;  4HPB A;  4ID2 A;  3WJB A;  5IO5 A;  2WR6 A;  1ICM A;  3O22 A;  5FQ8 E;  1X89 A;  4GDZ A;  1FEM A;  3ZUI A;  1HMS A;  2CBR A;  3FYF A;  1KT6 A;  1DZP A;  4L3R A;  5FAZ A;  2Q2M A;  2CM9 A;  3CQR A;  2JMB A;  2X45 A;  4LQZ A;  4U3Q A;  1A57 A;  2FS7 A;  2L5P A;  3FEK A;  2CZU A;  1KOI A;  4MIS A;  1JJX A;  4PSQ A;  2FTB A;  2HLV A;  2P8G A;  3UEU A;  5H9A A;  2Q4N A;  3CMP A;  4N7C A;  5EZ2 A;  2N93 A;  2X8T A;  5FQ7 E;  3U9P C;  1ML7 A;  4GRJ A;  2A2U A;  3FEP A;  3O19 A;  4YCH A;  3FMZ A;  1NP1 A;  2BLG A;  5BVT A;  1YIV A;  1EUO A;  4O3Y A;  1E06 A;  2WQA E;  3D4R A;  3DSZ A;  5CYB A;  1PEE A;  3STM X;  4U8U N;  5D45 A;  5C0N A;  4QZU A;  4AZQ A;  1OBP A;  3EMM A;  1LFO A;  4YDA A;  3PED A;  3SOT A;  1I4U A;  4IMN A;  3MVF A;  1QY2 A;  3EBW A;  4ZGF A;  1Y9T A;  5L8N A;  3KFI A;  3RWX A;  3D96 A;  3NP1 A;  3CR6 A;  4GNW A;  1VPR A;  1E00 A;  5F6Z A;  1B4M A;  2L67 A;  2LKK A;  3G7X A;  4O4S A;  1ADL A;  4AZN A;  4ML7 B;  5HCD C;  3QKG A;  3HTY A;  4O4X A;  5LKF A;  2GTF X;  1FDQ A;  3O2Y A;  1EAL A;  3OJY C;  1DZJ A;  5EDC A;  2KT4 B;  1S7D A;  3UEX A;  2OZQ A;  1DFV A;  2RA6 A;  1HBP A;  3UEV A;  3U0D A;  5AJB A;  1MDC A;  4AZP A;  2NND A;  3B2J A;  4XMF A;  1SY2 A;  1JV4 A;  2L68 A;  2HZR A;  1SY0 A;  5D4A A;  3F9D A;  1EIO A;  3H3I A;  3DTQ A;  4U8U O;  3BLG A;  4IB6 A;  3AKM A;  2CBS A;  1BRQ A;  4ORY A;  5HZ5 A;  3TGC A;  5HCE C;  1CJ5 A;  1D2U A;  1CBI A;  4ZHH A;  4YGG A;  1VYF A;  4GK9 A;  3BY0 A;  4YH0 A;  4BOE A;  1FEN A;  3VG2 A;  1KT3 A;  4COT A;  4ORX A;  2W2B A;  4WFU A;  2DM5 A;  1EXS A;  2ALL X;  5F7G A;  4JGL A;  5KHP A;  1LIB A;  3BX7 A;  1ZRY A;  4TKB A;  2X8S A;  4I6S A;  1O1U A;  5HWZ A;  2EU7 X;  2PY1 A;  1QG5 A;  1UZ2 X;  2ACO A;  1G85 A;  2R74 A;  2YMS A;  3APW A;  4I3B A;  4FBR A;  1BWY A;  3FEN A;  1X8N A;  1EI5 A;  1S44 A;  2OFM X;  3MBT A;  1GGL A;  4A8Z A;  1LID A;  4HPD A;  1U17 A;  4ZGU A;  4YFQ A;  1YWB A;  2WWP A;  4KH8 A;  1FEL A;  1LIC A;  1DZM A;  1SXW A;  1A3Y A;  5HTE A;  3EBK A;  2FLJ A;  1Y9L A;  1SXX A;  2K62 A;  4QYP A;  3VPJ E;  5LJC A;  2BS5 A;  3E3C A;  5HBS A;  2JU7 A;  2Q39 A;  4ORW A;  2MJI A;  1LIE A;  4XME A;  3P24 A;  5LKE A;  2FR3 A;  4TKJ A;  5D48 A;  4YKM A;  2QO5 A;  1NP4 A;  2AT8 X;  5H9K A;  2FRS A;  4ZHG A;  2OVA A;  1G5W A;  1O1V A;  1SY3 A;  1U0X A;  4KII A;  4TKH A;  3STK A;  1YWC A;  4LKP A;  3PQU A;  1DC9 A;  2WSJ A;  4FQB B;  2AT0 X;  2QOS C;  1KQX A;  5EED A;  3FIQ A;  3FW4 A;  3HWE A;  4MVK A;  4XMD A;  1B0O A;  1X8Q A;  3ELZ A;  5AQ6 A;  3KFG A;  2RQ0 A;  1BLR A;  2E4J A;  2WEX A;  3P6D A;  1B56 A;  5IO7 A;  3BS2 A;  3HOL A;  4ZHC A;  1BSY A;  1TW4 A;  4CSB A;  4IAW A;  4NLJ A;  4O4U A;  1FTP A;  1U18 A;  2A0A A;  5BYP A;  5L8O A;  1X8U A;  1XCA A;  3VG4 A;  2HZQ A;  1RLB E;  1B8E A;  4N7D A;  3NX1 A;  1SY1 A;  2G7B A;  4XMH A;  4HFO A;  2L9C A;  3NPO A;  1YP6 A;  3NQ9 A;  4IB8 A;  3VU1 A;  1E02 A;  1KGL A;  4U8U M;  3B2K A;  1ZNG A;  4NP1 A;  1HBQ A;  3C77 X;  5LJH A;  1N0S A;  3WBG A;  1JBH A;  5HZ9 A;  1DZK A;  3N91 A;  1HMT A;  4K19 A;  1BM5 A;  2MWH A;  2Z4I A;  1T8V A;  5D8J A;  4Y0Q A;  5LJD A;  3S60 A;  3T1D A;  4OS8 A;  3BU1 A;  1OBQ A;  4EFG A;  3MX7 A;  4WBK A;  5HTD A;  3FLL A;  3LHN A;  4M6S A;  4KC8 A;  2LBV A;  4ZHF A;  5B27 A;  3EYC A;  3GE2 A;  3FR2 A;  1GT4 A;  3RBY A;  4YDB A;  1OPB A;  4AYH A;  2OVE A;  4GU8 A;  1AVG I;  4ZR2 A;  3VG7 A;  1GM6 A;  2RCT A;  3NR3 A;  1AEL A;  3PEC A;  4HPC A;  1I05 A;  3WVM A;  4GKC A;  3KFH A;  1MUP A;  4OS0 A;  3PH5 A;  5HAE A;  1I06 A;  5LJK A;  4YMY A;  2ZAG A;  4NNT A;  1GT1 A;  3F6Z B;  1T0V A;  1KZX A;  3SAO A;  4ALB A;  2Q2P A;  4I95 A;  3P6G A;  3WJD A;  2RD7 C;  2AT3 X;  1IW2 A;  5L8I A;  4L1N A;  4RUN A;  1PM1 X;  3HWG A;  1LKE A;  3OE3 A;  2JOZ A;  4NLI A;  4ZFX A;  2Z4H A;  4YCE A;  1ERX A;  4TQ2 A;  1CBR A;  4OMX A;  3RZY A;  1OEE A;  1PMP A;  1ZNK A;  4IB7 A;  1OPA A;  4GE1 A;  3C76 X;  3FA6 A;  1GX8 A;  1AB0 A;  3S5V A;  5CE4 A;  3WXQ A;  2QO4 A;  5IO6 A;  2ZAI A;  2KD2 A;  3ZUO A;  4AW8 A;  3D95 A;  5H9N A;  1GXA A;  1NGL A;  1IFB A;  3BSZ E;  2NNQ A;  4YFR A;  3BDR A;  5AJC A;  4BQU A;  4A1H A;  2RN4 A;  2NP1 A;  1KT4 A;  3FA8 A;  3Q6L A;  3NQK A;  1E5P A;  5JR8 A;  3APV A;  4YBP A;  4MIR A;  1L6M A;  2NNE A;  2LBA A;  1FE3 A;  2POA A;  1QQS A;  3FR5 A;  3P6E A;  4AZO A;  1EQD A;  1KT7 A;  5B29 A;  4HWM A;  4IB9 A;  5FEN A;  4IBA A;  1G7N A;  2KTS A;  3ELX A;  2AT6 X;  4KT5 A;  4O3X B;  2ASN X;  3S5X A;  1QAB E;  4QZT A;  4D6A A;  2KTD A;  1SXY A;  4QGX A;  3S26 A;  1GX9 A;  1EW3 A;  2QMI A;  4M7M A;  2IFB A;  4QAE A;  2AMM X;  1PBO A;  4TJZ A;  2A3F X;  1YUP A;  2ACP X;  3RKG A;  1JZU A;  1RBP A;  4ARH A;  1ZNH A;  4YKO A;  2W2A A;  2JU8 A;  1P6P A;  4BVM A;  1IIU A;  1LIF A;  3WJF A;  3WJC A;  2MHD A;  3OBL A;  1G74 A;  4CV7 A;  3IFB A;  4A1Y A;  2Q9S A;  1JYJ A;  1LNM A;  5F1E A;  2WEW A;  1O8V A;  3P02 A;  2KW1 A;  3P6H A;  4ORS A;  3WJE A;  3PPT A;  1OEK A;  2FWV A;  3HWD A;  4Y0S A;  5EPQ A;  3I17 A;  4O9S A;  4HPA A;  5LJE A;  1EII A;  2AL0 X;  1T68 X;  4ZJ0 A;  1BBP A;  4NW4 A;  3PP6 A;  4O3W A;  3ZW1 A;  3TZS A;  1YWD A;  3UAQ A;  1SXU A;  4GET A;  4INN A;  1VYG A;  5HCC C;  1EPB A;  1ZND A;  2WUT A;  4A60 A;  1BJ7 A;  3B2I A;  3B2H A;  3FW5 A;  3KQ0 A;  1IKJ A;  1ALB A;  2CM4 A;  4EQA C;  4NYR A;  1CBQ A;  3CWK A;  3ZW1 B;  2OVD A;  2R56 A;  1EPA A;  4Y0P A;  4ZHD A;  4QGW A;  3KZA A;  4IMO A;  3NBX X;  4MVI A;  4QQ1 A;  2GJ5 A;  1TOW A;  1GT5 A;  1BSO A;  2F09 A;  3LV4 A;  3P6C A;  2HNX A;  2YG2 A;  1OEJ A;  3BU9 A;  1QFV A;  1MVG A;  2AKQ A;  3HWF A;  4O49 A;  3NQ3 A;  4I3C A;  2GTL N;  4MVL A;  3HK1 A;  5HZQ A;  3ZW0 B;  3FA9 A;  3D97 A;  1BRP A;  1ZNE A;  1DF3 A;  4OMW A;  1R0U A;  4ORU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...