3F9FA

Crystal structure of the f140a mutant of sars-coronovirus 3c-like protease at ph 6.0
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
299
structure length
299
Chain Sequence
GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two adjacent mutations on the dimer interface of SARS coronavirus 3C-like protease cause different conformational changes in crystal structure.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 82
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3f9fA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9fA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9fA02
2QCYA 3A84A 5EPYA 3SV2H 1AKSA 7KMEH 2ZQ2A 2NU4E 3MNCA 4YLUA 1NRSH 3OY6U 2ZDNA 1C5OH 2SFAA 5HYOA 1CHOF 1TA2A 3A7YA 5JBAS 2HNTF 1EKBB 3DD2H 5K7RA 1C2DA 2FESH 1DLEA 2ZO3H 1P9SA 1EOLA 4NWLA 2ZFFH 4AZ2B 5DP8A 3RXCA 1GBFA 1GHAF 1MD8A 1Z8IB 2VGCC 3EA9A 4MPWA 4MDSA 5DP7A 1TMBH 3ATKA 1MQ5A 3KGPA 1GBMA 4NGAH 3AVZA 1GBDA 4ZHLU 3LGVA 1TNLA 3QGNB 3RMNH 1RS0A 4BAMB 1ETSH 4CBNA 1TQ7B 4AX9H 1ZRKA 4E05H 3RC5A 1TLDA 2YOLA 4ABIA 1EOJA 1OX1A 5DPAA 5SGAE 3SV8A 2ZFRH 3BIVH 2HNTC 1O39A 2FS9A 2GZ8A 1Q3XA 3RXHA 3TH4H 1N1LA 5L6NH 1HBTH 1OXGA 1W0ZU 1D9IA 1DWDH 1CGHA 1A1RA 1GBBA 1OOKB 2PKSC 4TY7A 1G3EA 2WUBA 1FUJA 1B0FA 2A5AA 2J34A 3TNSA 1ELBA 4R0IA 3W94A 1BB0B 3A7WA 1GJ8B 2FX4A 1ZMLA 1BTXA 2BZ6H 4MNXA 4FUIA 3QO6A 3GISB 2HNTE 5J4SA 2KAIA 1AD8H 2ZU2A 5LH8A 4JYTA 1MTSA 2ZNKH 3RXAA 2PKAB 3LONA 3V12A 1Z8JB 3GYMA 3TJNA 1V2TT 1M9UA 1OWKA 3S7KB 4E7NA 2GCHG 1AHTH 4YOJA 2BVXH 2OBQA 3VFEA 1VR1H 3E8LA 4FVBA 2CF9H 1ZHRA 4X6NA 1GL0E 3O8CA 1BHXF 1F7ZA 4Q2KA 2P8OB 1O3BA 3FZDA 1A0HB 1NRQH 1C5XB 4MPUA 2BHGA 1SSXA 1J16A 4GCHF 4OS5A 2BDCA 3F9FA 1CGJE 1QNJA 2LPRA 2F9NA 1ELAA 3ZZ9A 5DP5A 3KEEA 3ZYEA 2F9PA 1BTUA 1TALA 1P05A 2RA0A 1L1GA 2O8MA 3A8CA 1O2IA 4H6TA 3URDA 1ZRBA 1CU1A 4FU8A 5FPTA 2VIDA 2W3IA 4NIYA 1DPOA 1XXFA 4UFGH 1QL9A 3MWIU 2A7HA 1YM0A 4VGCB 1LPGB 3A7XA 1K2I1 4KGAA 5JBTA 1KXBA 2SGFE 1GI6A 2ODYB 2BY5X 3RXDA 1VITH 3F9HA 3P8OA 2R3YA 2TGAA 2CF8H 3ZZ5A 4K5ZA 1ZTLA 1GJCB 2XXLA 3S7HB 1C5SA 4AYVB 2XBXA 3A88A 1C9PA 4MTBA 2GMTC 3P8GA 3RXBA 2ZU5A 2FTMA 1GMDF 1G9IE 3MNBA 4MLFB 3SNAA 1YP9A 4DJZB 3NKKA 1Y5BT 1ESTA 3SUDA 1BT7A 1OPHB 3TJUA 1HRTH 1G3BA 3EYDA 2A2XH 2ZDLA 3T25A 1W13U 2G81E 1FQ3A 2VH0A 2SGQE 1AUTC 1NPMA 5JPMH 4FUBA 2BYAX 4BTTB 1ACBE 2AYWA 1EPTB 1VJAU 1SGTA 1LTOA 4B75A 1J15A 2W5EA 1JWTA 2CGAA 3D65E 1QGFA 1BRUP 1Y8TA 1RTKA 3R3GB 4O97A 4BAOB 3SUFA 1HAVA 1MTVA 2HPPH 3S69A 4CHAB 4K69A 2R0KA 5DP9A 3TK9A 4CREA 2J9NA 2G52A 1MBQA 4GSOA 4JYVH 1UK2A 4WWYA 1MKXH 3T28A 3T2NA 2VVCA 1AWHB 1EB2A 1TB6H 3BTTE 3EGKH 1UHBB 2JETB 1TNHA 3GDSA 1LVOA 2VU8E 1H8IH 4NA8A 4UDWH 3MU4A 1GHBF 4M7GA 1KXFA 1GI5A 2PTNA 1MTNB 1XKBC 4JZ1A 2PTCE 3M7UA 3PLKA 2EEKA 3SHCH 4B71A 1HGTH 1EP5A 4U32A 1IQHA 1YF4A 4D9QA 3K6YA 4IMQA 2ZECA 1XUKA 4K1SA 1MCVA 3A86A 2WPJS 5F6MA 2QF3A 3MH7A 2ODQA 3VEQB 2ZQ1A 1WSSH 5FCRA 1YPEH 5DP4A 4ISHH 1FLEE 4K8BA 1LQEA 3KQBA 1AKSB 1BBRK 2ANKH 3SW2B 1C5QA 5LPRA 1LVBA 2BY8X 1CA0C 2FODA 1CHOG 2XBVA 1C2HA 2JH6D 1YCPH 3DT0H 3SGAE 1GI3A 3P95A 2JH5D 1NFXA 1S6FA 4WMEA 1O34A 4AYYB 1LO6A 1RGQA 1UTQA 2XW9A 1GHAG 5GIBA 2RA3A 3T27A 5C20A 1Z1JA 4ZHAA 3RU4T 2V6NA 1EASA 2B5TB 2G5NA 3BTWE 4Q7ZA 2UWLA 3BTKE 4CBOA 1XKAC 1F92A 1YPGH 1IQEA 3OTJE 4GVUA 1W11U 2TGDA 3U8OH 2OC8A 1HAYB 2BD9A 3PWBA 1AUJA 1O5BB 1NFYA 1C5LH 2ZF0H 2FEQH 3UUZA 4XBBA 2PUXB 4YESB 3PB1E 1QQUA 2FWWA 1O2NA 3L33A 3MNSA 2EI6A 1UVOA 1P01A 1CO7E 3TITA 1OYQA 3OU0A 2A4GA 3RLWH 2PKAA 2AH4X 1SGDE 3SJIA 1O5EH 1BDAA 1GCTB 4Q7XA 4J1YA 4FU7A 3ZVBA 5AVDA 3AW0A 2C4FH 1OWDA 1RTFB 1TOMH 1W8BH 3NPSA 1O2RA 3V7TA 5TCCA 3UNQA 2NU2E 1QB6A 1N8OC 3EQ0H 3OYPA 3TJVA 1ELDE 5GJ4B 2ZU1A 2G51A 3NUMA 1GJ7B 1O3PB 1P02A 1SOTA 3RXSA 1QBNA 2AS9A 2O8WA 2CXVA 4X8UH 1Y3UA 1A3BH 4Z6AH 5JB9S 1O2SA 5DP3A 1GBLA 1C1QA 4TPIZ 3RC6A 5JB8S 5DP6A 2XC0A 3ODDA 1HB0B 1AZZA 1KY9A 3U98H 2BVSH 1YPHE 1SLVB 1F0UA 2OLGA 2FOAA 4ABGA 2VWLA 1K21H 2SGDE 3A82A 1DM4B 1NO9H 3A7ZA 3CP7A 5EQRA 3LPRA 1HXEH 4YTAA 3MMGA 3ITIA 2ZGXH 1TFXA 2NU1E 1SL3A 2PSXA 2BOKA 2Q6FA 4O9VA 4JK6A 5EXLA 1UK4A 1QA0A 1C5RA 1TBQH 2EC9H 1IQGA 2WPKS 4LZ4B 1FY3A 5CHAC 1O37A 2EI7A 3QDZB 4NFEA 2PSYA 1C1NA 2UWOA 1SGQE 1T4UH 4SGBE 3RC4A 5HM9A 1O31A 1MZDA 1H4WA 1ZTKA 1UVUH 1HAGE 4AFSA 3UR9A 1XMNB 1WBGB 2FXRA 1TNIA 3ZYDA 1F5LA 4WF8A 3U8RH 1BTYA 3PROA 1K22H 2C93B 3RU4E 2Z9IA 2AIPA 1GG6C 3BEIB 1DFPA 4IN1A 5DKMA 1D3PB 1E34B 1TPAE 2XC4A 2ODPA 1TBRH 5A8ZA 5EXMA 1D3TB 4TYDA 3RXVA 4CRFA 1O30A 2VGCB 4X2VA 1THPB 3RXJA 1LKAA 1TGSZ 5EXNA 1TABE 1W3CA 2R0LA 3MO3A 4Y6DA 4Y8YA 2HGTH 1ELFA 4IN2A 1AE8H 1A0LA 1O3JA 4JZIA 1AFEH 2F91A 7ESTE 3MU1A 2FIRH 3ZVEA 1FPCH 4YT6H 2ZPRA 3GYLB 4NA9H 1A2CH 2A2QH 4CH2B 1Y3VA 1WQSA 1TX8A 1GL1A 1P03A 3UPEA 2RCEA 1QRXA 5GPIB 2TGPZ 3B23B 1L4DA 4X1SU 1PPCE 1ZOMA 1THSH 1TX6A 1EJMA 1BTHH 1N6YA 2ZZUH 1ZPCA 1O2UA 5F8TA 2F9OA 2TGTA 2ZDKA 1BHXB 1ETRH 2F83A 5L2ZH 1V2ST 5EW2H 1FY4A 4X1QU 1WOFA 1XX9A 1GI8B 2UUJB 5A09A 3K9XB 4WVPE 3TGKE 1GHVH 4DT7B 2ULLA 1MQ6A 1ESBA 1AFQC 2R3UA 1HIAB 3GY4A 3GCTG 4KTCA 1V2WT 2AGGX 2IJOB 3VB5A 1EZSC 1YPMH 1IHTH 1VGCB 2ALPA 4MPXA 2XWBI 2BB4A 3U8TH 1W2KH 1O38A 1ZTJA 3MO6A 1O3NA 3NZIA 4JZEH 1Y59T 3T26A 5ABWA 3LGYA 2QN5T 1W0YH 2BTCE 2FLRH 3G01A 1O0DH 2OP9A 1G36A 1A5IA 1O32A 1S0QA 2EI8A 4XOJA 2G00A 2ZHEH 1UCYK 3CS0A 3VGCC 1IQKA 2P95A 1C9TA 1F5KU 3RXMA 2RDLA 3RXUA 1NN6A 4I7YH 4AFUA 4B76A 4NIXA 5EQQA 3GCNA 1QL8A 4IMZA 2VWOA 2ZTZA 2LIZA 1FN6A 1TGTA 3M5NA 1SQTA 3F68H 2ZWLH 3TU7H 2UUKB 3FAOA 4Q7YA 1SGEE 2A0QB 1S6HA 1HAXB 1NU7B 3GDVA 1DOJA 1ELTA 3GCTF 1KXDA 2PKSB 4KTUA 3E6PH 1A3EH 3TH3H 2DUCA 4NG9H 3ELAH 2Q6DA 2BXUH 1SHYA 2P93A 1O36A 1O3MA 3W95A 2ANWA 2Y5GA 1MH0A 4LK4A 1MCTA 1TPSA 6CHAB 1AZ8A 3UNSA 1C1OA 2C90B 2C8WB 2J95A 3FP7E 1KIGH 1O5GH 3VGCB 3ATMA 3PLPA 4A92A 1PQ8A 2H9HA 1UMAH 1EXFA 1HJAB 2VB0A 5F8ZA 1PYTC 3JZ1B 1UTOA 2A31A 1WAYB 1YGCH 1GHZA 4B74A 2Z3DA 1HV7A 3E90B 1RTLA 1QFKH 2Y82A 4B2AA 3STJA 1BBRH 2ZHQH 5C1YA 2OBOA 1DUAA 1MAYA 3RUOA 1LHEH 2AERH 2FMJA 4I8KA 3FFGA 1NZQH 1UCYE 3SU0A 4U01A 1GDUA 2WPLS 3HPTB 4ABAA 1UTJA 3DFLA 2VVUA 1VITG 1TA6A 4TWWA 1JXPA 1OWEA 5PTPA 3RM2H 1C1MA 4Q80A 2Y5HA 1FN8A 4IGDA 3UY9A 1C4U2 3F6UH 2Q6GA 3FVFB 3RXGA 1C1PA 3UNRA 3GCOA 1OP2A 3MU5A 3UTUH 1DE7H 5FX6A 4Y8ZA 3RP2A 1V2LT 3R0FA 4DW2U 2GT8A 1E36B 1FIWA 3TLOA 2NU3E 2QGRA 2XTTB 3M35A 1KSNA 1O2TA 1BRAA 1GI1A 1MUEB 2TIOA 5CE1A 1MKXK 1TRNA 4D76A 1C1UH 1T8LA 4OS1A 1MTUA 2B0FA 5DJ7A 3NK8A 3I78A 1AN1E 5BPEA 4BANB 3SU4A 1ELCA 1V2VT 2BD8A 4FVDA 4XSKU 1AVGH 3D49H 1ZMNA 1P3CA 1NRRH 1E35B 1RJXB 2WYJA 1BJUA 1K1IA 1CHGA 1LCYA 1B0EA 1O2XA 1BMAA 1O3EA 2FYQA 4ABBA 1ARBA 4ABEA 1O3KA 3E16B 1A5HA 2PWXA 1Z8RA 1C4V2 3BG4B 1SLWB 2ZC9H 2O9QA 3QWCH 3EA7A 1FZZA 5HGGA 2XYAA 1UCYH 1K1PA 3E0PB 4I32A 4WMDA 2PR3A 1T4VH 2CN0H 2QIQA 1T32A 2BOHB 1XM1A 4Z0KA 1C4Y2 3KIDU 1AU8A 4CHAC 1QTFA 1RIWB 1LHGH 1PQAA 5JYIA 1EAIA 1EJNA 1OWHA 5FCKA 3PLBA 1NU9A 4Y8XA 3SUEA 1GBIA 4WMFA 3SUGA 1NM6A 3KQCA 4UFEH 3L6PA 1PPEE 5GXPA 1NROH 6GCHF 1DDJA 2H2ZA 1O5AB 3GY6A 4H6SB 1Z8GA 2H1UA 3LU9B 3RXRA 3F9GA 1HIAA 4ZROA 1OSSA 2WYGA 1LPKB 3HGPA 1PPFE 3SU2A 2HVXA 1GMCF 4OGYA 3LC3A 1D6RA 3ZVDA 1SGCA 1ANCA 2VIWA 1NY22 4DIHH 1T8MA 5CHAB 1BMMH 1BOQA 1P12E 2C8XB 4ZKNU 2GKVE 4IBLH 3ZV9A 6CHAC 2H5DA 4A1TA 2A45B 4AG2A 1SR5C 5K0HA 2WV5A 2QY0B 2AIQA 4PROA 1YYY1 2ZGCA 1A61H 1T8NA 3GICB 4DGJA 2B9LA 4AB8A 5AHGH 1RFNA 1TIOA 3LIWA 4KKDA 3ZZDA 1O3GA 4CRCA 1V2RT 2ZGHA 4BXWA 5E2PA 4BAHB 1GJBB 4JZFH 4YLQH 1QCPA 1FAKH 1QIXB 3P92A 1TOCB 1H9HE 4AFQA 3LT3A 4WY3A 2O8TA 5IYTA 1O3DA 2ZCKP 2J94A 4CRGA 3P6ZB 1SBWA 2VNTA 3AASA 1BBRE 1GDNA 1YPLH 2FOCA 3SJKA 3ZVAA 4HFPB 3FANA 1DX5M 3MH5A 1FMGA 1QB9A 3LJOA 5J4QA 2VIQA 1QJ6B 3MYWA 4Y10E 1OP0A 1P8VC 2DE9A 3M61U 2XNIA 4OGXA 4FUGA 3URCA 1V2QT 1CE5A 1K28D 4O3TA 1W12U 3QK1A 1ZLRA 2GDDA 2C8ZB 2SGPE 1L1JA 2GCTB 3M36A 1ETTH 4MNVA 3MI4A 3O8RA 2H6MA 1BMNH 1ANBA 4ABDA 1AIXH 1IAUA 3BTME 1DICA 1C5UA 3PO1C 1C1WH 3ESTA 4FUCA 1ZJDA 3ZZ7A 4A5TS 2FO9A 3LDXH 1C2IA 6LPRA 1ZGVA 3ZZ6A 2ZTXA 1P2KA 4GCHG 1GBHA 1AE5A 1TPPA 2HALA 1NRPH 2Z9GA 3OY5U 4NFFA 1WQVH 1PPBH 1BTWA 1TWXB 2A4OA 1C1SA 4YO9A 2ZKSA 1KLJH 1A46H 3SNCA 1ZHPA 1IQNA 1CT0E 2HWLB 4K3JA 3ZZ8A 1IHSH 2KAIB 3O8BA 3PMJA 2ZPSA 4TY6A 1TX7A 2H9EH 2FM2A 2IN2A 1GJ6A 5EG4A 1C5WB 2D2DA 2PW8H 1O3AA 4ISLA 3RXEA 4A1VA 1Q2WA 2A7JA 1KYNA 3Q3KA 1EJAA 1EPTA 2AMPA 3RM0H 1O2JA 1L1NA 2FI4E 1G37A 1XUFA 2P59A 1HDTH 2QF0A 1O5FH 1O2PA 3M7QA 2ANMH 1FY8E 4K1EA 5I46H 1TE0A 4J2YB 2BQ7B 4INHA 4NSYA 5FHTA 1TAWA 1EX3A 1DXPA 5A0CA 2AMQA 1GHYH 3SQEE 4JMYA 1SI5H 1Z71A 1G2MA 3CENA 4Y11E 1C5ZB 1O2QA 1TRMA 5FPYA 3EDXB 4DURA 1WV7H 1YCPM 4GHTA 1HJ9A 4MNWA 4JCNA 1S82A 4I8LA 1OKXA 3BTEE 4UE7H 1MTWA 1O3CA 3TK6A 4X6MA 2BD3A 3EE0B 3GY8A 4ZKSU 1CT2E 1JRTA 2GDEH 1QY6A 2OC1A 1RRKA 3RMLH 1GHXH 2O8UA 1GJ4H 5EPNA 1XVOA 2BX4A 4GHQA 3V13A 2G8TA 2BX3A 1HYLA 4ISIH 1FY5A 2CMYA 3FP6E 2GV7A 1FDPA 5A8XA 4B2BA 1GDQA 4BTIB 1GGDC 3QGJA 1PPZA 4D7FA 4B1TA 3V3MA 5L2YH 1LMWB 1YPJH 1P9UA 2QXGA 1FY1A 1B5GH 1YKTA 2NU0E 3H7OA 2UUFB 4NIWA 2B7DH 3GOVB 4ASHA 3N7OA 1S84A 3MTYA 5JBBS 3O8DA 2FI3E 1VCQA 1SGPE 3A87A 4BOHA 2PUQH 1V2KT 2VJ1A 3M3SA 1TGCA 2Y6TA 2VWMA 3MH6A 2ESTE 3DUXH 3E91A 4NSVA 4MQAA 1Z6EA 1FIZA 1E38B 1TBZH 4WH8A 3WY8A 2BLWA 2BZAA 3RMOH 3Q3XA 2BD2A 1XUGA 2W3KA 1QJ1B 1DITH 3HGNA 4JK5A 1DSUA 3M37A 3M7TA 5FPSA 3RDZA 3UR6A 1H1BA 3KHVA 2STBE 3SGQE 4K1TA 3CS7A 2OC7A 1P2JA 2WPIS 3I29A 1EQ9A 2STAE 4FUDA 1P10A 8GCHG 1CQQA 1ZSLA 5EODA 3BTHE 2QXIA 5T6FA 1TMUH 3PV4A 1C1RA 2ZFTA 2R2MB 3BIUH 1O2WA 2G4UA 1P3EA 2CJIA 3ENSB 3RXLA 1H9LB 3SHAH 4E7RG 1VCWA 1ABJH 4RKOB 1EZXC 1WYKA 3SNEA 1GPZA 2HOBA 1P2OA 2PLXA 3H7TA 3UWJH 1KTSB 1GBAA 1VITF 4BTUB 2FOMB 1A4WH 1CA0B 1P0SH 4Y7AA 3T62A 1J9CH 2Z3EA 4BXSA 3VPKA 2GV6A 4XBDA 1WCZA 2Q1JA 2QA9E 2QXHA 1V2JT 5GWZA 1EAUA 5I25A 2ZA5A 5A0AE 3MU0A 4AOQA 1C2FA 1DUEA 1DWCH 4K60A 3Q77A 4ISOA 1LHDH 3V0XA 1O2OA 1KDQA 2G55A 1LHFH 1AO5A 1MAXA 3SU3A 1V2NT 4DVAU 4X6OA 1INCA 4AB9A 2ZIQH 3RXOA 1C5TA 1G3CA 1KXAA 5TJXA 3A81A 3UOUA 3MHWU 1QL7A 2ZDAH 1UHBA 3T29A 3GDUA 5AFZH 3SU1A 3EBNA 4RN6A 3ATLA 2A5KA 1GJ5H 3U1IB 2FYRA 4ISNA 1S81A 2ZU3A 4NWKA 4XE4A 1P09A 3GY3A 1THRH 2XWAA 4ZXYH 1UVSH 3GY7A 2Z7FE 3RXKA 3Q3YA 2ZU4A 1CBWB 5HMAA 5FXLA 2P8OC 4RSPA 1SC8U 3IWMA 1BCUH 2QV1A 1EUFA 4XDEA 2C8YB 1UVPA 2GX4A 1UO6A 2I6SA 2VINA 3JZ2B 2R2WU 3ODFA 4YZUA 4K2YA 9LPRA 3GCHC 1D6WA 3UQVA 1SMFE 3LGIA 2IPHA 2J2UA 1MKWK 4X8TH 2ZPQA 4NA7A 1SFIA 1HAIH 1ZSJA 5ESBA 3LOXA 4A1XA 4HGCA 1C1VH 4ZHMU 1EAWA 3S0NA 5C3NA 1A7SA 2ZCLP 3A7VA 3ZVCA 1IQLA 3F9EA 3BTGE 3SU6A 4BAKB 1S83A 2QAAA 1E37B 4GAWA 1TONA 3A85A 1V6DA 2Z94A 1A5GH 3AAUA 8ESTE 3VXEH 3PTBA 3M5OA 4BAQB 2J38A 1KLIH 2ASUB 3MU8A 1K1MA 1GBEA 1XVMA 1W10U 1N8OB 2FDAA 2GCHF 4X0WU 6ESTA 7GCHF 3A8DA 3DA9B 1RIWC 1ZHMA 1O3OA 5C2ZA 2G4TA 1BMLA 3D62A 5FBEA 2WPHS 1SQAA 2A7CA 4X2YA 2XCFA 2ZHFH 5BRRE 1FXYA 4Y71A 1ZJKA 2BM2A 1SOZA 1DXWA 1SB1H 1P2MA 3QUMP 2CHAB 1ELVA 1QHRB 2B8OH 3HKJB 4DOQA 4AFZA 3PM3A 1OS8A 1O3IA 4H42U 2ZHWH 4OS2A 4FXGH 1V2PT 1BJVA 5E8EH 4Y7BA 1NTPA 5TCAA 3BEUA 3L3TA 4X6PA 1SGNE 1T7CA 2XCNA 1O3LA 1TNKA 2OD3B 1H8DH 2ZGJA 5JDUB 3S9AA 1CA8B 4ABHA 1CBWC 2LNCA 3BSQA 4KELA 1SLXB 1UVTH 1LVYA 3OSYA 4IC5A 4Y76A 2VIVA 3PMBB 3T5FH 2OQUA 2V3OH 3KCGH 1YPKH 4GUXA 1SPJA 5EOKA 5F03A 3PO1B 2GD4B 3QZQA 4X2WA 2ZFPH 1NT1A 2ZTYA 1AB9C 4KP0A 1CSOE 1MMJN 2WUCA 3Q76A 1PPHE 1FPHH 4ABFA 5E2OA 4WXIA 1JMOH 3LH3A 1QR3E 2W7SA 5T6DA 4DG4A 4LXBH 1KDQB 1O2KA 1L4ZA 1XUHA 1MU8B 1EB1H 2BLVA 1C5MD 4CH8B 1BITA 1VGCC 1HUTH 1N6XA 4RKJB 3LGWA 3QZRA 1K1JA 2Z9LA 2G5VA 4IW4E 3SJ8A 1AQ7A 5F8XA 1Y5AT 2C3SA 3LGUA 4UEHH 1HNEE 1K9OE 2BDYA 3UQOA 3NXPA 2OCVB 4MG3A 5AFYH 3SOSA 1FNIA 1Y5UT 4HZHA 1PPGE 1LDTT 1O2GH 1WUNH 2V0BA 5GCHF 2QXJA 5EQSA 1QJ7B 1SHHB 3D23A 1TGNA 2BDHA 2JKHA 3HK3B 2PGQB 5A8YA 2WINI 1PYTD 1P11E 1U6QA 1OWIA 3MOCA 3ZVFA 3ZVGA 3HK6B 4AG1A 5AF9H 2GT7A 1V2OT 1GI0A 1SLUB 4OS7A 4I31A 1SGFG 5T3HA 5EGMA 5B6OA 1O3FA 4ZXXH 3UFAA 4BNRA 4DY7B 1GJAB 3Q00A 1QA7A 1ELGA 2M5TA 4Y0ZE 1V3XA 3LKWA 1NFUA 4THNH 1DT2A 1BA8B 2D8WA 2VVVA 2BDAA 1GBJA 4JYUH 3SV7A 3TVJB 1ZR0A 3C27B 4NZQA 2BD4A 2K1QA 1W7XH 1MBMA 1GWAA 3QTOH 4DCDA 1GHWH 2FTLE 1D3DB 4O03A 2F9UA 3VB3A 1MD7A 2XBWA 1DY9A 3EA8A 4AGKA 1J8AA 4U30A 3K6ZA 4B73A 2P3TB 1FONA 3I77A 1XUJA 2J4IA 1GBTA 1HLTH 2Y7XA 3OX7U 3GY5A 2GTBA 1S5SA 2VH6A 1YLDA 4X2XA 4AN7A 1ELEE 1QBOA 1PQ5A 3LJJA 3ZV8A 3A8BA 4I8JA 3E0NB 2BDIA 3HATH 2BDGA 1LHCH 4OS4A 5E0GA 1HAZB 3BG4C 2FOGA 2GGVB 1YCPK 3SJ9A 1A0JA 1GCTC 2A4QA 3PMAB 4GPGA 4KTSA 2AGEX 1SGFA 1TRYA 2H5CA 2TRMA 2ANYA 4LZ1H 2IOTA 9ESTA 1C1TA 5A2MH 1TGBA 2JH0D 3C1KA 1ESAA 2EA3A 3KN2A 3ZZAA 3RLYH 1YBWA 2OUAA 2Z9JA 1PJPA 2BMGB 1HAHH 2FI5E 2XRCA 2QC2A 2BQWB 3STIA 3RXTA 3ZZBA 3SI3H 1ZSKA 2FOFA 5EU8A 2ZCHP 2ZI2H 4DIIH 4ZH8A 1BRCE 2AEIH 1WU1A 2XBYA 1ORFA 3M3VA 3VB4A 3UOPA 3RXIA 1GVZA 4I8HA 3VXFH 1GVKB 1YC0A 5CMXH 1C2EA 1MU6B 2D1JA 1VZQH 2PV9B 4A6LA 2ALVA 4TPYA 1G3DA 2ZP0H 2BQ6B 1TYNA 4NIVA 3QX5H 1L0ZA 2WV4A 1P2QA 1AVWA 5FX5A 2CV3A 3PWCA 1GI2A 1AY6H 3EAJA 3BF6H 1J14A 4D8NA 4ESTE 1IQMA 1CGIE 2P94A 2ZDVH 2H9TH 4U2WA 1O5DH 5LGOA 2SNWA 1SGIB 3TH2H 2SGEE 2THFB 4X1RU 2PFEA 3A7TA 2FLBH 1TNJA 3SNDA 1P57B 3KL6A 4WH6A 1G32B 1K1NA 4FUFA 1GI4A 1GI7B 5H4IB 2ZDMA 1ANDA 1EZQA 1G2LA 3KNXA 1RD3B 1NFWA 1DVAH 2UUYA 1JBUH 2ZGBH 3ZZ4A 2FOEA 1HPGA 1W14U 2ZHDA 4D7GA 5LPEA 1EAXA 3E3TA 1UJ1A 2FOHA 2BLQA 4ZUHA 4WXVA 3U1JB 2Z3CA 1UTMA 2ZG0H 2P16A 4SGAE 5FAHA 3IG6B 5G4BA 4XBCA 1FAXA 3TIUA 1C5YB 1NRNH 1CVWH 3SI4H 1XUIA 3RXQA 1QRWA 4A7IB 1HJ8A 1GBCA 2AFQB 2R9PA 1H9IE 1OYTH 1IOEA 2BD7A 1O3HA 2Z9KA 6GCHG 1ABIH 3FP8E 1C2GA 3ZZCA 2P3FH 2UWPA 2D26C 3M3TA 4Y0YE 2VIOA 4D9RA 1MTNC 5EW1H 1Y3YA 2GP9B 4X1NU 2Z6BD 3MH4A 3S9BA 1S85A 8KME2 5DGJA 1JOUB 1O2ZA 3HKIB 2BY9X 1FI8A 3S9CA 1W7GH 2JETC 8LPRA 3U69H 3TNTA 4AGJA 2BVRH 5JBCS 4MPVA 2ZFQH 3RU4D 4UONA 1F0SA 1AB9B 1P2NA 2OQ5A 1GJDB 1HAOH 1AVXA 5FBIA 1LPZB 3NCLA 3SU5A 2BXTH 1NESE 1OWJA 2RG3A 1F0TA 3RMMH 3SV9A 1C5VA 1BTZA 4ZKRU 1F2SE 4YM9A 1JIRA 1AI8H 1BIOA 5DO4H 1BZXE 1EP6A 2OC0A 2ILNA 3GY2A 4H4FA 2P3UB 3VB7A 5DK1A 7GCHG 2TBSA 2V35A 4IS5A 5L30H 4YOIA 4K8YA 4ZKOU 1Z1IA 2FOBA 4VGCC 1O35A 1C2JA 1AMHA 1HXFH 2OINA 3PTNA 3SO3A 1D4PB 2I6QA 2Y81A 7LPRA 2F9BH 3F1SB 1O2LA 1Z6JH 2AMDA 2F3CE 1FV9A 2VIPA 3SBKA 2J92A 3FZZA 1O2HA 4ZAEA 1ZMJA 3AAVA 1T31A 1DY8A 1GMCG 1KLTA 3TK5A 3SJOA 1VJ9U 2FX6A 3P8NA 1SQOA 4B2CA 2GMTB 4CRAA 1DANH 5E0JA 1EATA 3B9FH 1C5NH 1F0RA 1DWBH 1L2EA 5ESTE 2K7XA 1AGJA 4UFFH 2SNVA 2OXSA 1GMHF 4YT7H 3MFJA 3SN8A 4UFDH 2GVFA 2A1DB 3LC5A 1SFQB 1QURH 5T6GA 1K1OA 4MNYA 3MNXA 3A83A 1OP8A 2HRVA 1P06A 4NCYA 2O8LA 4XFQA 3ATWA 5C5OA 4R8TB 1BUIA 1ID5H 2XC5A 3SGBE 1DLKB 1ARCA 1F5RA 4E06H 3TGJE 2SGAA 3LGTA 5GDSH 4ABJA 2VWNA 3PYHA 4Y79A 3ATIA 1NC6A 1CT4E 3P70B 4FU9A 5IDKA 3UWIA 3AW1A 1C2LA 1SVPA 1HFDA 4JZDH 1O2VA 1ZGIA 2BY6X 4F4OC 2GZ7A 4WJG2 2W26A 1ANEA 5A0BA 1IQFA 1GVLA 1GBKA 3BV9B 3KQDA 2YNBA 1PFXC 1ZYOA 3A80A 5LPFA 5DG6A 1YPHC 4HTCH 1WTGH 1UTPA 2V3HH 3IITA 1G30B 3QLPH 2DE8A 2FS8A 3TGIE 1P2IA 1UTNA 2Y80A 2GCTC 2YNAA 1V2MT 5GCHG 1GMHG 1Y3WA 2AGIX 2NWNA 4AORA 1KXCA 4X1PU 4X8VH 4MVNA 5HM2A 3SQHE 3SORA 2BDBA 3K2UA 4X8SH 1QB1A 3P8FA 1AWFH 4FUJA 2OTVA 5ETXA 3TJOA 2PHBA 4CRDA 4FUHA 1DWEH 4INKA 1IQJA 1D3QB 1K1LA 3A8AA 4GLYA 1VCPA 4O3UA 2A4RA 3H5CB 3TPIZ 1DS2E 3RXFA 4ZMAH 1X7AC 3KQEA 3DFJA 1WTHD 1T8OA 1ZZZA 5HXFA 1BQYA 1Q31A 3K65B 1GGDB 4OS6A 1EZUC 2FPZA 1ZPZA 4TWYA 1EPTC 1B7XB 2W7UA 5E0HA 2A5IA 3M5LA 1GCDA 3ZZ3A 2Y5FA 1GMDG 1BTPA 2TPIZ 3BEFB 1C2MA 4I8GA 1HJAC 2ZFSA 1UTKA 1IQIA 3UIRA 1O2MA 1TMTH 3BTDE 3SV6A 1NS3A 1PQ7A 3GCHB 3RXPA 1UTLM 3SNBA 1O33A 1LVMA 3SZNA 3M5MA 1SGYE 2BLOA 4QT8C 5C1UA 1GI9B 1O2YA 4FUEA 3QTVH 1J17T 3BTFE 2FZZA 2Y7ZA 1QBVH 1O5CB 2F9VA 1YLCA 5C1XA 5C67A 1JRSA 1MZAA 2QYIA 3LH1A 1JIMA 5C5NA 1HAVB 1V2UT 2ZEBA 2PGBB 1Y3XA 1FJSA 3P17H 1TPOA 1TNGA 2FP7B 4CR5A 3UREA 1HAPH 3A89A 3KF2A 1BRBE 4I33A 3MO9A 2GZ9A 2A32A 1HCGA 3BTQE 4INLA 1C5PA 1SG8B 1TQ0B 1GHBG 4F49A 1E0FD 4YOGA 4CR9A 3NWUA 8GCHF 4HI3A 1KXEA 2HLCA 2BY7X 1DSTA 3QN7A 1RXPA 4CRBA 1QRZA 1UK3A 1P04A 4LOYH 3DHKH 1ZPBA 4IC6A 1XXDA 3E1XB 1C2KA 1Z7KA 1AFQB 1SGRE 3PMHB 1LKBA 3BN9A 1KTTB 1QQ4A 1MKWH 3VB6A 4UD9H 1GJ9B 3B8JA 2CHAC 2BD5A 4NZLA 1GG6B 1S0RA 1LQDB 2WPMS 3U9AH 3BG8A 2HPQH
chains in the Genus database with same CATH superfamily
2QCYA 3A84A 5EPYA 3SV2H 2F4LA 1AKSA 7KMEH 2ZQ2A 2NU4E 3MNCA 4YLUA 1NRSH 3OY6U 2ZDNA 4P02A 1C5OH 2SFAA 5HYOA 1CHOF 1TA2A 3A7YA 5JBAS 2HNTF 1EKBB 2XNDD 3DD2H 5K7RA 1C2DA 2FESH 1DLEA 2ZO3H 1P9SA 1EOLA 4NWLA 4ACBA 2ZFFH 4AZ2B 5DP8A 3RXCA 1GBFA 1GHAF 1MD8A 1Z8IB 2VGCC 4RT1A 3EA9A 4MPWA 4MDSA 5DP7A 1TMBH 3ATKA 1MQ5A 3KGPA 5IK2D 1GBMA 2J98A 4NGAH 3AVZA 2L74A 1VKYA 1GBDA 4ZHLU 3LGVA 1TNLA 3QGNB 3RMNH 1RS0A 4BAMB 1ETSH 4CBNA 1TQ7B 4AX9H 1ZRKA 4E05H 3RC5A 1TLDA 2YOLA 4ABIA 1EOJA 1OX1A 5DPAA 5SGAE 3SV8A 2ZFRH 3BIVH 2HNTC 1O39A 2FS9A 2GZ8A 1Q3XA 3RXHA 3TH4H 1N1LA 5L6NH 1HBTH 1OXGA 5T1VA 1W0ZU 1D9IA 1DWDH 1CGHA 1A1RA 1GBBA 1OOKB 2PKSC 4TY7A 1G3EA 5EJZA 2WUBA 1FUJA 1B0FA 2A5AA 2J34A 3TNSA 1ELBA 4R0IA 3W94A 1BB0B 3A7WA 1GJ8B 2FX4A 1ZMLA 1BTXA 2BZ6H 4MNXA 5C0TA 4FUIA 3QO6A 3GISB 2HNTE 5J4SA 2KAIA 1AD8H 2ZU2A 5LH8A 4JYTA 1MTSA 2ZNKH 3RXAA 2PKAB 3LONA 3V12A 1Z8JB 3GYMA 3TJNA 1V2TT 2WV9A 4DT4A 1M9UA 1OWKA 3S7KB 4E7NA 2GCHG 1AHTH 4YOJA 2BVXH 2OBQA 3VFEA 1VR1H 3E8LA 4FVBA 2CF9H 1ZHRA 4X6NA 1GL0E 3O8CA 1BHXF 1F7ZA 4Q2KA 2P8OB 1O3BA 3FZDA 1A0HB 1NRQH 1C5XB 4MPUA 2BHGA 1SSXA 1J16A 4GCHF 4OS5A 5F53A 3OFND 1S6LA 2BDCA 3F9FA 1CGJE 1QNJA 2LPRA 2F9NA 1ELAA 3ZZ9A 5DP5A 3KEEA 3ZYEA 2F9PA 1BTUA 1TALA 1P05A 2RA0A 1L1GA 5GNDA 2O8MA 3A8CA 1O2IA 4H6TA 3URDA 1ZRBA 1CU1A 4FU8A 5FPTA 2VIDA 5EJ1A 2W3IA 4NIYA 1DPOA 1XXFA 4UFGH 1QL9A 3MWIU 2A7HA 1YM0A 4VGCB 1LPGB 3A7XA 1K2I1 4KGAA 5JBTA 1KXBA 2SGFE 1GI6A 2ODYB 1E1RD 2BY5X 3RXDA 1VITH 3F9HA 4B6FA 4HG6A 3P8OA 2R3YA 2TGAA 2CF8H 3ZZ5A 4K5ZA 1ZTLA 1GJCB 2XXLA 3S7HB 1C5SA 4AYVB 3OE7D 2V3MA 2XBXA 3A88A 1C9PA 4MTBA 2GMTC 3P8GA 3RXBA 2ZU5A 2FTMA 1GMDF 1G9IE 3MNBA 4MLFB 3SNAA 1YP9A 2J5UA 3NKKA 4DJZB 1Y5BT 1ESTA 3SUDA 1BT7A 1OPHB 3TJUA 1HRTH 1G3BA 3EYDA 2A2XH 2ZDLA 3T25A 1W13U 2G81E 1FQ3A 2VH0A 2SGQE 1AUTC 1NPMA 5JPMH 4FUBA 2BYAX 4BTTB 1ACBE 2AYWA 1EPTB 1VJAU 1SGTA 1LTOA 4B75A 1J15A 2W5EA 1JWTA 2CGAA 3D65E 1QGFA 1BRUP 1Y8TA 1RTKA 3R3GB 4O97A 4BAOB 3SUFA 1HAVA 1MTVA 2JJ2D 2HPPH 3S69A 4CHAB 4K69A 2R0KA 5DP9A 3TK9A 4CREA 2V7QD 1FX0B 2J9NA 2G52A 1MBQA 4GSOA 4JYVH 1UK2A 4WWYA 1MKXH 3T28A 3T2NA 2VVCA 1AWHB 1EB2A 1TB6H 3BTTE 3EGKH 1UHBB 2JETB 1TNHA 3GDSA 1LVOA 2VU8E 3F0OA 1H8IH 4NA8A 4UDWH 3MU4A 1GHBF 1H8ED 2J98B 4M7GA 5DSFA 1KXFA 1GI5A 1MTNB 1XKBC 2PTNA 4JZ1A 2PTCE 3M7UA 3PLKA 2EEKA 3SHCH 4B71A 1HGTH 5FL7D 1EP5A 1YWUA 4U32A 1IQHA 1YF4A 4D9QA 5KECA 3K6YA 4IMQA 2ZECA 3OEED 1XUKA 4K1SA 1MCVA 2EQNA 3A86A 2WPJS 5F6MA 2QF3A 3MH7A 2ODQA 1BMFD 3VEQB 2ZQ1A 1WSSH 1YY3A 5FCRA 3MQKC 1YPEH 5DP4A 5C0UA 4ISHH 1FLEE 4K8BA 1LQEA 3KQBA 1AKSB 1BBRK 2ANKH 3SW2B 2KX4A 1C5QA 5LPRA 1LVBA 2BY8X 1CA0C 2FODA 1CHOG 2XBVA 1C2HA 2JH6D 1YCPH 3DT0H 3SGAE 1GI3A 3P95A 2JH5D 1NFXA 1S6FA 4WMEA 1O34A 1E1QD 4AYYB 1LO6A 1RGQA 1UTQA 2XW9A 1GHAG 5GIBA 2RA3A 3T27A 5C20A 1Z1JA 4ZHAA 3RU4T 2V6NA 1EASA 2B5TB 2G5NA 3BTWE 4Q7ZA 2UWLA 3BTKE 4CBOA 1XKAC 1F92A 1YPGH 1IQEA 2PP6A 3OTJE 4GVUA 1W11U 2TGDA 3U8OH 2OC8A 1HAYB 2BD9A 3PWBA 1AUJA 1O5BB 1NFYA 1C5LH 2ZF0H 2FEQH 3UUZA 4XBBA 2PUXB 4YESB 4B6EA 3PB1E 1QQUA 2FWWA 1O2NA 3L33A 3MNSA 2EI6A 1UVOA 1P01A 1CO7E 3TITA 1OYQA 3OU0A 2A4GA 3RLWH 2PKAA 2AH4X 1SGDE 3SJIA 1O5EH 1BDAA 1GCTB 4Q7XA 4J1YA 4FU7A 3ZVBA 5AVDA 3AW0A 2C4FH 1OWDA 1RTFB 1TOMH 1W8BH 3NPSA 1O2RA 3V7TA 5TCCA 3UNQA 2NU2E 1QB6A 1N8OC 3EQ0H 3FOAA 3OYPA 2CK3D 3TJVA 1ELDE 5GJ4B 2ZU1A 2G51A 3NUMA 1GJ7B 1O3PB 3FO8D 4RI0A 1P02A 1SOTA 3RXSA 1QBNA 2AS9A 2O8WA 2YMSD 2CXVA 4X8UH 1Y3UA 1A3BH 4Z6AH 5JB9S 1O2SA 2KZ4A 5DP3A 1GBLA 1C1QA 4TPIZ 3RC6A 5JB8S 5DP6A 2XC0A 3ODDA 1HB0B 1AZZA 1KY9A 3U98H 2BVSH 1YPHE 1SLVB 1F0UA 2OLGA 2FOAA 4ABGA 2VWLA 1K21H 2SGDE 3A82A 1DM4B 1NO9H 3A7ZA 3CP7A 5EQRA 3LPRA 1HXEH 4YTAA 3MMGA 3ITIA 2ZGXH 1TFXA 2NU1E 1SL3A 2PSXA 2BOKA 2Q6FA 4O9VA 4JK6A 5EXLA 1UK4A 1QA0A 1C5RA 2EC9H 1TBQH 5CHBA 1IQGA 2WPKS 4LZ4B 1FY3A 5CHAC 1O37A 2EI7A 3QDZB 4NFEA 2PSYA 1SKYE 1C1NA 2UWOA 1SGQE 1T4UH 4SGBE 3RC4A 5HM9A 1O31A 2IJD1 1MZDA 1H4WA 1ZTKA 1UVUH 1HAGE 4AFSA 3UR9A 1XMNB 1WBGB 2FXRA 1TNIA 3ZYDA 1F5LA 4WF8A 3U8RH 1BTYA 3PROA 1K22H 2C93B 3RU4E 2Z9IA 2AIPA 1GG6C 3BEIB 1DFPA 4IN1A 5DKMA 1D3PB 1E34B 1TPAE 2XC4A 2ODPA 1TBRH 5A8ZA 5EXMA 1D3TB 4TYDA 3RXVA 4CRFA 1O30A 2VGCB 4X2VA 1THPB 3RXJA 1LKAA 1TGSZ 5EXNA 1TABE 1W3CA 2R0LA 3MO3A 4Y6DA 4Y8YA 2HGTH 1ELFA 4IN2A 1AE8H 1A0LA 1O3JA 4JZIA 1AFEH 2F91A 7ESTE 3MU1A 2FIRH 3CNRA 3ZVEA 1FPCH 4YT6H 2ZPRA 3GYLB 4NA9H 1A2CH 2A2QH 4CH2B 1Y3VA 1WQSA 3OTPA 1TX8A 1GL1A 1P03A 3UPEA 2RCEA 1QRXA 5GPIB 2TGPZ 3B23B 1L4DA 4X1SU 1PPCE 1ZOMA 1THSH 1TX6A 1EJMA 1BTHH 1N6YA 2ZZUH 1ZPCA 1O2UA 5F8TA 2F9OA 2TGTA 2ZDKA 1BHXB 1ETRH 2F83A 2KR7A 5L2ZH 2KCAA 1V2ST 5EW2H 1NBMD 1FY4A 4X1QU 1WOFA 1XX9A 1GI8B 2UUJB 5A09A 3K9XB 4WVPE 3TGKE 1GHVH 4DT7B 2ULLA 1MQ6A 1ESBA 1AFQC 2R3UA 1MABB 1HIAB 3GY4A 3GCTG 4KTCA 1V2WT 2AGGX 2IJOB 3VB5A 1EZSC 1YPMH 1IHTH 1VGCB 2ALPA 4MPXA 2XWBI 2BB4A 3U8TH 1W2KH 1O38A 1ZTJA 3MO6A 1O3NA 3F2HA 3NZIA 4JZEH 1Y59T 3T26A 5ABWA 3LGYA 2QN5T 1W0YH 2BTCE 2FLRH 3G01A 3OAAD 1O0DH 2KFWA 2OP9A 1G36A 1A5IA 1O32A 1S0QA 2J97A 2EI8A 4XOJA 2G00A 2ZHEH 1UCYK 3CS0A 3VGCC 1IQKA 2P95A 1C9TA 1F5KU 3RXMA 2RDLA 3RXUA 1NN6A 4I7YH 4AFUA 4B76A 4NIXA 5EQQA 3GCNA 1QL8A 4IMZA 2VWOA 2ZTZA 2LIZA 1FN6A 1TGTA 3M5NA 1SQTA 3F68H 2ZWLH 3TU7H 2UUKB 3FAOA 4Q7YA 1SGEE 2A0QB 1S6HA 1E79D 1HAXB 1NU7B 3GDVA 1DOJA 1ELTA 3GCTF 1KXDA 2PKSB 4KTUA 3E6PH 1A3EH 3TH3H 2DUCA 4NG9H 3NRLA 3ELAH 2Q6DA 2BXUH 3W1EA 1SHYA 2P93A 1O36A 1O3MA 3W95A 2ANWA 2Y5GA 1MH0A 4LK4A 1MCTA 1TPSA 6CHAB 1AZ8A 3UNSA 1C1OA 2C90B 2C8WB 2J95A 3FP7E 1KIGH 1O5GH 3VGCB 3ATMA 3PLPA 4A92A 1PQ8A 2H9HA 1UMAH 1EXFA 1HJAB 2VB0A 5F8ZA 3SZEA 1PYTC 3JZ1B 1UTOA 2A31A 1WAYB 1YGCH 1GHZA 4B74A 2Z3DA 1HV7A 3E90B 1RTLA 1QFKH 2Y82A 4B2AA 3STJA 1BBRH 2ZHQH 5C1YA 2OBOA 1DUAA 3F2FA 1MAYA 3RUOA 1LHEH 2AERH 2FMJA 4I8KA 3FFGA 1NZQH 2JDID 1UCYE 3SU0A 4U01A 1GDUA 2WPLS 3HPTB 4ABAA 1UTJA 3DFLA 2VVUA 1VITG 1TA6A 4TWWA 1JXPA 1OWEA 5PTPA 3RM2H 1C1MA 4Q80A 5HKKD 2Y5HA 1FN8A 4IGDA 3UY9A 1C4U2 3F6UH 2Q6GA 3FVFB 3RXGA 1C1PA 3UNRA 3GCOA 1OP2A 3MU5A 3UTUH 1DE7H 5FX6A 4Y8ZA 3RP2A 1V2LT 3R0FA 4DW2U 2GT8A 1E36B 1FIWA 3TLOA 2NU3E 2QGRA 2XTTB 3M35A 1KSNA 1O2TA 3H09A 1BRAA 1GI1A 1MUEB 2TIOA 5CE1A 1MKXK 1TRNA 4D76A 1C1UH 1T8LA 4OS1A 1MTUA 2B0FA 5DJ7A 3NK8A 3I78A 1AN1E 5BPEA 4BANB 3SU4A 1ELCA 1V2VT 2BD8A 4FVDA 4XSKU 1AVGH 3D49H 1ZMNA 1P3CA 1NRRH 4ACAA 1E35B 1RJXB 2WYJA 1BJUA 1K1IA 1CHGA 1LCYA 1B0EA 1O2XA 1BMAA 1O3EA 2FYQA 4ABBA 1ARBA 4ABEA 1O3KA 3E16B 1A5HA 2PWXA 1Z8RA 1C4V2 3BG4B 1SLWB 2ZC9H 2O9QA 3QWCH 3EA7A 1FZZA 5HGGA 2WSSD 2XYAA 1UCYH 1K1PA 3E0PB 4I32A 4WMDA 2PR3A 1T4VH 2CN0H 2QIQA 1T32A 2BOHB 1XM1A 4Z0KA 1C4Y2 3KIDU 1AU8A 4CHAC 1QTFA 1RIWB 3F3BA 1LHGH 1PQAA 5JYIA 1EAIA 1EJNA 1OWHA 5FCKA 2OK5A 3PLBA 1NU9A 4Y8XA 3SUEA 1GBIA 4WMFA 3SUGA 1NM6A 3KQCA 4UFEH 3GS9A 3L6PA 1PPEE 5GXPA 1NROH 6GCHF 1DDJA 2H2ZA 1O5AB 3GY6A 4H6SB 1Z8GA 1OHHD 2H1UA 3KYFA 3LU9B 3RXRA 3F9GA 1HIAA 4ZROA 1OSSA 3EE7A 2WYGA 1LPKB 3HGPA 1PPFE 3SU2A 2HVXA 1GMCF 4OGYA 3LC3A 1D6RA 3ZVDA 1SGCA 1ANCA 2VIWA 1NY22 4DIHH 1T8MA 5CHAB 1BMMH 1BOQA 1P12E 2C8XB 4ZKNU 2GKVE 4IBLH 3ZV9A 2QE7D 6CHAC 2H5DA 4A1TA 2A45B 4AG2A 1SR5C 5K0HA 2WV5A 2QY0B 2AIQA 4PROA 1YYY1 2ZGCA 1A61H 1T8NA 3GICB 4DGJA 2B9LA 4AB8A 5AHGH 1RFNA 1TIOA 3LIWA 4KKDA 3ZZDA 1O3GA 4CRCA 1V2RT 2ZGHA 4BXWA 5E2PA 4BAHB 1GJBB 1NBME 4JZFH 1QCPA 1FAKH 4YLQH 1SQRA 1QIXB 3P92A 1TOCB 1H9HE 4AFQA 3LT3A 4WY3A 2O8TA 5IYTA 1O3DA 2ZCKP 2J94A 4CRGA 3P6ZB 1SBWA 2VNTA 1H8HD 3AASA 1BBRE 1GDNA 1YPLH 2FOCA 3SJKA 3ZVAA 4HFPB 3FANA 1DX5M 3MH5A 1FMGA 1QB9A 3LJOA 5J4QA 2VIQA 1QJ6B 3MYWA 4Y10E 1OP0A 1P8VC 2DE9A 3DSGA 4F55A 3M61U 2XNIA 4OGXA 4FUGA 3URCA 1V2QT 1CE5A 1K28D 3VG8A 4O3TA 1W12U 3QK1A 1ZLRA 2GDDA 2C8ZB 2SGPE 1L1JA 2GCTB 3M36A 1ETTH 4MNVA 3MI4A 3O8RA 2H6MA 1BMNH 1ANBA 4ABDA 1AIXH 1IAUA 3BTME 1DICA 1C5UA 3PO1C 1C1WH 3ESTA 4FUCA 1ZJDA 3ZZ7A 4A5TS 2FO9A 3LDXH 1C2IA 6LPRA 1ZGVA 3ZZ6A 2ZTXA 1P2KA 4GCHG 1GBHA 1AE5A 1TPPA 2HALA 1NRPH 2Z9GA 1WDIA 3OY5U 4NFFA 1WQVH 1PPBH 1BTWA 1TWXB 2A4OA 2EY4C 1C1SA 4YO9A 2ZKSA 1KLJH 1A46H 3SNCA 1ZHPA 1IQNA 1CT0E 2HWLB 4K3JA 3ZZ8A 1IHSH 2KAIB 3O8BA 3PMJA 2ZPSA 4TY6A 1TX7A 2H9EH 2FM2A 2IN2A 1GJ6A 5EG4A 1C5WB 2D2DA 2PW8H 1O3AA 4ISLA 3RXEA 4A1VA 1Q2WA 2A7JA 1KYNA 3Q3KA 5B6LA 1EJAA 1EPTA 2AMPA 3RM0H 1O2JA 1L1NA 2FI4E 1G37A 1XUFA 2P59A 1HDTH 3FN8A 2QF0A 2GJGA 1O5FH 1O2PA 3M7QA 2ANMH 1FY8E 4K1EA 5I46H 1TE0A 4J2YB 2BQ7B 4INHA 4NSYA 5FHTA 1TAWA 1EX3A 1DXPA 5A0CA 2AMQA 1GHYH 3SQEE 4JMYA 1SI5H 1Z71A 1G2MA 3OEHD 3CENA 4Y11E 1C5ZB 1O2QA 1TRMA 5FPYA 3EDXB 4I86A 4DURA 1WV7H 1YCPM 4GHTA 1HJ9A 4MNWA 4JCNA 1S82A 4I8LA 3F0PA 1OKXA 3BTEE 4UE7H 1MTWA 1O3CA 3TK6A 4X6MA 2BD3A 3EE0B 3GY8A 4ZKSU 1CT2E 1JRTA 2GDEH 1QY6A 2OC1A 1RRKA 3RMLH 1GHXH 2O8UA 1GJ4H 2JJ1D 5DN6D 5EPNA 1XVOA 2BX4A 4GHQA 3V13A 2G8TA 2BX3A 1HYLA 4ISIH 1FY5A 2CMYA 3FP6E 2GV7A 1FDPA 5A8XA 4B2BA 1GDQA 4BTIB 1GGDC 3QGJA 1PPZA 4D7FA 4B1TA 3V3MA 5L2YH 1LMWB 1YPJH 1P9UA 2QXGA 1FY1A 1B5GH 1YKTA 2NU0E 3H7OA 2UUFB 4NIWA 2B7DH 3GOVB 4ZCNA 4ASHA 3N7OA 1YLNA 1S84A 3MTYA 5JBBS 3O8DA 2FI3E 1VCQA 3SYJA 1SGPE 3A87A 3KYGA 4BOHA 2PUQH 2QF5A 1V2KT 2VJ1A 3M3SA 1TGCA 2Y6TA 2RDEA 2VWMA 2ESTE 3MH6A 3DUXH 3E91A 4NSVA 4MQAA 1Z6EA 1FIZA 1E38B 1TBZH 4WH8A 3WY8A 2BLWA 2BZAA 3RMOH 3Q3XA 2BD2A 1XUGA 2W3KA 1QJ1B 1DITH 3HGNA 4JK5A 1DSUA 3M37A 3M7TA 5FPSA 3RDZA 3DSOA 3UR6A 1H1BA 3KHVA 2STBE 3SGQE 4K1TA 3CS7A 2OC7A 1P2JA 2WPIS 3I29A 1EQ9A 2STAE 4FUDA 1P10A 8GCHG 1CQQA 1ZSLA 5EODA 3BTHE 2QXIA 5T6FA 1TMUH 3PV4A 1C1RA 2ZFTA 3KQ5A 2R2MB 3BIUH 1O2WA 2G4UA 1P3EA 2CJIA 3ENSB 3RXLA 1H9LB 3SHAH 4E7RG 1VCWA 1ABJH 4RKOB 1EZXC 1WYKA 3SNEA 1GPZA 2HOBA 1P2OA 2PLXA 4OM9A 3H7TA 3UWJH 1KTSB 1GBAA 1VITF 4BTUB 2FOMB 1A4WH 1CA0B 1P0SH 4Y7AA 1W0JD 3T62A 1J9CH 3AK5A 2Z3EA 4BXSA 3VPKA 2GV6A 3WW7A 1EFRD 4XBDA 1WCZA 2Q1JA 2QA9E 2QXHA 1V2JT 5GWZA 1EAUA 5I25A 2ZA5A 5A0AE 3MU0A 4AOQA 1C2FA 1DUEA 1DWCH 4K60A 3Q77A 4ISOA 1LHDH 3V0XA 1O2OA 4FOUC 1KDQA 2G55A 1LHFH 1AO5A 1MAXA 3SU3A 1V2NT 4DVAU 2JIZD 4X6OA 1INCA 4AB9A 2ZIQH 3RXOA 1C5TA 1G3CA 1KXAA 5TJXA 3A81A 3UOUA 3MHWU 1QL7A 2ZDAH 1UHBA 3T29A 3GDUA 5AFZH 3SU1A 3EBNA 4RN6A 3ATLA 2A5KA 1GJ5H 3U1IB 2FYRA 4ISNA 1S81A 2ZU3A 4NWKA 4XE4A 1P09A 3N7EA 3GY3A 1THRH 2XWAA 4ZXYH 1UVSH 3GY7A 2Z7FE 3RXKA 3Q3YA 2ZU4A 1CBWB 5HMAA 5FXLA 2P8OC 4RSPA 1SC8U 3IWMA 1BCUH 2QV1A 4XD7D 1EUFA 4XDEA 2C8YB 1UVPA 3DSPA 2GX4A 1UO6A 2I6SA 2VINA 3JZ2B 2R2WU 3ODFA 4YZUA 4K2YA 9LPRA 3GCHC 1D6WA 3UQVA 1SMFE 3LGIA 2IPHA 2J2UA 1MKWK 4X8TH 2ZPQA 4NA7A 1SFIA 1HAIH 1ZSJA 5KEDA 5ESBA 3LOXA 4A1XA 4HGCA 1C1VH 4ZHMU 1EAWA 3S0NA 4XRNA 5C3NA 1A7SA 2ZCLP 3A7VA 3ZVCA 1IQLA 3F9EA 3BTGE 3SU6A 4BAKB 1S83A 2QAAA 1E37B 4GAWA 1TONA 3A85A 2WHXA 1V6DA 2Z94A 1A5GH 3AAUA 8ESTE 3VXEH 3PTBA 3M5OA 4BAQB 2J38A 1KLIH 2ASUB 3MU8A 1K1MA 1GBEA 1XVMA 2YMSB 1QZ8A 1W10U 1N8OB 2FDAA 2GCHF 4X0WU 6ESTA 7GCHF 3A8DA 3DA9B 1RIWC 1ZHMA 1O3OA 5C2ZA 2G4TA 1BMLA 2QF4A 3D62A 5FBEA 2WPHS 1SQAA 2A7CA 4X2YA 2XCFA 2ZHFH 5BRRE 1FXYA 4Y71A 1ZJKA 2BM2A 1SOZA 1DXWA 1SB1H 1P2MA 4Q63A 3QUMP 2CHAB 1ELVA 1QHRB 2B8OH 3HKJB 4DOQA 4AFZA 3PM3A 1OS8A 1O3IA 4H42U 2ZHWH 4OS2A 4FXGH 1V2PT 1BJVA 5E8EH 4Y7BA 1NTPA 5TCAA 3BEUA 3L3TA 4X6PA 1SGNE 1T7CA 2XCNA 3PV5A 1O3LA 1TNKA 2OD3B 1H8DH 2ZGJA 5JDUB 3S9AA 1CA8B 4ABHA 1CBWC 2LNCA 3BSQA 4KELA 1SLXB 1UVTH 1LVYA 3OSYA 4IC5A 4Y76A 3FKSD 2VIVA 3PMBB 3T5FH 2OQUA 2V3OH 3KCGH 1YPKH 4GUXA 1SPJA 5EOKA 5F03A 3PO1B 2GD4B 3QZQA 4X2WA 2ZFPH 1NT1A 2ZTYA 1AB9C 4KP0A 1CSOE 3WWBA 1MMJN 2WUCA 3Q76A 1PPHE 1FPHH 4ABFA 5E2OA 4WXIA 1JMOH 3LH3A 1QR3E 2W7SA 5T6DA 4DG4A 4LXBH 1KDQB 1O2KA 1L4ZA 1XUHA 1MU8B 1EB1H 2BLVA 1C5MD 4ASUD 4CH8B 1BITA 1VGCC 1HUTH 1N6XA 4RKJB 3LGWA 3QZRA 1K1JA 2Z9LA 2G5VA 4IW4E 3SJ8A 1AQ7A 5F8XA 1Y5AT 2C3SA 3LGUA 4UEHH 1HNEE 1K9OE 2BDYA 3UQOA 3NXPA 2OCVB 4MG3A 5AFYH 3SOSA 1FNIA 1Y5UT 4HZHA 1PPGE 1LDTT 1O2GH 1WUNH 2V0BA 5GCHF 2QXJA 5EQSA 1QJ7B 1SHHB 3D23A 1TGNA 2BDHA 2JKHA 3HK3B 2PGQB 5A8YA 2WINI 1PYTD 1P11E 1U6QA 1OWIA 3MOCA 3ZVFA 3ZVGA 3HK6B 4AG1A 5AF9H 2GT7A 1V2OT 1GI0A 1SLUB 4OS7A 5HIZA 4I31A 1SGFG 5T3HA 5EGMA 5B6OA 1O3FA 4ZXXH 3UFAA 4BNRA 4DY7B 1GJAB 3Q00A 1QA7A 1ELGA 2M5TA 4Y0ZE 1V3XA 3LKWA 1NFUA 4THNH 1DT2A 1BA8B 4M9FA 2D8WA 2VVVA 1COWD 2BDAA 1GBJA 4JYUH 3SV7A 2VBCA 3TVJB 4P00A 1ZR0A 3C27B 4NZQA 2BD4A 2K1QA 1W7XH 1MBMA 1GWAA 3QTOH 4DCDA 1GHWH 5EJLA 2FTLE 1D3DB 3WWFA 4O03A 2F9UA 3VB3A 1MD7A 2XBWA 1DY9A 3EA8A 4AGKA 1J8AA 4U30A 3K6ZA 4B73A 2P3TB 1FONA 3I77A 1XUJA 2J4IA 1GBTA 1HLTH 2Y7XA 3OX7U 3GY5A 2W6ID 2GTBA 1S5SA 2VH6A 1YLDA 4X2XA 4AN7A 1ELEE 1QBOA 1PQ5A 3LJJA 3ZV8A 3A8BA 4I8JA 3E0NB 2BDIA 3HATH 2BDGA 1LHCH 4OS4A 5E0GA 1HAZB 3DCLA 3BG4C 2FOGA 2GGVB 1YCPK 3SJ9A 1A0JA 1GCTC 2A4QA 3UAIC 3PMAB 4GPGA 4KTSA 2AGEX 1SGFA 1TRYA 2H5CA 2TRMA 2ANYA 3ZIAD 4LZ1H 2IOTA 9ESTA 1C1TA 5A2MH 1TGBA 2JH0D 3C1KA 1ESAA 2EA3A 3KN2A 3ZZAA 2IPQX 1YBWA 3RLYH 2OUAA 4YXWD 2Z9JA 1PJPA 2BMGB 1HAHH 2FI5E 2XRCA 2QC2A 2K8IA 2BQWB 3STIA 3RXTA 3ZZBA 3SI3H 1ZSKA 2FOFA 5EU8A 2ZCHP 2ZI2H 4DIIH 4ZH8A 4TT3D 1BRCE 2AEIH 1WU1A 2XBYA 1ORFA 3M3VA 3VB4A 3UOPA 3RXIA 1GVZA 4I8HA 3VXFH 1GVKB 1YC0A 1W0KD 5CMXH 2KCPA 1C2EA 1MU6B 2D1JA 1VZQH 2PV9B 4A6LA 2ALVA 4TPYA 1G3DA 2ZP0H 2BQ6B 1TYNA 3PRBA 4NIVA 3QX5H 1L0ZA 4Q4LA 2WV4A 1P2QA 1AVWA 5FX5A 2CV3A 3N7DA 3PWCA 1GI2A 1AY6H 3EAJA 2WPDD 3BF6H 3N99A 1J14A 4D8NA 4ESTE 1IQMA 1CGIE 2P94A 2ZDVH 2H9TH 4U2WA 1O5DH 5LGOA 2SNWA 1SGIB 3UB0A 3TH2H 1KMHB 2SGEE 2THFB 4X1RU 2PFEA 3A7TA 2FLBH 1TNJA 3SNDA 1P57B 3KL6A 4WH6A 1G32B 1K1NA 2WZQA 4FUFA 1GI4A 1GI7B 5H4IB 2ZDMA 1ANDA 1EZQA 1G2LA 3KNXA 1RD3B 3PRDA 1NFWA 1DVAH 2UUYA 1JBUH 5CDFE 2ZGBH 3ZZ4A 2FOEA 1HPGA 1W14U 2ZHDA 4D7GA 5LPEA 1EAXA 3E3TA 1UJ1A 2FOHA 2BLQA 4ZUHA 4WXVA 3U1JB 2Z3CA 1UTMA 2ZG0H 2P16A 4SGAE 5FAHA 3IG6B 5G4BA 2XOKD 4XBCA 5C17A 2KCYA 1FAXA 5C94A 3TIUA 1C5YB 1NRNH 1CVWH 3SI4H 1XUIA 3RXQA 1QRWA 4A7IB 1HJ8A 5KGOA 1GBCA 2AFQB 1H9IE 2R9PA 1OYTH 1IOEA 2BD7A 1O3HA 2Z9KA 6GCHG 1ABIH 3FP8E 1C2GA 3ZZCA 2P3FH 2UWPA 2D26C 3M3TA 4Y0YE 2VIOA 4D9RA 1MTNC 2RFKC 5EW1H 1Y3YA 2GP9B 4X1NU 2Z6BD 3MH4A 3S9BA 1S85A 8KME2 5DGJA 1JOUB 1O2ZA 3HKIB 2BY9X 1FI8A 5EIYA 3S9CA 4FETA 1W7GH 2JETC 8LPRA 3U69H 3TNTA 1UW7A 4AGJA 2BVRH 5JBCS 4MPVA 2ZFQH 3RU4D 1WXRA 4UONA 1F0SA 1AB9B 2LELA 1P2NA 2OQ5A 1GJDB 1HAOH 1AVXA 5FBIA 4F48B 1LPZB 3NCLA 3SU5A 2BXTH 1NESE 1OWJA 2RG3A 1F0TA 3RMMH 3SV9A 1C5VA 1BTZA 4ZKRU 1F2SE 4YM9A 1JIRA 1AI8H 1BIOA 5DO4H 1BZXE 1EP6A 2OC0A 2ILNA 3GY2A 4H4FA 2P3UB 3VB7A 5DK1A 7GCHG 2TBSA 2V35A 4IS5A 5L30H 4YOIA 4K8YA 4ZKOU 1Z1IA 2FOBA 4VGCC 1O35A 1C2JA 1AMHA 1HXFH 2OINA 3PTNA 3SO3A 1D4PB 2I6QA 2Y81A 7LPRA 2F9BH 2HLDD 3F1SB 1O2LA 1Z6JH 2AMDA 2F3CE 1FV9A 2VIPA 3SBKA 2J92A 3FZZA 1O2HA 4ZAEA 1ZMJA 3AAVA 1T31A 1DY8A 1GMCG 1KLTA 3TK5A 3SJOA 1VJ9U 2FX6A 3P8NA 1SQOA 4TSFD 2GMTB 4B2CA 1DANH 5E0JA 1EATA 4CRAA 3B9FH 1C5NH 1F0RA 1DWBH 3F2GA 1L2EA 5ESTE 2K7XA 1AGJA 2YMSC 4UFFH 2SNVA 2OXSA 1GMHF 4YT7H 3MFJA 3SN8A 4UFDH 2GVFA 2A1DB 3LC5A 1SFQB 1QURH 5T6GA 1K1OA 4MNYA 3MNXA 3A83A 1OP8A 2HRVA 1P06A 4NCYA 2O8LA 4XFQA 3ATWA 5C5OA 4R8TB 1BUIA 1ID5H 2XC5A 2HVYB 3SGBE 1DLKB 1ARCA 1F5RA 2KM0A 4E06H 3TGJE 2SGAA 3LGTA 5GDSH 4ABJA 2VWNA 3PYHA 4Y79A 5HIYA 3ATIA 1NC6A 1CT4E 3P70B 4FU9A 5IDKA 3UWIA 3AW1A 1C2LA 1SVPA 1HFDA 4JZDH 1O2VA 1ZGIA 2BY6X 4F4OC 2GZ7A 4WJG2 2W26A 1ANEA 5A0BA 1IQFA 1GVLA 1GBKA 3BV9B 3KQDA 2M2AA 2YNBA 1PFXC 1ZYOA 3A80A 5LPFA 2L6OA 5DG6A 1YPHC 4HTCH 1WTGH 1UTPA 2V3HH 3IITA 1G30B 4AC9A 3QLPH 2DE8A 2FS8A 3TGIE 1P2IA 1UTNA 2Y80A 2GCTC 2YNAA 1V2MT 5GCHG 1GMHG 1Y3WA 2AGIX 2NWNA 4AORA 1KXCA 4X1PU 4X8VH 4MVNA 5HM2A 3SQHE 3SORA 2BDBA 3K2UA 4X8SH 1QB1A 3P8FA 1AWFH 4FUJA 2OTVA 5ETXA 3TJOA 2PHBA 4CRDA 4FUHA 1DWEH 4INKA 1IQJA 1D3QB 1K1LA 2LP6A 3A8AA 4GLYA 1VCPA 4O3UA 2A4RA 3H5CB 3TPIZ 1DS2E 2K0QA 3RXFA 4ZMAH 1X7AC 2AHME 3KQEA 3DFJA 1WTHD 1T8OA 1ZZZA 5HXFA 1BQYA 1Q31A 3K65B 1GGDB 2W6JD 4OS6A 1EZUC 2FPZA 1ZPZA 4TWYA 1EPTC 1B7XB 2W7UA 5E0HA 2A5IA 3M5LA 1GCDA 3ZZ3A 2Y5FA 1GMDG 1BTPA 2TPIZ 3BEFB 1C2MA 4I8GA 1HJAC 2ZFSA 1UTKA 1IQIA 3UIRA 1O2MA 1TMTH 3BTDE 3SV6A 1NS3A 1PQ7A 3GCHB 3RXPA 1UTLM 3SNBA 1O33A 1LVMA 3SZNA 3M5MA 1SGYE 2BLOA 4QT8C 5C1UA 1GI9B 1O2YA 4FUEA 3QTVH 1J17T 3BTFE 2FZZA 2Y7ZA 1QBVH 4RT0A 1O5CB 2F9VA 1YLCA 5C1XA 5C67A 1JRSA 1MZAA 2QYIA 3LH1A 1JIMA 5C5NA 1HAVB 1V2UT 2ZEBA 2PGBB 1Y3XA 1FJSA 3P17H 1TPOA 1TNGA 2FP7B 4CR5A 3UREA 1HAPH 3A89A 3KF2A 1BRBE 4I33A 3MO9A 2GZ9A 2A32A 1HCGA 3BTQE 4INLA 1C5PA 1SG8B 1TQ0B 1GHBG 4F49A 1E0FD 4YOGA 4CR9A 3NWUA 8GCHF 4HI3A 1KXEA 2HLCA 2BY7X 1DSTA 3QN7A 1RXPA 4CRBA 1QRZA 1UK3A 1P04A 4LOYH 3DHKH 1ZPBA 4IC6A 1XXDA 2F43B 3E1XB 1K0HA 1C2KA 1Z7KA 4Z1MD 1AFQB 1SGRE 3PMHB 3U28C 1LKBA 3BN9A 1KTTB 1QQ4A 1MKWH 3VB6A 4UD9H 1GJ9B 3B8JA 2CHAC 3PV2A 2BD5A 4NZLA 1GG6B 1S0RA 2KCOA 1LQDB 2WPMS 3U9AH 3BG8A 2HPQH
chains in the Genus database with same CATH topology
2QCYA 3A84A 5EPYA 3SV2H 1AKSA 7KMEH 2ZQ2A 2NU4E 3MNCA 4YLUA 1NRSH 3OY6U 2ZDNA 1C5OH 2SFAA 5HYOA 1CHOF 1TA2A 3A7YA 5JBAS 2HNTF 1EKBB 3DD2H 5K7RA 1C2DA 2FESH 1DLEA 2ZO3H 1P9SA 1EOLA 4NWLA 2ZFFH 4AZ2B 5DP8A 3RXCA 1GBFA 1GHAF 1MD8A 1Z8IB 2VGCC 3EA9A 4MPWA 4MDSA 5DP7A 1TMBH 3ATKA 1MQ5A 3KGPA 1GBMA 4NGAH 3AVZA 1GBDA 4ZHLU 3LGVA 1TNLA 3QGNB 3RMNH 1RS0A 4BAMB 1ETSH 4CBNA 1TQ7B 4AX9H 1ZRKA 4E05H 3RC5A 1TLDA 2YOLA 4ABIA 1EOJA 1OX1A 5DPAA 5SGAE 3SV8A 2ZFRH 3BIVH 2HNTC 1O39A 2FS9A 2GZ8A 1Q3XA 3RXHA 3TH4H 1N1LA 5L6NH 1HBTH 1OXGA 1W0ZU 1D9IA 1DWDH 1CGHA 1A1RA 1GBBA 1OOKB 2PKSC 4TY7A 1G3EA 2WUBA 1FUJA 1B0FA 2A5AA 2J34A 3TNSA 1ELBA 4R0IA 3W94A 1BB0B 3A7WA 1GJ8B 2FX4A 1ZMLA 1BTXA 2BZ6H 4MNXA 4FUIA 3QO6A 3GISB 2HNTE 5J4SA 2KAIA 1AD8H 2ZU2A 5LH8A 4JYTA 1MTSA 2ZNKH 3RXAA 2PKAB 3LONA 3V12A 1Z8JB 3GYMA 3TJNA 1V2TT 1M9UA 1OWKA 3S7KB 4E7NA 2GCHG 1AHTH 4YOJA 2BVXH 2OBQA 3VFEA 1VR1H 3E8LA 4FVBA 2CF9H 1ZHRA 4X6NA 1GL0E 3O8CA 1BHXF 1F7ZA 4Q2KA 2P8OB 1O3BA 3FZDA 1A0HB 1NRQH 1C5XB 4MPUA 2BHGA 1SSXA 1J16A 4GCHF 4OS5A 2BDCA 3F9FA 1CGJE 1QNJA 2LPRA 2F9NA 1ELAA 3ZZ9A 5DP5A 3KEEA 3ZYEA 2F9PA 1BTUA 1TALA 1P05A 2RA0A 1L1GA 2O8MA 3A8CA 1O2IA 4H6TA 3URDA 1ZRBA 1CU1A 4FU8A 5FPTA 2VIDA 2W3IA 4NIYA 1DPOA 1XXFA 4UFGH 1QL9A 3MWIU 2A7HA 1YM0A 4VGCB 1LPGB 3A7XA 1K2I1 4KGAA 5JBTA 1KXBA 2SGFE 1GI6A 2ODYB 2BY5X 3RXDA 1VITH 3F9HA 3P8OA 2R3YA 2TGAA 2CF8H 3ZZ5A 4K5ZA 1ZTLA 1GJCB 2XXLA 3S7HB 1C5SA 4AYVB 2XBXA 3A88A 1C9PA 4MTBA 2GMTC 3P8GA 3RXBA 2ZU5A 2FTMA 1GMDF 1G9IE 3MNBA 4MLFB 3SNAA 1YP9A 4DJZB 3NKKA 1Y5BT 1ESTA 3SUDA 1BT7A 1OPHB 3TJUA 1HRTH 1G3BA 3EYDA 2A2XH 2ZDLA 3T25A 1W13U 2G81E 1FQ3A 2VH0A 2SGQE 1AUTC 1NPMA 5JPMH 4FUBA 2BYAX 4BTTB 1ACBE 2AYWA 1EPTB 1VJAU 1SGTA 1LTOA 4B75A 1J15A 2W5EA 1JWTA 2CGAA 3D65E 1QGFA 1BRUP 1Y8TA 1RTKA 3R3GB 4O97A 4BAOB 3SUFA 1HAVA 1MTVA 2HPPH 3S69A 4CHAB 4K69A 2R0KA 5DP9A 3TK9A 4CREA 2J9NA 2G52A 1MBQA 4GSOA 4JYVH 1UK2A 4WWYA 1MKXH 3T28A 3T2NA 2VVCA 1AWHB 1EB2A 1TB6H 3BTTE 3EGKH 1UHBB 2JETB 1TNHA 3GDSA 1LVOA 2VU8E 1H8IH 4NA8A 4UDWH 3MU4A 1GHBF 4M7GA 1KXFA 1GI5A 2PTNA 1MTNB 1XKBC 4JZ1A 2PTCE 3M7UA 3PLKA 2EEKA 3SHCH 4B71A 1HGTH 1EP5A 4U32A 1IQHA 1YF4A 4D9QA 3K6YA 4IMQA 2ZECA 1XUKA 4K1SA 1MCVA 3A86A 2WPJS 5F6MA 2QF3A 3MH7A 2ODQA 3VEQB 2ZQ1A 1WSSH 5FCRA 1YPEH 5DP4A 4ISHH 1FLEE 4K8BA 1LQEA 3KQBA 1AKSB 1BBRK 2ANKH 3SW2B 1C5QA 5LPRA 1LVBA 2BY8X 1CA0C 2FODA 1CHOG 2XBVA 1C2HA 2JH6D 1YCPH 3DT0H 3SGAE 1GI3A 3P95A 2JH5D 1NFXA 1S6FA 4WMEA 1O34A 4AYYB 1LO6A 1RGQA 1UTQA 2XW9A 1GHAG 5GIBA 2RA3A 3T27A 5C20A 1Z1JA 4ZHAA 3RU4T 2V6NA 1EASA 2B5TB 2G5NA 3BTWE 4Q7ZA 2UWLA 3BTKE 4CBOA 1XKAC 1F92A 1YPGH 1IQEA 3OTJE 4GVUA 1W11U 2TGDA 3U8OH 2OC8A 1HAYB 2BD9A 3PWBA 1AUJA 1O5BB 1NFYA 1C5LH 2ZF0H 2FEQH 3UUZA 4XBBA 2PUXB 4YESB 3PB1E 1QQUA 2FWWA 1O2NA 3L33A 3MNSA 2EI6A 1UVOA 1P01A 1CO7E 3TITA 1OYQA 3OU0A 2A4GA 3RLWH 2PKAA 2AH4X 1SGDE 3SJIA 1O5EH 1BDAA 1GCTB 4Q7XA 4J1YA 4FU7A 3ZVBA 5AVDA 3AW0A 2C4FH 1OWDA 1RTFB 1TOMH 1W8BH 3NPSA 1O2RA 3V7TA 5TCCA 3UNQA 2NU2E 1QB6A 1N8OC 3EQ0H 3OYPA 3TJVA 1ELDE 5GJ4B 2ZU1A 2G51A 3NUMA 1GJ7B 1O3PB 1P02A 1SOTA 3RXSA 1QBNA 2AS9A 2O8WA 2CXVA 4X8UH 1Y3UA 1A3BH 4Z6AH 5JB9S 1O2SA 5DP3A 1GBLA 1C1QA 4TPIZ 3RC6A 5JB8S 5DP6A 2XC0A 3ODDA 1HB0B 1AZZA 1KY9A 3U98H 2BVSH 1YPHE 1SLVB 1F0UA 2OLGA 2FOAA 4ABGA 2VWLA 1K21H 2SGDE 3A82A 1DM4B 1NO9H 3A7ZA 3CP7A 5EQRA 3LPRA 1HXEH 4YTAA 3MMGA 3ITIA 2ZGXH 1TFXA 2NU1E 1SL3A 2PSXA 2BOKA 2Q6FA 4O9VA 4JK6A 5EXLA 1UK4A 1QA0A 1C5RA 1TBQH 2EC9H 1IQGA 2WPKS 4LZ4B 1FY3A 5CHAC 1O37A 2EI7A 3QDZB 4NFEA 2PSYA 1C1NA 2UWOA 1SGQE 1T4UH 4SGBE 3RC4A 5HM9A 1O31A 1MZDA 1H4WA 1ZTKA 1UVUH 1HAGE 4AFSA 3UR9A 1XMNB 1WBGB 2FXRA 1TNIA 3ZYDA 1F5LA 4WF8A 3U8RH 1BTYA 3PROA 1K22H 2C93B 3RU4E 2Z9IA 2AIPA 1GG6C 3BEIB 1DFPA 4IN1A 5DKMA 1D3PB 1E34B 1TPAE 2XC4A 2ODPA 1TBRH 5A8ZA 5EXMA 1D3TB 4TYDA 3RXVA 4CRFA 1O30A 2VGCB 4X2VA 1THPB 3RXJA 1LKAA 1TGSZ 5EXNA 1TABE 1W3CA 2R0LA 3MO3A 4Y6DA 4Y8YA 2HGTH 1ELFA 4IN2A 1AE8H 1A0LA 1O3JA 4JZIA 1AFEH 2F91A 7ESTE 3MU1A 2FIRH 3ZVEA 1FPCH 4YT6H 2ZPRA 3GYLB 4NA9H 1A2CH 2A2QH 4CH2B 1Y3VA 1WQSA 1TX8A 1GL1A 1P03A 3UPEA 2RCEA 1QRXA 5GPIB 2TGPZ 3B23B 1L4DA 4X1SU 1PPCE 1ZOMA 1THSH 1TX6A 1EJMA 1BTHH 1N6YA 2ZZUH 1ZPCA 1O2UA 5F8TA 2F9OA 2TGTA 2ZDKA 1BHXB 1ETRH 2F83A 5L2ZH 1V2ST 5EW2H 1FY4A 4X1QU 1WOFA 1XX9A 1GI8B 2UUJB 5A09A 3K9XB 4WVPE 3TGKE 1GHVH 4DT7B 2ULLA 1MQ6A 1ESBA 1AFQC 2R3UA 1HIAB 3GY4A 3GCTG 4KTCA 1V2WT 2AGGX 2IJOB 3VB5A 1EZSC 1YPMH 1IHTH 1VGCB 2ALPA 4MPXA 2XWBI 2BB4A 3U8TH 1W2KH 1O38A 1ZTJA 3MO6A 1O3NA 3NZIA 4JZEH 1Y59T 3T26A 5ABWA 3LGYA 2QN5T 1W0YH 2BTCE 2FLRH 3G01A 1O0DH 2OP9A 1G36A 1A5IA 1O32A 1S0QA 2EI8A 4XOJA 2G00A 2ZHEH 1UCYK 3CS0A 3VGCC 1IQKA 2P95A 1C9TA 1F5KU 3RXMA 2RDLA 3RXUA 1NN6A 4I7YH 4AFUA 4B76A 4NIXA 5EQQA 3GCNA 1QL8A 4IMZA 2VWOA 2ZTZA 2LIZA 1FN6A 1TGTA 3M5NA 1SQTA 3F68H 2ZWLH 3TU7H 2UUKB 3FAOA 4Q7YA 1SGEE 2A0QB 1S6HA 1HAXB 1NU7B 3GDVA 1DOJA 1ELTA 3GCTF 1KXDA 2PKSB 4KTUA 3E6PH 1A3EH 3TH3H 2DUCA 4NG9H 3ELAH 2Q6DA 2BXUH 1SHYA 2P93A 1O36A 1O3MA 3W95A 2ANWA 2Y5GA 1MH0A 4LK4A 1MCTA 1TPSA 6CHAB 1AZ8A 3UNSA 1C1OA 2C90B 2C8WB 2J95A 3FP7E 1KIGH 1O5GH 3VGCB 3ATMA 3PLPA 4A92A 1PQ8A 2H9HA 1UMAH 1EXFA 1HJAB 2VB0A 5F8ZA 1PYTC 3JZ1B 1UTOA 2A31A 1WAYB 1YGCH 1GHZA 4B74A 2Z3DA 1HV7A 3E90B 1RTLA 1QFKH 2Y82A 4B2AA 3STJA 1BBRH 2ZHQH 5C1YA 2OBOA 1DUAA 1MAYA 3RUOA 1LHEH 2AERH 2FMJA 4I8KA 3FFGA 1NZQH 1UCYE 3SU0A 4U01A 1GDUA 2WPLS 3HPTB 4ABAA 1UTJA 3DFLA 2VVUA 1VITG 1TA6A 4TWWA 1JXPA 1OWEA 5PTPA 3RM2H 1C1MA 4Q80A 2Y5HA 1FN8A 4IGDA 3UY9A 1C4U2 3F6UH 2Q6GA 3FVFB 3RXGA 1C1PA 3UNRA 3GCOA 1OP2A 3MU5A 3UTUH 1DE7H 5FX6A 4Y8ZA 3RP2A 1V2LT 3R0FA 4DW2U 2GT8A 1E36B 1FIWA 3TLOA 2NU3E 2QGRA 2XTTB 3M35A 1KSNA 1O2TA 1BRAA 1GI1A 1MUEB 2TIOA 5CE1A 1MKXK 1TRNA 4D76A 1C1UH 1T8LA 4OS1A 1MTUA 2B0FA 5DJ7A 3NK8A 3I78A 1AN1E 5BPEA 4BANB 3SU4A 1ELCA 1V2VT 2BD8A 4FVDA 4XSKU 1AVGH 3D49H 1ZMNA 1P3CA 1NRRH 1E35B 1RJXB 2WYJA 1BJUA 1K1IA 1CHGA 1LCYA 1B0EA 1O2XA 1BMAA 1O3EA 2FYQA 4ABBA 1ARBA 4ABEA 1O3KA 3E16B 1A5HA 2PWXA 1Z8RA 1C4V2 3BG4B 1SLWB 2ZC9H 2O9QA 3QWCH 3EA7A 1FZZA 5HGGA 2XYAA 1UCYH 1K1PA 3E0PB 4I32A 4WMDA 2PR3A 1T4VH 2CN0H 2QIQA 1T32A 2BOHB 1XM1A 4Z0KA 1C4Y2 3KIDU 1AU8A 4CHAC 1QTFA 1RIWB 1LHGH 1PQAA 5JYIA 1EAIA 1EJNA 1OWHA 5FCKA 3PLBA 1NU9A 4Y8XA 3SUEA 1GBIA 4WMFA 3SUGA 1NM6A 3KQCA 4UFEH 3L6PA 1PPEE 5GXPA 1NROH 6GCHF 1DDJA 2H2ZA 1O5AB 3GY6A 4H6SB 1Z8GA 2H1UA 3LU9B 3RXRA 3F9GA 1HIAA 4ZROA 1OSSA 2WYGA 1LPKB 3HGPA 1PPFE 3SU2A 2HVXA 1GMCF 4OGYA 3LC3A 1D6RA 3ZVDA 1SGCA 1ANCA 2VIWA 1NY22 4DIHH 1T8MA 5CHAB 1BMMH 1BOQA 1P12E 2C8XB 4ZKNU 2GKVE 4IBLH 3ZV9A 6CHAC 2H5DA 4A1TA 2A45B 4AG2A 1SR5C 5K0HA 2WV5A 2QY0B 2AIQA 4PROA 1YYY1 2ZGCA 1A61H 1T8NA 3GICB 4DGJA 2B9LA 4AB8A 5AHGH 1RFNA 1TIOA 3LIWA 4KKDA 3ZZDA 1O3GA 4CRCA 1V2RT 2ZGHA 4BXWA 5E2PA 4BAHB 1GJBB 4JZFH 4YLQH 1QCPA 1FAKH 1QIXB 3P92A 1TOCB 1H9HE 4AFQA 3LT3A 4WY3A 2O8TA 5IYTA 1O3DA 2ZCKP 2J94A 4CRGA 3P6ZB 1SBWA 2VNTA 3AASA 1BBRE 1GDNA 1YPLH 2FOCA 3SJKA 3ZVAA 4HFPB 3FANA 1DX5M 3MH5A 1FMGA 1QB9A 3LJOA 5J4QA 2VIQA 1QJ6B 3MYWA 4Y10E 1OP0A 1P8VC 2DE9A 3M61U 2XNIA 4OGXA 4FUGA 3URCA 1V2QT 1CE5A 1K28D 4O3TA 1W12U 3QK1A 1ZLRA 2GDDA 2C8ZB 2SGPE 1L1JA 2GCTB 3M36A 1ETTH 4MNVA 3MI4A 3O8RA 2H6MA 1BMNH 1ANBA 4ABDA 1AIXH 1IAUA 3BTME 1DICA 1C5UA 3PO1C 1C1WH 3ESTA 4FUCA 1ZJDA 3ZZ7A 4A5TS 2FO9A 3LDXH 1C2IA 6LPRA 1ZGVA 3ZZ6A 2ZTXA 1P2KA 4GCHG 1GBHA 1AE5A 1TPPA 2HALA 1NRPH 2Z9GA 3OY5U 4NFFA 1WQVH 1PPBH 1BTWA 1TWXB 2A4OA 1C1SA 4YO9A 2ZKSA 1KLJH 1A46H 3SNCA 1ZHPA 1IQNA 1CT0E 2HWLB 4K3JA 3ZZ8A 1IHSH 2KAIB 3O8BA 3PMJA 2ZPSA 4TY6A 1TX7A 2H9EH 2FM2A 2IN2A 1GJ6A 5EG4A 1C5WB 2D2DA 2PW8H 1O3AA 4ISLA 3RXEA 4A1VA 1Q2WA 2A7JA 1KYNA 3Q3KA 1EJAA 1EPTA 2AMPA 3RM0H 1O2JA 1L1NA 2FI4E 1G37A 1XUFA 2P59A 1HDTH 2QF0A 1O5FH 1O2PA 3M7QA 2ANMH 1FY8E 4K1EA 5I46H 1TE0A 4J2YB 2BQ7B 4INHA 4NSYA 5FHTA 1TAWA 1EX3A 1DXPA 5A0CA 2AMQA 1GHYH