3F9FA

Crystal structure of the f140a mutant of sars-coronovirus 3c-like protease at ph 6.0
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
299
structure length
299
Chain Sequence
GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Two adjacent mutations on the dimer interface of SARS coronavirus 3C-like protease cause different conformational changes in crystal structure.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 82
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3f9fA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9fA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9fA02
1WV7H 2ZDLA 3Q3KA 3RP2A 3RC5A 3AASA 1EATA 1G3CA 1BZXE 2XC0A 2XBYA 3T29A 3LOXA 4CRAA 1A0HB 1B5GH 4A1XA 1HDTH 1J8AA 5FPTA 5T6GA 1G36A 1LO6A 2FP7B 3RXAA 1S81A 2FOGA 2GVFA 2VB0A 4E06H 1AVXA 3TNTA 1NPMA 1S5SA 3V12A 1IQHA 1C4Y2 2RDLA 1DSTA 1N1LA 2W3IA 3CP7A 3SQHE 2ZHDA 4K8YA 4CHAB 3MMGA 1K2I1 1OWKA 2P59A 3F1SB 2QXJA 5DPAA 5ESTE 3B8JA 2P3FH 3VB7A 1BQYA 1YPHC 3BIVH 1GGDB 3K9XB 1QBVH 3MU5A 1C1TA 3S9BA 2A5AA 1HB0B 1XUJA 1QRWA 2LPRA 2FI3E 2TGTA 1ZGIA 1PFXC 2VIPA 5TJXA 4GCHF 4GHQA 4ABBA 1S85A 3PROA 1GDNA 4AB9A 1F7ZA 5A0CA 4KELA 4A1TA 3UTUH 1CA0B 2VWNA 1PQ8A 4MLFB 4BTIB 2HPPH 2J92A 1K1LA 3GCNA 2Q6FA 1TONA 2P95A 4MPUA 3M61U 4CREA 2VNTA 1Q2WA 2PWXA 5DG6A 2GMTC 2IPHA 4FUCA 1O37A 2VWMA 1CT0E 2H6MA 2J94A 4INKA 4YLUA 1O3JA 1TYNA 5HGGA 1Z6EA 1QBNA 3RXVA 4NIYA 1YBWA 2BDGA 2ANWA 2NU3E 4IN2A 3NCLA 2OINA 1MTNB 2ZU1A 1YLDA 3PMJA 1VR1H 2FOHA 1O2RA 4AN7A 4FUHA 1P02A 1L1JA 5C2ZA 4ZKOU 3MO9A 2EC9H 4JCNA 4BAKB 3U1JB 6GCHF 1QTFA 1ZMJA 1LHEH 2OD3B 2ZA5A 3FZZA 2ZI2H 3BTFE 2O8MA 4BAHB 1UTNA 3MH7A 1CT4E 4ABIA 5A8ZA 1ESBA 1O2JA 1VITH 2BLVA 5FXLA 1WU1A 4ISIH 1SBWA 3ZVGA 1EKBB 3P8GA 3ZVFA 5A0AE 1RTFB 2ZDKA 3SV7A 4RKOB 2HVXA 4NWKA 1JRTA 1O2XA 1UTKA 1AHTH 2BD2A 1SGDE 1O5AB 2GV7A 3V13A 1FUJA 1NC6A 1DT2A 1WBGB 1E36B 3SOSA 4OS7A 3ZVEA 1HGTH 2PUQH 1MTVA 1DVAH 2QXHA 3MU0A 2JKHA 4K3JA 3VEQB 2PKSC 4OS1A 1YPLH 3RXKA 3LGVA 1SGEE 2XBVA 1L4DA 2OC7A 1IQMA 1Y5AT 2A5IA 1J15A 1QCPA 2C93B 4WMEA 2BY5X 3KQBA 5EXMA 1K1MA 1UTLM 4B2CA 2FWWA 5BPEA 3RXMA 3A80A 5C1UA 5EOKA 1B0FA 4Q7XA 3QN7A 3SBKA 2J9NA 1ANCA 1GBLA 4UD9H 2Z9GA 4KTSA 2ODQA 4DCDA 1HXEH 3M7QA 1GI2A 2YNAA 2STBE 2ZDMA 2OTVA 2C3SA 1PPBH 1QRZA 1HJAB 2G00A 1G37A 2V35A 4CBNA 1O2QA 3RU4D 5F03A 1LHDH 2XBWA 2D8WA 1K22H 2FLBH 4O03A 2BD3A 4ESTE 2Y7ZA 1BRAA 4X1QU 1P10A 3P8FA 4ZXYH 2C90B 2C8WB 2BD8A 2CV3A 2B7DH 5C67A 5IDKA 4GCHG 1IQEA 3ZVAA 1OWEA 1LHFH 1GCDA 5C3NA 2ANMH 4I8HA 3RLYH 2FX4A 1YPGH 4Y7BA 3DD2H 1C1NA 3A7ZA 3LJJA 5J4SA 1QJ6B 1BIOA 3E8LA 4X6OA 1W10U 1GI9B 3TH2H 1O2PA 3H7OA 1SGNE 2I6QA 1V2LT 1ZR0A 4U01A 1IQJA 1BCUH 3A7YA 2F9VA 3MI4A 3RXHA 1NRPH 3GY3A 3ZVBA 3ZZ3A 4K1SA 3RU4E 1ZHRA 1B0EA 1IAUA 1P9UA 4MVNA 1XMNB 1XUKA 2GCTC 2ILNA 4X6NA 5E0GA 3VFEA 1SOTA 1GG6C 1GMHG 2FMJA 1GVZA 4DY7B 6GCHG 1LQEA 3FP8E 2F9BH 1V3XA 3RDZA 1FN6A 1V2ST 1D4PB 2O8UA 7LPRA 4CHAC 2GZ7A 2P3TB 1TNGA 4IGDA 2IOTA 2UWPA 1UVTH 2GT7A 5DP7A 1MKXK 4IMZA 1GHZA 2H9TH 1FLEE 1O33A 3MO3A 2UWOA 1H9HE 1O38A 4INHA 1ANBA 5DK1A 1TIOA 1GHVH 2HLCA 3BEIB 2XCNA 3SNDA 1SL3A 2J38A 5JBAS 3VGCB 1GCTB 2V3HH 2A4GA 2FI4E 1BRUP 1QL8A 3MHWU 1RIWB 3BTTE 3E16B 1Y3YA 3GCHC 2AIPA 2W5EA 2A31A 1AVWA 3K6ZA 1AQ7A 4I8LA 2AFQB 3T2NA 2Y7XA 4JYVH 1V2WT 1C5XB 3FP6E 4CR5A 1CGJE 1P01A 1EQ9A 5DGJA 5DP3A 1SPJA 2ZCLP 3TJVA 3RXJA 1TNKA 2FTMA 5FX5A 1AFQC 3GDSA 3NKKA 4JZEH 3KGPA 1GJDB 1ELGA 4B75A 1X7AC 4MNVA 5C1XA 6LPRA 2OQUA 1T7CA 3P92A 3UWJH 2ULLA 3FANA 1KLTA 1NN6A 3E3TA 1UHBB 1GJAB 1RGQA 2ZFTA 5IYTA 4Y11E 2R2WU 1O3AA 1YLCA 2ODYB 1YP9A 1TGNA 1O2KA 1SMFE 2KAIA 1A5GH 3KHVA 1ZZZA 1BJVA 3P95A 1E38B 1O2IA 3K2UA 4IC6A 1ZHPA 3URDA 7ESTE 1GBEA 2A4OA 3ESTA 3QX5H 2ZDVH 2PHBA 2VIVA 1VITF 1P12E 3EQ0H 1GPZA 2Z9LA 2C4FH 4Y79A 2Z3EA 3OY5U 4FVDA 1PQAA 2R2MB 3EYDA 4ZH8A 1IQNA 3RXOA 1XUGA 1Z8IB 5LPFA 3OYPA 3TLOA 2G55A 2UUJB 1VGCC 2W7UA 4OS2A 3TU7H 3UFAA 4B76A 3Q76A 3UREA 3UOUA 1RJXB 1LVMA 2PKAA 2OLGA 5F8TA 5FX6A 4BTUB 1O2TA 1NT1A 3I29A 3RC4A 5EPYA 1CGIE 3ELAH 3SUFA 3EDXB 3QO6A 3LJOA 1KXCA 2SGFE 3RXBA 1HAVA 1MD7A 5DO4H 1UTPA 1V2VT 1C1RA 1YPJH 2XCFA 1WUNH 1GI6A 2O8LA 3SHCH 3QGNB 1BTUA 2FEQH 1JIMA 4MPVA 2FM2A 1RD3B 2Z3DA 1C1VH 1GBAA 1HAXB 2UUYA 3GY5A 1D3TB 3U8OH 1PQ5A 1TA6A 1GHAF 1CO7E 5HM9A 3BIUH 5ETXA 2G4TA 1HUTH 2ZTYA 4NGAH 1QA7A 2O9QA 1DOJA 1LPZB 3NK8A 2ZHEH 1SI5H 5G4BA 3KN2A 2SFAA 1EAUA 2LNCA 1C5MD 2BD5A 3ZZ8A 2QXGA 1O3MA 1KIGH 1HJAC 2B0FA 2IN2A 1QJ7B 4LK4A 1HPGA 3QTOH 2BY9X 2STAE 3IG6B 1QA0A 1NU9A 1K1OA 1KYNA 2BLOA 1DWEH 4H6TA 2D1JA 1EJNA 1O2OA 1FQ3A 1WTGH 4JZFH 4U2WA 1KXAA 2EI7A 2GMTB 3SUEA 2VU8E 5C1YA 1F0UA 3RM2H 8GCHF 1O5DH 2NU0E 3AVZA 1AVGH 1SSXA 3NUMA 4QT8C 1O3PB 1TX8A 2C8ZB 1EOLA 1EX3A 1JOUB 4B71A 5E0JA 2G8TA 4NZQA 1LVBA 2WV5A 2VH0A 4OS6A 3TITA 3ZZ5A 1RTLA 1W2KH 2JH6D 4JK5A 5DJ7A 2FOFA 3SI3H 2GTBA 2R0KA 2FOAA 3SJ8A 3BEFB 5BRRE 2BD4A 1INCA 1C1WH 4KP0A 1C5YB 3H7TA 4FU8A 3EGKH 2BTCE 4MNWA 1LKAA 2WPLS 4WMDA 4A1VA 1O0DH 1O3CA 4RKJB 4ZHMU 1AE5A 1LPGB 1FN8A 3IITA 1VCQA 4I8JA 1TE0A 1AIXH 5TCCA 3BTGE 4INLA 3A86A 3P70B 1ELFA 3ZVCA 3A8BA 1D6RA 2O8TA 3WY8A 3RU4T 1UTOA 1GBMA 1OP8A 5L2YH 2Y5FA 4JZDH 1NROH 1TGBA 3L6PA 5JYIA 2FI5E 2UWLA 4D9QA 1BA8B 1C2LA 5FBEA 2QCYA 1ZTJA 1FIZA 3TK6A 4YO9A 1AZ8A 1GDQA 1O3FA 3A84A 4DVAU 3VGCC 5AHGH 1NRRH 3SNCA 2KAIB 3UQOA 3HKIB 5DP9A 2RCEA 5JBTA 1KSNA 2A1DB 2A45B 2WUBA 3DT0H 7KMEH 1O36A 4IMQA 4ZAEA 3Q3YA 2W26A 2TGDA 3RMOH 1C1MA 3P8NA 4VGCC 1HYLA 5GIBA 4NSVA 4Z6AH 4AFQA 2W7SA 1SGRE 1DUEA 2FOEA 1QIXB 1BMAA 1GHAG 1VCWA 1TPOA 1OKXA 4KGAA 3TJUA 1EOJA 1EAIA 1Q3XA 3CENA 1ANDA 1IQFA 2GZ8A 3A7VA 3PO1C 3MTYA 1WYKA 1GJ5H 2FO9A 2EI6A 2VWLA 3VB4A 2BD7A 1CVWH 1Q31A 2A2XH 1PQ7A 4YT7H 1QR3E 1CHOF 1BTWA 1Y5UT 4NIWA 3RXTA 3F9GA 1BMNH 2A2QH 1HAIH 4ABDA 2ZFFH 4MNXA 3MU1A 2BX4A 2Z9JA 5B6OA 3RM0H 1ETTH 4BNRA 1GBJA 4IS5A 2Z6BD 2P8OB 4MPWA 5AFZH 3BG4C 1QRXA 2GP9B 2DUCA 3ZZ6A 1JWTA 3U8RH 8GCHG 1H8DH 4Y8YA 3A89A 1ARCA 2QYIA 3QZRA 1QL9A 1L4ZA 1Y3UA 1ZHMA 3RXFA 2GCTB 3GDVA 3HK6B 4ISHH 3M5LA 3AW1A 5HMAA 2Q6GA 1GG6B 1UTQA 1NO9H 1XUIA 3ODDA 1UCYK 1ETSH 2OCVB 2FDAA 4X1SU 1GHXH 3CS7A 2GX4A 3LGWA 3A8DA 3TK5A 2ZGJA 3T62A 4ABAA 1BB0B 1HJ9A 3LGUA 2UUFB 4H6SB 7GCHF 3M7TA 3NPSA 1HCGA 1T32A 4IN1A 2G4UA 4XDEA 1JXPA 4TWYA 1TALA 1WCZA 3BF6H 4FU9A 1NU7B 3RXPA 4ISLA 3W95A 3RXUA 1K28D 2IJOB 2PR3A 4OGYA 5A0BA 5EXNA 4I8KA 4K5ZA 4R8TB 3GCHB 3RLWH 3MNXA 2ZQ1A 2ZDNA 4XOJA 3SNEA 1L0ZA 1DDJA 1BITA 1O2LA 3ZV9A 1BTXA 1EB2A 2OC1A 2CMYA 2ZTZA 1YCPK 3KL6A 5LPRA 1SGFA 1FAXA 1SGTA 1TB6H 2ZPRA 4XE4A 3UOPA 1DLKB 1TGTA 5E2OA 2BOHB 1AFQB 2A7HA 3P6ZB 4J1YA 2A0QB 1MUEB 5DP8A 4TY6A 3KF2A 5EQQA 3QTVH 2VIQA 1LPKB 3P8OA 1ELCA 1BBRH 1IOEA 4J2YB 1SGPE 5T6FA 1TNIA 5GDSH 2Z94A 2H5CA 2VVVA 4ASHA 2GKVE 2AMPA 5A8YA 5CHAC 4CBOA 4XBDA 1GMCF 1GI5A 3OY6U 2SGPE 3L33A 3PMBB 1FY5A 2W3KA 2BY8X 1SQTA 3SU0A 2TGAA 3LC3A 3U9AH 3T28A 1GL0E 1P09A 1WSSH 1LQDB 4X8VH 2FODA 4GHTA 4Y8XA 1O3OA 4B74A 4WF8A 1BMMH 2AMQA 1EAXA 1HV7A 2HGTH 4JYUH 1VGCB 1JIRA 1C2KA 1PPEE 2H9EH 3M5MA 1QB1A 2XWBI 2BQWB 2SGQE 5EW2H 1K1IA 4ZUHA 1UHBA 1CU1A 1ID5H 3EA8A 1E0FD 4AFUA 5DP4A 1WTHD 2OC0A 1NY22 1BTZA 3SJ9A 2WPHS 1O2GH 1C5OH 1L1NA 1MTWA 2QAAA 3RMNH 2F9OA 2G5NA 1XVMA 1Y8TA 4ABGA 4BXWA 4NSYA 3TIUA 2J95A 2TPIZ 1HAYB 2TIOA 3SUDA 1LHGH 1T4UH 1GDUA 1EUFA 1NFXA 2BOKA 1C9PA 2ZCHP 3PLBA 5ESBA 1BHXB 1RS0A 1ZTLA 4AGKA 2F9NA 3GY2A 3BTME 5AFYH 2SGEE 3GCTF 2C8XB 2BM2A 2ZPSA 1V2UT 3TGKE 1WOFA 1DPOA 1E37B 1YPHE 5C20A 3TH3H 2G81E 1AB9C 4X2XA 1RFNA 2GCHF 3GY7A 8ESTE 1ABJH 1A3BH 1CGHA 3T26A 1LHCH 1TQ0B 1TPPA 3QLPH 1C1UH 1MQ6A 2GDEH 2BDBA 3LH1A 3MNSA 1GI0A 4FUIA 3UIRA 1P05A 7GCHG 1BRCE 2AH4X 1NRNH 1TBZH 2SNWA 5GJ4B 2ESTE 4ZROA 3NWUA 1W0ZU 3ZZAA 5SGAE 1Y3XA 4IW4E 2BX3A 2PW8H 2V3OH 1A5IA 1GHWH 4AZ2B 1K1NA 1Z8GA 1Z7KA 3RXGA 1ZRBA 1GI8B 1ZSKA 4D76A 1A3EH 1P57B 1PJPA 2F91A 2ZHFH 1XXFA 1UK4A 1IHTH 2JETB 3S9AA 1O31A 3E0NB 1YF4A 1O2WA 3MNCA 3RXRA 1A0LA 2QY0B 1GMDF 2AEIH 1HAPH 2XC5A 4BOHA 2F83A 2FIRH 4Y8ZA 3E91A 1QQ4A 1F0TA 2QV1A 1ZSLA 1QBOA 1Y59T 2P8OC 3GICB 4MPXA 1U6QA 3FAOA 2PFEA 4AX9H 1S0QA 1P11E 1NRSH 1TA2A 4B73A 3N7OA 3RXLA 3RC6A 3S0NA 5EODA 4UFFH 1NRQH 1TPSA 1UK2A 3SZNA 4HGCA 2BZAA 1O2HA 1P9SA 1V2RT 5I46H 1ELDE 4BANB 1A0JA 1PPZA 4LOYH 2D26C 2GZ9A 1YPEH 4GLYA 1Z71A 2FOCA 3BTQE 3Q00A 3SW2B 1BT7A 4GUXA 3ATLA 2B9LA 2ALPA 3O8BA 4F49A 2VIWA 1J14A 4TPYA 3PTBA 2GDDA 5AF9H 1DWDH 1TOMH 2WPIS 2TRMA 4X1PU 1KY9A 1KLJH 5CMXH 1SR5C 1TNJA 4ZHLU 5JB9S 1XKBC 2R3YA 3PB1E 3F9HA 1ZTKA 3A85A 1SVPA 1EPTC 2P16A 3LIWA 1ZGVA 1P03A 1FI8A 1FZZA 2Q6DA 3ATKA 3U69H 1H4WA 4FUDA 4VGCB 2ODPA 4X8SH 3HATH 1Y3VA 2CJIA 5PTPA 4I8GA 1BBRE 1C2IA 1DANH 1P0SH 4AYYB 2HRVA 1TGCA 3M3VA 3SORA 2XW9A 1EJMA 2BHGA 3U1IB 4LZ1H 4FXGH 1Z6JH 1GVKB 3GCTG 3ZV8A 4TWWA 4D9RA 2P94A 5H4IB 1BUIA 1Y3WA 1H9IE 3PO1B 1VZQH 2QXIA 1FAKH 1A7SA 3M3SA 1EXFA 1SB1H 4JZ1A 2RG3A 1MU8B 4H42U 1S0RA 1MH0A 1ZJKA 1GI4A 1EB1H 4E7RG 2AGGX 2ANYA 2ZU5A 4Y76A 1Y5BT 4NG9H 4Y0YE 1A46H 1C4V2 1DITH 4BAMB 3KQCA 2THFB 3BG4B 1GI3A 5A8XA 1SFQB 3U8TH 1FV9A 5FBIA 3TGIE 5C5OA 3AW0A 1OYQA 4U32A 2LIZA 2GGVB 3EE0B 1T8NA 3D65E 3BTEE 3GISB 4ISOA 1OYTH 2BDCA 1KTSB 2XTTB 3EBNA 4MTBA 1V6DA 2FS9A 5FCRA 3SO3A 3A88A 1H9LB 1GMDG 3VB3A 4RSPA 1F92A 1PYTC 3S7KB 3UNSA 2G5VA 1O3LA 4XBBA 5I25A 1V2MT 2GD4B 1OPHB 1SGCA 3DHKH 5EQSA 3PWCA 1ESTA 3QK1A 1VJAU 4O9VA 3PM3A 4BAQB 2VGCB 5ABWA 1KXEA 3S69A 3KIDU 4NWLA 4DOQA 2BY7X 4GAWA 2HALA 3MNBA 1THPB 1P2OA 2H1UA 1EAWA 1O2MA 5GWZA 1W13U 2ANKH 3DFLA 2QF0A 3SU3A 1JMOH 4AYVB 1MZDA 1TRNA 2K1QA 3I78A 5LH8A 1SLWB 3LGYA 5C5NA 2OP9A 2ZEBA 1MZAA 4DIIH 3S9CA 2FTLE 4K1TA 1GJBB 1EZUC 1FY8E 1K1JA 3Q77A 3ZYEA 3FZDA 4U30A 4I31A 2NU2E 5J4QA 1P2IA 1P8VC 3O8DA 2Q1JA 2OQ5A 3RUOA 2OXSA 3TNSA 1AE8H 5DP6A 1SHYA 2PLXA 3SNBA 5HM2A 1C1SA 2FOBA 2P93A 3R0FA 4B1TA 2ZNKH 5CHAB 4Y71A 2JETC 3E90B 2V0BA 4JK6A 4AG1A 1GBKA 3ATIA 3PTNA 3B9FH 3LKWA 3SV9A 1MKXH 4HFPB 5A09A 1ZSJA 1C5VA 1PYTD 3SGQE 2A7CA 1UVUH 4I7YH 4K69A 2DE9A 1FIWA 1XUHA 2ZG0H 1OP0A 2XBXA 1FXYA 2BDIA 3TVJB 3DUXH 4DURA 1Z1JA 1KDQA 2WINI 2Y6TA 3BTDE 3O8CA 4A7IB 1SC8U 1TBQH 2GT8A 2VH6A 2ZGXH 3SJOA 3HGNA 3STJA 1H1BA 1VCPA 4ZHAA 3K65B 4D8NA 4E05H 1AWHB 3LDXH 1O2NA 1ETRH 3RXIA 3B23B 1J9CH 3SV2H 4DGJA 1F5RA 4X6PA 1LVOA 1OWIA 1MCVA 1VITG 1AGJA 1DY8A 1YM0A 1CT2E 1LCYA 3CS0A 4FU7A 1V2TT 3GOVB 3TH4H 5EU8A 3SUGA 4FUJA 3UNQA 1HRTH 4AFZA 2XRCA 5JBBS 4LZ4B 1T8MA 3MFJA 3MYWA 1W0YH 2UUKB 1C2JA 3ZZDA 4CH8B 5JBCS 6CHAC 1AB9B 1PPHE 4BAOB 1JBUH 5EPNA 1NFWA 1CHGA 5T6DA 1QB9A 1MCTA 1EP6A 4NA9H 4FVBA 2FPZA 2R3UA 1C5ZB 4O97A 5GCHF 1BHXF 4ZKNU 1H8IH 5GPIB 4UDWH 2PGQB 1THRH 4WXIA 2F9PA 2Y5GA 2Y81A 4Z0KA 2Z9KA 2A7JA 3UR6A 4XSKU 1XVOA 2PTNA 1BDAA 4FUFA 2ZTXA 1TRYA 4YOJA 1KXBA 3ZZBA 3SJKA 3EA9A 3PLPA 3SJIA 2ZC9H 1OSSA 4NA8A 3SHAH 3RMLH 2CGAA 1G3EA 3VXFH 4A6LA 4YLQH 3TK9A 4M7GA 2Z9IA 1DICA 4NCYA 2ZIQH 1J16A 4TY7A 1P2KA 1NFYA 1O3NA 3SU5A 1M9UA 3QZQA 4IBLH 2BZ6H 2P3UB 3RXSA 4KKDA 5F8ZA 4UONA 1O30A 1SFIA 2BMGB 5F6MA 5TCAA 3G01A 2AERH 2ZU4A 3VB6A 2JH5D 1N6YA 4WMFA 4YOGA 1JRSA 1TMBH 1ABIH 2AGIX 4A5TS 1O2YA 1QY6A 3PMHB 1G32B 3LT3A 4YZUA 1P2QA 1QHRB 1F5LA 3VXEH 4PROA 1SQAA 1C1OA 1DS2E 1ANEA 1V2NT 2ZHWH 1DY9A 3BSQA 3D49H 3GYMA 1O3EA 3T25A 1P2MA 4CRBA 1T8LA 1TNLA 2FYQA 1OXGA 3U98H 4BTTB 1XKAC 1CA8B 3R3GB 1GHYH 2BLWA 1O5BB 1T31A 1EZSC 1HLTH 1C5LH 1W8BH 2VGCC 1ZLRA 1THSH 2CN0H 3URCA 2ZGBH 4KTUA 1D9IA 1V2OT 1C1PA 3KQDA 1FNIA 1ELEE 1EPTB 2WYGA 1BTYA 3F6UH 1AO5A 2VVUA 3HGPA 8LPRA 1BRBE 1UTJA 2H9HA 4DG4A 1W14U 9LPRA 1ELAA 1YGCH 1W7XH 1NTPA 4UFGH 1DWBH 4AFSA 3KQEA 5FPYA 1F0SA 1UVPA 3MU4A 4DT7B 1UTMA 4ABJA 3VB5A 1LMWB 5E2PA 1E34B 3T27A 1KDQB 3UNRA 3JZ1B 3ZVDA 4CRGA 3ITIA 1GJ9B 4KTCA 1CBWB 1OS8A 1IQLA 3OX7U 5E8EH 4HZHA 2FYRA 4WH8A 2BDAA 3M3TA 2BDHA 3E6PH 2ZCKP 1LKBA 1MQ5A 3M37A 1O2VA 5L30H 3GY8A 1TGSZ 4X2WA 4K2YA 4DW2U 2OC8A 4JYTA 5JDUB 2AGEX 2A5KA 4MNYA 2A4QA 2YNBA 3HK3B 4TPIZ 3SV6A 1D3DB 1BJUA 5GCHG 1O2SA 1C5SA 2D2DA 3SGAE 1P3CA 5HXFA 4GSOA 2ASUB 1S83A 1MBMA 1PPGE 2Z7FE 3M36A 3RXEA 4NZLA 3FVFB 3SU2A 2B8OH 1V2KT 1C2FA 1MTUA 3AAVA 3BV9B 1SLXB 1SGIB 2BVRH 1DE7H 1HIAA 4CRFA 1GMHF 1GVLA 1AFEH 2ZZUH 1GBDA 5DP5A 1OWJA 1NS3A 1RRKA 1TBRH 1CE5A 1N6XA 4B2BA 2WYJA 3K6YA 1QL7A 1SG8B 3M7UA 3VPKA 1CHOG 1L1GA 1O3GA 2QC2A 1O2ZA 1G30B 1GBFA 1C2DA 2RA3A 1SGYE 1AKSB 1ZMLA 3HPTB 4K60A 4ABEA 2PUXB 9ESTA 2ZF0H 1NZQH 2EEKA 4CRCA 1MBQA 1S6HA 3EA7A 1A61H 3MH6A 4JZIA 4X0WU 4YTAA 1O3IA 4WVPE 3O8RA 1ZPBA 1SGQE 1SQOA 1Z8RA 1GBBA 1C2EA 1ACBE 3BTWE 1YKTA 1HAOH 1GBHA 3E1XB 1TLDA 1QNJA 3IWMA 1FJSA 3A83A 4HI3A 3L3TA 3Q3XA 1YPKH 1AZZA 3MOCA 1GJCB 2CXVA 3I77A 3M35A 1SLUB 1HAZB 1OOKB 3RXQA 1XUFA 1GJ4H 1OP2A 3KNXA 1BTHH 1SOZA 1CQQA 1K21H 4H4FA 3GY4A 1BTPA 2CHAB 2JH0D 5AVDA 4F4OC 4WWYA 1AMHA 1HNEE 1B7XB 2QGRA 3V0XA 5LPEA 1BOQA 1G3BA 1XM1A 1MTSA 3F9FA 4D7GA 3LC5A 3TGJE 4IC5A 2XXLA 2TGPZ 4UFDH 1SGFG 1UCYH 1GJ8B 2FS8A 1FY3A 2SNVA 2A4RA 1TX6A 1V2PT 2ZHQH 3A7WA 1CSOE 1BMLA 5FPSA 4THNH 4ZKSU 1FONA 3SU6A 3LU9B 5EQRA 1N8OC 3KEEA 4DIHH 1KXDA 4Q7YA 4FUGA 3P17H 4SGBE 3AAUA 1ZRKA 4YOIA 2PV9B 1TRMA 1GL1A 5JPMH 3GDUA 4JMYA 1V2JT 1W3CA 2QF3A 2ZU3A 3E0PB 4Q7ZA 3A82A 4O3UA 1AY6H 1OWHA 1GI1A 1O32A 4Y0ZE 1XX9A 2WV4A 1P06A 1C9TA 1SHHB 5L2ZH 1GMCG 3SU1A 2RA0A 3NXPA 4YM9A 1ESAA 1WQVH 1YCPH 1MKWK 2J2UA 4WH6A 6ESTA 1G9IE 2BDYA 2AIQA 4O3TA 2VJ1A 2PGBB 1TMTH 2CF9H 2FLRH 3S7HB 3V3MA 3ATMA 1FMGA 4DJZB 3GY6A 1T4VH 1DLEA 2ZGHA 1C5WB 1NESE 1O3BA 1IHSH 3PWBA 3ZZ4A 3A8CA 3QWCH 2ZQ2A 4YT6H 2SGDE 2WUCA 1P3EA 3UWIA 3PMAB 1EZQA 2ZWLH 4X2VA 2ALVA 2VVCA 6CHAB 1C5PA 2BQ7B 5LGOA 2J4IA 2A32A 4NIVA 2ZP0H 1AWFH 1O35A 1GGDC 2BY6X 1TPAE 1EZXC 3RXCA 4X2YA 1XXDA 4SGAE 4ZXXH 5F8XA 3GCOA 2Y5HA 2WPJS 2NU1E 3MO6A 2O8WA 1PPFE 1TABE 1GWAA 3SV8A 1QFKH 2XWAA 1RTKA 1CBWC 3FFGA 4YESB 1HIAB 2QA9E 4K1EA 2VWOA 2ZU2A 1QGFA 1LVYA 1CA0C 2EI8A 2H5DA 5EW1H 2HWLB 3UR9A 1QURH 1S82A 4XBCA 1QJ1B 3ZYDA 1A2CH 3SU4A 1FPCH 2HNTC 3SGBE 4GVUA 2GCHG 2HOBA 2G51A 3UPEA 1HAGE 4A92A 2PTCE 2EA3A 2ZFRH 1ZOMA 1AD8H 4X6MA 1C5QA 1UMAH 1QQUA 2HPQH 2Z3CA 2R9PA 2XYAA 1UVOA 2I6SA 1A5HA 2BVSH 5CE1A 2ZFQH 3RXDA 3PLKA 1EP5A 1C5TA 1MTNC 1T8OA 1P2JA 1ZMNA 1WQSA 5DKMA 4E7NA 4NFEA 3OSYA 2V6NA 4ABFA 5EGMA 2XNIA 1F0RA 4CRDA 1O3DA 4GPGA 1ZJDA 4Y10E 1DM4B 1DFPA 3LPRA 3ZZ7A 1TMUH 2Y82A 2YOLA 1TX7A 2VIDA 4FUEA 3NZIA 1FPHH 2OBOA 1DWCH 3A81A 2ZFSA 2VIOA 1ZPZA 2QIQA 1GI7B 2BD9A 2ZPQA 2FZZA 1HBTH 4I32A 2J34A 1S6FA 4NFFA 2NWNA 3STIA 5HYOA 1HAHH 2AS9A 2GV6A 1LDTT 1GBIA 2VINA 1GHBF 4R0IA 1OX1A 3TJNA 5K7RA 4FUBA 1P2NA 1KLIH 1AN1E 1TOCB 3W94A 4WY3A 4HTCH 3ZZ9A 5FAHA 1PPCE 1V2QT 1DXPA 1IQIA 1D3QB 1IQGA 2DE8A 4RN6A 4UFEH 2SGAA 4LXBH 4UE7H 1DX5M 4ABHA 1D3PB 4X1NU 1UVSH 1O5FH 4NA7A 3SQEE 1UCYE 1ELVA 1TNHA 3UQVA 4XFQA 1Z8JB 2CHAC 3OTJE 5K0HA 1AU8A 2FXRA 5FCKA 1AUTC 2ZDAH 1WAYB 3TJOA 3UUZA 1C2MA 2WPKS 1O5EH 5T3HA 1MKWH 1C2HA 1MD8A 3RMMH 2BQ6B 1RXPA 3C1KA 4CH2B 3BG8A 1EPTA 1J17T 1NFUA 1ZYOA 1AI8H 1MAXA 1ORFA 2OUAA 1C5UA 2F3CE 1ELBA 4Y6DA 5EXLA 1L2EA 2Y80A 2ZKSA 4K8BA 2K7XA 2ZGCA 3BTKE 1G3DA 2HNTE 3F68H 1HXFH 1O3HA 1ZPCA 1K9OE 1O39A 2F9UA 3HKJB 5GXPA 4X1RU 4OS5A 1F2SE 2HNTF 3LONA 1Z1IA 1A1RA 1O34A 3GYLB 1GJ7B 3QUMP 5A2MH 5L6NH 2XC4A 1KXFA 1W12U 2ZECA 2BXTH 3H5CB 1TQ7B 1GBCA 4ISNA 4D7FA 1C2GA 4WJG2 1MU6B 1OWDA 1O5GH 3BN9A 4NIXA 2FOMB 3M5NA 1F5KU 2AYWA 2BYAX 4AG2A 5JB8S 1KTTB 4TYDA 3D62A 1E35B 8KME2 1TFXA 4AOQA 1UJ1A 3QGJA 4OS4A 3V7TA 1MAYA 2BVXH 1A4WH 3F9EA 3SNAA 1DSUA 4CR9A 1P04A 2B5TB 1BBRK 1W7GH 4AB8A 3BTHE 3FP7E 1O3KA 1EASA 4I33A 3T5FH 2PKSB 1SLVB 3ATWA 1HJ8A 3TPIZ 4B2AA 1W11U 1G2MA 2G52A 4Y7AA 1K1PA 1EJAA 1TAWA 1FY1A 3LH3A 3SI4H 3PYHA 2PSYA 1AKSA 1TWXB 3A87A 1UK3A 2ZFPH 1AUJA 1YCPM 3C27B 1VJ9U 1C5NH 1GBTA 3ODFA 3PV4A 3A7XA 4Q80A 2PSXA 4MQAA 2BB4A 1GJ6A 1GCTC 3M5OA 3QDZB 3LGIA 1NM6A 1QB6A 3OU0A 1UO6A 1RIWC 4AORA 4AGJA 3UY9A 1GHBG 4MDSA 3MH4A 2H2ZA 4OGXA 3A7TA 4ZKRU 3ZZCA 4BXSA 1HFDA 2C8YB 3DFJA 2FX6A 3MWIU 4WXVA 2WPMS 4Q2KA 2M5TA 3A8AA 2FESH 2OBQA 1YPMH 1FDPA 1YYY1 3JZ2B 3KCGH 1G2LA 2CF8H 4ZMAH 1N8OB 1DXWA 3MH5A 1C5RA 1O2UA 1O5CB 1C1QA 4MG3A 1YC0A 1ARBA 1FY4A 4UEHH 2PKAB 4X8UH 3ENSB 1ELTA 2BXUH 2NU4E 5E0HA 3SN8A 5EG4A 1C4U2 2TBSA 2BLQA 3EAJA 2R0LA 3MU8A 5FHTA 1MMJN 1D6WA 1HAVB 2QN5T 3D23A 4X8TH 2ZO3H 1DUAA 1S84A 2AMDA 3LGTA 3DA9B 3BEUA 1IQKA 1LTOA
chains in the Genus database with same CATH superfamily
1WV7H 2ZDLA 3Q3KA 3RP2A 3RC5A 3AASA 1EATA 1G3CA 1BZXE 2XC0A 3OTPA 2XBYA 3CNRA 3T29A 3LOXA 4CRAA 1A0HB 1B5GH 4A1XA 1HDTH 1J8AA 5FPTA 5T6GA 1G36A 1LO6A 2FP7B 2YMSD 3RXAA 1S81A 2FOGA 2GVFA 2VB0A 4E06H 1AVXA 3TNTA 1NPMA 1S5SA 4TT3D 3V12A 1IQHA 1C4Y2 2RDLA 1DSTA 1N1LA 2W3IA 3CP7A 3SQHE 2ZHDA 4K8YA 4CHAB 3MMGA 1COWD 2JJ2D 1K2I1 1OWKA 2P59A 3F1SB 2QXJA 5DPAA 5ESTE 3B8JA 2P3FH 3VB7A 1BQYA 1YPHC 3BIVH 1GGDB 3K9XB 1QBVH 3MU5A 4HG6A 1C1TA 3S9BA 2A5AA 1HB0B 1XUJA 1QRWA 2LPRA 2FI3E 2TGTA 1ZGIA 1PFXC 2VIPA 5TJXA 4GCHF 4GHQA 4ABBA 1S85A 3PROA 1GDNA 4AB9A 1F7ZA 5A0CA 4KELA 4AC9A 4A1TA 3UTUH 1CA0B 2VWNA 1PQ8A 4MLFB 4BTIB 2HPPH 2J92A 1K1LA 3GCNA 2Q6FA 1TONA 2P95A 4MPUA 3M61U 4CREA 2VNTA 1Q2WA 2PWXA 5DG6A 5C94A 2GMTC 2IPHA 4FUCA 1O37A 2VWMA 1CT0E 2H6MA 2J94A 4INKA 4YLUA 4ACBA 1O3JA 1TYNA 5HGGA 1Z6EA 1QBNA 3RXVA 4NIYA 1YBWA 2BDGA 2ANWA 2NU3E 4IN2A 3NCLA 2OINA 1MTNB 2W6JD 2ZU1A 1YLDA 3PMJA 1VR1H 2FOHA 1O2RA 4AN7A 4FUHA 1P02A 1L1JA 5C2ZA 4ZKOU 3MO9A 2EC9H 4JCNA 4BAKB 3U1JB 6GCHF 1QTFA 1ZMJA 1LHEH 2OD3B 2ZA5A 3FZZA 2ZI2H 3BTFE 2O8MA 2HLDD 4BAHB 1UTNA 3MH7A 1CT4E 4ABIA 5A8ZA 1ESBA 1O2JA 3F3BA 1VITH 5C0UA 2BLVA 5FXLA 3FN8A 1WU1A 4ISIH 1SBWA 3ZVGA 1EKBB 3P8GA 3ZVFA 5IK2D 3MQKC 4M9FA 5A0AE 1RTFB 2ZDKA 3SV7A 4RKOB 2K8IA 2HVXA 4NWKA 1JRTA 1O2XA 1UTKA 1AHTH 2BD2A 1SGDE 1O5AB 2GV7A 3V13A 1FUJA 1NC6A 1DT2A 3U28C 1WBGB 1E36B 3SOSA 4OS7A 3ZVEA 1HGTH 2PUQH 1MTVA 1DVAH 2QXHA 3MU0A 2JKHA 4K3JA 3VEQB 2PKSC 4OS1A 1YPLH 3RXKA 3LGVA 1SGEE 2XBVA 1L4DA 2OC7A 1IQMA 2J98B 1Y5AT 2A5IA 1J15A 1QCPA 2C93B 4WMEA 2BY5X 3KQBA 5EXMA 1K1MA 1UTLM 4B2CA 2FWWA 5BPEA 1KMHB 3A80A 3RXMA 1EFRD 5EOKA 5C1UA 1B0FA 4Q7XA 3QN7A 3SBKA 2J9NA 1ANCA 1GBLA 4UD9H 2Z9GA 4KTSA 2ODQA 4DCDA 1HXEH 3M7QA 1GI2A 2YNAA 2STBE 2ZDMA 2OTVA 2C3SA 1PPBH 1QRZA 1HJAB 5HKKD 2G00A 1G37A 2V35A 4CBNA 1O2QA 3RU4D 5F03A 1LHDH 2XBWA 2D8WA 1K22H 2FLBH 4O03A 2BD3A 4ESTE 2Y7ZA 1BRAA 4X1QU 1P10A 3P8FA 4ZXYH 2C90B 2C8WB 2KFWA 2BD8A 2CV3A 2B7DH 5C67A 5IDKA 4GCHG 1IQEA 3ZVAA 1OWEA 1LHFH 1GCDA 5C3NA 2ANMH 2RDEA 1E1RD 4I8HA 1W0KD 3RLYH 2FX4A 1YPGH 4Y7BA 3OE7D 1C1NA 3A7ZA 3LJJA 5J4SA 3DD2H 1QJ6B 1BIOA 3E8LA 4X6OA 1W10U 1GI9B 3TH2H 1O2PA 3H7OA 1SGNE 2I6QA 1V2LT 1ZR0A 4U01A 2KZ4A 1IQJA 1BCUH 3A7YA 2F9VA 3MI4A 3RXHA 1NRPH 3GY3A 3ZVBA 3ZZ3A 4K1SA 3RU4E 1ZHRA 1B0EA 1IAUA 3WW7A 1P9UA 4MVNA 1XMNB 1XUKA 2GCTC 2ILNA 2XOKD 4X6NA 5E0GA 3VFEA 1SOTA 1GG6C 1GMHG 2FMJA 1GVZA 4DY7B 6GCHG 1LQEA 3FP8E 2F9BH 1V3XA 3RDZA 1FN6A 1V2ST 1D4PB 2O8UA 7LPRA 4CHAC 2GZ7A 2P3TB 1TNGA 4IGDA 2IOTA 2GJGA 2UWPA 1UVTH 2GT7A 5DP7A 3DSOA 1MKXK 4IMZA 1GHZA 2H9TH 1FLEE 1O33A 3MO3A 2UWOA 1H9HE 1O38A 4INHA 1ANBA 5DK1A 1TIOA 1GHVH 2HLCA 2IJD1 3BEIB 2XCNA 3SNDA 1SL3A 2J38A 5JBAS 3VGCB 1GCTB 2WZQA 1QZ8A 2YMSB 5F53A 2V3HH 2A4GA 2FI4E 1BRUP 1QL8A 3MHWU 1RIWB 3BTTE 3E16B 1Y3YA 3GCHC 2AIPA 2W5EA 2A31A 1AVWA 3K6ZA 1AQ7A 4I8LA 2AFQB 3T2NA 2Y7XA 4JYVH 1V2WT 1C5XB 3FP6E 4CR5A 1CGJE 1P01A 1EQ9A 5DGJA 5DP3A 1SPJA 2ZCLP 3TJVA 3RXJA 1TNKA 2FTMA 5FX5A 1AFQC 3GDSA 3NKKA 4JZEH 3KGPA 1GJDB 1ELGA 3FOAA 1X7AC 4B75A 2KCYA 4MNVA 5C1XA 1BMFD 6LPRA 2OQUA 1T7CA 3P92A 3UWJH 2ULLA 3FANA 1KLTA 1NN6A 1NBMD 3SYJA 3E3TA 1UHBB 1GJAB 1RGQA 2ZFTA 5IYTA 4Y11E 2R2WU 1O3AA 1YLCA 2ODYB 1YP9A 1TGNA 1O2KA 1SMFE 2KAIA 1A5GH 3KHVA 1ZZZA 1BJVA 3P95A 1E38B 1O2IA 3K2UA 4IC6A 1ZHPA 3URDA 3F2HA 7ESTE 1GBEA 2A4OA 3ESTA 3QX5H 2ZDVH 2PHBA 2VIVA 1VITF 1P12E 3EQ0H 1GPZA 2Z9LA 2C4FH 4Y79A 2Z3EA 3OY5U 4FVDA 1PQAA 2R2MB 3EYDA 4ZH8A 1IQNA 4FETA 1XUGA 2J97A 1Z8IB 3OAAD 3RXOA 3WWFA 5LPFA 3OYPA 3TLOA 2G55A 2UUJB 1VGCC 2W7UA 4OS2A 3TU7H 3UFAA 4B76A 3Q76A 3UREA 3UOUA 1RJXB 1LVMA 2PKAA 2J5UA 2OLGA 3OFND 5F8TA 5FX6A 4BTUB 1O2TA 1NT1A 3F2FA 3I29A 3RC4A 5EPYA 1CGIE 3ELAH 3SUFA 3EDXB 3QO6A 3PV2A 3LJOA 1KXCA 2SGFE 3RXBA 1HAVA 1MD7A 2RFKC 5DO4H 1UTPA 2PP6A 1V2VT 1C1RA 1YPJH 2XCFA 1WUNH 1GI6A 2O8LA 3SHCH 3QGNB 1BTUA 2FEQH 1JIMA 4MPVA 2FM2A 1RD3B 2Z3DA 1C1VH 1GBAA 1HAXB 2UUYA 3GY5A 1D3TB 3U8OH 1PQ5A 1TA6A 1GHAF 1CO7E 5HM9A 3BIUH 5ETXA 2G4TA 1HUTH 2ZTYA 4NGAH 1QA7A 2O9QA 1DOJA 1LPZB 3NK8A 2ZHEH 1SI5H 5G4BA 3KN2A 2SFAA 1EAUA 2LNCA 1C5MD 2BD5A 3ZZ8A 2QXGA 1O3MA 1KIGH 1HJAC 2B0FA 2IN2A 1QJ7B 4LK4A 1HPGA 3QTOH 2BY9X 2STAE 3IG6B 1QA0A 1NU9A 1K1OA 1KYNA 2M2AA 2BLOA 1DWEH 4H6TA 2D1JA 1EJNA 1O2OA 3DCLA 1FQ3A 1WTGH 4JZFH 4U2WA 1KXAA 2EI7A 2GMTB 3SUEA 2VU8E 5C1YA 1YWUA 1F0UA 3RM2H 8GCHF 1O5DH 2NU0E 3AVZA 1AVGH 1SSXA 3NUMA 4QT8C 1O3PB 1TX8A 2C8ZB 1EOLA 1EX3A 1JOUB 4B71A 5E0JA 2G8TA 4NZQA 1LVBA 1YLNA 2WV5A 2VH0A 4OS6A 3TITA 3ZZ5A 1RTLA 1W2KH 2JH6D 4JK5A 5DJ7A 2FOFA 3SI3H 2GTBA 2R0KA 4F55A 2FOAA 3SJ8A 3BEFB 5BRRE 2BD4A 1INCA 1C1WH 4KP0A 1C5YB 3H7TA 4FU8A 3KQ5A 3EGKH 2BTCE 4MNWA 2IPQX 1LKAA 2WPLS 4WMDA 4A1VA 1O0DH 1O3CA 4RKJB 4ZHMU 1AE5A 1LPGB 1FN8A 3IITA 1VCQA 4I8JA 1TE0A 1AIXH 5TCCA 3BTGE 4INLA 1UW7A 3A86A 3P70B 3F0PA 1ELFA 3ZVCA 2KCPA 3A8BA 1D6RA 1E1QD 2O8TA 3WY8A 3RU4T 1UTOA 2LELA 2WHXA 1GBMA 1OP8A 5L2YH 2Y5FA 4JZDH 1NROH 1TGBA 3L6PA 5JYIA 2FI5E 2UWLA 4D9QA 1BA8B 1C2LA 5FBEA 2QCYA 1ZTJA 1FIZA 3TK6A 4YO9A 1AZ8A 1GDQA 1O3FA 3A84A 4DVAU 3VGCC 5AHGH 1NRRH 3SNCA 2KAIB 3UQOA 3HKIB 5DP9A 2RCEA 5JBTA 1KSNA 2A1DB 2A45B 2WUBA 3DT0H 5KECA 7KMEH 1O36A 4IMQA 4ZAEA 3Q3YA 2W26A 2TGDA 3RMOH 1C1MA 3P8NA 4VGCC 1HYLA 5GIBA 4NSVA 4Z6AH 4AFQA 2W7SA 1SGRE 2J98A 1DUEA 2FOEA 1QIXB 1BMAA 1GHAG 1VCWA 1TPOA 1OKXA 4KGAA 3TJUA 1EOJA 1EAIA 1Q3XA 3CENA 3UB0A 1ANDA 1IQFA 2GZ8A 3A7VA 3PO1C 3MTYA 1WYKA 1GJ5H 2FO9A 2EI6A 2VWLA 3VB4A 2BD7A 1CVWH 1Q31A 2A2XH 1PQ7A 4YT7H 1QR3E 1CHOF 1BTWA 1Y5UT 4NIWA 3RXTA 3F9GA 1BMNH 2A2QH 4F48B 1HAIH 4ABDA 2ZFFH 4MNXA 3MU1A 2BX4A 2Z9JA 5B6OA 3RM0H 1ETTH 4BNRA 1GBJA 4IS5A 2Z6BD 2P8OB 4MPWA 5AFZH 3BG4C 1QRXA 2GP9B 2DUCA 3ZZ6A 1JWTA 3U8RH 8GCHG 1H8DH 4Y8YA 3A89A 1ARCA 2QYIA 3QZRA 1QL9A 1L4ZA 1Y3UA 1ZHMA 3RXFA 2GCTB 3GDVA 3HK6B 4ISHH 3M5LA 3AW1A 5HMAA 2Q6GA 1GG6B 1UTQA 1NO9H 1XUIA 3ODDA 1UCYK 1ETSH 2OCVB 2FDAA 4X1SU 1GHXH 3CS7A 1H8HD 2GX4A 3LGWA 3A8DA 3TK5A 2ZGJA 3T62A 4ABAA 1BB0B 1HJ9A 3LGUA 2UUFB 4H6SB 7GCHF 3M7TA 3NPSA 1HCGA 1T32A 4IN1A 2G4UA 4XDEA 1JXPA 4TWYA 1TALA 1WCZA 3BF6H 4FU9A 1NU7B 3RXPA 4ISLA 3W95A 3RXUA 1K28D 2IJOB 2PR3A 4OGYA 5A0BA 5EXNA 4I8KA 4K5ZA 4R8TB 3GCHB 3RLWH 3MNXA 2ZQ1A 2ZDNA 4XOJA 3SNEA 1L0ZA 1DDJA 1BITA 1O2LA 3ZV9A 1BTXA 1EB2A 2OC1A 2CMYA 2ZTZA 1YCPK 3KL6A 5LPRA 1SGFA 1FAXA 1SGTA 1TB6H 2ZPRA 4XE4A 3UOPA 1DLKB 1TGTA 5E2OA 2BOHB 1AFQB 2A7HA 3P6ZB 4J1YA 2A0QB 1MUEB 5DP8A 4TY6A 3KF2A 5EQQA 3QTVH 2VIQA 1LPKB 3P8OA 1ELCA 1BBRH 1IOEA 4J2YB 1SGPE 5T6FA 1TNIA 5GDSH 2Z94A 2H5CA 2VVVA 4ASHA 2GKVE 4P02A 2AMPA 5DSFA 5A8YA 5CHAC 4CBOA 4XBDA 1S6LA 1GMCF 1GI5A 3OY6U 2SGPE 3L33A 3PMBB 1FY5A 2W3KA 2BY8X 1SQTA 3SU0A 2TGAA 3LC3A 3U9AH 3T28A 1WDIA 1GL0E 1P09A 5KEDA 1WSSH 1LQDB 4X8VH 2FODA 4GHTA 4Y8XA 1O3OA 4B74A 4WF8A 1BMMH 2AMQA 1EAXA 1HV7A 2HGTH 4JYUH 1VGCB 1JIRA 1C2KA 1PPEE 2H9EH 3M5MA 1QB1A 2XWBI 3FO8D 2BQWB 2SGQE 5EW2H 1K1IA 4ZUHA 1UHBA 1CU1A 5HIYA 1ID5H 3EA8A 1E0FD 4AFUA 5DP4A 1YY3A 1WTHD 2OC0A 1NY22 3DSPA 1BTZA 3SJ9A 2WPHS 1O2GH 1C5OH 1L1NA 1MTWA 2QAAA 3RMNH 2F9OA 2G5NA 1XVMA 1Y8TA 4ABGA 4BXWA 4NSYA 3TIUA 2J95A 2TPIZ 1HAYB 2TIOA 3SUDA 1LHGH 1W0JD 1T4UH 1GDUA 1EUFA 1NFXA 2BOKA 1C9PA 2ZCHP 3PLBA 5ESBA 1BHXB 1RS0A 1ZTLA 4AGKA 2F9NA 3GY2A 3BTME 5AFYH 2SGEE 3GCTF 2C8XB 2BM2A 2ZPSA 1V2UT 3TGKE 1WOFA 1DPOA 1E37B 1YPHE 5C20A 3TH3H 2G81E 1AB9C 4X2XA 1RFNA 2GCHF 3GY7A 8ESTE 1ABJH 1A3BH 1CGHA 3T26A 1LHCH 1TQ0B 1TPPA 3QLPH 1C1UH 1MQ6A 2GDEH 2BDBA 3LH1A 3MNSA 1GI0A 4FUIA 3UIRA 1P05A 7GCHG 1BRCE 2AH4X 1NRNH 1TBZH 2SNWA 5GJ4B 2ESTE 4ZROA 2V3MA 3NWUA 1W0ZU 3ZZAA 5SGAE 1Y3XA 4IW4E 1OHHD 2BX3A 2PW8H 2V3OH 1A5IA 1GHWH 4AZ2B 1K1NA 1Z8GA 1Z7KA 3RXGA 4Q4LA 5C17A 1ZRBA 1GI8B 1ZSKA 4D76A 1A3EH 1P57B 1PJPA 2F91A 2ZHFH 1XXFA 1UK4A 1IHTH 2JETB 3WWBA 3S9AA 1O31A 3E0NB 1YF4A 1O2WA 3MNCA 3RXRA 1A0LA 2QY0B 1GMDF 2AEIH 1HAPH 2XC5A 4BOHA 2AHME 2F83A 2FIRH 3E91A 1QQ4A 3F0OA 4Y8ZA 1F0TA 2QV1A 1ZSLA 1QBOA 1Y59T 2P8OC 3GICB 5KGOA 4MPXA 1U6QA 3FAOA 2PFEA 4AX9H 3AK5A 1S0QA 4OM9A 1P11E 1NRSH 1TA2A 4B73A 3N7OA 3RXLA 3RC6A 3ZIAD 5EODA 3S0NA 4UFFH 1NRQH 1TPSA 1UK2A 3SZNA 4HGCA 2BZAA 1O2HA 1P9SA 1V2RT 5I46H 2JDID 1ELDE 4BANB 1A0JA 1PPZA 4LOYH 2D26C 2GZ9A 1YPEH 4GLYA 1Z71A 2FOCA 3BTQE 3Q00A 3SW2B 1BT7A 4GUXA 3ATLA 2B9LA 2ALPA 3O8BA 5CDFE 4F49A 2VIWA 1J14A 4TPYA 3GS9A 3PTBA 2GDDA 5AF9H 1DWDH 2QE7D 1TOMH 2WPIS 5EIYA 2TRMA 4X1PU 1KY9A 1KLJH 5CMXH 1SR5C 1TNJA 4ZHLU 5JB9S 1XKBC 2R3YA 3PB1E 3F9HA 1ZTKA 3A85A 1SVPA 1EPTC 2P16A 3LIWA 1ZGVA 1MABB 1P03A 1FI8A 1FZZA 2Q6DA 3ATKA 3U69H 1H4WA 4FUDA 5T1VA 4VGCB 2ODPA 4X8SH 3HATH 1Y3VA 2CJIA 5PTPA 4I8GA 1BBRE 1C2IA 1DANH 1P0SH 2XNDD 4AYYB 2HRVA 1TGCA 3M3VA 3SORA 2XW9A 1EJMA 2BHGA 3U1IB 4LZ1H 4FXGH 1Z6JH 1GVKB 3GCTG 3ZV8A 4TWWA 4D9RA 2P94A 5H4IB 1BUIA 1Y3WA 3N7EA 1H9IE 3PO1B 1VZQH 2QXIA 1FAKH 1A7SA 3M3SA 1EXFA 1SB1H 4JZ1A 2RG3A 1MU8B 4H42U 1S0RA 1MH0A 1ZJKA 1GI4A 1EB1H 4E7RG 2AGGX 2ANYA 3PV5A 2ZU5A 4Y76A 1Y5BT 4NG9H 4Y0YE 1A46H 1C4V2 1DITH 3N7DA 4BAMB 4YXWD 3KQCA 2L6OA 2THFB 3BG4B 1GI3A 5A8XA 1SFQB 3U8TH 1FV9A 5FBIA 3TGIE 4I86A 5C5OA 3AW0A 1OYQA 4U32A 2LIZA 2GGVB 3EE0B 1T8NA 3D65E 3BTEE 3GISB 4ISOA 1OYTH 2BDCA 1KTSB 2XTTB 3EBNA 4MTBA 1V6DA 2FS9A 5FCRA 3SO3A 3A88A 1H9LB 1GMDG 3VB3A 4RSPA 1F92A 1NBME 1PYTC 3S7KB 3UNSA 2G5VA 1O3LA 4XBBA 5I25A 1V2MT 2GD4B 1OPHB 1SGCA 3DHKH 5EQSA 3PWCA 1ESTA 3QK1A 1VJAU 4O9VA 3PM3A 4BAQB 2VGCB 5ABWA 1KXEA 3S69A 3KIDU 4NWLA 4DOQA 2BY7X 2WV9A 4GAWA 2HALA 3MNBA 1THPB 1P2OA 2H1UA 1EAWA 1O2MA 5GWZA 1W13U 2ANKH 3DFLA 2QF0A 3SU3A 1JMOH 3DSGA 4AYVB 1MZDA 1TRNA 2K1QA 3I78A 4XD7D 5LH8A 4Q63A 1SLWB 3LGYA 5C5NA 2OP9A 2ZEBA 1MZAA 4DIIH 3S9CA 2FTLE 4K1TA 1GJBB 1EZUC 1FY8E 1K1JA 3Q77A 3ZYEA 3FZDA 4U30A 4I31A 2NU2E 5J4QA 1P2IA 1P8VC 3O8DA 2Q1JA 2OQ5A 3RUOA 2OXSA 3TNSA 1AE8H 5DP6A 1SHYA 2V7QD 2PLXA 3SNBA 5HM2A 5GNDA 1C1SA 2FOBA 2HVYB 2P93A 3R0FA 4B1TA 2ZNKH 5CHAB 4Y71A 2JETC 3E90B 2V0BA 4JK6A 3KYFA 4AG1A 1GBKA 3ATIA 3PTNA 3B9FH 3LKWA 3SV9A 1MKXH 4HFPB 5A09A 1ZSJA 1C5VA 1PYTD 3SGQE 2A7CA 1UVUH 4I7YH 4K69A 2DE9A 1FIWA 1XUHA 2ZG0H 1OP0A 2XBXA 1FXYA 2BDIA 3TVJB 3DUXH 4DURA 1Z1JA 1KDQA 2WINI 2Y6TA 3BTDE 3O8CA 4A7IB 1SC8U 1TBQH 2GT8A 2VH6A 2ZGXH 3SJOA 3HGNA 3STJA 1H1BA 1VCPA 4ZHAA 3K65B 4D8NA 4E05H 1AWHB 3LDXH 1O2NA 1ETRH 3RXIA 3B23B 1J9CH 3SV2H 4DGJA 1F5RA 4X6PA 1LVOA 1OWIA 1MCVA 1VITG 1AGJA 1DY8A 1YM0A 1CT2E 1LCYA 3CS0A 4FU7A 1V2TT 3GOVB 3TH4H 5EU8A 3SUGA 4FUJA 3UNQA 1HRTH 4AFZA 2XRCA 5JBBS 4LZ4B 1T8MA 3MFJA 3MYWA 1W0YH 2UUKB 1C2JA 3ZZDA 4CH8B 2K0QA 5JBCS 6CHAC 1AB9B 1PPHE 4BAOB 1JBUH 5EPNA 1NFWA 1CHGA 5T6DA 1QB9A 1MCTA 1EP6A 4NA9H 4FVBA 2FPZA 2R3UA 1C5ZB 4O97A 5GCHF 1BHXF 4ZKNU 1H8IH 5GPIB 4UDWH 2PGQB 1THRH 4WXIA 2F9PA 2Y5GA 5EJLA 2Y81A 4Z0KA 2Z9KA 2A7JA 3UR6A 4XSKU 1XVOA 2PTNA 1BDAA 3N99A 4FUFA 2JIZD 2ZTXA 4B6EA 1TRYA 4YOJA 1KXBA 3ZZBA 3SJKA 5CHBA 3EA9A 3PLPA 3SJIA 2ZC9H 1OSSA 4NA8A 3SHAH 3RMLH 2CGAA 1G3EA 3VXFH 4A6LA 4YLQH 3TK9A 4M7GA 2Z9IA 1DICA 4NCYA 2ZIQH 1J16A 4TY7A 1P2KA 1NFYA 1O3NA 3SU5A 1M9UA 3QZQA 4IBLH 2BZ6H 2P3UB 3RXSA 4KKDA 5F8ZA 4UONA 1O30A 3OEHD 1SFIA 2BMGB 5F6MA 5TCAA 3G01A 2AERH 2ZU4A 3VB6A 2JH5D 1N6YA 2F43B 4WMFA 4YOGA 1JRSA 1TMBH 1ABIH 2AGIX 4A5TS 1O2YA 1QY6A 3PMHB 1G32B 3LT3A 4YZUA 1P2QA 1QHRB 1F5LA 3VXEH 4PROA 1SQAA 1C1OA 1DS2E 1ANEA 1V2NT 2ZHWH 1DY9A 1H8ED 3BSQA 3D49H 3GYMA 1O3EA 3T25A 1P2MA 4CRBA 1T8LA 1TNLA 2FYQA 1OXGA 3U98H 4BTTB 1XKAC 1CA8B 2L74A 1GHYH 3R3GB 2BLWA 1O5BB 1T31A 1EZSC 1HLTH 4TSFD 1C5LH 1W8BH 2VGCC 1ZLRA 1THSH 2CN0H 3URCA 2ZGBH 3KYGA 4KTUA 1D9IA 1V2OT 1C1PA 3KQDA 1FNIA 1ELEE 1EPTB 2WYGA 1BTYA 3F6UH 1AO5A 2VVUA 3HGPA 8LPRA 1BRBE 1UTJA 2H9HA 4DG4A 1W14U 9LPRA 1ELAA 1YGCH 1W7XH 1NTPA 4UFGH 1DWBH 4AFSA 3KQEA 5FPYA 1F0SA 1UVPA 3MU4A 4DT7B 1UTMA 4ABJA 3VB5A 1LMWB 5E2PA 1E34B 3T27A 1KDQB 3UNRA 3JZ1B 3ZVDA 4CRGA 3ITIA 1GJ9B 4KTCA 1CBWB 1OS8A 1IQLA 3OX7U 5E8EH 4HZHA 2WPDD 2FYRA 4WH8A 5C0TA 2BDAA 3M3TA 2BDHA 3E6PH 2ZCKP 1LKBA 1MQ5A 3M37A 1O2VA 5L30H 3GY8A 1TGSZ 4X2WA 4K2YA 4DW2U 2OC8A 4JYTA 5JDUB 2AGEX 2A5KA 5HIZA 4MNYA 2A4QA 2YNBA 3HK3B 4TPIZ 3SV6A 1D3DB 1BJUA 5GCHG 1O2SA 4ZCNA 1C5SA 2D2DA 2F4LA 3SGAE 1P3CA 5HXFA 4GSOA 2ASUB 1S83A 1MBMA 1PPGE 2Z7FE 3M36A 3RXEA 4NZLA 3FVFB 3SU2A 2B8OH 1V2KT 1C2FA 1MTUA 2JJ1D 3AAVA 3BV9B 1SLXB 1SGIB 2BVRH 1DE7H 1HIAA 4CRFA 1GMHF 1GVLA 1AFEH 2ZZUH 1GBDA 5DP5A 1OWJA 1NS3A 1RRKA 1TBRH 1E79D 1CE5A 1N6XA 4B2BA 2WYJA 4FOUC 3K6YA 5DN6D 1QL7A 1SG8B 3M7UA 3VPKA 1CHOG 1L1GA 1O3GA 2QC2A 1O2ZA 1G30B 1GBFA 1C2DA 2RA3A 1SGYE 1AKSB 1ZMLA 3HPTB 4K60A 4ABEA 2PUXB 9ESTA 2ZF0H 1NZQH 2EEKA 4CRCA 1MBQA 1S6HA 3EA7A 1A61H 3MH6A 4JZIA 4X0WU 4YTAA 1O3IA 4WVPE 3O8RA 4P00A 1ZPBA 1SGQE 1SQOA 1Z8RA 1GBBA 1C2EA 1ACBE 3BTWE 1YKTA 1HAOH 1GBHA 3E1XB 1TLDA 1QNJA 3IWMA 1FJSA 3A83A 2WSSD 4HI3A 1SQRA 3L3TA 3Q3XA 5EJ1A 1YPKH 1AZZA 3MOCA 1GJCB 2CXVA 3I77A 3M35A 1SLUB 1HAZB 1OOKB 3RXQA 1XUFA 1GJ4H 1OP2A 3KNXA 1BTHH 1SOZA 1CQQA 1K21H 4H4FA 3GY4A 1BTPA 2CHAB 2JH0D 5AVDA 4F4OC 4WWYA 1AMHA 1HNEE 1B7XB 2KCOA 2QGRA 3V0XA 5LPEA 3EE7A 1BOQA 1G3BA 1XM1A 1MTSA 3F9FA 4D7GA 3LC5A 3TGJE 4IC5A 2XXLA 2TGPZ 4UFDH 1SGFG 1UCYH 1GJ8B 2FS8A 1FY3A 2SNVA 2A4RA 3UAIC 5B6LA 1TX6A 1V2PT 2ZHQH 3A7WA 1CSOE 1BMLA 1VKYA 5FPSA 4THNH 4ZKSU 1FONA 3SU6A 3LU9B 5EQRA 1N8OC 3KEEA 4DIHH 1KXDA 4Q7YA 4FUGA 2CK3D 3P17H 4SGBE 3AAUA 1ZRKA 4YOIA 2PV9B 1TRMA 5FL7D 1GL1A 5JPMH 3GDUA 4JMYA 1V2JT 1W3CA 2QF3A 2ZU3A 3E0PB 4Q7ZA 3A82A 4O3UA 1AY6H 1OWHA 1GI1A 1O32A 4Y0ZE 4Z1MD 1XX9A 2WV4A 1P06A 1C9TA 1SHHB 5L2ZH 1GMCG 3SU1A 2RA0A 3NXPA 4YM9A 1ESAA 1WQVH 1YCPH 1MKWK 2J2UA 4WH6A 6ESTA 1G9IE 2BDYA 2AIQA 4O3TA 2VJ1A 2PGBB 1TMTH 2CF9H 2FLRH 3S7HB 3W1EA 3V3MA 3ATMA 4B6FA 1FMGA 4DJZB 3GY6A 1T4VH 1DLEA 2ZGHA 1C5WB 1NESE 1O3BA 1IHSH 3PWBA 3ZZ4A 3A8CA 3QWCH 2ZQ2A 4YT6H 2VBCA 2SGDE 2WUCA 1P3EA 3UWIA 3PMAB 1EZQA 2ZWLH 3F2GA 4X2VA 2ALVA 3H09A 2VVCA 6CHAB 1C5PA 2BQ7B 4DT4A 5LGOA 2J4IA 2A32A 4NIVA 2ZP0H 1AWFH 1O35A 1GGDC 2BY6X 1TPAE 1EZXC 3RXCA 4X2YA 1XXDA 4SGAE 4ZXXH 5F8XA 3GCOA 2Y5HA 2WPJS 2NU1E 3MO6A 2O8WA 1PPFE 1TABE 1GWAA 3SV8A 1QFKH 2XWAA 1RTKA 1CBWC 3FFGA 4YESB 1HIAB 2QA9E 4K1EA 2VWOA 2ZU2A 1FX0B 1QGFA 1LVYA 1CA0C 2EI8A 2H5DA 5EW1H 2HWLB 3UR9A 1QURH 4RT1A 1S82A 4XBCA 1QJ1B 3ZYDA 1A2CH 3SU4A 1FPCH 2HNTC 3SGBE 4GVUA 2GCHG 2HOBA 3PRDA 2G51A 3UPEA 1HAGE 4A92A 2PTCE 2EA3A 2ZFRH 1ZOMA 1AD8H 4X6MA 1C5QA 1UMAH 1QQUA 2HPQH 2Z3CA 2R9PA 2XYAA 1UVOA 2I6SA 1A5HA 2BVSH 5CE1A 2ZFQH 3RXDA 3PLKA 1EP5A 1C5TA 1MTNC 1T8OA 1P2JA 1ZMNA 1WQSA 5DKMA 4E7NA 4NFEA 3OSYA 2V6NA 4ABFA 5EGMA 2XNIA 1F0RA 4CRDA 1O3DA 4GPGA 1ZJDA 4Y10E 1DM4B 1DFPA 3LPRA 3ZZ7A 1TMUH 2KCAA 2KM0A 2Y82A 1TX7A 2YOLA 2VIDA 1K0HA 4XRNA 3PRBA 3NZIA 4FUEA 1FPHH 2OBOA 1DWCH 3A81A 2ZFSA 4RT0A 2VIOA 1ZPZA 2QIQA 1GI7B 2BD9A 2ZPQA 2FZZA 1HBTH 4I32A 2J34A 1S6FA 4NFFA 2NWNA 3STIA 5HYOA 1HAHH 2AS9A 2GV6A 1LDTT 1GBIA 2VINA 1GHBF 4R0IA 4ACAA 1OX1A 3TJNA 4ASUD 5K7RA 4FUBA 1P2NA 1KLIH 1AN1E 3VG8A 1TOCB 3W94A 4WY3A 4HTCH 3ZZ9A 5FAHA 1PPCE 3SZEA 1V2QT 1DXPA 1IQIA 1D3QB 1IQGA 2DE8A 4RN6A 4UFEH 2SGAA 4LXBH 4UE7H 5EJZA 1DX5M 4ABHA 1D3PB 4X1NU 1UVSH 1O5FH 4NA7A 3SQEE 1UCYE 1ELVA 1TNHA 3UQVA 4XFQA 1Z8JB 2CHAC 3OTJE 5K0HA 1AU8A 2FXRA 5FCKA 2OK5A 1AUTC 2ZDAH 1WAYB 3TJOA 3UUZA 1C2MA 2WPKS 1O5EH 5T3HA 1MKWH 1C2HA 1MD8A 3RMMH 2BQ6B 1RXPA 3C1KA 4CH2B 3BG8A 1EPTA 1J17T 1NFUA 1ZYOA 1AI8H 1MAXA 1ORFA 2OUAA 1C5UA 2F3CE 1ELBA 4Y6DA 5EXLA 1L2EA 2Y80A 2ZKSA 4K8BA 2K7XA 2ZGCA 3BTKE 1G3DA 2HNTE 3F68H 1HXFH 1O3HA 1ZPCA 1K9OE 1O39A 2F9UA 3HKJB 5GXPA 4X1RU 2EQNA 4OS5A 1F2SE 2HNTF 3LONA 1Z1IA 1A1RA 1O34A 3GYLB 1GJ7B 3QUMP 5A2MH 5L6NH 2XC4A 1KXFA 1W12U 2ZECA 2BXTH 3H5CB 1TQ7B 1GBCA 4ISNA 4D7FA 1C2GA 4WJG2 1MU6B 1OWDA 1O5GH 3BN9A 4NIXA 2FOMB 3M5NA 1F5KU 2AYWA 2BYAX 4AG2A 5JB8S 1KTTB 4TYDA 4RI0A 3D62A 1E35B 3OEED 3NRLA 1TFXA 4AOQA 1UJ1A 8KME2 3QGJA 4OS4A 3V7TA 1MAYA 2BVXH 1A4WH 3F9EA 3SNAA 1DSUA 4CR9A 1P04A 2B5TB 1BBRK 1W7GH 4AB8A 3BTHE 3FP7E 1O3KA 1EASA 4I33A 3T5FH 3FKSD 2PKSB 1SLVB 3ATWA 1HJ8A 3TPIZ 4B2AA 1W11U 1G2MA 2G52A 4Y7AA 2EY4C 1K1PA 1EJAA 1TAWA 1FY1A 3LH3A 3SI4H 2QF4A 3PYHA 2PSYA 1AKSA 1TWXB 3A87A 1UK3A 2ZFPH 1AUJA 1YCPM 3C27B 2W6ID 1VJ9U 1C5NH 1GBTA 3ODFA 3PV4A 3A7XA 2KR7A 4Q80A 2PSXA 4MQAA 2BB4A 1GJ6A 1GCTC 2YMSC 3M5OA 3QDZB 3LGIA 1NM6A 1QB6A 3OU0A 1UO6A 1RIWC 4AORA 1WXRA 4AGJA 3UY9A 1GHBG 4MDSA 3MH4A 2H2ZA 4OGXA 3A7TA 4ZKRU 3ZZCA 4BXSA 1HFDA 2C8YB 3DFJA 2FX6A 3MWIU 4WXVA 2WPMS 4Q2KA 2M5TA 3A8AA 2FESH 2OBQA 1YPMH 1FDPA 1YYY1 3JZ2B 3KCGH 1G2LA 2CF8H 4ZMAH 1N8OB 1DXWA 3MH5A 1C5RA 1O2UA 1O5CB 1C1QA 2KX4A 4MG3A 1YC0A 1ARBA 1FY4A 4UEHH 2PKAB 4X8UH 3ENSB 1ELTA 2BXUH 2NU4E 5E0HA 3SN8A 5EG4A 1C4U2 2TBSA 2BLQA 3EAJA 2R0LA 3MU8A 5FHTA 1MMJN 1D6WA 1HAVB 2QN5T 3D23A 1SKYE 4X8TH 2ZO3H 1DUAA 1S84A 2QF5A 2AMDA 3LGTA 3DA9B 2LP6A 3BEUA 1IQKA 1LTOA
chains in the Genus database with same CATH topology
1WV7H 2ZDLA 3Q3KA 3RP2A 3RC5A 3AASA 1EATA 1G3CA 1BZXE 2XC0A 2XBYA 3T29A 3LOXA 4CRAA 1A0HB 1B5GH 4A1XA 1HDTH 1J8AA 5FPTA 5T6GA 1G36A 1LO6A 2FP7B 3RXAA 1S81A 2FOGA 2GVFA 2VB0A 4E06H 1AVXA 3TNTA 1NPMA 1S5SA 3V12A 1IQHA 1C4Y2 2RDLA 1DSTA 1N1LA 2W3IA 3CP7A 3SQHE 2ZHDA 4K8YA 4CHAB 3MMGA 1K2I1 1OWKA 2P59A 3F1SB 2QXJA 5DPAA 5ESTE 3B8JA 2P3FH 3VB7A 1BQYA 1YPHC 3BIVH 1GGDB 3K9XB 1QBVH 3MU5A 1C1TA 3S9BA 2A5AA 1HB0B 1XUJA 1QRWA 2LPRA 2FI3E 2TGTA 1ZGIA 1PFXC 2VIPA 5TJXA 4GCHF 4GHQA 4ABBA 1S85A 3PROA 1GDNA 4AB9A 1F7ZA 5A0CA 4KELA 4A1TA 3UTUH 1CA0B 2VWNA 1PQ8A 4MLFB 4BTIB 2HPPH 2J92A 1K1LA 3GCNA 2Q6FA 1TONA 2P95A 4MPUA 3M61U 4CREA 2VNTA 1Q2WA 2PWXA 5DG6A 2GMTC 2IPHA 4FUCA 1O37A 2VWMA 1CT0E 2H6MA 2J94A 4INKA 4YLUA 1O3JA 1TYNA 5HGGA 1Z6EA 1QBNA 3RXVA 4NIYA 1YBWA 2BDGA 2ANWA 2NU3E 4IN2A 3NCLA 2OINA 1MTNB 2ZU1A 1YLDA 3PMJA 1VR1H 2FOHA 1O2RA 4AN7A 4FUHA 1P02A 1L1JA 5C2ZA 4ZKOU 3MO9A 2EC9H 4JCNA 4BAKB 3U1JB 6GCHF 1QTFA 1ZMJA 1LHEH 2OD3B 2ZA5A 3FZZA 2ZI2H 3BTFE 2O8MA 4BAHB 1UTNA 3MH7A 1CT4E 4ABIA 5A8ZA 1ESBA 1O2JA 1VITH 2BLVA 5FXLA 1WU1A 4ISIH 1SBWA 3ZVGA 1EKBB 3P8GA 3ZVFA 5A0AE 1RTFB 2ZDKA 3SV7A 4RKOB 2HVXA 4NWKA 1JRTA 1O2XA 1UTKA 1AHTH 2BD2A 1SGDE 1O5AB 2GV7A 3V13A 1FUJA 1NC6A 1DT2A 1WBGB 1E36B 3SOSA 4OS7A 3ZVEA 1HGTH 2PUQH 1MTVA 1DVAH 2QXHA 3MU0A 2JKHA 4K3JA 3VEQB 2PKSC 4OS1A 1YPLH 3RXKA 3LGVA 1SGEE 2XBVA 1L4DA 2OC7A 1IQMA 1Y5AT 2A5IA 1J15A 1QCPA 2C93B 4WMEA 2BY5X 3KQBA 5EXMA 1K1MA 1UTLM 4B2CA 2FWWA 5BPEA 3RXMA 3A80A 5C1UA 5EOKA 1B0FA 4Q7XA 3QN7A 3SBKA 2J9NA 1ANCA 1GBLA 4UD9H 2Z9GA 4KTSA 2ODQA 4DCDA 1HXEH 3M7QA 1GI2A 2YNAA 2STBE 2ZDMA 2OTVA 2C3SA 1PPBH 1QRZA 1HJAB 2G00A 1G37A 2V35A 4CBNA 1O2QA 3RU4D 5F03A 1LHDH 2XBWA 2D8WA 1K22H 2FLBH 4O03A 2BD3A 4ESTE 2Y7ZA 1BRAA 4X1QU 1P10A 3P8FA 4ZXYH 2C90B 2C8WB 2BD8A 2CV3A 2B7DH 5C67A 5IDKA 4GCHG 1IQEA 3ZVAA 1OWEA 1LHFH 1GCDA 5C3NA 2ANMH 4I8HA 3RLYH 2FX4A 1YPGH 4Y7BA 3DD2H 1C1NA 3A7ZA 3LJJA 5J4SA 1QJ6B 1BIOA 3E8LA 4X6OA 1W10U 1GI9B 3TH2H 1O2PA 3H7OA 1SGNE 2I6QA 1V2LT 1ZR0A 4U01A 1IQJA 1BCUH 3A7YA 2F9VA 3MI4A 3RXHA 1NRPH 3GY3A 3ZVBA 3ZZ3A 4K1SA 3RU4E 1ZHRA 1B0EA 1IAUA 1P9UA 4MVNA 1XMNB 1XUKA 2GCTC 2ILNA 4X6NA 5E0GA 3VFEA 1SOTA 1GG6C 1GMHG 2FMJA 1GVZA 4DY7B 6GCHG 1LQEA 3FP8E 2F9BH 1V3XA 3RDZA 1FN6A 1V2ST 1D4PB 2O8UA 7LPRA 4CHAC 2GZ7A 2P3TB 1TNGA 4IGDA 2IOTA 2UWPA 1UVTH 2GT7A 5DP7A 1MKXK 4IMZA 1GHZA 2H9TH 1FLEE 1O33A 3MO3A 2UWOA 1H9HE 1O38A 4INHA 1ANBA 5DK1A 1TIOA 1GHVH 2HLCA 3BEIB 2XCNA 3SNDA 1SL3A 2J38A 5JBAS 3VGCB 1GCTB 2V3HH 2A4GA 2FI4E 1BRUP 1QL8A 3MHWU 1RIWB 3BTTE 3E16B 1Y3YA 3GCHC 2AIPA 2W5EA 2A31A 1AVWA 3K6ZA 1AQ7A 4I8LA 2AFQB 3T2NA 2Y7XA 4JYVH 1V2WT 1C5XB 3FP6E 4CR5A 1CGJE 1P01A 1EQ9A 5DGJA 5DP3A 1SPJA 2ZCLP 3TJVA 3RXJA 1TNKA 2FTMA 5FX5A 1AFQC 3GDSA 3NKKA 4JZEH 3KGPA 1GJDB 1ELGA 4B75A 1X7AC 4MNVA 5C1XA 6LPRA 2OQUA 1T7CA 3P92A 3UWJH 2ULLA 3FANA 1KLTA 1NN6A 3E3TA 1UHBB 1GJAB 1RGQA 2ZFTA 5IYTA 4Y11E 2R2WU 1O3AA 1YLCA 2ODYB 1YP9A 1TGNA 1O2KA 1SMFE 2KAIA 1A5GH 3KHVA 1ZZZA 1BJVA 3P95A 1E38B 1O2IA 3K2UA 4IC6A 1ZHPA 3URDA 7ESTE 1GBEA 2A4OA 3ESTA 3QX5H 2ZDVH 2PHBA 2VIVA 1VITF 1P12E 3EQ0H 1GPZA 2Z9LA 2C4FH 4Y79A 2Z3EA 3OY5U 4FVDA 1PQAA 2R2MB 3EYDA 4ZH8A 1IQNA 3RXOA 1XUGA 1Z8IB 5LPFA 3OYPA 3TLOA 2G55A 2UUJB 1VGCC 2W7UA 4OS2A 3TU7H 3UFAA 4B76A 3Q76A 3UREA 3UOUA 1RJXB 1LVMA 2PKAA 2OLGA 5F8TA 5FX6A 4BTUB 1O2TA 1NT1A 3I29A 3RC4A 5EPYA 1CGIE 3ELAH 3SUFA 3EDXB 3QO6A 3LJOA 1KXCA 2SGFE 3RXBA 1HAVA 1MD7A 5DO4H 1UTPA 1V2VT 1C1RA 1YPJH 2XCFA 1WUNH 1GI6A 2O8LA 3SHCH 3QGNB 1BTUA 2FEQH 1JIMA 4MPVA 2FM2A 1RD3B 2Z3DA 1C1VH 1GBAA 1HAXB 2UUYA 3GY5A 1D3TB 3U8OH 1PQ5A 1TA6A 1GHAF 1CO7E 5HM9A 3BIUH 5ETXA 2G4TA 1HUTH 2ZTYA 4NGAH 1QA7A 2O9QA 1DOJA 1LPZB 3NK8A 2ZHEH 1SI5H 5G4BA 3KN2A 2SFAA 1EAUA 2LNCA 1C5MD 2BD5A 3ZZ8A 2QXGA 1O3MA 1KIGH 1HJAC 2B0FA 2IN2A 1QJ7B 4LK4A 1HPGA 3QTOH 2BY9X 2STAE 3IG6B 1QA0A 1NU9A 1K1OA 1KYNA 2BLOA 1DWEH 4H6TA 2D1JA 1EJNA 1O2OA 1FQ3A 1WTGH 4JZFH 4U2WA 1KXAA 2EI7A 2GMTB 3SUEA 2VU8E 5C1YA 1F0UA 3RM2H 8GCHF 1O5DH 2NU0E 3AVZA 1AVGH 1SSXA 3NUMA 4QT8C 1O3PB 1TX8A 2C8ZB 1EOLA 1EX3A 1JOUB 4B71A 5E0JA 2G8TA 4NZQA 1LVBA 2WV5A 2VH0A 4OS6A 3TITA 3ZZ5A 1RTLA 1W2KH 2JH6D 4JK5A 5DJ7A 2FOFA 3SI3H 2GTBA 2R0KA 2FOAA 3SJ8A 3BEFB 5BRRE 2BD4A 1INCA 1C1WH 4KP0A 1C5YB 3H7TA 4FU8A 3EGKH 2BTCE 4MNWA 1LKAA 2WPLS 4WMDA 4A1VA 1O0DH 1O3CA 4RKJB 4ZHMU 1AE5A 1LPGB 1FN8A 3IITA 1VCQA 4I8JA 1TE0A 1AIXH 5TCCA 3BTGE 4INLA 3A86A 3P70B 1ELFA 3ZVCA 3A8BA 1D6RA 2O8TA 3WY8A 3RU4T 1UTOA 1GBMA 1OP8A 5L2YH 2Y5FA 4JZDH 1NROH 1TGBA 3L6PA 5JYIA 2FI5E 2UWLA 4D9QA 1BA8B 1C2LA 5FBEA 2QCYA 1ZTJA 1FIZA 3TK6A 4YO9A 1AZ8A 1GDQA 1O3FA 3A84A 4DVAU 3VGCC 5AHGH 1NRRH 3SNCA 2KAIB 3UQOA 3HKIB 5DP9A 2RCEA 5JBTA 1KSNA 2A1DB 2A45B 2WUBA 3DT0H 7KMEH 1O36A 4IMQA 4ZAEA 3Q3YA 2W26A 2TGDA 3RMOH 1C1MA 3P8NA 4VGCC 1HYLA 5GIBA 4NSVA 4Z6AH 4AFQA 2W7SA 1SGRE 1DUEA 2FOEA 1QIXB 1BMAA 1GHAG 1VCWA 1TPOA 1OKXA 4KGAA 3TJUA 1EOJA 1EAIA 1Q3XA 3CENA 1ANDA 1IQFA 2GZ8A 3A7VA 3PO1C 3MTYA 1WYKA 1GJ5H 2FO9A 2EI6A 2VWLA 3VB4A 2BD7A 1CVWH 1Q31A 2A2XH 1PQ7A 4YT7H 1QR3E 1CHOF 1BTWA 1Y5UT 4NIWA 3RXTA 3F9GA 1BMNH 2A2QH 1HAIH 4ABDA 2ZFFH 4MNXA 3MU1A 2BX4A 2Z9JA 5B6OA 3RM0H 1ETTH 4BNRA 1GBJA 4IS5A 2Z6BD 2P8OB 4MPWA 5AFZH 3BG4C 1QRXA 2GP9B 2DUCA 3ZZ6A 1JWTA 3U8RH 8GCHG 1H8DH 4Y8YA 3A89A 1ARCA 2QYIA 3QZRA 1QL9A 1L4ZA 1Y3UA 1ZHMA 3RXFA 2GCTB 3GDVA 3HK6B 4ISHH 3M5LA 3AW1A 5HMAA 2Q6GA 1GG6B 1UTQA 1NO9H 1XUIA 3ODDA 1UCYK 1ETSH 2OCVB 2FDAA 4X1SU 1GHXH 3CS7A 2GX4A 3LGWA 3A8DA 3TK5A 2ZGJA 3T62A 4ABAA 1BB0B 1HJ9A 3LGUA 2UUFB 4H6SB 7GCHF 3M7TA 3NPSA 1HCGA 1T32A 4IN1A 2G4UA 4XDEA 1JXPA 4TWYA 1TALA 1WCZA 3BF6H 4FU9A 1NU7B 3RXPA 4ISLA 3W95A 3RXUA 1K28D 2IJOB 2PR3A 4OGYA 5A0BA 5EXNA 4I8KA 4K5ZA 4R8TB 3GCHB 3RLWH 3MNXA 2ZQ1A 2ZDNA 4XOJA 3SNEA 1L0ZA 1DDJA 1BITA 1O2LA 3ZV9A 1BTXA 1EB2A 2OC1A 2CMYA 2ZTZA 1YCPK 3KL6A 5LPRA 1SGFA 1FAXA 1SGTA 1TB6H 2ZPRA 4XE4A 3UOPA 1DLKB 1TGTA 5E2OA 2BOHB 1AFQB 2A7HA 3P6ZB 4J1YA 2A0QB 1MUEB 5DP8A 4TY6A 3KF2A 5EQQA 3QTVH 2VIQA 1LPKB 3P8OA 1ELCA 1BBRH 1IOEA 4J2YB 1SGPE 5T6FA 1TNIA 5GDSH 2Z94A 2H5CA 2VVVA 4ASHA 2GKVE 2AMPA 5A8YA 5CHAC 4CBOA 4XBDA 1GMCF 1GI5A 3OY6U 2SGPE 3L33A 3PMBB 1FY5A 2W3KA 2BY8X 1SQTA 3SU0A 2TGAA 3LC3A 3U9AH 3T28A 1GL0E 1P09A 1WSSH 1LQDB 4X8VH 2FODA 4GHTA 4Y8XA 1O3OA 4B74A 4WF8A 1BMMH 2AMQA 1EAXA 1HV7A 2HGTH 4JYUH 1VGCB 1JIRA 1C2KA 1PPEE 2H9EH 3M5MA 1QB1A 2XWBI 2BQWB 2SGQE 5EW2H 1K1IA 4ZUHA 1UHBA 1CU1A 1ID5H 3EA8A 1E0FD 4AFUA 5DP4A 1WTHD 2OC0A 1NY22 1BTZA 3SJ9A 2WPHS 1O2GH 1C5OH 1L1NA 1MTWA 2QAAA 3RMNH 2F9OA 2G5NA 1XVMA 1Y8TA 4ABGA 4BXWA 4NSYA 3TIUA 2J95A 2TPIZ 1HAYB 2TIOA 3SUDA 1LHGH 1T4UH 1GDUA 1EUFA 1NFXA 2BOKA 1C9PA 2ZCHP 3PLBA 5ESBA 1BHXB 1RS0A 1ZTLA 4AGKA 2F9NA 3GY2A 3BTME 5AFYH 2SGEE 3GCTF 2C8XB 2BM2A 2ZPSA 1V2UT 3TGKE 1WOFA 1DPOA 1E37B 1YPHE 5C20A 3TH3H 2G81E 1AB9C 4X2XA 1RFNA 2GCHF 3GY7A 8ESTE 1ABJH 1A3BH 1CGHA 3T26A 1LHCH 1TQ0B 1TPPA 3QLPH 1C1UH 1MQ6A 2GDEH 2BDBA 3LH1A 3MNSA 1GI0A 4FUIA 3UIRA 1P05A 7GCHG 1BRCE 2AH4X 1NRNH 1TBZH 2SNWA 5GJ4B 2ESTE 4ZROA 3NWUA 1W0ZU 3ZZAA 5SGAE 1Y3XA 4IW4E 2BX3A 2PW8H 2V3OH 1A5IA 1GHWH 4AZ2B 1K1NA 1Z8GA 1Z7KA 3RXGA 1ZRBA 1GI8B 1ZSKA 4D76A 1A3EH 1P57B 1PJPA 2F91A 2ZHFH 1XXFA 1UK4A 1IHTH 2JETB 3S9AA 1O31A 3E0NB 1YF4A 1O2WA 3MNCA 3RXRA 1A0LA 2QY0B 1GMDF 2AEIH 1HAPH 2XC5A 4BOHA 2F83A 2FIRH 4Y8ZA 3E91A 1QQ4A 1F0TA 2QV1A 1ZSLA 1QBOA 1Y59T 2P8OC 3GICB 4MPXA 1U6QA 3FAOA 2PFEA 4AX9H 1S0QA 1P11E 1NRSH 1TA2A 4B73A 3N7OA 3RXLA 3RC6A 3S0NA 5EODA 4UFFH 1NRQH 1TPSA 1UK2A 3SZNA 4HGCA 2BZAA 1O2HA 1P9SA 1V2RT 5I46H 1ELDE 4BANB 1A0JA 1PPZA 4LOYH 2D26C 2GZ9A 1YPEH 4GLYA 1Z71A 2FOCA 3BTQE 3Q00A 3SW2B 1BT7A 4GUXA 3ATLA 2B9LA 2ALPA 3O8BA 4F49A 2VIWA 1J14A 4TPYA 3PTBA 2GDDA 5AF9H 1DWDH 1TOMH 2WPIS 2TRMA 4X1PU 1KY9A 1KLJH 5CMXH 1SR5C 1TNJA 4ZHLU 5JB9S 1XKBC 2R3YA 3PB1E 3F9HA 1ZTKA 3A85A 1SVPA 1EPTC 2P16A 3LIWA 1ZGVA 1P03A 1FI8A