3F9HA

Crystal structure of the f140a mutant of sars-coronovirus 3c-like protease at ph 7.6
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
299
structure length
299
Chain Sequence
GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Two adjacent mutations on the dimer interface of SARS coronavirus 3C-like protease cause different conformational changes in crystal structure.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 77
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3f9hA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9hA02
3QUMP 1O3GA 1P04A 8GCHF 3A8AA 1FUJA 2BXTH 4ZKOU 4JZFH 5TCAA 2PUXB 4E06H 1MBMA 2BM2A 1ARCA 1YCPM 2HGTH 2A5KA 2R2MB 1DXPA 1A5IA 1C1TA 4ABDA 2FMJA 1C5LH 2VIWA 1IOEA 1AIXH 1BJUA 2GT8A 2FM2A 2D26C 1S83A 1WSSH 3QWCH 4X1PU 5GIBA 4MPUA 2JKHA 2FOAA 3BG4C 3PTBA 1AUJA 1AMHA 1PYTC 1EPTB 4DURA 4ZMAH 1QGFA 3BSQA 1Z8RA 1P3CA 3M5LA 1XM1A 3Q3XA 1EAXA 3TNTA 3ZVBA 1Z1IA 4AYVB 1V2OT 4IN2A 1A1RA 2CHAC 1PYTD 1WYKA 1TPAE 1NRPH 2ZU1A 3LPRA 4B2CA 2DE9A 5HYOA 2UUYA 4X6MA 3RXLA 1DE7H 1DX5M 1O33A 1C5ZB 2GKVE 3OTJE 1NRSH 1C4Y2 2AS9A 4DGJA 2PWXA 1K1PA 2WV5A 2XW9A 1ZHMA 4OS1A 2GCTB 2ZHWH 4B71A 1BRUP 1QQUA 2C93B 4I32A 6LPRA 1VCQA 2V0BA 5T6GA 3UFAA 2QV1A 3MI4A 2P3TB 3ZZBA 1K2I1 2H9HA 1ELEE 1NN6A 2ZTYA 3OU0A 3O8CA 2AFQB 3QX5H 5ESBA 3RXQA 4NGAH 1DSUA 5I46H 4I31A 1O3BA 1MU8B 5EXLA 3ZYDA 5A09A 4H42U 2EEKA 2OC0A 4A1TA 1WQSA 4GHTA 1FN8A 2SNVA 1OP0A 1BRCE 4A7IB 3RXAA 1LPKB 4Y7AA 4B73A 3UQOA 1C2MA 3FP6E 3D62A 2BX4A 3R3GB 1ETTH 2XWAA 1J17T 2Y7ZA 1EOJA 4H6SB 1GJ7B 1IAUA 1K1OA 4MPWA 1BBRE 1NFUA 5GXPA 2D8WA 1XUIA 1UVSH 1EP5A 2HOBA 4ABHA 3FVFB 1KXEA 1RTKA 1F0TA 4ABBA 2ZGHA 3GY6A 1IQJA 2B9LA 4U30A 1O3IA 8KME2 1H9HE 3D49H 4X1RU 1MZAA 1O3PB 5JBAS 5JBTA 1ZPZA 3A84A 3LIWA 4INKA 1M9UA 3MNBA 1YC0A 1BB0B 1MTNB 3AVZA 3ITIA 3T25A 1IQEA 1Z8JB 2FX4A 3P70B 2PSXA 3TGKE 2XC4A 3LC5A 4X2XA 1OYQA 3T26A 2XCFA 1G3CA 3URDA 1FY1A 1UTOA 1FQ3A 1VCPA 1P9UA 2FIRH 2TGPZ 1P11E 1SR5C 3AAVA 5K7RA 3PYHA 1V3XA 1S6HA 1ZPCA 4E7NA 3SV6A 1HAOH 2ZQ2A 1DANH 1V2JT 2SFAA 1B5GH 1D3QB 1GMDG 2WV4A 4I8GA 2ZCHP 1B7XB 3UOUA 2J38A 2O8WA 3O8DA 1HIAA 2ZA5A 1C2LA 1ZMJA 3ZV9A 1O39A 1HXEH 3RMNH 1VITG 3A7WA 5E2OA 1SGIB 3KGPA 2WPHS 3M35A 3M61U 1G2LA 2ZFTA 1W3CA 2H5CA 2A5IA 1AZ8A 1GHBG 1MUEB 1SGRE 1ZJDA 3MHWU 2PGBB 3M3TA 3DD2H 1GI3A 3VGCB 5DPAA 1TNLA 2BTCE 3SV7A 1QRZA 1BRBE 4JZEH 1FY5A 7LPRA 3ZZ6A 1C5UA 1HAVA 3LGYA 1PFXC 1XXFA 1IQNA 1A0HB 1PJPA 1FAXA 1P09A 5GCHG 1P2IA 1MH0A 4NSVA 1WCZA 1TX6A 3GCTF 1GI7B 1TOMH 3P6ZB 1QB1A 3F9FA 3DT0H 2CXVA 1TFXA 3NPSA 1OKXA 3RDZA 4ZHLU 3TJNA 1ZGIA 1DPOA 3ZZ3A 2QA9E 1NO9H 3C27B 3K9XB 1E0FD 2BQ6B 3RU4D 1RRKA 1WOFA 3P8GA 1QBVH 2RDLA 1UHBB 3QLPH 3LU9B 2ZU2A 5F8TA 1ETSH 2ZPQA 1QJ7B 1P2MA 1UTMA 1F7ZA 2ZTZA 3F6UH 7KMEH 2P94A 1O2OA 1GBEA 1JWTA 1O2SA 1P2JA 1NFWA 3TNSA 1NZQH 3MH7A 4MNVA 3RU4E 3EA9A 2G55A 1TBRH 3BTDE 2Z3CA 2A2XH 4TYDA 5EXNA 5JDUB 4KELA 3RXHA 1AWHB 2VIVA 2WPIS 1GHAF 2P3FH 2OUAA 3AAUA 2C4FH 3GISB 1H1BA 1EB1H 1YYY1 1CE5A 2TBSA 3TITA 3BG8A 3LJOA 2O8TA 1QL8A 3SJOA 5EGMA 3LJJA 1BTXA 3SV8A 2UUFB 1L1NA 3VB6A 4D76A 3RXPA 1LPGB 5CMXH 2Z9GA 6ESTA 1ELFA 1VR1H 1GWAA 1NU9A 4A92A 1TBQH 3TVJB 4NCYA 2F9OA 1DS2E 2WUCA 1C5NH 4X1NU 1XMNB 1TMTH 5E0GA 5HXFA 1Y5BT 3RXKA 3LDXH 1YBWA 2Q6GA 1O3OA 3O8RA 1NTPA 4FUEA 3M3VA 4FUCA 1TALA 3Q00A 5F8XA 2OXSA 2A7HA 2ZC9H 3RUOA 3QN7A 1TNHA 1XVOA 2A1DB 3A83A 4U32A 3PO1B 1TNIA 2C8ZB 4XOJA 1PQAA 3T2NA 1HCGA 1Z6JH 5GWZA 1KXCA 4ABEA 3MNSA 4Y10E 3T62A 1C2HA 1QJ1B 4I8HA 3S7KB 1P01A 3DA9B 2ANKH 1ETRH 3RXEA 2WINI 1EZUC 4KP0A 1J9CH 5DP6A 1ZHRA 2H5DA 3UNRA 2WPKS 1CA8B 3ZVGA 4JCNA 3F9HA 3GCNA 1TRYA 1O0DH 1O2XA 2GMTC 2WYJA 4MNWA 2SGPE 1O3CA 4ZKRU 1N8OB 4I8LA 4INHA 3STJA 2BDCA 2P95A 1SSXA 4X8TH 3RXUA 3FZZA 1TPOA 1ZHPA 2PSYA 1Y5AT 1C5WB 4X0WU 1J14A 4X8VH 2J2UA 2C90B 2ZNKH 5C1XA 1H8IH 1SGPE 1HAHH 2GD4B 1OPHB 2XBYA 2F9BH 2J34A 3MO6A 4I7YH 1AHTH 1C4V2 2ZU5A 1LQEA 4OGXA 5DO4H 2ODQA 2FPZA 4X8SH 3FP7E 4Y7BA 2AGGX 2PLXA 1QY6A 1TGBA 2OCVB 2BDBA 1RTLA 4QT8C 3E16B 2AIPA 4GVUA 3GY4A 2BYAX 5FXLA 1THSH 1J16A 4F49A 1OWIA 1XKBC 2TGDA 1Y8TA 4XE4A 1L2EA 2ZHFH 3BTKE 4Y79A 1WV7H 4XDEA 5C2ZA 5JBBS 1HAPH 3SNEA 5AVDA 1GJDB 3LGIA 2BD5A 1RIWB 1GL1A 1ELBA 2VGCC 3R0FA 4O9VA 2STAE 1EB2A 1HAYB 1EKBB 1V2WT 4RSPA 1MMJN 4NIVA 3Q3YA 1O32A 1TBZH 5FBEA 1WAYB 4UFGH 2QN5T 1BTPA 2D1JA 2QXIA 2W3KA 2A32A 5CHAC 1O2QA 3K2UA 3ATKA 1UCYK 4XFQA 3GDVA 5DP5A 1O31A 1AFEH 1V2RT 4CBNA 1CGJE 3BEFB 1EX3A 4NFEA 2BY5X 1YPJH 2AYWA 1V2PT 3Q3KA 4GCHF 2CJIA 1SGEE 5JB8S 1GBCA 1BQYA 1OWKA 1ZMLA 3MO9A 1IQKA 2EI7A 3LKWA 1TNKA 1GBAA 3GCTG 4NZQA 2Z3EA 4IGDA 2KAIA 1GDQA 5J4SA 2THFB 1O37A 3A7ZA 4BOHA 5BPEA 2A7JA 1W14U 4B2AA 4JYUH 4BAOB 1GDUA 1UTQA 2FOGA 4BXWA 1O3FA 1AKSA 3PB1E 1ZTJA 4XBDA 5ESTE 4BTUB 1KYNA 1IQLA 5T6DA 1EPTC 1ZZZA 1SGQE 1V2UT 3ODFA 1TRMA 4A1XA 4NA8A 1OWHA 2G8TA 3A89A 2P8OB 1GI6A 1SC8U 3A8DA 3TH2H 2IN2A 1KXDA 4CRBA 1KLIH 4NA9H 4NZLA 5L2YH 2DE8A 1KIGH 1CU1A 1T32A 1NM6A 1TMBH 2TRMA 3IWMA 3K6ZA 4Y0YE 2BD3A 5DK1A 2FODA 2F91A 2ZZUH 2ZFSA 2PFEA 1O35A 1Y3UA 3SJKA 5FPYA 2ZFFH 2BY9X 2ZDNA 1KXAA 3VFEA 4O97A 1BHXF 2WPJS 1LPZB 1QB9A 2NU4E 1V6DA 3A7VA 4HFPB 1AFQC 1EQ9A 4WMEA 4ABFA 5L6NH 2Y6TA 3RXIA 1SHYA 1H4WA 3EYDA 3HGPA 4U01A 4WF8A 3GCOA 1IHSH 3C1KA 1OYTH 2OC1A 1SGDE 1C1UH 1EP6A 1GMHG 3EGKH 4AB8A 4DW2U 2HWLB 2FO9A 2Y5GA 1UTJA 2GZ7A 1CT0E 1P02A 5C3NA 1FMGA 1TB6H 5FHTA 4FUFA 2FYQA 1FN6A 3B8JA 2ZWLH 1ELAA 2VH6A 4JZIA 4ISHH 4Z6AH 1P0SH 3SBKA 2ZG0H 2ZDMA 2FLBH 2Q6FA 2G00A 4UD9H 1ELVA 3SNBA 4VGCB 1GCTB 1NFYA 3GDSA 2B0FA 1C5PA 1K1IA 3S9BA 1ZLRA 4RKJB 2XXLA 3GYLB 4ABIA 2GT7A 3ZZAA 1C5RA 1XXDA 4K1EA 4ABJA 4JK6A 3TJUA 1SLVB 4X6OA 3SJ8A 2VVCA 1MCVA 1XKAC 2ZCKP 3KN2A 1UK2A 4BNRA 3M7UA 4UFDH 1RTFB 1FAKH 1O5BB 1AWFH 3SHCH 1PPFE 3TK9A 2ZFRH 3PMBB 1GJ4H 9LPRA 1S0RA 3BTHE 4CRFA 2ZEBA 1AGJA 1W0YH 1WQVH 1F5LA 1HYLA 1QQ4A 2IJOB 4ZXYH 2EI8A 1YPGH 2ZHQH 1QURH 3S7HB 5H4IB 3ZZDA 2I6QA 5A8ZA 4CH8B 3BIVH 1BMAA 2XYAA 2LNCA 4IS5A 2AERH 1DWEH 1ZRKA 2G5NA 3HK3B 1HAIH 1K28D 1QBNA 1FY4A 1NFXA 5A0AE 3V13A 3E90B 1UK4A 4YTAA 1O2GH 3SNCA 1AO5A 3BIUH 4NWKA 1E34B 1TGTA 1VZQH 5DG6A 1INCA 3NWUA 1GBJA 4OGYA 4X2YA 2ALPA 3TPIZ 1F0SA 3F9GA 3WY8A 3LONA 5JB9S 2W7UA 1KDQB 3HATH 1C2FA 3RU4T 3VGCC 1AVGH 3MU1A 3SHAH 3ENSB 3BTEE 1C1WH 1SLXB 5F8ZA 1W7GH 4JMYA 3UIRA 4I8JA 4GCHG 4Y8YA 3T5FH 3RXVA 5EU8A 1C1MA 1G3DA 1KXFA 2HALA 1UJ1A 2ZQ1A 3MNXA 4B2BA 4NSYA 4AORA 1EOLA 2BD2A 4O3TA 4TPYA 2Q1JA 1SI5H 1A2CH 1ELTA 1LVOA 3A7TA 3RXTA 1C2KA 1YPEH 3ZVFA 3V0XA 3E0PB 1XVMA 4WH8A 1BT7A 1V2MT 1NROH 3EBNA 1UCYH 2ALVA 2AGEX 1O2NA 3P17H 1O3NA 2HPQH 2QXHA 1K21H 3STIA 3U8TH 5LPRA 1ZSKA 1JRSA 1Z6EA 1Q2WA 1O3KA 3HPTB 3BV9B 2P59A 3S69A 3E91A 1FPHH 2ODYB 2Y5HA 3PLPA 3SU1A 3ZVCA 1MZDA 3MO3A 4TY6A 1PQ8A 3IITA 1SLUB 2VINA 2FS9A 2CN0H 2GZ8A 3SUGA 1IQGA 1JMOH 5T6FA 2ANMH 1DITH 3EDXB 3OY6U 1QCPA 1YPKH 2VIPA 1JIRA 1TGSZ 1WBGB 3SU4A 1MAYA 3MH6A 1UVUH 3RXCA 1MKXH 1F0UA 1Z7KA 2R0KA 3Q77A 4B76A 1FY8E 1ZPBA 4YLUA 3PMAB 1GVZA 3DFLA 4A5TS 1THPB 4AFQA 3A8CA 1CHGA 1MKWK 3SU6A 3U8OH 1QRWA 4CREA 2QF3A 2QY0B 1SMFE 5A0BA 1CA0B 2CGAA 4ZH8A 1AVWA 1TGNA 3PLKA 1ANEA 2VIOA 3D65E 4MPXA 5PTPA 4D9QA 2OD3B 2W7SA 1W2KH 1PQ7A 1V2KT 3BTQE 3U1IB 1Z8GA 2ZDAH 3M3SA 3ZZ5A 1PPCE 2P3UB 5EPYA 3U1JB 2G5VA 1E38B 1P2KA 3QZRA 3TGIE 1UCYE 3F9EA 4K8YA 4LOYH 1D9IA 1HAXB 2FZZA 1THRH 2CV3A 4AOQA 1DOJA 1BJVA 1GI8B 3CENA 3NCLA 2FI5E 3MH4A 6GCHF 1NESE 1H9IE 1J15A 4ZKSU 3KQDA 2NU0E 5CE1A 3RM0H 2FTMA 1D3TB 3KQBA 5EQQA 3SU3A 4OS6A 4R8TB 1A0LA 4ISLA 1TGCA 5GPIB 2GV6A 1SQTA 1NRQH 1AD8H 3I77A 1N8OC 4IBLH 3KF2A 4X2WA 1HJAB 1LDTT 1RS0A 1K9OE 2H6MA 4CR9A 1VJ9U 3RC4A 1TLDA 1Z8IB 5GJ4B 4AFUA 2GZ9A 1S84A 2A4GA 4B74A 1SFQB 3QGNB 3RXSA 1BIOA 2YOLA 1ESAA 3W95A 3BF6H 3SUFA 2ZP0H 2ASUB 2FX6A 1TPSA 2QIQA 3LGTA 5AFYH 4DCDA 1YCPH 2PUQH 2BD9A 4FUHA 3U69H 3B9FH 2XTTB 1D6RA 5ETXA 1DUAA 1AE5A 4J2YB 3RM2H 1BTYA 4KTUA 5EQRA 9ESTA 4ABGA 1HIAB 2HLCA 2SGEE 4JZ1A 1EATA 5BRRE 2SGQE 1ZYOA 1O3HA 2XRCA 4INLA 1KY9A 2Z9LA 1BRAA 1D3PB 1SVPA 4AG1A 3A7XA 3V3MA 1VJAU 8LPRA 1C2GA 1KTTB 4KKDA 1D4PB 1O3LA 1S81A 1SOZA 2BVRH 1GHZA 2RG3A 3KEEA 3NUMA 1NRNH 1Z1JA 1EZSC 1C5XB 4K5ZA 1BZXE 1FI8A 1IQFA 3GYMA 2Z9IA 4ISOA 4GLYA 1RIWC 1P2OA 1P57B 2QGRA 3ZZ8A 3AASA 1V2TT 2PKAA 2JETB 2TPIZ 1VGCB 1HAVB 1GI5A 1SGTA 4DOQA 3ATMA 2V6NA 5FX6A 4DJZB 5E8EH 4BTTB 1GG6B 3PV4A 3QDZB 4ISNA 2A45B 3U8RH 2PKSB 1V2NT 1YGCH 3FP8E 2AGIX 1W10U 1O2TA 4UEHH 5FPTA 1BMLA 2SGDE 3GDUA 1P03A 2BOKA 2QC2A 1Y59T 4UONA 3NK8A 4BAQB 3VB3A 1GVLA 3E8LA 1GMHF 1KLJH 2F3CE 3M5OA 1LVYA 3RXOA 2PGQB 4K60A 1QL7A 5FCKA 1JRTA 1A61H 3UUZA 1GHWH 2YNBA 4NIXA 3ESTA 3UOPA 1CHOF 3ZVEA 4MPVA 3FANA 2XBWA 1EJAA 4TWWA 1K1JA 1JOUB 3SJIA 4AN7A 1HBTH 4THNH 4E7RG 1L4DA 3P8FA 5AFZH 3SU0A 1FIWA 4FVBA 4D8NA 4Y8XA 1LO6A 2O8MA 1GI4A 4Y6DA 4ZUHA 3SNAA 1L0ZA 1RJXB 1C1NA 4HGCA 2BB4A 1PPZA 2BDGA 2I6SA 1ZR0A 4XSKU 1AVXA 1ESTA 2P8OC 3A80A 3M7QA 3SGQE 1EASA 1LMWB 1AQ7A 4CR5A 1FXYA 2VWNA 1BBRK 1HDTH 4MVNA 3M5NA 2FOMB 1SBWA 2A4RA 1IHTH 4HZHA 3RC6A 1O2MA 1NRRH 4BXSA 4X6NA 1CSOE 7GCHG 1YP9A 4YOGA 2TGTA 1X7AC 4ZHAA 4UDWH 4JK5A 1XUHA 1LCYA 1YPLH 1MTUA 4NG9H 4IN1A 3GY3A 4AGKA 1N1LA 1OWEA 3S9AA 3LH3A 2UWLA 3P92A 1UTKA 3EE0B 3ELAH 1DSTA 4FU8A 2VIDA 2O8UA 1AN1E 1XUKA 2ZF0H 3A86A 2W5EA 4K3JA 4WJG2 8ESTE 3V7TA 1GPZA 5DP9A 5G4BA 3SQEE 3U9AH 1MKWH 4OS2A 3M5MA 4Z0KA 2ILNA 7ESTE 5F6MA 2QF0A 3QTVH 3ZZCA 3OYPA 2Q6DA 3G01A 5C5OA 2HNTC 5EXMA 1MTWA 1F0RA 4MTBA 4FVDA 1DICA 3PM3A 2GX4A 1GI9B 1YF4A 2B5TB 3ODDA 1C5SA 3MFJA 3UQVA 2FOHA 6GCHG 2NU1E 1JIMA 1GCTC 3ZV8A 2EA3A 3GY8A 4Q7YA 1WU1A 1UVTH 2BLWA 5EW1H 3F1SB 2BY7X 1CT4E 1GMCG 3UNQA 5C67A 2F9VA 1O2YA 1O38A 1XUFA 1O3EA 2XCNA 1YLCA 1AZZA 4X8UH 1Z71A 2ZDVH 2F9PA 2HNTE 2ZI2H 5EW2H 1EAUA 3GCHB 2BOHB 4YZUA 3GOVB 2HVXA 2AMQA 1GJ9B 1MKXK 2F9NA 3F68H 5JBCS 2P93A 3RXRA 5E2PA 4NIYA 4NIWA 1AE8H 1SGNE 5EPNA 5ABWA 4FUIA 1C5VA 3PMJA 4H6TA 5C1YA 3UWJH 1G3BA 3D23A 1C2DA 1O3AA 3LGVA 1DM4B 1SQOA 1N6YA 3SI4H 3ZYEA 2OQUA 1W8BH 5DKMA 1BTZA 2YNAA 1ELCA 1SPJA 4BAKB 2K7XA 2A31A 3EA8A 1A3EH 3I29A 1T4UH 3ZVAA 1C4U2 5I25A 1HRTH 1KLTA 1J8AA 2H9TH 3PWBA 1G9IE 2IOTA 4Y8ZA 2VWLA 3GY7A 4AFSA 1MU6B 2BDAA 4GSOA 3UY9A 3H5CB 1OXGA 1CVWH 1Q3XA 1S6FA 3RXFA 1K1NA 1WTGH 2GCTC 1O5EH 3SOSA 3UR6A 1CGHA 2SNWA 1GHVH 3M36A 2PV9B 2BHGA 1UO6A 2VWOA 3OX7U 2XWBI 5A8YA 2KAIB 1GBFA 3Q76A 3P8OA 2K1QA 1O30A 1HAGE 2OP9A 5LGOA 4MLFB 3TH3H 1QB6A 4BTIB 1ANBA 1YLDA 1P2NA 2PW8H 1EAWA 3PLBA 4Q7XA 2RA3A 1GCDA 1AKSB 1O5AB 2BMGB 2AMPA 4BANB 1RFNA 4CRDA 1E37B 1LKBA 1ANCA 1TMUH 1AB9B 1BMNH 3V12A 1HAZB 3MU4A 3T28A 1CHOG 1NU7B 2ZU4A 1EPTA 2UUKB 1YCPK 4D7GA 1TYNA 1O2WA 4K2YA 3BEIB 3PROA 1O2ZA 1T7CA 5FBIA 2FS8A 1GBMA 3OSYA 2FP7B 2H2ZA 4DY7B 4B1TA 1O2LA 3BTFE 4NWLA 1ZGVA 1GJ8B 5CHAB 4MDSA 3TK6A 4FXGH 3N7OA 4WY3A 1QR3E 3KNXA 4O03A 1AY6H 1JXPA 1QRXA 1O5DH 2ODPA 1G32B 4WVPE 1FNIA 1O5CB 5A0CA 1MTNC 1SQAA 3URCA 1FZZA 1TPPA 3RMLH 1ANDA 3O8BA 2OC7A 4Q2KA 4CHAB 1DY9A 2R3UA 2ANYA 1SFIA 3MOCA 3MNCA 1HGTH 1DT2A 3EQ0H 1EAIA 2ZECA 1QA0A 1P06A 1GVKB 3E0NB 1C1PA 1O34A 1GBIA 1XUGA 1CA0C 2VVVA 2ZO3H 1S0QA 2ESTE 5DP3A 1MTVA 2QAAA 4AX9H 1C1VH 3VB4A 2FOFA 2ZGJA 4FU9A 3KHVA 1BBRH 3CS7A 3FAOA 1A4WH 2FI4E 1GGDB 1VITH 2IPHA 2NWNA 1GBKA 4H4FA 3K6YA 5E0JA 4F4OC 1ZTKA 2BY8X 2NU3E 3ATWA 3H7TA 2VU8E 1E35B 5DP4A 2C8YB 2PR3A 1S85A 1ZJKA 3QGJA 3NKKA 4YLQH 1HJ8A 2M5TA 2OINA 4ASHA 2R3YA 3LGUA 3RXDA 3SU5A 1U6QA 1FV9A 3SGBE 3ZZ9A 3W94A 2CF8H 4X1SU 1P10A 1O2JA 2XC5A 4CRGA 1OWDA 1LHDH 5HM2A 1UTLM 2FLRH 1LQDB 1MQ6A 3TIUA 2FWWA 4FUGA 1MBQA 3TH4H 2ZDLA 2C8WB 2ZFPH 1O2VA 3ATLA 1HJAC 4K1SA 3KL6A 3HKJB 1G37A 1QIXB 4YT7H 1GJAB 1Y5UT 3UR9A 1PPBH 4MG3A 1AFQB 1TQ7B 1TQ0B 3UPEA 3SO3A 4LZ4B 2F83A 1E36B 5F03A 2O9QA 2VWMA 3KQCA 4DVAU 4MNYA 1OSSA 4WXVA 4U2WA 3UWIA 1K22H 4ZAEA 1P8VC 4JYTA 3GICB 1F2SE 3FFGA 1PPEE 2ZGXH 1W11U 5C20A 2UUJB 1EJNA 4Q80A 2UWOA 3AW0A 4WH6A 1IQHA 1Y3XA 6CHAB 3OY5U 2PHBA 3QTOH 3MU5A 1TE0A 1DFPA 1O2KA 1HLTH 1O5FH 3SJ9A 5C5NA 3E3TA 1CO7E 4K1TA 1OP8A 1NPMA 4K8BA 3SV2H 1FY3A 1T8LA 1C5MD 2BQ7B 1LVBA 1UVOA 2OC8A 3CS0A 1FLEE 3A87A 2F9UA 3ATIA 4M7GA 1O2HA 4BAMB 3SI3H 2QXJA 7GCHF 1O2IA 1VCWA 4HI3A 3DHKH 5K0HA 1C5TA 5E0HA 3LOXA 4FU7A 2XNIA 3BEUA 1CBWB 2AEIH 2ZCLP 4GUXA 2Z6BD 4Y11E 1WUNH 2FTLE 1ORFA 2JETC 1VGCC 2PTCE 2LPRA 2GP9B 1GJ5H 4SGAE 1GG6C 5EQSA 1ABIH 1DXWA 1C5YB 5AHGH 2C8XB 4DT7B 4E05H 2PKSC 2WUBA 3KQEA 1C9TA 4X1QU 1K1LA 1OX1A 4OS7A 5DP7A 1QA7A 1UMAH 1SB1H 2HRVA 3BG4B 3BTGE 5J4QA 4TPIZ 2J9NA 2J94A 1O2UA 4Y0ZE 4CRCA 1DY8A 2RCEA 4DIHH 3PO1C 4X6PA 4AG2A 1N6XA 1ELDE 3NXPA 1UHBA 3DUXH 1BCUH 3H7OA 2FDAA 4B75A 2BVXH 1SOTA 4LZ1H 2CHAB 4OS5A 4PROA 4AFZA 1EZXC 3TGJE 4ZROA 1Y3VA 2Y80A 2XBXA 3PMHB 1UTPA 3LH1A 4I8KA 4WXIA 4UFEH 1QJ6B 2CMYA 2XC0A 3GY5A 4AB9A 3A85A 5A8XA 3S9CA 4IMZA 2V3HH 3HGNA 2OBOA 1HUTH 2JH6D 1BHXB 1QBOA 2BY6X 4ZHMU 2VVUA 3SW2B 3K65B 4FUBA 4GHQA 1GMCF 1ZRBA 1H9LB 3S0NA 3RC5A 4YESB 4YOJA 2SGFE 3LGWA 3RXGA 1CGIE 2A4QA 4NA7A 2JH0D 3VXFH 4RN6A 4OS4A 2PTNA 1DLEA 1TOCB 1GI2A 5HMAA 5A2MH 3MMGA 2ZU3A 3HK6B 2QXGA 2A5AA 1QTFA 1A0JA 1AU8A 2QYIA 1ESBA 3VEQB 1GJ6A 5TCCA 2CF9H 1P12E 2TIOA 1O5GH 3SGAE 1W13U 3BN9A 2P16A 2H9EH 1OOKB 3A7YA 5SGAE 1C2EA 1SGYE 4SGBE 1V2VT 1ZOMA 1BMMH 5L30H 4DIIH 1O2RA 3RLYH 2ZGCA 1L1JA 8GCHG 5L2ZH 4AYYB 5FCRA 2DUCA 1C5OH 3EAJA 1SGFA 1TWXB 5EG4A 2ZHEH 2LIZA 2WYGA 4IC5A 4D9RA 1ZMNA 2Z7FE 1GJBB 2B7DH 5DP8A 3VB7A 4XBBA 3PTNA 2NU2E 3RP2A 3UREA 3TU7H 1DWDH 3A88A 2GCHF 2GTBA 1HPGA 1JBUH 1MAXA 5IYTA 3E6PH 1P3EA 3JZ2B 1B0FA 2FESH 1W12U 1MD7A 1WTHD 3UTUH 1SGFG 1XUJA 4KTSA 1F5KU 5EODA 1SL3A 4YOIA 2BQWB 1YPHC 1A5HA 2HNTF 1G2MA 2FOBA 4ABAA 1G3EA 2G4TA 3SUDA 1T4VH 1UK3A 1L1GA 1SG8B 1C5QA 4MNXA 4IMQA 3RLWH 1H8DH 3RXMA 5FPSA 2XBVA 5LPEA 4TWYA 5JPMH 2G81E 4HTCH 3P8NA 2O8LA 5HGGA 2VB0A 1LVMA 1FDPA 2ULLA 1HV7A 1IQMA 3TK5A 2RA0A 1ELGA 1TX7A 3GCHC 3QK1A 2OQ5A 1BA8B 1YPHE 3BTME 3NZIA 1LTOA 1S5SA 5B6OA 1A7SA 3IG6B 3VB5A 2OBQA 4ZKNU 1FPCH 1AUTC 3ZVDA 1C1SA 3VXEH 3A81A 1RGQA 2G51A 3KCGH 1BTWA 3E1XB 2AIQA 2Z94A 2VIQA 3TJVA 1P9SA 1GHXH 1LHCH 3MU0A 1OWJA 5IDKA 4J1YA 1GDNA 4WWYA 1DLKB 2B8OH 3L3TA 3SORA 1T8OA 2Z3DA 3MTYA 2R2WU 5LH8A 2ZTXA 2BDIA 2PKAB 2ZFQH 1EXFA 2ZDKA 1HJ9A 2ZHDA 1ARBA 2AMDA 3DFJA 4FUDA 2W26A 1DUEA 1RD3B 3MU8A 1UVPA 3I78A 2Y82A 4KGAA 2A2QH 1YKTA 3T27A 4IW4E 1QFKH 2TGAA 4Y76A 1ZSJA 3ZZ4A 1Y3YA 1DDJA 1OP2A 2JH5D 1UTNA 1NY22 3P95A 2BVSH 1ACBE 4UFFH 2GVFA 3LC3A 4UE7H 1MTSA 3HKIB 1OS8A 2FEQH 1QHRB 1HNEE 3BTWE 2G52A 1MCTA 3A8BA 1GI0A 3SV9A 3QO6A 1EJMA 5LPFA 1O2PA 1SLWB 3SZNA 4GAWA 2BX3A 1L4ZA 1A5GH 4IC6A 3MYWA 2OLGA 2J92A 2BDYA 4LXBH 4XBCA 1LKAA 1S82A 2BD7A 3BTTE 4FUJA 5FAHA 1TA6A 2STBE 5DGJA 3LT3A 1AB9C 1C1RA 2A4OA 1V2QT 3A82A 4TY7A 1SHHB 2BD8A 1FIZA 2C3SA 2BLOA 1GBDA 3TLOA 4WMFA 2A0QB 2FI3E 2SGAA 2ANWA 2EC9H 3M37A 4VGCC 3SU2A 4A6LA 2J95A 1B0EA 1GI1A 4NFFA 3QZQA 2J4IA 2H1UA 1P05A 1CQQA 4CBOA 1D3DB 1PPGE 4YO9A 2R0LA 1Q31A 1G30B 3PWCA 1QL9A 1PQ5A 1IQIA 2ZIQH 3ZZ7A 4DG4A 1K1MA 1W0ZU 4KTCA 4LK4A 4I33A 4MQAA 4WMDA 1KTSB 1A46H 3GY2A 1P2QA 1TRNA 1BTHH 4CH2B 2GDDA 2Y81A 2GGVB 1BDAA 2ZGBH 4ZXXH 4CHAC 2HPPH 2D2DA 1NT1A 2QCYA 1A3BH 1NS3A 2WPMS 5AF9H 3SQHE 1LHFH 2G4UA 1TA2A 5EOKA 2BDHA 3VPKA 1LHGH 1ZSLA 1GBBA 1EZQA 3AW1A 1YM0A 1FJSA 4A1VA 2GDEH 2FOCA 3RXBA 5DJ7A 3SN8A 1DWBH 2W3IA 2GMTB 4RKOB 1O3JA 2V3OH 4Q7ZA 1NC6A 1DWCH 1GGDC 4D7FA 2VH0A 1ABJH 5JYIA 1DVAH 1HFDA 5T3HA 2UWPA 4CRAA 2GV7A 1FONA 4GPGA 5TJXA 1KSNA 1GBHA 2GCHG 4JYVH 1PPHE 1LHEH 1D6WA 3FZDA 1V2LT 3B23B 1EUFA 1GHAG 2BZ6H 4X2VA 5FX5A 2V35A 4O3UA 3CP7A 2Y5FA 4R0IA 3EA7A 2R9PA 5GDSH 1Y3WA 1C2IA 1TNJA 3L33A 2ZPSA 1O3DA 2BLVA 4BAHB 5C1UA 3M7TA 2A7CA 1F5RA 1T8MA 3JZ1B 1T31A 1W7XH 1GMDF 2OTVA 1C1QA 5HM9A 4Y71A 1KXBA 1O36A 4YT6H 4AGJA 2Z9KA 1F92A 2VNTA 1BTUA 1GJCB 3RMOH 2FOEA 2ZKSA 2FXRA 1BITA 1TIOA 2BD4A 3RXJA 3UNSA 1TONA 2AH4X 1MD8A 1VITF 3MWIU 3L6PA 1BUIA 2FYRA 1G36A 1CT2E 2ZPRA 1ID5H 4YM9A 3SUEA 4AZ2B 3SNDA 2VGCB 1C2JA 1ZTLA 4K69A 6CHAC 1C1OA 1C9PA 3RMMH 1O3MA 1GHBF 2WPLS 4JZDH 1TNGA 4ESTE 1YPMH 3MH5A 4ISIH 1QNJA 1RXPA 3TJOA 1TABE 1HB0B 1GL0E 1V2ST 1TAWA 1HXFH 1TX8A 1AI8H 2BXUH 2VJ1A 3T29A 2BZAA 2BLQA 5GCHF 1MQ5A 2Y7XA 1KDQA 3U98H 2EI6A 1GBTA 1T8NA 3KIDU 1XX9A 1SGCA 2Z9JA 1CBWC 1GBLA 1GHYH 1BOQA
chains in the Genus database with same CATH superfamily
3QUMP 1O3GA 1P04A 8GCHF 3A8AA 1FUJA 2BXTH 4ZKOU 4JZFH 5TCAA 2PUXB 4E06H 1MBMA 2BM2A 1ARCA 1YCPM 2HGTH 2LELA 2A5KA 2R2MB 1DXPA 1A5IA 1C1TA 4ABDA 2FMJA 1C5LH 2VIWA 1IOEA 1AIXH 1BJUA 2QE7D 2GT8A 2FM2A 2D26C 1S83A 1WSSH 3QWCH 4X1PU 5GIBA 4MPUA 2JKHA 2FOAA 3BG4C 3PTBA 1AUJA 1AMHA 1PYTC 1EPTB 4DURA 4ZMAH 1KMHB 1QGFA 3BSQA 1Z8RA 1P3CA 3M5LA 1XM1A 3Q3XA 1EAXA 3TNTA 3ZVBA 1Z1IA 4AYVB 1V2OT 4IN2A 1A1RA 2CHAC 1PYTD 1WYKA 1TPAE 1NRPH 2ZU1A 3LPRA 4B2CA 2DE9A 5HYOA 2UUYA 4X6MA 3RXLA 1DE7H 1DX5M 1O33A 1C5ZB 2GKVE 3OTJE 1NRSH 1C4Y2 2AS9A 4DGJA 2PWXA 1K1PA 2WV5A 2K0QA 2XW9A 1ZHMA 4OS1A 1H8HD 2GCTB 2ZHWH 4B71A 1BRUP 1QQUA 2C93B 4I32A 6LPRA 1VCQA 2V0BA 5T6GA 3UFAA 2QV1A 3MI4A 2P3TB 3ZZBA 1K2I1 2KM0A 2H9HA 1ELEE 1NN6A 2ZTYA 3OU0A 3O8CA 2AFQB 3QX5H 5ESBA 3RXQA 4NGAH 1DSUA 5I46H 4I31A 1O3BA 1MU8B 5EXLA 3ZYDA 5A09A 4H42U 2EEKA 2OC0A 4A1TA 3F3BA 1WQSA 4GHTA 1FN8A 2SNVA 1OP0A 1BRCE 4A7IB 3RXAA 1LPKB 4Z1MD 4Y7AA 4B73A 3UQOA 1C2MA 3FP6E 3D62A 2BX4A 3R3GB 1ETTH 2XWAA 1J17T 2Y7ZA 1EOJA 4H6SB 1GJ7B 1IAUA 2QF5A 1K1OA 4MPWA 1BBRE 1NFUA 2GJGA 5GXPA 3W1EA 2D8WA 1XUIA 1UVSH 1EP5A 2HOBA 4ABHA 3FVFB 1KXEA 1RTKA 2XNDD 1F0TA 2W6ID 4ABBA 2ZGHA 3GY6A 1IQJA 2B9LA 4U30A 1O3IA 8KME2 1H9HE 3D49H 4X1RU 4AC9A 1MZAA 1O3PB 5JBAS 5JBTA 1ZPZA 3A84A 4FOUC 3LIWA 4INKA 1M9UA 3MNBA 1YC0A 1BB0B 1MTNB 3AVZA 3ITIA 3T25A 1IQEA 1Z8JB 2FX4A 3P70B 2PSXA 3TGKE 2XC4A 3LC5A 4X2XA 1OYQA 3T26A 2XCFA 1G3CA 3URDA 1FY1A 1UTOA 4TSFD 1FQ3A 1VCPA 1P9UA 2FIRH 2TGPZ 1P11E 1SR5C 3AAVA 5K7RA 3PYHA 1V3XA 1S6HA 1ZPCA 4E7NA 3SV6A 1HAOH 2ZQ2A 1DANH 1V2JT 2SFAA 1B5GH 1D3QB 1GMDG 2WV4A 4I8GA 2ZCHP 1B7XB 3UOUA 2J38A 2O8WA 3O8DA 1HIAA 2ZA5A 1C2LA 1ZMJA 3ZV9A 1O39A 1HXEH 2JIZD 3RMNH 1VITG 3A7WA 5E2OA 1SGIB 2YMSC 3KGPA 2WPHS 3M35A 3M61U 1G2LA 2ZFTA 5EJ1A 1W3CA 2H5CA 2A5IA 1AZ8A 1GHBG 2YMSD 1MUEB 1SGRE 1ZJDA 3MHWU 2PGBB 3M3TA 3DD2H 1GI3A 4XD7D 5DPAA 3VGCB 1TNLA 3N7DA 2BTCE 3SV7A 1QRZA 1BRBE 4JZEH 1FY5A 7LPRA 3ZZ6A 1C5UA 1HAVA 3LGYA 1PFXC 1XXFA 1IQNA 1A0HB 1PJPA 1FAXA 1P09A 5GCHG 1P2IA 1MH0A 4NSVA 1WCZA 1TX6A 3GCTF 1GI7B 1TOMH 3P6ZB 1QB1A 3F9FA 3DT0H 2CXVA 1TFXA 3NPSA 1OKXA 3RDZA 4ZHLU 1WXRA 3TJNA 1ZGIA 1DPOA 3ZZ3A 1E1QD 2QA9E 1NO9H 3C27B 3K9XB 1E0FD 2BQ6B 3RU4D 1RRKA 1WOFA 3P8GA 1QBVH 2RDLA 1UHBB 3QLPH 3LU9B 2ZU2A 5F8TA 1ETSH 2ZPQA 1QJ7B 1P2MA 1UTMA 1F7ZA 3KYGA 2ZTZA 3F6UH 7KMEH 2P94A 1O2OA 1GBEA 4FETA 1JWTA 1O2SA 1P2JA 1NFWA 3TNSA 1NZQH 3MH7A 4XRNA 4MNVA 3RU4E 3EA9A 2G55A 5KEDA 1TBRH 3BTDE 2Z3CA 2A2XH 4TYDA 5EXNA 5KGOA 5JDUB 4KELA 3RXHA 1AWHB 2VIVA 2WPIS 1GHAF 2P3FH 2OUAA 3AAUA 1E1RD 2C4FH 3GISB 1H1BA 1EB1H 1YYY1 1CE5A 2TBSA 3TITA 3BG8A 3LJOA 2O8TA 1QL8A 3SJOA 5EGMA 3LJJA 1BTXA 3SV8A 2UUFB 1UW7A 1L1NA 3VB6A 4D76A 3RXPA 1LPGB 5CMXH 2Z9GA 6ESTA 1ELFA 1VR1H 1GWAA 1NU9A 4A92A 1TBQH 3TVJB 4NCYA 2F9OA 1DS2E 1MABB 1C5NH 2WUCA 4X1NU 1XMNB 1TMTH 5E0GA 5HXFA 1Y5BT 3RXKA 3LDXH 1YBWA 2Q6GA 1O3OA 3O8RA 1NTPA 4FUEA 3M3VA 4FUCA 1TALA 3Q00A 5F8XA 2OXSA 2A7HA 2ZC9H 3RUOA 3QN7A 1TNHA 1XVOA 2A1DB 3OTPA 3A83A 4U32A 3PO1B 1TNIA 2C8ZB 4XOJA 1PQAA 3T2NA 1HCGA 1Z6JH 5GWZA 1KXCA 4ABEA 3MNSA 4Y10E 3T62A 1C2HA 1QJ1B 4I8HA 3S7KB 1P01A 2QF4A 2ANKH 3DA9B 1ETRH 3RXEA 2WINI 1EZUC 4KP0A 5C17A 1J9CH 5DP6A 1ZHRA 2H5DA 3UNRA 2WPKS 1CA8B 3ZVGA 4JCNA 3F9HA 3GCNA 1TRYA 1O0DH 2HVYB 1O2XA 2GMTC 2WYJA 4MNWA 2SGPE 1O3CA 4ZKRU 1N8OB 4I8LA 4INHA 3STJA 2BDCA 2P95A 1SSXA 4X8TH 3RXUA 3FZZA 1TPOA 1ZHPA 2PSYA 1Y5AT 1C5WB 4X0WU 1J14A 3OEHD 4X8VH 2J2UA 2C90B 2ZNKH 5C1XA 3NRLA 1H8IH 1SGPE 1HAHH 5HIZA 2GD4B 1OPHB 2XBYA 2F9BH 2J34A 3MO6A 4I7YH 1AHTH 1C4V2 2ZU5A 1LQEA 4OGXA 5DO4H 2ODQA 2FPZA 2F4LA 4X8SH 3FP7E 4Y7BA 2AGGX 2PLXA 1QY6A 1TGBA 2JJ2D 2OCVB 2BDBA 1RTLA 4QT8C 3E16B 2AIPA 4GVUA 3GY4A 2BYAX 5FXLA 1THSH 1J16A 4F49A 1OWIA 1XKBC 2TGDA 1Y8TA 4XE4A 1L2EA 2ZHFH 3BTKE 4Q4LA 4Y79A 1WV7H 4XDEA 5C2ZA 5JBBS 1HAPH 3SNEA 5AVDA 1GJDB 3LGIA 2BD5A 1RIWB 1GL1A 1ELBA 2VGCC 3R0FA 4O9VA 2STAE 1EB2A 1HAYB 1EKBB 1V2WT 4RSPA 1MMJN 4NIVA 3Q3YA 1O32A 1TBZH 5FBEA 1WAYB 4UFGH 2QN5T 1BTPA 2D1JA 2QXIA 2W3KA 2A32A 5CHAC 1O2QA 3K2UA 3ATKA 1UCYK 4XFQA 3GDVA 5DP5A 1O31A 1AFEH 1V2RT 4CBNA 1CGJE 3BEFB 1EX3A 4NFEA 2BY5X 1YPJH 2AYWA 1V2PT 3Q3KA 4GCHF 2CJIA 1SGEE 5JB8S 1GBCA 1BQYA 1OWKA 1ZMLA 1COWD 3MO9A 1IQKA 2EI7A 3LKWA 1TNKA 1GBAA 3GCTG 4NZQA 2Z3EA 4IGDA 2KAIA 1GDQA 5J4SA 2THFB 1O37A 3A7ZA 4BOHA 5BPEA 2A7JA 3UAIC 2VBCA 1W14U 4B2AA 4JYUH 4BAOB 1GDUA 1UTQA 2FOGA 4BXWA 1O3FA 1AKSA 3PB1E 1SKYE 1ZTJA 4XBDA 4B6FA 5ESTE 4BTUB 1KYNA 4ZCNA 1IQLA 5T6DA 1EPTC 1ZZZA 4P02A 1SGQE 1V2UT 3ODFA 1TRMA 4A1XA 2WSSD 4NA8A 1OWHA 2G8TA 3A89A 2P8OB 1GI6A 3SYJA 1SC8U 3A8DA 3TH2H 2IN2A 3VG8A 1KXDA 4CRBA 1KLIH 4NA9H 4NZLA 5L2YH 2DE8A 1KIGH 1CU1A 1T32A 1NM6A 1TMBH 2TRMA 5EIYA 3IWMA 3K6ZA 4Y0YE 2BD3A 5DK1A 2FODA 2KZ4A 2F91A 2ZZUH 2ZFSA 2PFEA 1O35A 1Y3UA 3SJKA 5FPYA 2ZFFH 2BY9X 2ZDNA 1KXAA 3VFEA 4O97A 1BHXF 4B6EA 2WPJS 1LPZB 1QB9A 2NU4E 1V6DA 3A7VA 4HFPB 1AFQC 3OFND 1EQ9A 4WMEA 4ABFA 5L6NH 2Y6TA 3RXIA 1SHYA 1H4WA 3EYDA 3HGPA 4U01A 4WF8A 4F48B 3GCOA 1IHSH 3C1KA 1OYTH 2OC1A 1SGDE 1C1UH 1EP6A 1GMHG 3EGKH 4AB8A 4DW2U 2HWLB 2FO9A 2Y5GA 1UTJA 2GZ7A 1CT0E 1P02A 5C3NA 1FMGA 1TB6H 5FHTA 4FUFA 2FYQA 1FN6A 3B8JA 2ZWLH 1ELAA 2VH6A 4JZIA 4ISHH 4Z6AH 1P0SH 3SBKA 2ZG0H 2ZDMA 2FLBH 2Q6FA 2G00A 4UD9H 1ELVA 3SNBA 4VGCB 1GCTB 1NFYA 3GDSA 2B0FA 1C5PA 1K1IA 3S9BA 3MQKC 1ZLRA 4RKJB 2XXLA 3GYLB 4ABIA 2KFWA 2GT7A 3ZZAA 1C5RA 1XXDA 4K1EA 4ABJA 4JK6A 3TJUA 1SLVB 2V3MA 4X6OA 3SJ8A 2VVCA 1MCVA 1XKAC 2ZCKP 3H09A 3KN2A 1UK2A 4BNRA 3M7UA 4UFDH 1RTFB 1FAKH 1O5BB 1AWFH 3SHCH 1PPFE 3KQ5A 3TK9A 2ZFRH 3PMBB 1GJ4H 9LPRA 1S0RA 4OM9A 3BTHE 4CRFA 2J98B 2ZEBA 1AGJA 1W0YH 1WQVH 1F5LA 1HYLA 1QQ4A 2IJOB 4ZXYH 2EI8A 1YPGH 2ZHQH 1QURH 3S7HB 5H4IB 3ZZDA 2I6QA 5A8ZA 4CH8B 3BIVH 1BMAA 2XYAA 2WHXA 2LNCA 4IS5A 2AERH 1DWEH 1ZRKA 2G5NA 3HK3B 1HAIH 1K28D 1QBNA 1FY4A 1NFXA 5A0AE 3V13A 5FL7D 3E90B 1UK4A 4YTAA 1O2GH 3SNCA 1AO5A 3BIUH 4NWKA 1E34B 1TGTA 1VZQH 5DG6A 1INCA 3NWUA 1GBJA 4OGYA 4X2YA 2ALPA 3TPIZ 1F0SA 3F9GA 3WY8A 3LONA 5JB9S 2W7UA 1KDQB 3HATH 1C2FA 3RU4T 3VGCC 1AVGH 3MU1A 3SHAH 3ENSB 3BTEE 1C1WH 1SLXB 5F8ZA 1W7GH 4JMYA 3UIRA 2K8IA 4Q63A 4I8JA 4GCHG 4Y8YA 3T5FH 3RXVA 5EU8A 1C1MA 1G3DA 1KXFA 2HALA 1UJ1A 2ZQ1A 3MNXA 4B2BA 4NSYA 4AORA 1EOLA 2BD2A 4O3TA 4TPYA 2Q1JA 1SI5H 1A2CH 1ELTA 1LVOA 3A7TA 3RXTA 1C2KA 1YPEH 3ZVFA 3V0XA 3E0PB 1XVMA 4WH8A 1BT7A 1V2MT 1NROH 3EBNA 1UCYH 2ALVA 2AGEX 1O2NA 3P17H 1O3NA 2HPQH 2QXHA 1K21H 3STIA 3U8TH 5LPRA 1ZSKA 1JRSA 1Z6EA 1Q2WA 1O3KA 3HPTB 3BV9B 2P59A 3S69A 3E91A 1FPHH 2ODYB 2Y5HA 3PLPA 3SU1A 3ZIAD 3ZVCA 1MZDA 5F53A 3MO3A 4TY6A 1PQ8A 3IITA 1SLUB 2VINA 2FS9A 2CN0H 2GZ8A 3SUGA 1IQGA 1JMOH 5T6FA 2ANMH 1DITH 1WDIA 3EDXB 3OY6U 1QCPA 1YPKH 2VIPA 1JIRA 1TGSZ 1VKYA 2J97A 1WBGB 3SU4A 1MAYA 3MH6A 1UVUH 3RXCA 1MKXH 1F0UA 1Z7KA 2R0KA 3Q77A 4B76A 1FY8E 1ZPBA 4YLUA 3PMAB 1GVZA 3DFLA 4A5TS 1THPB 4RI0A 4AFQA 3A8CA 1CHGA 1MKWK 3SU6A 3U8OH 1QRWA 4CREA 2QF3A 2QY0B 1SMFE 5A0BA 1CA0B 2CGAA 4ZH8A 1AVWA 1TGNA 3PLKA 1ANEA 2VIOA 2W6JD 3D65E 2M2AA 4MPXA 5PTPA 4D9QA 2OD3B 2W7SA 1W2KH 2KCPA 1PQ7A 1V2KT 3BTQE 3U1IB 1Z8GA 2ZDAH 3M3SA 3ZZ5A 1PPCE 2P3UB 5EPYA 3U1JB 2G5VA 1E38B 1P2KA 3QZRA 3TGIE 1UCYE 3F9EA 4K8YA 4LOYH 1D9IA 1HAXB 2FZZA 1THRH 2CV3A 4AOQA 1DOJA 1BJVA 1GI8B 3CENA 3NCLA 2FI5E 3MH4A 6GCHF 1NESE 1H9IE 1J15A 4ZKSU 3KQDA 2NU0E 5CE1A 3RM0H 2FTMA 1D3TB 3KQBA 5EQQA 3SU3A 4OS6A 4R8TB 1A0LA 4ISLA 1TGCA 5GPIB 2GV6A 1SQTA 1NRQH 1AD8H 3I77A 1N8OC 4IBLH 3KF2A 4X2WA 1HJAB 4I86A 1LDTT 1RS0A 1K9OE 2H6MA 4CR9A 1VJ9U 3RC4A 1TLDA 1Z8IB 5GJ4B 4AFUA 2GZ9A 1S84A 2A4GA 3PV5A 4B74A 1SFQB 3QGNB 3RXSA 1BIOA 2YOLA 1ESAA 3W95A 3BF6H 3SUFA 2ZP0H 2ASUB 2FX6A 1TPSA 2QIQA 3LGTA 3OE7D 5AFYH 4DCDA 1YCPH 2PUQH 2BD9A 1K0HA 1EFRD 4FUHA 3U69H 3B9FH 2XTTB 1D6RA 5ETXA 1DUAA 1AE5A 4J2YB 3RM2H 1BTYA 4KTUA 5EQRA 9ESTA 4ABGA 1HIAB 2HLCA 2SGEE 4JZ1A 1EATA 5BRRE 2SGQE 1ZYOA 1O3HA 2XRCA 4INLA 1KY9A 2Z9LA 1BRAA 1D3PB 1SVPA 4AG1A 3A7XA 3V3MA 1VJAU 8LPRA 1C2GA 1KTTB 4KKDA 1D4PB 1O3LA 1S81A 1SOZA 2BVRH 1GHZA 2RG3A 3KEEA 3NUMA 3FOAA 1NRNH 1Z1JA 1EZSC 1C5XB 4K5ZA 4M9FA 1BZXE 1FI8A 1IQFA 3GYMA 2Z9IA 4ISOA 4GLYA 1RIWC 1P2OA 1P57B 2QGRA 3ZZ8A 3FO8D 3AASA 1V2TT 2PKAA 2JETB 2TPIZ 1VGCB 1HAVB 1GI5A 1SGTA 4DOQA 3ATMA 1SQRA 2V6NA 5FX6A 4DJZB 5E8EH 4BTTB 1GG6B 3PV4A 3QDZB 4ISNA 2A45B 3U8RH 2IJD1 2PKSB 1V2NT 1YGCH 3FP8E 2AGIX 1W10U 2L74A 1O2TA 4UEHH 3DSOA 3PRBA 5FPTA 1BMLA 1H8ED 2SGDE 3GDUA 1P03A 2BOKA 2QC2A 1Y59T 4UONA 3NK8A 4BAQB 3VB3A 1GVLA 3E8LA 1GMHF 2OK5A 1KLJH 2EQNA 2F3CE 3M5OA 1LVYA 5GNDA 2PGQB 4K60A 1QL7A 3RXOA 5FCKA 1JRTA 1A61H 3UUZA 1GHWH 2YNBA 4NIXA 3ESTA 3UOPA 1CHOF 3ZVEA 4MPVA 3FANA 1W0KD 2XBWA 1EJAA 4TWWA 1K1JA 1JOUB 3SJIA 4AN7A 1HBTH 4THNH 4E7RG 1L4DA 3P8FA 5AFZH 3SU0A 1FIWA 4FVBA 4D8NA 4Y8XA 1LO6A 2O8MA 1GI4A 4Y6DA 4ZUHA 3SNAA 1L0ZA 5DN6D 1RJXB 5T1VA 1C1NA 3AK5A 4HGCA 2BB4A 1PPZA 2BDGA 2I6SA 1ZR0A 4XSKU 1AVXA 1ESTA 2P8OC 3A80A 3M7QA 3SGQE 3UB0A 1EASA 1LMWB 1AQ7A 4CR5A 1FXYA 2VWNA 1BBRK 1HDTH 4MVNA 3M5NA 5IK2D 2FOMB 1SBWA 2A4RA 1IHTH 4HZHA 3RC6A 1O2MA 1NRRH 4BXSA 4X6NA 1CSOE 7GCHG 1YP9A 4YOGA 2TGTA 1X7AC 4ZHAA 4UDWH 4JK5A 1XUHA 1LCYA 1YPLH 1MTUA 4NG9H 4IN1A 5CHBA 3GY3A 4AGKA 1N1LA 1OWEA 3S9AA 3LH3A 2UWLA 2EY4C 3P92A 1UTKA 3EE0B 3PRDA 5DSFA 3ELAH 1DSTA 4FU8A 2VIDA 2O8UA 1AN1E 1XUKA 2ZF0H 3A86A 2W5EA 4K3JA 4WJG2 8ESTE 3V7TA 1GPZA 5DP9A 3F2FA 5G4BA 3SQEE 3U9AH 1MKWH 4OS2A 3M5MA 4Z0KA 2KX4A 2ILNA 7ESTE 5F6MA 2QF0A 1S6LA 3QTVH 3ZZCA 3OYPA 5C0TA 2Q6DA 3G01A 5C5OA 2HNTC 5EXMA 1MTWA 1F0RA 4MTBA 4FVDA 1DICA 3PM3A 2GX4A 1GI9B 1YF4A 2B5TB 3ODDA 1C5SA 3MFJA 3UQVA 2FOHA 6GCHG 2NU1E 1W0JD 1JIMA 1GCTC 3ZV8A 3PV2A 2EA3A 3GY8A 4Q7YA 1WU1A 1UVTH 2BLWA 5EJLA 5EW1H 3F1SB 2BY7X 1CT4E 1GMCG 3UNQA 5HIYA 5C67A 2F9VA 1O2YA 1OHHD 1O38A 1XUFA 1O3EA 2XCNA 1YLCA 1AZZA 3OEED 1Z71A 2ZDVH 2F9PA 4X8UH 2HNTE 2ZI2H 5EW2H 1EAUA 3GCHB 2BOHB 4YZUA 3GOVB 2HVXA 2AMQA 1GJ9B 1MKXK 2F9NA 3F68H 5JBCS 2P93A 3RXRA 5E2PA 4NIYA 4NIWA 1AE8H 1SGNE 5EPNA 5ABWA 4FUIA 1C5VA 3PMJA 4H6TA 5C1YA 2AHME 3UWJH 1G3BA 3D23A 1C2DA 1O3AA 3LGVA 4RT0A 1DM4B 1SQOA 1N6YA 3SI4H 3ZYEA 2OQUA 1W8BH 5DKMA 1BTZA 2YNAA 1ELCA 1SPJA 4BAKB 2K7XA 2A31A 3EA8A 1A3EH 3I29A 1T4UH 3ZVAA 1C4U2 5I25A 1HRTH 1KLTA 1J8AA 2H9TH 3PWBA 1G9IE 2IOTA 3N99A 4Y8ZA 2VWLA 3GY7A 4AFSA 4ACAA 1MU6B 2BDAA 4GSOA 3UY9A 3H5CB 2RFKC 1OXGA 1CVWH 1Q3XA 1S6FA 3RXFA 1K1NA 1WTGH 2GCTC 1O5EH 3SOSA 3UR6A 1CGHA 2SNWA 1GHVH 3M36A 2PV9B 2BHGA 1UO6A 2VWOA 4P00A 3OX7U 2XWBI 4F55A 5A8YA 2KAIB 2JJ1D 1GBFA 3Q76A 3P8OA 2K1QA 1O30A 1HAGE 2OP9A 5LGOA 4MLFB 3TH3H 1QB6A 4BTIB 1ANBA 1YLDA 1P2NA 2PW8H 1EAWA 3PLBA 4Q7XA 2RA3A 1GCDA 1AKSB 1O5AB 2BMGB 2AMPA 4BANB 1RFNA 4CRDA 1E37B 1LKBA 1ANCA 1TMUH 1AB9B 1BMNH 3V12A 1HAZB 3MU4A 3T28A 1CHOG 1NU7B 2ZU4A 1EPTA 2UUKB 1YCPK 4D7GA 1TYNA 1O2WA 4K2YA 3BEIB 3PROA 1O2ZA 1T7CA 5FBIA 2FS8A 1GBMA 3OSYA 2FP7B 2H2ZA 4DY7B 4B1TA 1O2LA 3BTFE 4NWLA 1ZGVA 1GJ8B 5CHAB 4MDSA 3TK6A 1YLNA 4FXGH 3N7OA 4WY3A 1QR3E 3KNXA 3KYFA 2F43B 1AY6H 4O03A 1JXPA 1QRXA 1O5DH 2ODPA 1G32B 4WVPE 1FNIA 1O5CB 3EE7A 5A0CA 1MTNC 1SQAA 3URCA 1FZZA 1TPPA 3RMLH 2WZQA 1ANDA 3O8BA 2OC7A 4Q2KA 4CHAB 1DY9A 2R3UA 2ANYA 1SFIA 3MOCA 3MNCA 1HGTH 1DT2A 3EQ0H 1EAIA 2ZECA 1QA0A 1P06A 1GVKB 3E0NB 1C1PA 1O34A 1GBIA 1XUGA 1CA0C 2VVVA 3N7EA 2ZO3H 1S0QA 2ESTE 5DP3A 1MTVA 2QAAA 4AX9H 1C1VH 3VB4A 2FOFA 2ZGJA 4FU9A 3KHVA 1BBRH 3CS7A 3FAOA 1A4WH 2FI4E 1GGDB 1VITH 2IPHA 2NWNA 1GBKA 4H4FA 3K6YA 5E0JA 4F4OC 1ZTKA 2BY8X 2NU3E 3ATWA 3H7TA 2VU8E 1E35B 5DP4A 2C8YB 2PR3A 1S85A 1ZJKA 3QGJA 3F2GA 3NKKA 4YLQH 1HJ8A 2M5TA 2OINA 1E79D 3F2HA 4ASHA 2R3YA 3LGUA 3RXDA 3SU5A 1U6QA 1FV9A 3SGBE 3ZZ9A 3W94A 2CF8H 4X1SU 1P10A 1O2JA 2XC5A 4CRGA 1OWDA 1LHDH 5HM2A 1UTLM 2FLRH 3F0PA 1LQDB 1MQ6A 3TIUA 2FWWA 4FUGA 4TT3D 1MBQA 3TH4H 2ZDLA 2C8WB 2WPDD 2ZFPH 1O2VA 3ATLA 1HJAC 4K1SA 3KL6A 3HKJB 1G37A 1QIXB 4YT7H 1GJAB 1Y5UT 3UR9A 1PPBH 4MG3A 2L6OA 1AFQB 2V7QD 1TQ7B 1TQ0B 3UPEA 3SO3A 4LZ4B 2F83A 1E36B 5F03A 2O9QA 2VWMA 3KQCA 4DVAU 4MNYA 1OSSA 4WXVA 4U2WA 3UWIA 2KCOA 1K22H 4ZAEA 1P8VC 4JYTA 3GICB 1F2SE 3FFGA 1PPEE 2ZGXH 1W11U 4YXWD 5C20A 2UUJB 1EJNA 4Q80A 2UWOA 3AW0A 4WH6A 1IQHA 1Y3XA 6CHAB 3OY5U 2PHBA 3CNRA 3MU5A 3QTOH 1TE0A 1DFPA 1O2KA 1HLTH 1O5FH 3SJ9A 5C5NA 3E3TA 1CO7E 1YY3A 4K1TA 1OP8A 1NPMA 4K8BA 3SV2H 1FY3A 1T8LA 5B6LA 1C5MD 2BQ7B 1LVBA 1UVOA 2OC8A 3CS0A 1FLEE 3A87A 2F9UA 3ATIA 4M7GA 1O2HA 4BAMB 3SI3H 2KR7A 2QXJA 7GCHF 1O2IA 1VCWA 4HI3A 3DHKH 5K0HA 1C5TA 5E0HA 5HKKD 3LOXA 4FU7A 2XNIA 3BEUA 1CBWB 2AEIH 2ZCLP 4GUXA 2Z6BD 4Y11E 1WUNH 2FTLE 1ORFA 2JETC 1VGCC 2PTCE 2LPRA 2GP9B 1GJ5H 4SGAE 1GG6C 5EQSA 1ABIH 1DXWA 1C5YB 5AHGH 2C8XB 4DT7B 4E05H 2PKSC 1YWUA 2WUBA 3KQEA 3WWFA 1C9TA 4X1QU 1K1LA 1OX1A 3DCLA 4OS7A 5DP7A 1QA7A 1UMAH 1SB1H 2HRVA 3BG4B 3BTGE 5J4QA 4TPIZ 2J9NA 2J94A 1O2UA 4Y0ZE 4CRCA 1DY8A 2RCEA 5CDFE 4DIHH 3PO1C 4X6PA 4AG2A 1N6XA 1ELDE 3NXPA 1UHBA 3DUXH 1BCUH 3H7OA 3GS9A 2FDAA 4B75A 2BVXH 1SOTA 4LZ1H 2CHAB 4OS5A 4PROA 4AFZA 1EZXC 3TGJE 5C0UA 4ZROA 1Y3VA 2Y80A 2XBXA 3PMHB 1UTPA 3LH1A 4I8KA 4WXIA 4UFEH 1QJ6B 2CMYA 2XC0A 3GY5A 4AB9A 3A85A 5A8XA 3S9CA 4IMZA 2V3HH 3HGNA 2OBOA 1HUTH 2JH6D 1BHXB 1QBOA 2BY6X 4ZHMU 2VVUA 3SW2B 3K65B 4FUBA 4GHQA 1GMCF 1ZRBA 1H9LB 3S0NA 3RC5A 4YESB 4YOJA 2SGFE 3LGWA 3RXGA 1CGIE 2A4QA 4NA7A 2JH0D 4DT4A 3VXFH 4RN6A 4OS4A 2PTNA 1DLEA 1TOCB 1GI2A 5HMAA 5A2MH 3DSPA 3MMGA 2ZU3A 3HK6B 2QXGA 2A5AA 1QTFA 1A0JA 1AU8A 2QYIA 1ESBA 3VEQB 1GJ6A 5TCCA 2CF9H 1P12E 2TIOA 1O5GH 3SGAE 1W13U 3BN9A 2P16A 2H9EH 1OOKB 3A7YA 5SGAE 1C2EA 1SGYE 4SGBE 1V2VT 1ZOMA 1BMMH 5L30H 4DIIH 1O2RA 3RLYH 2ZGCA 1L1JA 8GCHG 5L2ZH 4AYYB 5FCRA 2DUCA 3FKSD 1C5OH 3EAJA 1SGFA 1TWXB 5EG4A 2ZHEH 2LIZA 2WYGA 4IC5A 4D9RA 1ZMNA 2Z7FE 1GJBB 2B7DH 5DP8A 3VB7A 4XBBA 3PTNA 2NU2E 3RP2A 3UREA 3TU7H 1DWDH 3A88A 2GCHF 2GTBA 1HPGA 1JBUH 1MAXA 5IYTA 3E6PH 1P3EA 3JZ2B 1B0FA 2FESH 1W12U 1MD7A 1WTHD 3UTUH 1SGFG 1XUJA 4KTSA 1F5KU 4HG6A 5EODA 1SL3A 4YOIA 2BQWB 1YPHC 1A5HA 2HNTF 5C94A 1G2MA 2FOBA 4ABAA 1G3EA 2G4TA 3SUDA 1T4VH 1UK3A 1L1GA 1SG8B 1C5QA 4MNXA 4IMQA 3RLWH 1H8DH 3RXMA 3FN8A 5FPSA 2XBVA 5LPEA 4TWYA 5JPMH 3OAAD 2G81E 4HTCH 3P8NA 2O8LA 3WW7A 5HGGA 3U28C 2VB0A 1LVMA 2RDEA 1FDPA 2ULLA 1HV7A 1IQMA 3TK5A 2RA0A 1ELGA 1TX7A 3GCHC 3QK1A 2OQ5A 1BA8B 1YPHE 3BTME 3NZIA 1LTOA 1S5SA 5B6OA 1A7SA 3IG6B 2YMSB 3VB5A 2OBQA 4ZKNU 1FPCH 1AUTC 3ZVDA 1C1SA 3VXEH 3A81A 1RGQA 3SZEA 2G51A 3KCGH 1BTWA 3E1XB 2AIQA 2Z94A 2VIQA 3TJVA 1P9SA 1GHXH 1LHCH 3MU0A 1OWJA 5IDKA 4J1YA 1GDNA 4WWYA 1DLKB 2B8OH 3L3TA 3SORA 1T8OA 2Z3DA 3MTYA 2R2WU 5LH8A 2ZTXA 2BDIA 2PKAB 2ZFQH 1EXFA 2ZDKA 1HJ9A 2PP6A 2ZHDA 1ARBA 2AMDA 3DFJA 4FUDA 2W26A 1DUEA 1RD3B 3MU8A 1NBMD 1UVPA 3I78A 2J5UA 2Y82A 4KGAA 2A2QH 1YKTA 3T27A 4IW4E 1QFKH 2TGAA 4Y76A 1ZSJA 3ZZ4A 1Y3YA 1DDJA 1OP2A 2JH5D 1UTNA 1NY22 3P95A 2BVSH 1ACBE 4UFFH 2GVFA 3LC3A 4UE7H 1MTSA 3HKIB 1OS8A 1NBME 2FEQH 1QHRB 1HNEE 3BTWE 2G52A 1MCTA 3A8BA 1GI0A 3SV9A 3QO6A 1EJMA 5LPFA 1O2PA 1SLWB 3SZNA 4GAWA 2BX3A 1L4ZA 1A5GH 4IC6A 3MYWA 2OLGA 2J92A 2BDYA 4LXBH 4XBCA 1LKAA 1S82A 2BD7A 3BTTE 4FUJA 4ASUD 5FAHA 1TA6A 2STBE 5DGJA 3LT3A 1AB9C 1C1RA 2A4OA 1V2QT 3A82A 4TY7A 1SHHB 2BD8A 5EJZA 1FIZA 2C3SA 2BLOA 1GBDA 2FI3E 3TLOA 4WMFA 2A0QB 2SGAA 2ANWA 2EC9H 3M37A 5KECA 4VGCC 3SU2A 4A6LA 2J95A 1B0EA 1GI1A 4NFFA 3QZQA 2J4IA 2H1UA 1P05A 1CQQA 4CBOA 1D3DB 1PPGE 4YO9A 2R0LA 1Q31A 1G30B 3PWCA 1QL9A 1PQ5A 1IQIA 2ZIQH 3ZZ7A 4DG4A 1K1MA 1W0ZU 4KTCA 3WWBA 4LK4A 4I33A 4MQAA 4WMDA 1KTSB 1A46H 3GY2A 2HLDD 1P2QA 1TRNA 1BTHH 4CH2B 2GDDA 2Y81A 2GGVB 1BDAA 2ZGBH 4ZXXH 4CHAC 2HPPH 2D2DA 1NT1A 2QCYA 1A3BH 1NS3A 2IPQX 2WPMS 5AF9H 3SQHE 1LHFH 2G4UA 1TA2A 5EOKA 2BDHA 3VPKA 1LHGH 1ZSLA 1GBBA 1EZQA 3AW1A 1YM0A 1FJSA 4A1VA 2GDEH 2FOCA 3RXBA 5DJ7A 3SN8A 1DWBH 2W3IA 2GMTB 4RKOB 1O3JA 2V3OH 4Q7ZA 1NC6A 1DWCH 1GGDC 4D7FA 2VH0A 1ABJH 5JYIA 1DVAH 1HFDA 5T3HA 2UWPA 4CRAA 2GV7A 1FONA 4GPGA 5TJXA 1QZ8A 1KSNA 1GBHA 2GCHG 4JYVH 1PPHE 1LHEH 1D6WA 3FZDA 1V2LT 3B23B 2KCAA 1EUFA 1GHAG 2BZ6H 4X2VA 5FX5A 2V35A 4O3UA 3CP7A 2Y5FA 4R0IA 3EA7A 2R9PA 5GDSH 1Y3WA 1C2IA 1TNJA 1BMFD 2JDID 3L33A 2ZPSA 1O3DA 2BLVA 4BAHB 5C1UA 3M7TA 2A7CA 4RT1A 1F5RA 1T8MA 3JZ1B 1T31A 1W7XH 1GMDF 2OTVA 1C1QA 5HM9A 4Y71A 1KXBA 1O36A 4YT6H 4ACBA 2Z9KA 1F92A 2J98A 2VNTA 1BTUA 4AGJA 1GJCB 3RMOH 2FOEA 2ZKSA 2FXRA 1BITA 1TIOA 2BD4A 2CK3D 3RXJA 3UNSA 1TONA 2AH4X 1MD8A 1VITF 3MWIU 3L6PA 3DSGA 1BUIA 2FYRA 1G36A 1CT2E 2ZPRA 1ID5H 4YM9A 3SUEA 4AZ2B 3SNDA 2VGCB 1FX0B 1C2JA 1ZTLA 4K69A 6CHAC 1C1OA 1C9PA 3RMMH 1O3MA 1GHBF 2WPLS 4JZDH 1TNGA 2WV9A 4ESTE 1YPMH 3MH5A 4ISIH 1QNJA 1RXPA 3TJOA 1TABE 1HB0B 1GL0E 1V2ST 1TAWA 1HXFH 1TX8A 2LP6A 1AI8H 2BXUH 2KCYA 3F0OA 2VJ1A 3T29A 2BZAA 2BLQA 5GCHF 1MQ5A 2Y7XA 1KDQA 3U98H 2EI6A 1GBTA 1T8NA 3KIDU 1XX9A 1SGCA 2Z9JA 1CBWC 1GBLA 1GHYH 1BOQA 2XOKD
chains in the Genus database with same CATH topology
3QUMP 1O3GA 1P04A 8GCHF 3A8AA 1FUJA 2BXTH 4ZKOU 4JZFH 5TCAA 2PUXB 4E06H 1MBMA 2BM2A 1ARCA 1YCPM 2HGTH 2A5KA 2R2MB 1DXPA 1A5IA 1C1TA 4ABDA 2FMJA 1C5LH 2VIWA 1IOEA 1AIXH 1BJUA 2GT8A 2FM2A 2D26C 1S83A 1WSSH 3QWCH 4X1PU 5GIBA 4MPUA 2JKHA 2FOAA 3BG4C 3PTBA 1AUJA 1AMHA 1PYTC 1EPTB 4DURA 4ZMAH 1QGFA 3BSQA 1Z8RA 1P3CA 3M5LA 1XM1A 3Q3XA 1EAXA 3TNTA 3ZVBA 1Z1IA 4AYVB 1V2OT 4IN2A 1A1RA 2CHAC 1PYTD 1WYKA 1TPAE 1NRPH 2ZU1A 3LPRA 4B2CA 2DE9A 5HYOA 2UUYA 4X6MA 3RXLA 1DE7H 1DX5M 1O33A 1C5ZB 2GKVE 3OTJE 1NRSH 1C4Y2 2AS9A 4DGJA 2PWXA 1K1PA 2WV5A 2XW9A 1ZHMA 4OS1A 2GCTB 2ZHWH 4B71A 1BRUP 1QQUA 2C93B 4I32A 6LPRA 1VCQA 2V0BA 5T6GA 3UFAA 2QV1A 3MI4A 2P3TB 3ZZBA 1K2I1 2H9HA 1ELEE 1NN6A 2ZTYA 3OU0A 3O8CA 2AFQB 3QX5H 5ESBA 3RXQA 4NGAH 1DSUA 5I46H 4I31A 1O3BA 1MU8B 5EXLA 3ZYDA 5A09A 4H42U 2EEKA 2OC0A 4A1TA 1WQSA 4GHTA 1FN8A 2SNVA 1OP0A 1BRCE 4A7IB 3RXAA 1LPKB 4Y7AA 4B73A 3UQOA 1C2MA 3FP6E 3D62A 2BX4A 3R3GB 1ETTH 2XWAA 1J17T 2Y7ZA 1EOJA 4H6SB 1GJ7B 1IAUA 1K1OA 4MPWA 1BBRE 1NFUA 5GXPA 2D8WA 1XUIA 1UVSH 1EP5A 2HOBA 4ABHA 3FVFB 1KXEA 1RTKA 1F0TA 4ABBA 2ZGHA 3GY6A 1IQJA 2B9LA 4U30A 1O3IA 8KME2 1H9HE 3D49H 4X1RU 1MZAA 1O3PB 5JBAS 5JBTA 1ZPZA 3A84A 3LIWA 4INKA 1M9UA 3MNBA 1YC0A 1BB0B 1MTNB 3AVZA 3ITIA 3T25A 1IQEA 1Z8JB 2FX4A 3P70B 2PSXA 3TGKE 2XC4A 3LC5A 4X2XA 1OYQA 3T26A 2XCFA 1G3CA 3URDA 1FY1A 1UTOA 1FQ3A 1VCPA 1P9UA 2FIRH 2TGPZ 1P11E 1SR5C 3AAVA 5K7RA 3PYHA 1V3XA 1S6HA 1ZPCA 4E7NA 3SV6A 1HAOH 2ZQ2A 1DANH 1V2JT 2SFAA 1B5GH 1D3QB 1GMDG 2WV4A 4I8GA 2ZCHP 1B7XB 3UOUA 2J38A 2O8WA 3O8DA 1HIAA 2ZA5A 1C2LA 1ZMJA 3ZV9A 1O39A 1HXEH 3RMNH 1VITG 3A7WA 5E2OA 1SGIB 3KGPA 2WPHS 3M35A 3M61U 1G2LA 2ZFTA 1W3CA 2H5CA 2A5IA 1AZ8A 1GHBG 1MUEB 1SGRE 1ZJDA 3MHWU 2PGBB 3M3TA 3DD2H 1GI3A 3VGCB 5DPAA 1TNLA 2BTCE 3SV7A 1QRZA 1BRBE 4JZEH 1FY5A 7LPRA 3ZZ6A 1C5UA 1HAVA 3LGYA 1PFXC 1XXFA 1IQNA 1A0HB 1PJPA 1FAXA 1P09A 5GCHG 1P2IA 1MH0A 4NSVA 1WCZA 1TX6A 3GCTF 1GI7B 1TOMH 3P6ZB 1QB1A 3F9FA 3DT0H 2CXVA 1TFXA 3NPSA 1OKXA 3RDZA 4ZHLU 3TJNA 1ZGIA 1DPOA 3ZZ3A 2QA9E 1NO9H 3C27B 3K9XB 1E0FD 2BQ6B 3RU4D 1RRKA 1WOFA 3P8GA 1QBVH 2RDLA 1UHBB 3QLPH 3LU9B 2ZU2A 5F8TA 1ETSH 2ZPQA 1QJ7B 1P2MA 1UTMA 1F7ZA 2ZTZA 3F6UH 7KMEH 2P94A 1O2OA 1GBEA 1JWTA 1O2SA 1P2JA 1NFWA 3TNSA 1NZQH 3MH7A 4MNVA 3RU4E 3EA9A 2G55A 1TBRH 3BTDE 2Z3CA 2A2XH 4TYDA 5EXNA 5JDUB 4KELA 3RXHA 1AWHB 2VIVA 2WPIS 1GHAF 2P3FH 2OUAA 3AAUA 2C4FH 3GISB 1H1BA 1EB1H 1YYY1 1CE5A 2TBSA 3TITA 3BG8A 3LJOA 2O8TA 1QL8A 3SJOA 5EGMA 3LJJA 1BTXA 3SV8A 2UUFB 1L1NA 3VB6A 4D76A 3RXPA 1LPGB 5CMXH 2Z9GA 6ESTA 1ELFA 1VR1H 1GWAA 1NU9A 4A92A 1TBQH 3TVJB 4NCYA 2F9OA 1DS2E 2WUCA 1C5NH 4X1NU 1XMNB 1TMTH 5E0GA 5HXFA 1Y5BT 3RXKA 3LDXH 1YBWA 2Q6GA 1O3OA 3O8RA 1NTPA 4FUEA 3M3VA 4FUCA 1TALA 3Q00A 5F8XA 2OXSA 2A7HA 2ZC9H 3RUOA 3QN7A 1TNHA 1XVOA 2A1DB 3A83A 4U32A 3PO1B 1TNIA 2C8ZB 4XOJA 1PQAA 3T2NA 1HCGA 1Z6JH 5GWZA 1KXCA 4ABEA 3MNSA 4Y10E 3T62A 1C2HA 1QJ1B 4I8HA 3S7KB 1P01A 3DA9B 2ANKH 1ETRH 3RXEA 2WINI 1EZUC 4KP0A 1J9CH 5DP6A 1ZHRA 2H5DA 3UNRA 2WPKS 1CA8B 3ZVGA 4JCNA 3F9HA 3GCNA 1TRYA 1O0DH 1O2XA 2GMTC 2WYJA 4MNWA 2SGPE 1O3CA 4ZKRU 1N8OB 4I8LA 4INHA 3STJA 2BDCA 2P95A 1SSXA 4X8TH 3RXUA 3FZZA 1TPOA 1ZHPA 2PSYA 1Y5AT 1C5WB 4X0WU 1J14A 4X8VH 2J2UA 2C90B 2ZNKH 5C1XA 1H8IH 1SGPE 1HAHH 2GD4B 1OPHB 2XBYA 2F9BH 2J34A 3MO6A 4I7YH 1AHTH 1C4V2 2ZU5A 1LQEA 4OGXA 5DO4H 2ODQA 2FPZA 4X8SH 3FP7E 4Y7BA 2AGGX 2PLXA 1QY6A 1TGBA 2OCVB 2BDBA 1RTLA 4QT8C 3E16B 2AIPA 4GVUA 3GY4A 2BYAX 5FXLA 1THSH 1J16A 4F49A 1OWIA 1XKBC 2TGDA 1Y8TA 4XE4A 1L2EA 2ZHFH 3BTKE 4Y79A 1WV7H 4XDEA 5C2ZA 5JBBS 1HAPH 3SNEA 5AVDA 1GJDB 3LGIA 2BD5A 1RIWB 1GL1A 1ELBA 2VGCC 3R0FA 4O9VA 2STAE 1EB2A 1HAYB 1EKBB 1V2WT 4RSPA 1MMJN 4NIVA 3Q3YA 1O32A 1TBZH 5FBEA 1WAYB 4UFGH 2QN5T 1BTPA 2D1JA 2QXIA 2W3KA 2A32A 5CHAC 1O2QA 3K2UA 3ATKA 1UCYK 4XFQA 3GDVA 5DP5A 1O31A 1AFEH 1V2RT 4CBNA 1CGJE 3BEFB 1EX3A 4NFEA 2BY5X 1YPJH 2AYWA 1V2PT 3Q3KA 4GCHF 2CJIA 1SGEE 5JB8S 1GBCA 1BQYA 1OWKA 1ZMLA 3MO9A 1IQKA 2EI7A 3LKWA 1TNKA 1GBAA 3GCTG 4NZQA 2Z3EA 4IGDA 2KAIA 1GDQA 5J4SA 2THFB 1O37A 3A7ZA 4BOHA 5BPEA 2A7JA 1W14U 4B2AA 4JYUH 4BAOB 1GDUA 1UTQA 2FOGA 4BXWA 1O3FA 1AKSA 3PB1E 1ZTJA 4XBDA 5ESTE 4BTUB 1KYNA 1IQLA 5T6DA 1EPTC 1ZZZA 1SGQE 1V2UT 3ODFA 1TRMA 4A1XA 4NA8A 1OWHA 2G8TA 3A89A 2P8OB 1GI6A 1SC8U 3A8DA 3TH2H 2IN2A 1KXDA 4CRBA 1KLIH 4NA9H 4NZLA 5L2YH 2DE8A 1KIGH 1CU1A 1T32A 1NM6A 1TMBH 2TRMA 3IWMA 3K6ZA 4Y0YE 2BD3A 5DK1A 2FODA 2F91A 2ZZUH 2ZFSA 2PFEA 1O35A 1Y3UA 3SJKA 5FPYA 2ZFFH 2BY9X 2ZDNA 1KXAA 3VFEA 4O97A 1BHXF 2WPJS 1LPZB 1QB9A 2NU4E 1V6DA 3A7VA 4HFPB 1AFQC 1EQ9A 4WMEA 4ABFA 5L6NH 2Y6TA 3RXIA 1SHYA 1H4WA 3EYDA 3HGPA 4U01A 4WF8A 3GCOA 1IHSH 3C1KA 1OYTH 2OC1A 1SGDE 1C1UH 1EP6A 1GMHG 3EGKH 4AB8A 4DW2U 2HWLB 2FO9A 2Y5GA 1UTJA 2GZ7A 1CT0E 1P02A 5C3NA 1FMGA 1TB6H 5FHTA 4FUFA 2FYQA 1FN6A 3B8JA 2ZWLH 1ELAA 2VH6A 4JZIA 4ISHH 4Z6AH 1P0SH 3SBKA 2ZG0H 2ZDMA 2FLBH 2Q6FA 2G00A 4UD9H 1ELVA 3SNBA 4VGCB 1GCTB 1NFYA 3GDSA 2B0FA 1C5PA 1K1IA 3S9BA 1ZLRA 4RKJB 2XXLA 3GYLB 4ABIA 2GT7A 3ZZAA 1C5RA 1XXDA 4K1EA 4ABJA 4JK6A 3TJUA 1SLVB 4X6OA 3SJ8A 2VVCA 1MCVA 1XKAC 2ZCKP 3KN2A 1UK2A 4BNRA 3M7UA 4UFDH 1RTFB 1FAKH 1O5BB 1AWFH 3SHCH 1PPFE 3TK9A 2ZFRH 3PMBB 1GJ4H 9LPRA 1S0RA 3BTHE 4CRFA 2ZEBA 1AGJA 1W0YH 1WQVH 1F5LA 1HYLA 1QQ4A 2IJOB 4ZXYH 2EI8A 1YPGH 2ZHQH 1QURH 3S7HB 5H4IB 3ZZDA 2I6QA 5A8ZA 4CH8B 3BIVH 1BMAA 2XYAA 2LNCA 4IS5A 2AERH 1DWEH 1ZRKA 2G5NA 3HK3B 1HAIH 1K28D 1QBNA 1FY4A 1NFXA 5A0AE 3V13A 3E90B 1UK4A 4YTAA 1O2GH 3SNCA 1AO5A 3BIUH 4NWKA 1E34B 1TGTA 1VZQH 5DG6A 1INCA 3NWUA 1GBJA 4OGYA 4X2YA 2ALPA 3TPIZ 1F0SA 3F9GA 3WY8A 3LONA 5JB9S 2W7UA 1KDQB 3HATH 1C2FA 3RU4T 3VGCC 1AVGH 3MU1A 3SHAH 3ENSB 3BTEE 1C1WH 1SLXB 5F8ZA 1W7GH 4JMYA 3UIRA 4I8JA 4GCHG 4Y8YA 3T5FH 3RXVA 5EU8A 1C1MA 1G3DA 1KXFA 2HALA 1UJ1A 2ZQ1A 3MNXA 4B2BA 4NSYA 4AORA 1EOLA 2BD2A 4O3TA 4TPYA 2Q1JA 1SI5H 1A2CH 1ELTA 1LVOA 3A7TA 3RXTA 1C2KA 1YPEH 3ZVFA 3V0XA 3E0PB 1XVMA 4WH8A 1BT7A 1V2MT 1NROH 3EBNA 1UCYH 2ALVA 2AGEX 1O2NA 3P17H 1O3NA 2HPQH 2QXHA 1K21H 3STIA 3U8TH 5LPRA 1ZSKA 1JRSA 1Z6EA 1Q2WA 1O3KA 3HPTB 3BV9B 2P59A 3S69A 3E91A 1FPHH 2ODYB 2Y5HA 3PLPA 3SU1A 3ZVCA 1MZDA 3MO3A 4TY6A 1PQ8A 3IITA 1SLUB 2VINA 2FS9A 2CN0H 2GZ8A 3SUGA 1IQGA 1JMOH 5T6FA 2ANMH 1DITH 3EDXB 3OY6U 1QCPA 1YPKH 2VIPA 1JIRA 1TGSZ 1WBGB 3SU4A 1MAYA 3MH6A 1UVUH 3RXCA 1MKXH 1F0UA 1Z7KA 2R0KA 3Q77A 4B76A 1FY8E 1ZPBA 4YLUA 3PMAB 1GVZA 3DFLA 4A5TS 1THPB 4AFQA 3A8CA 1CHGA 1MKWK 3SU6A 3U8OH 1QRWA 4CREA 2QF3A 2QY0B 1SMFE 5A0BA 1CA0B 2CGAA 4ZH8A 1AVWA 1TGNA 3PLKA 1ANEA 2VIOA 3D65E 4MPXA 5PTPA 4D9QA 2OD3B 2W7SA 1W2KH 1PQ7A 1V2KT 3BTQE 3U1IB 1Z8GA 2ZDAH 3M3SA 3ZZ5A 1PPCE 2P3UB 5EPYA 3U1JB 2G5VA 1E38B 1P2KA 3QZRA 3TGIE 1UCYE 3F9EA 4K8YA 4LOYH 1D9IA 1HAXB 2FZZA 1THRH 2CV3A 4AOQA 1DOJA 1BJVA 1GI8B 3CENA 3NCLA 2FI5E 3MH4A 6GCHF 1NESE 1H9IE 1J15A 4ZKSU 3KQDA 2NU0E 5CE1A 3RM0H 2FTMA 1D3TB 3KQBA 5EQQA 3SU3A 4OS6A 4R8TB 1A0LA 4ISLA 1TGCA 5GPIB 2GV6A 1SQTA 1NRQH 1AD8H 3I77A 1N8OC 4IBLH 3KF2A 4X2WA 1HJAB 1LDTT 1RS0A 1K9OE 2H6MA 4CR9A 1VJ9U 3RC4A 1TLDA 1Z8IB 5GJ4B 4AFUA 2GZ9A 1S84A 2A4GA 4B74A 1SFQB 3QGNB 3RXSA 1BIOA 2YOLA 1ESAA 3W95A 3BF6H 3SUFA 2ZP0H 2ASUB 2FX6A 1TPSA 2QIQA 3LGTA 5AFYH 4DCDA 1YCPH 2PUQH 2BD9A 4FUHA 3U69H 3B9FH 2XTTB 1D6RA 5ETXA 1DUAA 1AE5A 4J2YB 3RM2H 1BTYA 4KTUA 5EQRA 9ESTA 4ABGA 1HIAB 2HLCA 2SGEE 4JZ1A 1EATA 5BRRE 2SGQE 1ZYOA 1O3HA 2XRCA 4INLA 1KY9A 2Z9LA 1BRAA 1D3PB 1SVPA 4AG1A 3A7XA 3V3MA 1VJAU 8LPRA 1C2GA 1KTTB 4KKDA 1D4PB 1O3LA 1S81A 1SOZA 2BVRH 1GHZA 2RG3A 3KEEA 3NUMA 1NRNH 1Z1JA 1EZSC 1C5XB 4K5ZA 1BZXE 1FI8A 1IQFA 3GYMA 2Z9IA 4ISOA 4GLYA 1RIWC 1P2OA 1P57B 2QGRA 3ZZ8A 3AASA 1V2TT 2PKAA 2JETB 2TPIZ 1VGCB 1HAVB 1GI5A 1SGTA 4DOQA 3ATMA 2V6NA 5FX6A 4DJZB 5E8EH 4BTTB 1GG6B 3PV4A 3QDZB 4ISNA 2A45B 3U8RH 2PKSB 1V2NT 1YGCH 3FP8E 2AGIX 1W10U 1O2TA 4UEHH 5FPTA 1BMLA 2SGDE 3GDUA 1P03A 2BOKA 2QC2A 1Y59T 4UONA 3NK8A 4BAQB