3F9EA

Crystal structure of the s139a mutant of sars-coronovirus 3c-like protease
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
297
structure length
297
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGAFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Two adjacent mutations on the dimer interface of SARS coronavirus 3C-like protease cause different conformational changes in crystal structure.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 64
structure length 297
sequence length 297
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3f9eA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9eA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9eA02
1VZQH 1AVGH 5FX6A 1V2NT 1BDAA 2RCEA 3M5LA 1WBGB 4HZHA 4BXSA 2SGPE 3SV9A 2H9EH 4VGCC 2HGTH 3DHKH 1XKBC 1J15A 1F5LA 1OP0A 1E37B 4FXGH 2XBWA 1UTNA 1SB1H 3U1IB 1A5HA 2PHBA 2XBXA 3FANA 3I78A 3LONA 5DP4A 3VXEH 3MH5A 2NU2E 3PWBA 3SHCH 1P02A 2BQ6B 1KYNA 3NKKA 4U01A 1ZTJA 3SNDA 1SGEE 4GAWA 4AGKA 1GI7B 1EAWA 1BTUA 1ELAA 2Q6GA 3RC4A 3ZZ4A 2EI8A 3P95A 1CA0C 3RXIA 5E0GA 3SBKA 3M5OA 2FX4A 3TH4H 3T2NA 1SLVB 2ZDVH 3ITIA 1P2JA 4B2BA 1UTMA 4JZDH 1OWDA 5SGAE 1YGCH 1UO6A 2FWWA 1MTWA 1SLXB 1K1PA 1G32B 2VIOA 4YTAA 1KXCA 4ZKRU 3ELAH 4ABEA 1BJVA 1KLIH 1SGRE 1TA2A 2G51A 4IMZA 2NU1E 4TYDA 5F6MA 1AU8A 2FPZA 1TNIA 4DCDA 3UOUA 1RTKA 1EJNA 4GCHG 3E3TA 2Z9GA 1HBTH 3GY8A 1GHZA 1BTPA 1O33A 3RC5A 5L30H 4THNH 2G55A 2ZCHP 1TMBH 2W3IA 1TIOA 2C8ZB 1AKSB 1ZSKA 1MKXK 1YPGH 1T8LA 2GMTB 5A8XA 2BDIA 5ETXA 4WJG2 1GG6B 2G4TA 1DPOA 3ZV8A 1UHBA 1A0HB 1J8AA 2JH5D 3L33A 1H8IH 4X2WA 2IPHA 3QTVH 1S81A 4BOHA 4FUFA 1IQJA 3TVJB 2J9NA 2STBE 1F0TA 4AFQA 1GJ5H 2BLQA 1GJ6A 1NC6A 4ABIA 4AOQA 1NESE 1P06A 1SQAA 1XUGA 2BDGA 3BG4C 4KP0A 1ZHRA 3QK1A 3B23B 2BD7A 2Z7FE 3E6PH 4DOQA 1MH0A 3EA7A 5F8ZA 1Z8GA 1HAOH 2TBSA 1TMTH 4ISHH 4A92A 2SFAA 2VGCB 4AX9H 3HGPA 2OINA 3ZVBA 4UEHH 1V2LT 4KGAA 3RP2A 1IOEA 4WXVA 4U2WA 3SUGA 1EX3A 3V0XA 2ZP0H 1IQGA 2TGPZ 1P57B 1NRRH 1AE8H 4GHQA 1T8NA 3NXPA 2IN2A 1P2MA 1BRCE 4K3JA 1QB9A 4FUEA 2CF9H 3U69H 1MQ5A 2F9BH 3PYHA 3UNSA 3A8CA 2ZU1A 2SGEE 3U8RH 1GHYH 2ZHEH 1L4DA 5C1YA 4CRBA 1GJ9B 2QGRA 1Y5AT 4DW2U 3LGIA 3H5CB 4X6OA 2QCYA 1AQ7A 1ETRH 1TGNA 3HGNA 3RXLA 1SHYA 1WTGH 2HNTE 4I8HA 1D3QB 3DD2H 5EQSA 2GMTC 3JZ2B 2P95A 1ZMJA 2J94A 4JCNA 4ABDA 1O2WA 1GG6C 1ZRBA 1JBUH 2P93A 1O2GH 4ISNA 1AHTH 1GCTB 1C2KA 3PWCA 4GHTA 1O3MA 1IQMA 1DY8A 3F9GA 1DE7H 1TPPA 2AEIH 1WTHD 4JK6A 1CBWB 3ZZBA 5A8YA 1MZDA 4RSPA 4CR9A 2A4GA 1YPHE 2R9PA 3MH4A 4A7IB 2ZU2A 5BPEA 3M35A 1FLEE 2WPLS 1RGQA 2J34A 3BSQA 5JB9S 3O8BA 2FOHA 3UNRA 5LPFA 3SUFA 1BMMH 2W7UA 4KELA 1L4ZA 5C5NA 1F92A 2R3YA 1GGDB 2VGCC 3KQDA 1VJAU 1O31A 4K1SA 2BY7X 3AAVA 3QX5H 3BIUH 2RA3A 3T26A 1V6DA 1TNKA 4WY3A 2A32A 4AFZA 1O2IA 2BDYA 1DY9A 3A88A 3Q00A 1BJUA 6GCHG 2ZHFH 1P10A 2RA0A 1JMOH 1QJ1B 1O2LA 9LPRA 4X1QU 1EZUC 1S84A 1A5IA 5L6NH 4Y79A 3V12A 3A87A 1UTJA 1OWIA 1QQUA 1J16A 1DSTA 1FY5A 4KKDA 5TCCA 3A7ZA 5JBCS 1TRYA 1N6XA 7LPRA 3ENSB 1Y8TA 1W0ZU 1HIAB 1A1RA 4K2YA 3T29A 4KTCA 8KME2 3Q3KA 1ZJDA 2I6SA 1AD8H 1B5GH 4NA8A 1P0SH 3VPKA 2FZZA 1C2HA 5E2OA 1V2UT 1S5SA 3A7XA 2ZKSA 4NWLA 4D7GA 3SU3A 2ZCLP 1C5TA 1GCDA 4NIWA 3UPEA 1GCTC 5HGGA 2UUKB 2ODYB 2SNVA 2C93B 1QL7A 2A7HA 1CBWC 1O3JA 1JRTA 5GXPA 1W7XH 4ZKSU 1W11U 3MNSA 1KXDA 1QBVH 1HB0B 3PROA 1UCYK 5GCHG 4J1YA 1GVKB 4BAQB 4FUDA 1NFXA 2ZGBH 1NN6A 5FX5A 8GCHF 5AFZH 1SQOA 4ASHA 2PTNA 1PQ8A 4NWKA 3AW1A 2ZFQH 3WY8A 3GDVA 1D3PB 1CU1A 3JZ1B 1O2NA 3ATIA 4TPIZ 5EW1H 2BM2A 4XBCA 3R3GB 3PM3A 3ZZ7A 1UVSH 1HAZB 2V3HH 1F5KU 5GJ4B 1A3BH 4MTBA 4Q7YA 2STAE 2GGVB 3UREA 2HNTF 1ETTH 1GBKA 2XXLA 1O2VA 1O2PA 1V2WT 2O8TA 1KIGH 4X6NA 1UVUH 1YLCA 1QY6A 1FN8A 3HK6B 5IYTA 1A3EH 3M3TA 1C5XB 1GHXH 1Y3WA 1P3EA 3UNQA 2B8OH 3ZVGA 1GHBF 3M3VA 1O39A 2OC1A 4B1TA 2G00A 5FCRA 1YPJH 2OCVB 3RLYH 2ZU3A 2VH0A 1O5FH 1AGJA 5E8EH 4Y0YE 2JKHA 2C3SA 5ABWA 2C8YB 2FXRA 4SGBE 3SV2H 2PGQB 2BMGB 3RXQA 1P2KA 1TMUH 1TBRH 2ZFPH 4DGJA 1THPB 3P17H 1A0JA 2VWLA 2G5VA 5A8ZA 4KTSA 3SGBE 4X1PU 4CHAC 1DX5M 1KDQB 1W12U 2Y6TA 2RG3A 2ZPRA 3MMGA 3M37A 3A8DA 5EG4A 2BLOA 3KL6A 3RM2H 1V2RT 4FU9A 2ZHWH 3RXAA 2BDAA 1EOLA 3PLPA 5E0HA 4GLYA 1ZTKA 5A0CA 1AY6H 1HAGE 1W8BH 1DUAA 5DG6A 1QB6A 3ZZ6A 3UUZA 4Y11E 1P04A 2D1JA 1O2XA 4INKA 1MU8B 3BTTE 3FP6E 2Y5HA 3BTGE 1NFWA 4UDWH 4GUXA 1PPZA 2Y82A 3SN8A 1C9TA 2I6QA 2GCHF 1S83A 5FXLA 1QNJA 2P8OB 1DUEA 1J17T 1K1IA 3S69A 1GHAF 1GMHF 5AFYH 4TY7A 2Z3EA 1J9CH 3EDXB 5I46H 2FS8A 1ZRKA 1HYLA 5EOKA 1V2KT 1K1JA 2UWPA 2G5NA 4DG4A 1A4WH 1CE5A 3A83A 3MNBA 2FOGA 2CF8H 2ZDLA 3KGPA 1UCYH 4INHA 4X2XA 5CHAC 3GICB 2OC8A 1H9HE 2HOBA 5T6FA 1EPTA 1D3DB 1C1OA 4ZXYH 1EZQA 4OS1A 4LZ4B 1NPMA 2F9VA 4MNYA 3PLKA 2Z94A 3BG8A 3GDSA 1OP2A 5A0BA 3A80A 5PTPA 3RXVA 2F9OA 3SOSA 1ESAA 3VEQB 1Y5BT 3GCHB 2GDEH 2VINA 1ZHPA 4I8LA 3ZZ8A 4A1TA 1TABE 2VB0A 3RXFA 1YKTA 2FS9A 3P92A 2V35A 5EXNA 3OSYA 3T28A 1KXAA 1G30B 2AIPA 1HUTH 2FO9A 1LVOA 2ZFFH 3U8TH 1C2LA 1M9UA 2FIRH 2PWXA 1L0ZA 2VWNA 4U32A 3NUMA 4AFUA 1SG8B 2WINI 1HLTH 5C5OA 3UQVA 2F9UA 1OWEA 2AMPA 1O5DH 2SGAA 3R0FA 1RXPA 2CXVA 1RIWB 1TPOA 3BIVH 1JWTA 5J4QA 2GZ9A 1QFKH 1RFNA 7KMEH 1L2EA 3F9HA 2GT8A 4FUHA 3SU4A 1HV7A 1YCPH 3BTWE 3VB6A 1C1NA 2BVSH 3VFEA 5A2MH 3H7TA 1O2ZA 4NIYA 2P8OC 1GI6A 1MTNB 2ANYA 2AGIX 1Z7KA 3NWUA 4E7RG 3HKJB 1FAXA 7GCHF 2BD4A 1F2SE 2D8WA 1GMDG 3MTYA 1BTZA 3LGTA 4X8SH 3BTDE 3Q3YA 1PQ7A 4TPYA 1FJSA 1RTLA 1INCA 4UFFH 4BTIB 3CENA 1BB0B 1KTTB 2WPIS 4BAMB 1TQ0B 4QT8C 4D9QA 3SJOA 3ZZ3A 2Y81A 2OXSA 2NU0E 3E16B 4ABBA 1C1TA 1AFQB 1GDUA 1PPHE 2C8WB 4NFFA 1FY4A 2ZDNA 4XSKU 2ZF0H 2XWAA 1IQFA 4B71A 3LJOA 1CGHA 2TGTA 4AORA 4E7NA 3GCHC 2PUQH 1BZXE 1EB2A 1VITH 1CT4E 1TAWA 2Z3CA 2YNBA 1O5AB 1FONA 2QF0A 1OSSA 1O2SA 5G4BA 1NZQH 3ZZ9A 3SNCA 4CRDA 1FY1A 1HAXB 1ELTA 5JPMH 1V2QT 1Z1IA 3TGKE 1LTOA 1LVMA 4Y0ZE 4ESTE 2VIDA 2LIZA 1V3XA 1XVMA 1UTOA 1EUFA 4OGYA 2OC7A 3SNEA 3SU0A 1XUHA 1BA8B 3LT3A 1GL0E 1DDJA 3IG6B 3MU5A 1RIWC 2BQWB 2GVFA 1B0FA 1OWKA 1S0QA 2ZDMA 3ATLA 1LPKB 3SW2B 3T62A 1ETSH 3STIA 3LKWA 4Y71A 2FM2A 1QL8A 2ALPA 1P9UA 1O5CB 2XC4A 3SUEA 3AVZA 1O5GH 1MTNC 2FYQA 4JYUH 3BG4B 3LPRA 2HRVA 5F8XA 3B9FH 3BTQE 1AUJA 1O3GA 1PQ5A 2BD3A 3URDA 2ZTYA 1SGCA 3A86A 3RLWH 4B75A 3TJVA 1SGNE 2UWOA 2H6MA 3BEIB 4JZFH 5HM2A 4YT7H 3W95A 3NCLA 1NO9H 2GKVE 4Q7XA 4JK5A 3GCOA 4BTTB 1K1MA 2O8UA 3RXJA 1AFQC 5AVDA 3KHVA 1N8OC 1FN6A 2UUYA 2VVUA 4TWWA 2FDAA 1GI0A 2C4FH 1PYTC 2ZNKH 1EATA 4MG3A 1CHOG 1LKBA 1RJXB 1ZGIA 2BXUH 2K1QA 2HVXA 1BMAA 1ZYOA 1BRBE 1QL9A 1F0RA 1LVYA 2XBVA 4DT7B 3O8DA 3LC3A 1UVOA 1E34B 1C2JA 3LDXH 2OP9A 1O30A 1C2GA 3GCTG 1HXFH 2ZA5A 1QHRB 1N6YA 1SFIA 1B7XB 3QZQA 5C20A 1GBIA 1SPJA 3P70B 1HAPH 1DS2E 1JXPA 1UK4A 5B6OA 2WV5A 2QA9E 3TIUA 4IC6A 4I8GA 3UY9A 1AN1E 4X8VH 1EQ9A 1AZ8A 3RXOA 1BMLA 1ZLRA 1ELDE 4UE7H 1Y59T 1ZSJA 1YPEH 4ZXXH 1GJ7B 2AMDA 3EQ0H 2R2MB 3IWMA 1C1SA 1UMAH 2XW9A 1HNEE 4K1TA 9ESTA 2GX4A 1C9PA 1XVOA 2AGGX 4ZH8A 1G36A 4J2YB 3VGCB 1O3FA 3LH3A 1Z8JB 1VITF 3N7OA 1C1WH 4ABHA 1PPCE 3M7UA 1AIXH 1EPTB 5ESBA 3FZDA 3E91A 1G3CA 4A1VA 4HTCH 4OS4A 3A81A 4BAKB 1F0UA 3MNXA 3LH1A 1LQDB 2HPPH 2ZQ2A 5FCKA 3P8FA 4XOJA 1THRH 1GMCG 1GJAB 1EZSC 2WPMS 3SQEE 1IQEA 2FYRA 5J4SA 2OUAA 2Y7XA 3K65B 1P2QA 5FPTA 1YC0A 2ZPQA 1YF4A 4MNXA 3VB3A 1AWFH 4JZ1A 1Q3XA 1Z8RA 4DURA 1B0EA 1T8MA 2P3UB 1EKBB 4K5ZA 5HYOA 5JBAS 2PKSB 1P12E 1ZSLA 2DE9A 1GHWH 2FODA 4MNVA 1NRSH 1SGYE 1HXEH 3M36A 4YOIA 1GI4A 2R3UA 3HKIB 1TBZH 3EA9A 1D6WA 3NZIA 2CJIA 1O2MA 1OYTH 1O3AA 1FXYA 4DIIH 2PLXA 3SQHE 1YPKH 1ARBA 3GDUA 1BITA 2CHAC 1O3KA 4I8JA 3RXGA 3VB7A 2G4UA 1CO7E 1S0RA 2EI6A 1HJ8A 1XUJA 1PPBH 3SJ8A 1O3LA 3EE0B 3VGCC 1D4PB 2GD4B 1WV7H 6ESTA 3TJUA 5GWZA 2H1UA 1BRUP 1O35A 2PSYA 4D9RA 5JBTA 1EPTC 1SGIB 1T32A 1O0DH 2A4QA 1IQKA 3A84A 1TOMH 1V2JT 2FI5E 4X2YA 4TWYA 1XX9A 2PW8H 1TX8A 4XBDA 3SU5A 1GBTA 1OS8A 2BDHA 3PO1C 2FOBA 4D7FA 1N1LA 1ID5H 4YLQH 4WMDA 1QCPA 4WMEA 2BD5A 3FZZA 1K28D 3U8OH 1GJ4H 3U1JB 1W10U 3C27B 1SGFA 3LIWA 1DM4B 1DWEH 1O3IA 2TRMA 1GBAA 1DXPA 1HAHH 1GJBB 2PKSC 3TGIE 2FP7B 1BOQA 1WAYB 2V0BA 3SO3A 1K9OE 2P3FH 1OWHA 1TNGA 5GIBA 1XUIA 3A85A 2Z9KA 3FVFB 2VNTA 1P2OA 2ZHDA 2FOAA 2AFQB 3RMLH 1MZAA 3SJIA 1NU9A 1PQAA 3ODDA 3SV6A 1IHTH 3OY6U 1P01A 2AYWA 2TGAA 2KAIA 1LVBA 2PV9B 4UFEH 3TLOA 5DP9A 4UONA 1ABIH 3E0NB 5LPRA 3TK9A 1HFDA 1SGPE 1L1GA 2A5IA 3M5NA 1O36A 3EGKH 3LJJA 5E0JA 5EQQA 1GI1A 1S6HA 2Y80A 4XE4A 1LKAA 3Q76A 1WCZA 1O3HA 4FUJA 1GL1A 2ZDKA 1JRSA 2GZ8A 3TK5A 4GCHF 3LGWA 1MUEB 3MO6A 2BDBA 1AVWA 4CHAB 2EEKA 1THSH 5F03A 4DIHH 2FOCA 3QN7A 1C2MA 1Q2WA 2BD8A 3ZYDA 3E1XB 4FUGA 3L3TA 1XMNB 3UR6A 4FVDA 2JH0D 3ZZCA 1UVTH 2FOFA 1ZOMA 2VJ1A 4NZQA 4LZ1H 4IS5A 2WUCA 3SGQE 1TYNA 3GY2A 2BZ6H 4K8YA 2QIQA 3TJOA 1O2KA 3RXBA 1C1PA 4NCYA 3OY5U 5EXLA 1LHEH 2XWBI 3A8BA 3RMNH 2ZTZA 2BY9X 1J14A 1RTFB 5FPYA 1C5MD 1DLEA 1UHBB 1C1MA 4O3TA 1JIMA 1GWAA 4IW4E 1YCPM 5EPNA 1KXEA 1BHXB 4AYYB 1KSNA 3F1SB 2EI7A 2UUFB 2P16A 1PPEE 4YOGA 5CHAB 1WYKA 1TGSZ 2VWMA 3RMOH 2A7CA 2BDCA 2B5TB 3P8GA 1NRNH 3F9FA 1YCPK 3GY5A 3MFJA 4X8TH 4AFSA 1QA7A 1QTFA 3MU0A 5FPSA 1FY3A 1W7GH 2A2QH 1ZHMA 6CHAB 5LH8A 2W5EA 1O3EA 2SGDE 2TGDA 1RS0A 5HMAA 4WVPE 1FV9A 1NY22 1RRKA 1QRZA 1ELVA 2A2XH 1EASA 3RXKA 2BQ7B 1AE5A 2NU4E 3SUDA 1BTHH 1DWDH 1O5BB 2BOHB 1SMFE 3E8LA 4X8UH 5LGOA 4GVUA 5EPYA 1MCTA 1GBLA 3QWCH 1T4UH 1C5YB 3RXTA 4IN2A 5C1UA 3ZYEA 3PMHB 4MQAA 3SNBA 1Z1JA 2VWOA 1MTVA 1D6RA 4WWYA 3D62A 1UCYE 3D49H 3TH2H 5C2ZA 2DE8A 4Y8YA 4ZROA 2Y7ZA 2BY8X 2WUBA 4I7YH 2R0KA 4JZIA 4A6LA 1O32A 2O8LA 2FEQH 1VJ9U 3Q77A 4I8KA 1A0LA 1QGFA 4MPXA 2A0QB 3K9XB 1UK2A 1AVXA 1E35B 1OP8A 2BVRH 2HALA 4D8NA 1AKSA 1EZXC 2ZGXH 1NRQH 4O97A 1TONA 2HNTC 1SOZA 1NS3A 5DP3A 7ESTE 4D76A 3VB4A 3U9AH 2ZFTA 1NRPH 2PFEA 1SSXA 4JZEH 3PB1E 1YPMH 3ATMA 4H42U 3QTOH 2K7XA 4IN1A 6GCHF 2VIQA 1LHCH 1TLDA 3STJA 1HCGA 1KXBA 4WF8A 1A61H 1AWHB 2AS9A 1GI3A 2OC0A 1T31A 3EYDA 4NGAH 1AMHA 6CHAC 1PPGE 1H9IE 2GV6A 1O3OA 1ZPCA 1YPHC 1DFPA 4CBNA 2YOLA 2Z3DA 1NM6A 2GV7A 1CQQA 1HJ9A 1C5WB 3M3SA 3RXEA 5DKMA 3O8RA 1YPLH 3H7OA 1C1VH 1LHFH 1PPFE 2EC9H 4INLA 4AYVB 1AUTC 4CH2B 1TNJA 5E2PA 1E36B 1WQSA 2Y5FA 2WPJS 2AERH 2QY0B 4B2CA 1H9LB 1Q31A 1W3CA 2ODQA 3DUXH 1BBRK 1G3BA 1HPGA 5BRRE 1HAIH 4Z6AH 2UUJB 1FNIA 2ZQ1A 3A7TA 4CR5A 3SJKA 1CT0E 1AZZA 3SI3H 1OPHB 3UQOA 3CS0A 1UTQA 2OBQA 1LQEA 1T8OA 2Q6FA 3KQEA 3DFLA 4O03A 1QURH 1FUJA 1DITH 2VVVA 1NU7B 2H5CA 3URCA 2J38A 2OQ5A 1XUFA 5AHGH 1SL3A 2XBYA 1MAXA 5DGJA 2FOMB 4X1NU 4BANB 2ZZUH 4ZMAH 4F4OC 5GCHF 1O3PB 2FI4E 4ABGA 3RXHA 3RUOA 2BY6X 3BN9A 1O2UA 5GPIB 1EOJA 1K1NA 3MO3A 2H5DA 2A31A 1SVPA 1T4VH 2ASUB 5CMXH 1VGCB 1XUKA 2WPHS 2WYJA 3A7WA 4NA9H 4GSOA 3KQCA 4CRAA 1F5RA 1LPZB 1BIOA 1N8OB 2ZU5A 5L2YH 1FIWA 1C5LH 3M5MA 2VIPA 1SGQE 3MHWU 1O3NA 2ZCKP 3TNTA 1Z6JH 1OOKB 1DOJA 5L2ZH 2J92A 1E38B 3D23A 5T3HA 1ABJH 3HPTB 3S7KB 1ZZZA 2FLBH 1W2KH 3DFJA 1MD7A 3AASA 1SLUB 5HXFA 1GI2A 1YP9A 1DLKB 1HGTH 3ZVCA 2SNWA 5C67A 1O2TA 2QXGA 3LGVA 1KLJH 2Q6DA 2ZPSA 1MTSA 1ZPBA 1Y3XA 3K6YA 3UWJH 3GCNA 1ZJKA 2BD9A 3SV8A 3ESTA 3RU4D 2QYIA 1ELFA 3MU4A 1DICA 4AN7A 1BBRE 4XFQA 2ZFSA 1QRWA 3B8JA 1LPGB 1EJMA 4Q7ZA 2VH6A 2CV3A 1HIAA 5K7RA 2BX4A 4XBBA 1GBJA 1O5EH 1C2EA 4B2AA 5FBEA 1X7AC 2P3TB 3FFGA 1Z6EA 1GPZA 2H9TH 1VGCC 1TBQH 3E90B 1OX1A 1JOUB 4GPGA 2A4OA 1BBRH 1MTUA 4FUIA 3S9AA 4ZHLU 4LK4A 1O2OA 3QGJA 1W13U 2WYGA 1ORFA 3OX7U 4JYTA 3EBNA 3QZRA 1IHSH 1BMNH 1MQ6A 4CH8B 3V7TA 1A5GH 1DANH 5FAHA 1CHGA 4DJZB 2ESTE 1GJ8B 4X0WU 5JDUB 2Q1JA 4UFGH 2W3KA 2LPRA 3LOXA 3UR9A 1DSUA 1K1OA 3GY3A 5T6DA 3UFAA 1BTXA 3SU1A 3W94A 2QXHA 4BNRA 1ELGA 4WH6A 3MOCA 1G2MA 4K69A 5DJ7A 2VU8E 1LHDH 1QJ7B 4E06H 1KXFA 4LXBH 4NG9H 1HAVA 4FUCA 1WUNH 2B7DH 4FVBA 4MPWA 4Q80A 2ULLA 4NFEA 2PKAA 2PSXA 2H9HA 2VIWA 3EAJA 2JETC 1G9IE 1HJAB 1KTSB 3F68H 3NK8A 1TFXA 1PYTD 1VCWA 2GTBA 1YYY1 3A82A 3HATH 4YM9A 2G8TA 1FZZA 2VIVA 4H6SB 3GY6A 3AW0A 3BEUA 4ZHMU 1OXGA 3ZZAA 1O38A 4AZ2B 1QRXA 4ABJA 2D2DA 2CHAB 3M7QA 3PMAB 3TNSA 1BQYA 4IBLH 1S6FA 1O2JA 8GCHG 4OS7A 4BTUB 5JB8S 8LPRA 1UJ1A 1V2ST 2O9QA 3FP8E 1TGTA 5DO4H 4HGCA 4ZUHA 1NFYA 3G01A 1BTWA 3ZVDA 2IJOB 5EXMA 1ESTA 2WV4A 1GI9B 1SHHB 3V13A 4AG2A 4AG1A 4BAOB 1TGBA 2A7JA 1FPHH 3QLPH 2QF3A 4PROA 1FAKH 1K1LA 2FX6A 4CBOA 1SR5C 2ZFRH 3PO1B 2V6NA 1TRNA 3EA8A 1LHGH 3MYWA 4K8BA 4MPVA 3RXSA 1C2IA 2O8WA 5DP7A 2ZI2H 4DY7B 3SU6A 2C90B 1GHVH 5H4IB 3RMMH 4TY6A 2H2ZA 1IQHA 1MMJN 2VVCA 3VB5A 5EODA 2ZDAH 1MKWK 4AGJA 1O2YA 1TRMA 1P2NA 1FI8A 1ZGVA 1C1UH 2GCTB 1C5ZB 1KDQA 1XXDA 2NU3E 2XYAA 3BTFE 1XKAC 1TX7A 1BTYA 2W7SA 1Y3YA 3UIRA 1AO5A 3AAUA 1GMDF 1GHBG 5AF9H 1VR1H 2QAAA 4SGAE 2ZTXA 1LMWB 1EAXA 4Y7BA 1F0SA 3DT0H 2QC2A 1HJAC 1TOCB 3OYPA 4YOJA 1CA8B 2J95A 1VCQA 1XM1A 2BD2A 1HDTH 4IC5A 4KTUA 4OS2A 2O8MA 4ZAEA 1L1JA 1O3BA 1WU1A 4ZKNU 2ZG0H 4B76A 3PLBA 1AFEH 1C5SA 3RXRA 2Y5GA 3BTKE 2QV1A 4MLFB 1TE0A 2QN5T 2FESH 5LPEA 3A7YA 2ALVA 2ZGHA 1GVLA 2A5KA 4NSVA 3PTNA 3LC5A 3M61U 3BV9B 3T5FH 2OTVA 1SC8U 4NA7A 1G37A 2Z9IA 4Y10E 4RKOB 4H6TA 2BYAX 3QDZB 2B9LA 1C4Y2 4RN6A 4AB9A 3SNAA 1C5VA 5TCAA 1AI8H 2ANKH 4DVAU 4MVNA 2ZC9H 4IMQA 3ZZ5A 5EU8A 3TPIZ 3VXFH 2FOEA 3QGNB 2GCHG 4X6MA 5TJXA 2A1DB 2A4RA 4YZUA 1UTLM 4HI3A 1GHAG 1GMHG 1ANDA 3KF2A 2GDDA 4E05H 3BTME 1UVPA 2OLGA 1V2MT 1IQLA 3BTHE 1QB1A 1D3TB 4FUBA 4OGXA 1MU6B 2GCTC 1ZTLA 1GBHA 5K0HA 5JYIA 3BF6H 1MKXH 1QBNA 1OYQA 3S0NA 1C5UA 1NTPA 1V2OT 3LGYA 1Y5UT 3ODFA 4Y6DA 4Y8ZA 5EW2H 3TJNA 2NWNA 1O34A 1Y3UA 1GDQA 3A7VA 1QBOA 1P8VC 1ZMNA 2R0LA 3KCGH 4R0IA 1QIXB 1TA6A 2A45B 4X1SU 3P6ZB 1TPAE 3SZNA 2FMJA 1Y3VA 1C2DA 3PTBA 1ANCA 2EA3A 3SHAH 1CHOF 1BT7A 1SGFG 4B73A 1F7ZA 2B0FA 3RXPA 1CT2E 2F3CE 3ZVFA 3RXUA 2LNCA 1TX6A 3GY7A 3MWIU 2XRCA 3I77A 4WH8A 1EAUA 1GI5A 1MKWH 3GCTF 2ANMH 2ZECA 4NIXA 2XC0A 1YLDA 1XXFA 2V3OH 4H4FA 2Z6BD 4A1XA 1LDTT 1ZPZA 1SFQB 2AH4X 3A8AA 3MH7A 5C1XA 2DUCA 2GZ7A 2ZU4A 1C5QA 3UOPA 3RU4E 2QXJA 2F9NA 3L6PA 3SJ9A 1P9SA 1EP5A 3OU0A 3TH3H 2ANWA 4IGDA 3UWIA 7GCHG 5DK1A 5DP6A 1GGDC 1WQVH 1S85A 3RM0H 1HAVB 2BZAA 3PV4A 1GBCA 2CMYA 1YBWA 2PKAB 2WPKS 2XC5A 2ZGJA 3RU4T 1WSSH 4CRCA 1P05A 1K22H 3MU1A 1FIZA 1P11E 4Y76A 3KIDU 1TB6H 3Q3XA 5C3NA 1V2PT 4YO9A 3A89A 1GBEA 3KNXA 3ZVAA 1QA0A 1CSOE 1FMGA 1C4V2 8ESTE 5A0AE 1GI8B 3MNCA 1C4U2 1GMCF 2RDLA 1D9IA 2BHGA 1MAYA 3F6UH 3KEEA 1GBFA 1TNLA 3S7HB 4K60A 1BHXF 3KQBA 4FU7A 1UK3A 1SGDE 4MNWA 6LPRA 4YLUA 2D26C 1UTPA 1CGJE 4F49A 1ELBA 1GVZA 1TWXB 1ZMLA 1A7SA 1C5OH 3RXDA 2J2UA 2J4IA 3P8OA 1E0FD 1GBMA 1Z8IB 1EJAA 2THFB 2OBOA 5ESTE 3CP7A 2Z9JA 5DP5A 1NFUA 4O9VA 1ELEE 2PGBB 4UFDH 2YNAA 3F9EA 1IQIA 1P03A 5CE1A 2ZWLH 2BX3A 2BY5X 3LU9B 1ANEA 1H4WA 4BAHB 1W0YH 3T25A 4ISLA 3ZZDA 4X2VA 1CGIE 3ATWA 1MBMA 1DXWA 3ZV9A 1ELCA 4R8TB 1PJPA 1SOTA 3TGJE 1P09A 3GISB 3DA9B 1AB9B 4WMFA 1O3DA 2FTMA 2TIOA 1C1RA 2BB4A 1C1QA 2BXTH 2QXIA 3S9CA 3RXMA 2G52A 1L1NA 2GT7A 1WOFA 2AGEX 2UWLA 4I32A 1EB1H 2XCFA 2BLWA 1BUIA 2HLCA 4K1EA 2ODPA 1TALA 2XTTB 3HK3B 4LOYH 1C5NH 3IITA 3C1KA 3SORA 1DWCH 1GBDA 2GP9B 3GYMA 1MBQA 2BTCE 1QQ4A 1C2FA 4NIVA 2CN0H 4ISOA 1KLTA 2BLVA 3ATKA 4JYVH 3M7TA 3O8CA 1ACBE 1KY9A 2M5TA 2PUXB 2XCNA 2HPQH 3GOVB 3MO9A 4Y8XA 3GY4A 1P2IA 4Y7AA 2ZGCA 4AB8A 2SGQE 1OKXA 1JIRA 1H8DH 4YT6H 1SLWB 3KN2A 1GDNA 4HFPB 4ISIH 3I29A 3E0PB 4NZLA 1QJ6B 5FBIA 1ANBA 5A09A 3PMJA 2P59A 3SI4H 2SGFE 5HM9A 1IQNA 4XDEA 5F8TA 2PR3A 1VCPA 4WXIA 4I33A 1BRAA 1P3CA 2Z9LA 3P8NA 3K2UA 1O37A 1QR3E 5JBBS 1V2VT 1LCYA 4BXWA 3BTEE 4X6PA 2AIQA 1A2CH 3RDZA 3U98H 2OD3B 1EAIA 5DPAA 1YM0A 2AMQA 4MPUA 4O3UA 4ZHAA 1T7CA 1SI5H 5DP8A 1O2QA 2ZEBA 4YESB 1O2HA 1A46H 4M7GA 4RKJB 4JMYA 4I31A 4CREA 1CVWH 3S9BA 1W14U 1O2RA 1ZR0A 3SGAE 1U6QA 4ABAA 1VITG 1TPSA 2ZO3H 1AB9C 1IAUA 3FAOA 2XNIA 3QO6A 1PFXC 2FTLE 1FY8E 5GDSH 3MI4A 4A5TS 3T27A 1C5PA 4X1RU 4OS6A 3QUMP 3ZVEA 2C8XB 4NSYA 2TPIZ 1EXFA 1LO6A 4VGCB 3MH6A 3D65E 5I25A 4UD9H 2KAIB 4U30A 1G3EA 2BOKA 2ILNA 1BCUH 4FU8A 1OWJA 1RD3B 5EGMA 1HRTH 3LGUA 2IOTA 1O3CA 1S82A 3BEFB 5IDKA 5T6GA 1SBWA 2JH6D 3PMBB 2P94A 1C5RA 5FHTA 1DWBH 4Z0KA 1ARCA 4ZKOU 1TGCA 3NPSA 1CA0B 3RXCA 1EP6A 2ZHQH 2OQUA 2BVXH 3RC6A 3TK6A 1DT2A 2R2WU 3TU7H 4ABFA 1MD8A 2ZIQH 3FP7E 3SU2A 2FLRH 1GJCB 1TNHA 3MU8A 3OTJE 3K6ZA 3GYLB 1SGTA 2FI3E 1G2LA 1GJDB 1K21H 1FDPA 2F83A 1V2TT 2G81E 3V3MA 2F91A 1G3DA 4Q2KA 1FQ3A 1GBBA 2JETB 1UTKA 1MCVA 4CRFA 2PTCE 1ESBA 2W26A 1FPCH 1NT1A 5EQRA 2HWLB 3TITA 1H1BA 2CGAA 1NROH 1SQTA 3SV7A 1HAYB 4OS5A 1TQ7B 3CS7A 1Z71A 4B74A 2A5AA 3UTUH 4CRGA 4MDSA 2F9PA 1K2I1 1DVAH
chains in the Genus database with same CATH superfamily
1VZQH 1AVGH 5FX6A 1V2NT 1BDAA 2RCEA 3M5LA 1WBGB 4HZHA 4BXSA 2SGPE 3SV9A 4OM9A 2H9EH 4VGCC 2HGTH 3DHKH 1XKBC 1J15A 1F5LA 1OP0A 1E37B 4FXGH 2XBWA 1UTNA 1SB1H 3U1IB 1A5HA 2PHBA 2XBXA 3FANA 3I78A 3LONA 5DP4A 3VXEH 3MH5A 2NU2E 3PWBA 3SHCH 2WZQA 1P02A 2BQ6B 1KYNA 3NKKA 1WXRA 4U01A 1ZTJA 3SNDA 1SGEE 4GAWA 4AGKA 1GI7B 1EAWA 1BTUA 1ELAA 2Q6GA 3RC4A 3ZZ4A 2XNDD 2EI8A 3P95A 1CA0C 3RXIA 5E0GA 3SBKA 3M5OA 2FX4A 3TH4H 3T2NA 1SLVB 2ZDVH 3ITIA 1P2JA 4B2BA 3KYGA 1UTMA 4JZDH 1OWDA 5SGAE 1YGCH 1UO6A 2FWWA 1MTWA 1SLXB 1K1PA 1G32B 2VIOA 4YTAA 1KXCA 4ZKRU 3ELAH 4ABEA 1BJVA 1KLIH 1SGRE 1TA2A 1MABB 2G51A 4IMZA 2NU1E 3AK5A 4TYDA 5F6MA 1AU8A 2FPZA 1TNIA 4DCDA 3UOUA 1RTKA 1EJNA 4GCHG 3E3TA 2KCAA 2Z9GA 1HBTH 3GY8A 1GHZA 1BTPA 1O33A 3RC5A 5L30H 4THNH 2G55A 2ZCHP 1TMBH 2W3IA 1TIOA 2C8ZB 1AKSB 1ZSKA 1MKXK 1YPGH 1T8LA 2GMTB 5A8XA 2JDID 2BDIA 5ETXA 3WWFA 4WJG2 1GG6B 2G4TA 1DPOA 3ZV8A 1UHBA 1A0HB 1J8AA 2JH5D 3L33A 1H8IH 4X2WA 2IPHA 3QTVH 4P02A 1S81A 4BOHA 4FUFA 1IQJA 3TVJB 2J9NA 4FETA 2STBE 1F0TA 2XOKD 4AFQA 3SZEA 1GJ5H 2BLQA 1GJ6A 1NC6A 4ABIA 4XD7D 4AOQA 1NESE 1P06A 1SQAA 1XUGA 2BDGA 3BG4C 4KP0A 1ZHRA 3QK1A 3B23B 2BD7A 5B6LA 2Z7FE 3E6PH 4DOQA 1MH0A 3EA7A 1H8HD 1Z8GA 5F8ZA 1HAOH 2TBSA 1TMTH 2V7QD 4ISHH 4A92A 2SFAA 2VGCB 2QF4A 4AX9H 3HGPA 2OINA 3ZVBA 4UEHH 1V2LT 4KGAA 3RP2A 5DN6D 1IOEA 4WXVA 4U2WA 3SUGA 1EX3A 3V0XA 2ZP0H 1IQGA 2TGPZ 1P57B 1NRRH 1AE8H 4GHQA 1T8NA 3NXPA 2IN2A 1P2MA 1BRCE 4K3JA 1QB9A 4FUEA 2CF9H 3U69H 1MQ5A 2F9BH 3PYHA 3UNSA 3A8CA 2ZU1A 2SGEE 3U8RH 2KCYA 1GHYH 2ZHEH 1L4DA 5C1YA 4CRBA 1GJ9B 2QGRA 1Y5AT 4DW2U 3LGIA 3H5CB 4X6OA 2QCYA 1AQ7A 1ETRH 1TGNA 3HGNA 3RXLA 1SHYA 1WTGH 2HNTE 4I8HA 1D3QB 3DD2H 5EQSA 2GMTC 3JZ2B 2P95A 1ZMJA 2J94A 4JCNA 4ABDA 1O2WA 1GG6C 1ZRBA 1JBUH 2P93A 1O2GH 4ISNA 1AHTH 1GCTB 1C2KA 3PWCA 4GHTA 1O3MA 1IQMA 1DY8A 3F9GA 1DE7H 1TPPA 2AEIH 1WTHD 4JK6A 1CBWB 3ZZBA 5A8YA 1MZDA 4RSPA 4CR9A 2A4GA 1YPHE 2R9PA 3MH4A 4A7IB 2ZU2A 5BPEA 3M35A 1FLEE 2WPLS 1RGQA 2J34A 3BSQA 5JB9S 3O8BA 2FOHA 3UNRA 5LPFA 3SUFA 1BMMH 2W7UA 4KELA 1L4ZA 5C5NA 1F92A 2R3YA 1GGDB 2VGCC 3KQDA 1VJAU 1O31A 4K1SA 2BY7X 3AAVA 3QX5H 3BIUH 2RA3A 3T26A 1V6DA 1TNKA 4WY3A 2A32A 4AFZA 1O2IA 2BDYA 1DY9A 3A88A 3Q00A 1BJUA 6GCHG 2ZHFH 1P10A 2RA0A 1JMOH 1QJ1B 1O2LA 9LPRA 4X1QU 1EZUC 3EE7A 1S84A 1A5IA 5L6NH 4Y79A 3V12A 3A87A 1UTJA 1OWIA 1QQUA 1J16A 1DSTA 1FY5A 3UB0A 4KKDA 5TCCA 3A7ZA 5JBCS 1TRYA 1N6XA 7LPRA 3ENSB 1Y8TA 1W0ZU 1HIAB 1A1RA 4K2YA 3T29A 4KTCA 8KME2 3Q3KA 1ZJDA 2I6SA 1AD8H 1B5GH 4NA8A 2VBCA 1P0SH 3VPKA 2FZZA 1C2HA 5E2OA 1V2UT 1S5SA 3A7XA 2ZKSA 4NWLA 4D7GA 3SU3A 2ZCLP 1C5TA 1GCDA 4NIWA 3UPEA 1GCTC 5HGGA 2UUKB 2ODYB 2SNVA 2C93B 1QL7A 2A7HA 1CBWC 1O3JA 1JRTA 5GXPA 1W7XH 4ZKSU 1W11U 3MNSA 4P00A 1KXDA 1QBVH 5F53A 1HB0B 3PROA 1UCYK 5GCHG 4J1YA 1GVKB 4BAQB 4FUDA 1NFXA 2ZGBH 1NN6A 5FX5A 4TT3D 8GCHF 5AFZH 1SQOA 4ASHA 2PTNA 1PQ8A 2AHME 1W0JD 4NWKA 3AW1A 2ZFQH 3WY8A 3GDVA 1D3PB 1CU1A 3JZ1B 1O2NA 3ATIA 4TPIZ 5EW1H 2BM2A 4XBCA 3R3GB 3PM3A 3ZZ7A 1UVSH 1HAZB 2V3HH 1F5KU 5GJ4B 1A3BH 4MTBA 4Q7YA 1W0KD 2STAE 2GGVB 3UREA 2HNTF 1ETTH 1GBKA 2XXLA 1O2VA 1O2PA 1V2WT 2O8TA 1KIGH 4X6NA 1UVUH 1YLCA 1QY6A 1FN8A 3HK6B 5IYTA 3W1EA 1A3EH 3M3TA 1C5XB 1GHXH 1Y3WA 4F55A 1P3EA 3UNQA 2B8OH 3ZVGA 1GHBF 3M3VA 1O39A 2OC1A 4B1TA 2G00A 5FCRA 1YPJH 2OCVB 3RLYH 2ZU3A 2VH0A 1O5FH 1AGJA 5E8EH 4Y0YE 2JKHA 2C3SA 5ABWA 2C8YB 2FXRA 4SGBE 3SV2H 2PGQB 2BMGB 3RXQA 1P2KA 1TMUH 2L74A 1TBRH 1UW7A 2ZFPH 4DGJA 1THPB 3P17H 5C0TA 1A0JA 2VWLA 2G5VA 5A8ZA 4KTSA 3SGBE 4X1PU 4CHAC 1DX5M 1KDQB 1W12U 2Y6TA 1YY3A 2RG3A 2ZPRA 3MMGA 3M37A 2IPQX 3A8DA 5EG4A 2BLOA 3KL6A 3RM2H 1V2RT 4FU9A 2ZHWH 3RXAA 2BDAA 1EOLA 3PLPA 5E0HA 4GLYA 1ZTKA 5A0CA 1AY6H 1HAGE 1W8BH 1DUAA 5DG6A 1QB6A 3ZZ6A 3UUZA 4Y11E 1P04A 2D1JA 1O2XA 4INKA 1MU8B 3BTTE 3FP6E 2Y5HA 3BTGE 1NFWA 4UDWH 4GUXA 1PPZA 2Y82A 3SN8A 1C9TA 2I6QA 2J97A 2GCHF 1S83A 5FXLA 1QNJA 2P8OB 1DUEA 1J17T 1K1IA 3S69A 1GHAF 1GMHF 5AFYH 4TY7A 2Z3EA 1J9CH 3EDXB 3N7DA 2FS8A 1ZRKA 5I46H 1HYLA 5EOKA 1V2KT 1K1JA 2UWPA 2G5NA 4DG4A 1A4WH 1CE5A 3A83A 3MNBA 2FOGA 2J5UA 1YWUA 2CF8H 2ZDLA 3KGPA 1UCYH 4INHA 4X2XA 5CHAC 3GICB 2OC8A 1H9HE 2HOBA 5T6FA 3GS9A 1EPTA 2KCPA 1D3DB 5HKKD 1C1OA 4ZXYH 1EZQA 4OS1A 4LZ4B 1NPMA 2F9VA 1OHHD 4MNYA 3PLKA 2Z94A 3BG8A 3GDSA 1OP2A 5A0BA 3A80A 5PTPA 2F4LA 3RXVA 2F9OA 3SOSA 1ESAA 3VEQB 1Y5BT 3GCHB 2GDEH 2VINA 1ZHPA 4I8LA 3ZZ8A 4A1TA 1TABE 2VB0A 3RXFA 1YKTA 4Z1MD 2FS9A 3P92A 2V35A 5EXNA 3OSYA 3T28A 1KXAA 1G30B 2AIPA 1HUTH 2FO9A 1LVOA 2ZFFH 3U8TH 1C2LA 1M9UA 2FIRH 2PWXA 1L0ZA 2VWNA 4U32A 3NUMA 4AFUA 1SG8B 2WINI 1HLTH 5C5OA 2YMSB 3UQVA 2F9UA 1OWEA 2AMPA 1O5DH 2SGAA 3R0FA 1RXPA 2CXVA 1RIWB 1TPOA 3BIVH 1JWTA 5J4QA 2GZ9A 1QFKH 1RFNA 7KMEH 1L2EA 4XRNA 2JJ1D 3F9HA 2GT8A 4FUHA 3SU4A 1HV7A 1YCPH 3BTWE 5KEDA 3VB6A 1C1NA 2BVSH 3VFEA 5A2MH 3H7TA 1O2ZA 4NIYA 2P8OC 1GI6A 1MTNB 2ANYA 2AGIX 1Z7KA 3NWUA 4E7RG 3HKJB 1FAXA 7GCHF 2BD4A 1F2SE 3VG8A 2D8WA 1GMDG 3MTYA 1BTZA 3LGTA 4X8SH 3BTDE 3Q3YA 1PQ7A 4TPYA 1FJSA 1RTLA 1INCA 4UFFH 4BTIB 3CENA 1BB0B 1KTTB 2WPIS 4BAMB 1TQ0B 4QT8C 4D9QA 3SJOA 3ZZ3A 2Y81A 2OXSA 2NU0E 3E16B 4ABBA 1C1TA 1AFQB 1GDUA 1PPHE 2C8WB 4NFFA 1FY4A 2ZDNA 4XSKU 2ZF0H 2XWAA 1IQFA 4B71A 3LJOA 1CGHA 2TGTA 4AORA 4E7NA 3GCHC 2PUQH 1BZXE 1EB2A 1VITH 1CT4E 1TAWA 2Z3CA 2YNBA 1O5AB 5CDFE 1FONA 2QF0A 1OSSA 1O2SA 5G4BA 1NZQH 3ZZ9A 3SNCA 4CRDA 1FY1A 1HAXB 1ELTA 5JPMH 1V2QT 1Z1IA 3TGKE 1LTOA 1LVMA 4Y0ZE 4ESTE 2VIDA 2LIZA 1V3XA 1XVMA 1UTOA 1EUFA 4OGYA 2OC7A 3SNEA 3SU0A 1XUHA 2YMSC 1BA8B 3LT3A 1GL0E 1DDJA 3IG6B 3MU5A 1RIWC 2BQWB 2GVFA 1B0FA 1OWKA 1S0QA 2ZDMA 3ATLA 1LPKB 3SW2B 3T62A 2HVYB 1ETSH 3STIA 3LKWA 4Y71A 2FM2A 1QL8A 2ALPA 1P9UA 1O5CB 2XC4A 3SUEA 3AVZA 1O5GH 1MTNC 2FYQA 4JYUH 4ACBA 3BG4B 3LPRA 2HRVA 5F8XA 3B9FH 2EY4C 2J98B 3BTQE 1AUJA 1O3GA 1PQ5A 2BD3A 3URDA 2ZTYA 1SGCA 3A86A 1E79D 3RLWH 4B75A 3TJVA 1SGNE 2UWOA 2H6MA 3BEIB 4JZFH 5HM2A 4YT7H 3W95A 3NCLA 1NO9H 2GJGA 2GKVE 4Q7XA 4JK5A 3GCOA 4BTTB 1K1MA 2O8UA 3RXJA 1AFQC 5AVDA 2QE7D 1N8OC 1FN6A 2UUYA 3KHVA 2VVUA 4TWWA 2FDAA 1GI0A 2C4FH 1SKYE 1PYTC 3F3BA 2ZNKH 1EATA 4MG3A 1CHOG 1LKBA 1RJXB 1ZGIA 2BXUH 2K1QA 2HVXA 1BMAA 1ZYOA 1BRBE 1QL9A 1F0RA 1LVYA 2XBVA 4DT7B 3O8DA 3LC3A 1UVOA 1E34B 1C2JA 5C0UA 3LDXH 2OP9A 1O30A 1C2GA 3GCTG 1HXFH 2ZA5A 1QHRB 1N6YA 1SFIA 1B7XB 3QZQA 4DT4A 5C20A 1GBIA 1SPJA 3P70B 1HAPH 1DS2E 1JXPA 1UK4A 5B6OA 2WV5A 2QA9E 3TIUA 4IC6A 4I8GA 3UY9A 1AN1E 4X8VH 1EQ9A 1AZ8A 3RXOA 1BMLA 1ZLRA 1ELDE 4UE7H 1Y59T 1ZSJA 1YPEH 2LELA 4ZXXH 1GJ7B 2AMDA 3EQ0H 2R2MB 3IWMA 1C1SA 1UMAH 2XW9A 1HNEE 4K1TA 9ESTA 2GX4A 1C9PA 1XVOA 2AGGX 4ZH8A 1G36A 1S6LA 4J2YB 3VGCB 1O3FA 3LH3A 1Z8JB 1VITF 3N7OA 1C1WH 4ABHA 1PPCE 3M7UA 1AIXH 1EPTB 5ESBA 3FZDA 3E91A 1G3CA 4A1VA 4HTCH 4OS4A 3A81A 4BAKB 1F0UA 3MNXA 3LH1A 1LQDB 2HPPH 4F48B 3OEHD 3WW7A 2ZQ2A 5FCKA 3P8FA 4XOJA 1THRH 1GMCG 1GJAB 1EZSC 2WPMS 3SQEE 1IQEA 2FYRA 5J4SA 2OUAA 2Y7XA 3K65B 1P2QA 5FPTA 1YC0A 2ZPQA 2CK3D 4ACAA 1YF4A 4MNXA 3VB3A 1AWFH 4JZ1A 3FO8D 1Q3XA 1Z8RA 4DURA 1B0EA 1T8MA 2P3UB 1EKBB 5EJ1A 4K5ZA 5HYOA 5JBAS 2PKSB 1P12E 1ZSLA 1QZ8A 2DE9A 1GHWH 2FODA 4MNVA 1NRSH 1SGYE 1HXEH 3M36A 4YOIA 1GI4A 2R3UA 3HKIB 1TBZH 3EA9A 2QF5A 1D6WA 3NZIA 2CJIA 1O2MA 1OYTH 1O3AA 1FXYA 4DIIH 2PLXA 3SQHE 1YPKH 1ARBA 3GDUA 1BITA 2CHAC 1O3KA 4I8JA 3RXGA 3VB7A 2G4UA 1CO7E 1S0RA 2EI6A 1HJ8A 1XUJA 1SQRA 1PPBH 3SJ8A 1O3LA 3EE0B 3VGCC 1D4PB 2GD4B 1WV7H 6ESTA 3TJUA 5GWZA 2H1UA 1BRUP 1O35A 2PSYA 4D9RA 5JBTA 1EPTC 1SGIB 1T32A 1O0DH 2A4QA 1IQKA 3A84A 1TOMH 1V2JT 2FI5E 4X2YA 4TWYA 1XX9A 2PW8H 1TX8A 4XBDA 3SU5A 1GBTA 1OS8A 2BDHA 3PO1C 2FOBA 4D7FA 1N1LA 1ID5H 4YLQH 4WMDA 1QCPA 3H09A 4WMEA 5FL7D 2BD5A 3FZZA 1K28D 3U8OH 1GJ4H 3U1JB 1W10U 3C27B 1SGFA 3LIWA 1DM4B 1DWEH 1O3IA 2TRMA 3N99A 1GBAA 1DXPA 1HAHH 1GJBB 2PKSC 3TGIE 2JJ2D 2FP7B 1BOQA 1WAYB 3ZIAD 2V0BA 3SO3A 1K9OE 2RDEA 2P3FH 1OWHA 1TNGA 5GIBA 1XUIA 3A85A 2V3MA 2Z9KA 3FVFB 2VNTA 1P2OA 2ZHDA 2FOAA 3PRBA 2AFQB 3RMLH 1MZAA 3SJIA 1NU9A 1PQAA 3ODDA 3SV6A 1IHTH 3OY6U 1P01A 2AYWA 2TGAA 3UAIC 2KAIA 1LVBA 2PV9B 4UFEH 3TLOA 5DP9A 4UONA 1ABIH 3E0NB 5LPRA 3TK9A 1HFDA 1SGPE 1L1GA 2A5IA 3M5NA 1O36A 3EGKH 3LJJA 5E0JA 5EQQA 1GI1A 1S6HA 2Y80A 4XE4A 1LKAA 3Q76A 1WCZA 1O3HA 3DCLA 4FUJA 1GL1A 2ZDKA 1JRSA 2GZ8A 3TK5A 4GCHF 3LGWA 1MUEB 3MO6A 2BDBA 1AVWA 4CHAB 2EEKA 3OTPA 1THSH 4Q63A 5F03A 4DIHH 2FOCA 3QN7A 1C2MA 3KQ5A 1Q2WA 2BD8A 3ZYDA 3E1XB 4FUGA 3L3TA 1XMNB 3UR6A 4FVDA 2JH0D 3ZZCA 1UVTH 2FOFA 1ZOMA 2VJ1A 3F0PA 4NZQA 4LZ1H 4IS5A 2WUCA 3SGQE 1TYNA 3GY2A 2BZ6H 4K8YA 2QIQA 3TJOA 1O2KA 3RXBA 1C1PA 4NCYA 3OY5U 5EXLA 1LHEH 2XWBI 3A8BA 3RMNH 5KGOA 2ZTZA 2BY9X 4YXWD 1J14A 1RTFB 5FPYA 1C5MD 1DLEA 1UHBB 1C1MA 4O3TA 1JIMA 1GWAA 4IW4E 1YCPM 5EPNA 1KXEA 1BHXB 4AYYB 1KSNA 3F1SB 2EI7A 2UUFB 2P16A 1PPEE 4YOGA 2KX4A 5CHAB 1NBMD 1WYKA 1TGSZ 2VWMA 3RMOH 2A7CA 2BDCA 2B5TB 3P8GA 1NRNH 3F9FA 1YCPK 3GY5A 3MFJA 4X8TH 4AFSA 1QA7A 1QTFA 3MU0A 5FPSA 1FY3A 1W7GH 2A2QH 1ZHMA 6CHAB 5LH8A 2W5EA 1O3EA 2SGDE 1KMHB 2TGDA 1RS0A 5HMAA 4WVPE 1FV9A 2KM0A 1NY22 1RRKA 1QRZA 2HLDD 1ELVA 2A2XH 1EASA 3RXKA 4FOUC 2BQ7B 1AE5A 2NU4E 3SUDA 1BTHH 1DWDH 1O5BB 2BOHB 1SMFE 3E8LA 4X8UH 4Q4LA 5LGOA 4GVUA 5EPYA 1MCTA 1GBLA 5EIYA 3QWCH 1T4UH 1C5YB 3RXTA 4IN2A 5C1UA 3ZYEA 3PMHB 4MQAA 3SNBA 1Z1JA 2VWOA 1MTVA 1D6RA 4WWYA 2EQNA 3D62A 1UCYE 3D49H 3TH2H 5C2ZA 2JIZD 2DE8A 4Y8YA 4ZROA 2Y7ZA 2BY8X 2WUBA 4I7YH 2R0KA 4JZIA 4A6LA 1O32A 2O8LA 2FEQH 1VJ9U 3Q77A 4I8KA 1EFRD 1A0LA 1QGFA 4MPXA 2A0QB 3K9XB 1UK2A 1AVXA 1E35B 1OP8A 2BVRH 2HALA 4D8NA 1AKSA 1EZXC 2ZGXH 1NRQH 4O97A 1TONA 2HNTC 1SOZA 1NS3A 5DP3A 7ESTE 4D76A 5DSFA 3VB4A 3U9AH 2ZFTA 1NRPH 2PFEA 1SSXA 4JZEH 3PB1E 1YPMH 3ATMA 3F2HA 4H42U 3QTOH 2K7XA 2KCOA 4IN1A 3OEED 6GCHF 2VIQA 1LHCH 1TLDA 3STJA 3F2FA 1HCGA 1KXBA 4WF8A 1A61H 5T1VA 1AWHB 3PRDA 2AS9A 1GI3A 2LP6A 2OC0A 1T31A 3EYDA 4NGAH 1AMHA 6CHAC 1PPGE 1H9IE 2GV6A 1O3OA 1ZPCA 1YPHC 1DFPA 4RT1A 4CBNA 2YOLA 2Z3DA 1NM6A 2GV7A 1CQQA 1HJ9A 1C5WB 3M3SA 3RXEA 5DKMA 3O8RA 1H8ED 1YPLH 3H7OA 1C1VH 1LHFH 1PPFE 2EC9H 3FN8A 4INLA 4AYVB 1AUTC 4CH2B 1TNJA 5E2PA 1E36B 1WQSA 2Y5FA 2WPJS 2K8IA 2AERH 2QY0B 4B2CA 1H9LB 1Q31A 1W3CA 2ODQA 3DUXH 1BBRK 1G3BA 1HPGA 5BRRE 1HAIH 4Z6AH 1YLNA 2UUJB 1FNIA 2ZQ1A 3A7TA 4CR5A 3SJKA 4B6FA 1CT0E 1AZZA 3SI3H 1OPHB 3UQOA 3CS0A 1UTQA 2OBQA 1LQEA 1T8OA 2Q6FA 3KQEA 3DFLA 4O03A 1QURH 1FUJA 1DITH 2VVVA 1NU7B 2H5CA 3URCA 2J38A 2OQ5A 1XUFA 5AHGH 1SL3A 2XBYA 1MAXA 5DGJA 2KZ4A 2FOMB 4X1NU 1WDIA 4BANB 3FOAA 2ZZUH 4ZMAH 4F4OC 5GCHF 1O3PB 2FI4E 4ABGA 3RXHA 3RUOA 2BY6X 3BN9A 1O2UA 5GPIB 1EOJA 1K1NA 3MO3A 2A31A 2H5DA 1SVPA 1T4VH 2ASUB 5CMXH 1VGCB 1XUKA 2WPHS 2WYJA 4AC9A 3PV5A 3A7WA 4NA9H 4GSOA 3KQCA 4CRAA 1F5RA 1LPZB 1BIOA 1N8OB 1VKYA 2ZU5A 5L2YH 1FIWA 1C5LH 3M5MA 2VIPA 1SGQE 2L6OA 3MHWU 1O3NA 2ZCKP 3TNTA 1Z6JH 1OOKB 1DOJA 5L2ZH 2J92A 1E38B 3D23A 5T3HA 1ABJH 3HPTB 3S7KB 1ZZZA 2FLBH 1W2KH 3DFJA 1MD7A 3AASA 1SLUB 5HXFA 1K0HA 1GI2A 1YP9A 1DLKB 1HGTH 3ZVCA 2SNWA 5C67A 1O2TA 2QXGA 3LGVA 1KLJH 2Q6DA 2ZPSA 1MTSA 1ZPBA 1Y3XA 3K6YA 3UWJH 3GCNA 1ZJKA 2BD9A 2WPDD 3SV8A 3ESTA 3RU4D 2QYIA 1ELFA 3MU4A 2IJD1 1DICA 4AN7A 1BBRE 4XFQA 2ZFSA 1QRWA 3B8JA 1LPGB 2K0QA 1EJMA 4Q7ZA 2VH6A 2CV3A 1HIAA 5K7RA 2BX4A 4XBBA 1GBJA 1O5EH 1C2EA 5EJZA 4B2AA 2YMSD 5FBEA 1X7AC 2P3TB 3OE7D 3FFGA 1Z6EA 1GPZA 2H9TH 1VGCC 1TBQH 3E90B 1OX1A 1JOUB 4GPGA 2A4OA 1BBRH 1MTUA 4FUIA 3S9AA 4ZHLU 4LK4A 1O2OA 3QGJA 1W13U 2WYGA 1ORFA 3OX7U 4JYTA 3EBNA 3QZRA 1IHSH 1BMNH 1MQ6A 4CH8B 3V7TA 1A5GH 1DANH 5FAHA 1CHGA 4DJZB 2ESTE 1GJ8B 4X0WU 5JDUB 2Q1JA 4UFGH 2W3KA 2LPRA 3LOXA 3UR9A 5C17A 1DSUA 1K1OA 3GY3A 5T6DA 3UFAA 1BTXA 3SU1A 3W94A 2QXHA 4BNRA 1ELGA 4WH6A 3MOCA 1G2MA 4K69A 5DJ7A 2VU8E 1LHDH 1QJ7B 4E06H 1KXFA 4LXBH 4NG9H 1HAVA 4FUCA 1WUNH 2B7DH 4FVBA 4MPWA 4Q80A 2ULLA 4NFEA 2PKAA 1NBME 2PSXA 2H9HA 2VIWA 3EAJA 2JETC 1G9IE 1HJAB 1KTSB 3F68H 3NK8A 1TFXA 1PYTD 1VCWA 2GTBA 1YYY1 3A82A 3HATH 4YM9A 2G8TA 4M9FA 1FZZA 2VIVA 4H6SB 3GY6A 3AW0A 3BEUA 4ZHMU 1OXGA 3ZZAA 2KFWA 1O38A 4AZ2B 1QRXA 4ABJA 2D2DA 2CHAB 3M7QA 3PMAB 3TNSA 1BQYA 4IBLH 1S6FA 1O2JA 8GCHG 4OS7A 4BTUB 5JB8S 8LPRA 1UJ1A 1V2ST 2O9QA 3FP8E 1TGTA 5DO4H 4HGCA 4ZUHA 1NFYA 3G01A 1BTWA 3ZVDA 2IJOB 5EXMA 1E1RD 1ESTA 2WV4A 1GI9B 1SHHB 3V13A 4AG2A 4AG1A 3U28C 4BAOB 1TGBA 2A7JA 5C94A 1FPHH 3QLPH 2QF3A 4PROA 1FAKH 1K1LA 2FX6A 4CBOA 1SR5C 2ZFRH 3PO1B 2V6NA 1TRNA 3EA8A 1LHGH 3MYWA 4K8BA 4MPVA 3RXSA 1C2IA 2O8WA 5DP7A 2ZI2H 4DY7B 3SU6A 2C90B 1GHVH 5H4IB 3RMMH 4TY6A 2H2ZA 1IQHA 1MMJN 2VVCA 3VB5A 5EODA 2ZDAH 1MKWK 3DSPA 4AGJA 1O2YA 1TRMA 1P2NA 1FI8A 1ZGVA 1C1UH 2GCTB 1C5ZB 1KDQA 1XXDA 2NU3E 2XYAA 3BTFE 1XKAC 1TX7A 1BTYA 2W7SA 1Y3YA 3UIRA 1AO5A 3AAUA 1GMDF 1GHBG 1FX0B 5AF9H 1VR1H 2QAAA 4SGAE 2ZTXA 1LMWB 2WSSD 1EAXA 4Y7BA 1F0SA 3DT0H 2QC2A 1HJAC 1TOCB 3OYPA 4YOJA 1CA8B 2J95A 1VCQA 1XM1A 2BD2A 1HDTH 4IC5A 4KTUA 4OS2A 2O8MA 4RT0A 4ZAEA 1L1JA 1O3BA 1WU1A 4ZKNU 2ZG0H 4B76A 3PLBA 1AFEH 1C5SA 3RXRA 2Y5GA 3BTKE 2QV1A 4MLFB 1TE0A 2QN5T 2FESH 5LPEA 3A7YA 2ALVA 2ZGHA 1GVLA 4TSFD 2A5KA 4NSVA 3PTNA 3LC5A 2F43B 3M61U 3BV9B 3T5FH 2OTVA 1SC8U 4NA7A 1G37A 2Z9IA 4Y10E 4RKOB 4H6TA 2BYAX 3QDZB 2B9LA 1C4Y2 4RN6A 4ZCNA 4AB9A 3SNAA 1C5VA 5TCAA 1AI8H 2ANKH 4DVAU 4MVNA 2ZC9H 4IMQA 3ZZ5A 5EU8A 3TPIZ 3VXFH 2FOEA 3QGNB 2GCHG 5CHBA 4X6MA 5TJXA 5HIZA 2A1DB 2A4RA 4YZUA 1UTLM 4HI3A 2W6ID 1GHAG 1GMHG 1ANDA 3KF2A 2GDDA 4E05H 3BTME 1UVPA 2OLGA 1V2MT 3DSGA 1IQLA 3BTHE 1QB1A 1D3TB 4FUBA 4OGXA 1MU6B 2GCTC 1ZTLA 1GBHA 5K0HA 5JYIA 3BF6H 1MKXH 1QBNA 1OYQA 3S0NA 1C5UA 2WV9A 1NTPA 1V2OT 3LGYA 1Y5UT 3ODFA 4Y6DA 4Y8ZA 5EW2H 3TJNA 2NWNA 5IK2D 1O34A 4HG6A 1Y3UA 1GDQA 3A7VA 1QBOA 1P8VC 1ZMNA 2R0LA 3KCGH 4R0IA 1QIXB 1TA6A 3N7EA 2A45B 4X1SU 3P6ZB 1TPAE 3SZNA 2FMJA 1Y3VA 1C2DA 3PTBA 1ANCA 2EA3A 3SHAH 1CHOF 1BT7A 1SGFG 4B73A 1F7ZA 2B0FA 3RXPA 1CT2E 2F3CE 3ZVFA 3RXUA 2LNCA 1TX6A 3GY7A 3FKSD 3MWIU 2XRCA 3I77A 4WH8A 1EAUA 1GI5A 4B6EA 1MKWH 3GCTF 2ANMH 5KECA 2ZECA 4NIXA 2XC0A 1YLDA 1XXFA 2V3OH 3F0OA 4H4FA 2Z6BD 4A1XA 1LDTT 1ZPZA 1SFQB 2AH4X 3A8AA 3MH7A 5C1XA 2DUCA 2GZ7A 2ZU4A 1C5QA 3UOPA 3RU4E 2QXJA 2F9NA 3L6PA 3SJ9A 1P9SA 1COWD 1EP5A 3OU0A 3TH3H 2ANWA 4IGDA 3UWIA 7GCHG 5DK1A 5DP6A 1GGDC 1WQVH 1S85A 3RM0H 1HAVB 2BZAA 3PV4A 1GBCA 2CMYA 3NRLA 1YBWA 2PKAB 2WPKS 2XC5A 2ZGJA 3RU4T 1WSSH 4CRCA 1P05A 3WWBA 1K22H 3MU1A 1FIZA 1P11E 4Y76A 3KIDU 1TB6H 3Q3XA 5C3NA 1V2PT 4YO9A 3A89A 1GBEA 3KNXA 3ZVAA 1QA0A 1CSOE 1FMGA 1C4V2 2M2AA 8ESTE 5A0AE 1GI8B 3MNCA 1C4U2 1GMCF 2RDLA 1D9IA 2OK5A 2BHGA 1MAYA 3F6UH 3KEEA 1GBFA 1TNLA 3S7HB 4K60A 1BHXF 3OFND 3KQBA 4FU7A 1UK3A 1SGDE 4MNWA 6LPRA 4YLUA 2D26C 1UTPA 1CGJE 4F49A 1ELBA 1GVZA 1TWXB 1ZMLA 1A7SA 1C5OH 3RXDA 2J2UA 2J4IA 3P8OA 1E0FD 1GBMA 1Z8IB 1EJAA 2THFB 3MQKC 2OBOA 2J98A 5ESTE 3CP7A 2Z9JA 5DP5A 1NFUA 4O9VA 1ELEE 2PGBB 4UFDH 2YNAA 3F9EA 1IQIA 1P03A 5CE1A 2ZWLH 2BX3A 2BY5X 3LU9B 1ANEA 1H4WA 4BAHB 1W0YH 3T25A 4ISLA 3ZZDA 4X2VA 1CGIE 3ATWA 1MBMA 1DXWA 3ZV9A 1ELCA 4I86A 4R8TB 1PJPA 1SOTA 3TGJE 1P09A 3GISB 3DA9B 1AB9B 4WMFA 1O3DA 2FTMA 2KR7A 1C1RA 2BB4A 1C1QA 2BXTH 2QXIA 2TIOA 3S9CA 3RXMA 2G52A 1L1NA 2GT7A 1WOFA 2AGEX 2UWLA 4I32A 1EB1H 2XCFA 2W6JD 2BLWA 1BUIA 2HLCA 4K1EA 2ODPA 1TALA 2XTTB 3HK3B 4LOYH 1C5NH 3IITA 3C1KA 3SORA 1DWCH 1GBDA 2GP9B 3GYMA 1MBQA 2BTCE 1QQ4A 1C2FA 4NIVA 1E1QD 2CN0H 4ISOA 1KLTA 2BLVA 3ATKA 4JYVH 3M7TA 3O8CA 1ACBE 1KY9A 2M5TA 2PUXB 2XCNA 2HPQH 3GOVB 3MO9A 4Y8XA 3GY4A 1P2IA 4Y7AA 2ZGCA 4AB8A 2SGQE 4ASUD 1OKXA 1JIRA 1H8DH 4YT6H 1SLWB 3KN2A 1GDNA 4HFPB 4ISIH 3I29A 3E0PB 4NZLA 1QJ6B 5FBIA 1ANBA 5A09A 3PMJA 2P59A 5HIYA 2SGFE 3SI4H 5HM9A 1IQNA 4XDEA 5F8TA 2PR3A 1VCPA 4RI0A 1BMFD 4WXIA 4I33A 1BRAA 1P3CA 2Z9LA 3P8NA 3K2UA 1O37A 1QR3E 5JBBS 1V2VT 1LCYA 4BXWA 3BTEE 4X6PA 2AIQA 1A2CH 3RDZA 3U98H 2OD3B 1EAIA 5DPAA 1YM0A 2AMQA 4MPUA 4O3UA 2RFKC 4ZHAA 1T7CA 1SI5H 5DP8A 1O2QA 2ZEBA 4YESB 1O2HA 1A46H 4M7GA 4RKJB 4JMYA 4I31A 4CREA 1CVWH 3S9BA 1W14U 1O2RA 1ZR0A 3SGAE 1U6QA 4ABAA 1VITG 1TPSA 2ZO3H 1AB9C 1IAUA 3FAOA 2XNIA 3QO6A 1PFXC 2FTLE 1FY8E 5GDSH 3MI4A 4A5TS 3T27A 1C5PA 4X1RU 3F2GA 4OS6A 3QUMP 3ZVEA 2C8XB 4NSYA 2TPIZ 1EXFA 1LO6A 4VGCB 3MH6A 3D65E 5GNDA 5I25A 4UD9H 3DSOA 3KYFA 2KAIB 4U30A 1G3EA 2BOKA 3PV2A 2ILNA 2PP6A 1BCUH 4FU8A 1OWJA 1RD3B 5EGMA 1HRTH 3LGUA 2IOTA 1O3CA 1S82A 3BEFB 5IDKA 5T6GA 1SBWA 2JH6D 3PMBB 2P94A 1C5RA 5FHTA 1DWBH 4Z0KA 1ARCA 4ZKOU 5EJLA 1TGCA 3NPSA 1CA0B 3RXCA 1EP6A 2ZHQH 2OQUA 2WHXA 2BVXH 3RC6A 3TK6A 1DT2A 2R2WU 3TU7H 4ABFA 1MD8A 2ZIQH 3FP7E 3SU2A 2FLRH 3OAAD 1GJCB 1TNHA 3MU8A 3OTJE 3K6ZA 3CNRA 3GYLB 1SGTA 2FI3E 3SYJA 1G2LA 1GJDB 1K21H 1FDPA 2F83A 1V2TT 2G81E 3V3MA 2F91A 1G3DA 4Q2KA 1FQ3A 1GBBA 2JETB 1UTKA 1MCVA 4CRFA 2PTCE 1ESBA 2W26A 1FPCH 1NT1A 5EQRA 2HWLB 3TITA 1H1BA 2CGAA 1NROH 1SQTA 3SV7A 1HAYB 4OS5A 1TQ7B 3CS7A 1Z71A 4B74A 2A5AA 3UTUH 4CRGA 4MDSA 2F9PA 1K2I1 1DVAH
chains in the Genus database with same CATH topology
1VZQH 1AVGH 5FX6A 1V2NT 1BDAA 2RCEA 3M5LA 1WBGB 4HZHA 4BXSA 2SGPE 3SV9A 2H9EH 4VGCC 2HGTH 3DHKH 1XKBC 1J15A 1F5LA 1OP0A 1E37B 4FXGH 2XBWA 1UTNA 1SB1H 3U1IB 1A5HA 2PHBA 2XBXA 3FANA 3I78A 3LONA 5DP4A 3VXEH 3MH5A 2NU2E 3PWBA 3SHCH 1P02A 2BQ6B 1KYNA 3NKKA 4U01A 1ZTJA 3SNDA 1SGEE 4GAWA 4AGKA 1GI7B 1EAWA 1BTUA 1ELAA 2Q6GA 3RC4A 3ZZ4A 2EI8A 3P95A 1CA0C 3RXIA 5E0GA 3SBKA 3M5OA 2FX4A 3TH4H 3T2NA 1SLVB 2ZDVH 3ITIA 1P2JA 4B2BA 1UTMA 4JZDH 1OWDA 5SGAE 1YGCH 1UO6A 2FWWA 1MTWA 1SLXB 1K1PA 1G32B 2VIOA 4YTAA 1KXCA 4ZKRU 3ELAH 4ABEA 1BJVA 1KLIH 1SGRE 1TA2A 2G51A 4IMZA 2NU1E 4TYDA 5F6MA 1AU8A 2FPZA 1TNIA 4DCDA 3UOUA 1RTKA 1EJNA 4GCHG 3E3TA 2Z9GA 1HBTH 3GY8A 1GHZA 1BTPA 1O33A 3RC5A 5L30H 4THNH 2G55A 2ZCHP 1TMBH 2W3IA 1TIOA 2C8ZB 1AKSB 1ZSKA 1MKXK 1YPGH 1T8LA 2GMTB 5A8XA 2BDIA 5ETXA 4WJG2 1GG6B 2G4TA 1DPOA 3ZV8A 1UHBA 1A0HB 1J8AA 2JH5D 3L33A 1H8IH 4X2WA 2IPHA 3QTVH 1S81A 4BOHA 4FUFA 1IQJA 3TVJB 2J9NA 2STBE 1F0TA 4AFQA 1GJ5H 2BLQA 1GJ6A 1NC6A 4ABIA 4AOQA 1NESE 1P06A 1SQAA 1XUGA 2BDGA 3BG4C 4KP0A 1ZHRA 3QK1A 3B23B 2BD7A 2Z7FE 3E6PH 4DOQA 1MH0A 3EA7A 5F8ZA 1Z8GA 1HAOH 2TBSA 1TMTH 4ISHH 4A92A 2SFAA 2VGCB 4AX9H 3HGPA 2OINA 3ZVBA 4UEHH 1V2LT 4KGAA 3RP2A 1IOEA 4WXVA 4U2WA 3SUGA 1EX3A 3V0XA 2ZP0H 1IQGA 2TGPZ 1P57B 1NRRH 1AE8H 4GHQA 1T8NA 3NXPA 2IN2A 1P2MA 1BRCE 4K3JA 1QB9A 4FUEA 2CF9H 3U69H 1MQ5A 2F9BH 3PYHA 3UNSA 3A8CA 2ZU1A 2SGEE 3U8RH 1GHYH 2ZHEH 1L4DA 5C1YA 4CRBA 1GJ9B 2QGRA 1Y5AT 4DW2U 3LGIA 3H5CB 4X6OA 2QCYA 1AQ7A 1ETRH 1TGNA 3HGNA 3RXLA 1SHYA 1WTGH 2HNTE 4I8HA 1D3QB 3DD2H 5EQSA 2GMTC 3JZ2B 2P95A 1ZMJA 2J94A 4JCNA 4ABDA 1O2WA 1GG6C 1ZRBA 1JBUH 2P93A 1O2GH 4ISNA 1AHTH 1GCTB 1C2KA 3PWCA 4GHTA 1O3MA 1IQMA 1DY8A 3F9GA 1DE7H 1TPPA 2AEIH 1WTHD 4JK6A 1CBWB 3ZZBA 5A8YA 1MZDA 4RSPA 4CR9A 2A4GA 1YPHE 2R9PA 3MH4A 4A7IB 2ZU2A 5BPEA 3M35A 1FLEE 2WPLS 1RGQA 2J34A 3BSQA 5JB9S 3O8BA 2FOHA 3UNRA 5LPFA 3SUFA 1BMMH 2W7UA 4KELA 1L4ZA 5C5NA 1F92A 2R3YA 1GGDB 2VGCC 3KQDA 1VJAU 1O31A 4K1SA 2BY7X 3AAVA 3QX5H 3BIUH 2RA3A 3T26A 1V6DA 1TNKA 4WY3A 2A32A 4AFZA 1O2IA 2BDYA 1DY9A 3A88A 3Q00A 1BJUA 6GCHG 2ZHFH 1P10A 2RA0A 1JMOH 1QJ1B 1O2LA 9LPRA 4X1QU 1EZUC 1S84A 1A5IA 5L6NH 4Y79A 3V12A 3A87A 1UTJA 1OWIA 1QQUA 1J16A 1DSTA 1FY5A 4KKDA 5TCCA 3A7ZA 5JBCS 1TRYA 1N6XA 7LPRA 3ENSB 1Y8TA 1W0ZU 1HIAB 1A1RA 4K2YA 3T29A 4KTCA 8KME2 3Q3KA 1ZJDA 2I6SA 1AD8H 1B5GH 4NA8A 1P0SH 3VPKA 2FZZA 1C2HA 5E2OA 1V2UT 1S5SA 3A7XA 2ZKSA 4NWLA 4D7GA 3SU3A 2ZCLP 1C5TA 1GCDA 4NIWA 3UPEA 1GCTC 5HGGA 2UUKB 2ODYB 2SNVA 2C93B 1QL7A 2A7HA 1CBWC 1O3JA 1JRTA 5GXPA 1W7XH 4ZKSU 1W11U 3MNSA 1KXDA 1QBVH 1HB0B 3PROA 1UCYK 5GCHG 4J1YA 1GVKB 4BAQB 4FUDA 1NFXA 2ZGBH 1NN6A 5FX5A 8GCHF 5AFZH 1SQOA 4ASHA 2PTNA 1PQ8A 4NWKA 3AW1A 2ZFQH 3WY8A 3GDVA 1D3PB 1CU1A 3JZ1B 1O2NA 3ATIA 4TPIZ 5EW1H 2BM2A 4XBCA 3R3GB 3PM3A 3ZZ7A 1UVSH 1HAZB 2V3HH 1F5KU 5GJ4B 1A3BH 4MTBA 4Q7YA 2STAE 2GGVB 3UREA 2HNTF 1ETTH 1GBKA 2XXLA 1O2VA 1O2PA 1V2WT 2O8TA 1KIGH 4X6NA 1UVUH 1YLCA 1QY6A 1FN8A 3HK6B 5IYTA 1A3EH 3M3TA 1C5XB 1GHXH 1Y3WA 1P3EA 3UNQA 2B8OH 3ZVGA 1GHBF 3M3VA 1O39A 2OC1A 4B1TA 2G00A 5FCRA 1YPJH 2OCVB 3RLYH 2ZU3A 2VH0A 1O5FH 1AGJA 5E8EH 4Y0YE 2JKHA 2C3SA 5ABWA 2C8YB 2FXRA 4SGBE 3SV2H 2PGQB 2BMGB 3RXQA 1P2KA 1TMUH 1TBRH 2ZFPH 4DGJA 1THPB 3P17H 1A0JA 2VWLA 2G5VA 5A8ZA 4KTSA 3SGBE 4X1PU 4CHAC 1DX5M 1KDQB 1W12U 2Y6TA 2RG3A 2ZPRA 3MMGA 3M37A 3A8DA 5EG4A 2BLOA 3KL6A 3RM2H 1V2RT 4FU9A 2ZHWH 3RXAA 2BDAA 1EOLA 3PLPA 5E0HA 4GLYA 1ZTKA 5A0CA 1AY6H 1HAGE 1W8BH 1DUAA 5DG6A 1QB6A 3ZZ6A 3UUZA 4Y11E 1P04A 2D1JA 1O2XA 4INKA 1MU8B 3BTTE 3FP6E 2Y5HA 3BTGE 1NFWA 4UDWH 4GUXA 1PPZA 2Y82A 3SN8A 1C9TA 2I6QA 2GCHF 1S83A 5FXLA 1QNJA 2P8OB 1DUEA 1J17T 1K1IA 3S69A 1GHAF 1GMHF 5AFYH 4TY7A 2Z3EA 1J9CH 3EDXB 5I46H 2FS8A 1ZRKA 1HYLA 5EOKA 1V2KT 1K1JA 2UWPA 2G5NA 4DG4A 1A4WH 1CE5A 3A83A 3MNBA 2FOGA 2CF8H 2ZDLA 3KGPA 1UCYH 4INHA 4X2XA 5CHAC 3GICB 2OC8A 1H9HE 2HOBA 5T6FA 1EPTA 1D3DB 1C1OA 4ZXYH 1EZQA 4OS1A 4LZ4B 1NPMA 2F9VA 4MNYA 3PLKA 2Z94A 3BG8A 3GDSA 1OP2A 5A0BA 3A80A 5PTPA 3RXVA 2F9OA 3SOSA 1ESAA 3VEQB 1Y5BT 3GCHB 2GDEH 2VINA 1ZHPA 4I8LA 3ZZ8A 4A1TA 1TABE 2VB0A 3RXFA 1YKTA 2FS9A 3P92A 2V35A 5EXNA 3OSYA 3T28A 1KXAA 1G30B 2AIPA 1HUTH 2FO9A 1LVOA 2ZFFH 3U8TH 1C2LA 1M9UA 2FIRH 2PWXA 1L0ZA 2VWNA 4U32A 3NUMA 4AFUA 1SG8B 2WINI 1HLTH 5C5OA 3UQVA 2F9UA 1OWEA 2AMPA 1O5DH 2SGAA 3R0FA 1RXPA 2CXVA 1RIWB 1TPOA 3BIVH 1JWTA 5J4QA 2GZ9A 1QFKH 1RFNA 7KMEH 1L2EA 3F9HA 2GT8A 4FUHA 3SU4A 1HV7A 1YCPH 3BTWE 3VB6A 1C1NA 2BVSH 3VFEA 5A2MH 3H7TA 1O2ZA 4NIYA 2P8OC 1GI6A 1MTNB 2ANYA 2AGIX 1Z7KA 3NWUA 4E7RG 3HKJB 1FAXA 7GCHF 2BD4A 1F2SE 2D8WA 1GMDG 3MTYA 1BTZA 3LGTA 4X8SH 3BTDE 3Q3YA 1PQ7A 4TPYA 1FJSA 1RTLA 1INCA 4UFFH 4BTIB 3CENA 1BB0B 1KTTB 2WPIS 4BAMB 1TQ0B 4QT8C 4D9QA 3SJOA 3ZZ3A 2Y81A 2OXSA 2NU0E 3E16B 4ABBA 1C1TA 1AFQB 1GDUA 1PPHE 2C8WB 4NFFA 1FY4A 2ZDNA 4XSKU 2ZF0H 2XWAA 1IQFA 4B71A 3LJOA 1CGHA 2TGTA 4AORA 4E7NA 3GCHC 2PUQH 1BZXE 1EB2A 1VITH 1CT4E 1TAWA 2Z3CA 2YNBA 1O5AB 1FONA 2QF0A 1OSSA 1O2SA 5G4BA 1NZQH 3ZZ9A 3SNCA 4CRDA 1FY1A 1HAXB 1ELTA 5JPMH 1V2QT 1Z1IA 3TGKE 1LTOA 1LVMA 4Y0ZE 4ESTE 2VIDA 2LIZA 1V3XA 1XVMA 1UTOA 1EUFA 4OGYA 2OC7A 3SNEA 3SU0A 1XUHA 1BA8B 3LT3A 1GL0E 1DDJA 3IG6B 3MU5A 1RIWC 2BQWB 2GVFA 1B0FA 1OWKA 1S0QA 2ZDMA 3ATLA 1LPKB 3SW2B 3T62A 1ETSH 3STIA 3LKWA 4Y71A 2FM2A 1QL8A 2ALPA 1P9UA 1O5CB 2XC4A 3SUEA 3AVZA 1O5GH 1MTNC 2FYQA 4JYUH 3BG4B 3LPRA 2HRVA 5F8XA 3B9FH 3BTQE 1AUJA 1O3GA 1PQ5A 2BD3A 3URDA 2ZTYA 1SGCA 3A86A 3RLWH 4B75A 3TJVA 1SGNE 2UWOA 2H6MA 3BEIB 4JZFH 5HM2A 4YT7H 3W95A 3NCLA 1NO9H 2GKVE 4Q7XA 4JK5A 3GCOA 4BTTB 1K1MA 2O8UA 3RXJA 1AFQC 5AVDA 3KHVA 1N8OC 1FN6A 2UUYA 2VVUA 4TWWA 2FDAA 1GI0A 2C4FH 1PYTC 2ZNKH 1EATA 4MG3A 1CHOG 1LKBA 1RJXB 1ZGIA 2BXUH 2K1QA 2HVXA 1BMAA 1ZYOA 1BRBE 1QL9A 1F0RA 1LVYA 2XBVA 4DT7B 3O8DA 3LC3A 1UVOA 1E34B 1C2JA 3LDXH 2OP9A 1O30A 1C2GA 3GCTG 1HXFH 2ZA5A 1QHRB 1N6YA 1SFIA 1B7XB 3QZQA 5C20A 1GBIA 1SPJA 3P70B 1HAPH 1DS2E 1JXPA 1UK4A 5B6OA 2WV5A 2QA9E 3TIUA 4IC6A 4I8GA 3UY9A 1AN1E 4X8VH 1EQ9A 1AZ8A 3RXOA 1BMLA 1ZLRA 1ELDE 4UE7H 1Y59T 1ZSJA 1YPEH 4ZXXH 1GJ7B 2AMDA 3EQ0H 2R2MB 3IWMA 1C1SA 1UMAH 2XW9A 1HNEE 4K1TA 9ESTA 2GX4A 1C9PA 1XVOA 2AGGX 4ZH8A 1G36A 4J2YB 3VGCB 1O3FA 3LH3A 1Z8JB 1VITF 3N7OA 1C1WH 4ABHA 1PPCE 3M7UA 1AIXH 1EPTB 5ESBA 3FZDA 3E91A 1G3CA 4A1VA 4HTCH 4OS4A 3A81A 4BAKB 1F0UA 3MNXA 3LH1A 1LQDB 2HPPH 2ZQ2A 5FCKA 3P8FA 4XOJA 1THRH 1GMCG 1GJAB 1EZSC 2WPMS 3SQEE 1IQEA 2FYRA 5J4SA 2OUAA 2Y7XA 3K65B 1P2QA 5FPTA 1YC0A 2ZPQA 1YF4A 4MNXA 3VB3A 1AWFH 4JZ1A 1Q3XA 1Z8RA 4DURA 1B0EA 1T8MA 2P3UB 1EKBB 4K5ZA 5HYOA 5JBAS 2PKSB 1P12E 1ZSLA 2DE9A 1GHWH 2FODA 4MNVA 1NRSH 1SGYE 1HXEH 3M36A 4YOIA 1GI4A 2R3UA 3HKIB 1TBZH 3EA9A 1D6WA 3NZIA 2CJIA 1O2MA 1OYTH 1O3AA 1FXYA 4DIIH 2PLXA 3SQHE 1YPKH 1ARBA 3GDUA 1BITA 2CHAC 1O3KA 4I8JA 3RXGA 3VB7A 2G4UA 1CO7E 1S0RA 2EI6A 1HJ8A 1XUJA 1PPBH 3SJ8A 1O3LA 3EE0B 3VGCC 1D4PB 2GD4B 1WV7H 6ESTA 3TJUA 5GWZA 2H1UA 1BRUP 1O35A 2PSYA 4D9RA 5JBTA 1EPTC 1SGIB 1T32A 1O0DH 2A4QA 1IQKA 3A84A 1TOMH 1V2JT 2FI5E 4X2YA 4TWYA 1XX9A 2PW8H 1TX8A 4XBDA 3SU5A 1GBTA 1OS8A 2BDHA 3PO1C 2FOBA 4D7FA 1N1LA 1ID5H 4YLQH 4WMDA 1QCPA 4WMEA 2BD5A 3FZZA 1K28D 3U8OH 1GJ4H 3U1JB 1W10U 3C27B 1SGFA 3LIWA 1DM4B 1DWEH 1O3IA 2TRMA 1GBAA 1DXPA 1HAHH 1GJBB 2PKSC 3TGIE 2FP7B 1BOQA 1WAYB 2V0BA 3SO3A 1K9OE 2P3FH 1OWHA 1TNGA 5GIBA 1XUIA 3A85A 2Z9KA 3FVFB 2VNTA 1P2OA 2ZHDA 2FOAA 2AFQB 3RMLH 1MZAA 3SJIA 1NU9A 1PQAA 3ODDA 3SV6A 1IHTH 3OY6U 1P01A 2AYWA 2TGAA 2KAIA 1LVBA 2PV9B 4UFEH 3TLOA 5DP9A 4UONA 1ABIH 3E0NB 5LPRA 3TK9A 1HFDA 1SGPE 1L1GA 2A5IA 3M5NA 1O36A 3EGKH 3LJJA 5E0JA 5EQQA 1GI1A 1S6HA 2Y80A 4XE4A 1LKAA 3Q76A 1WCZA 1O3HA 4FUJA 1GL1A 2ZDKA 1JRSA 2GZ8A 3TK5A 4GCHF 3LGWA 1MUEB 3MO6A 2BDBA 1AVWA 4CHAB 2EEKA 1THSH 5F03A 4DIHH 2FOCA 3QN7A 1C2MA 1Q2WA 2BD8A 3ZYDA 3E1XB 4FUGA 3L3TA 1XMNB 3UR6A 4FVDA 2JH0D 3ZZCA 1UVTH 2FOFA 1ZOMA 2VJ1A 4NZQA 4LZ1H 4IS5A 2WUCA 3SGQE 1TYNA