3F9HA

Crystal structure of the f140a mutant of sars-coronovirus 3c-like protease at ph 7.6
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
299
structure length
299
Chain Sequence
GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two adjacent mutations on the dimer interface of SARS coronavirus 3C-like protease cause different conformational changes in crystal structure.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 77
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3f9hA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9hA02
3GCTF 3BG4B 1HAHH 1QJ7B 1NU9A 1QB6A 1NRSH 2B5TB 4OS1A 2ZIQH 3GICB 3MI4A 4WH6A 1BHXB 3NWUA 5A0BA 4J1YA 2V6NA 1RRKA 1AN1E 1NPMA 3A8BA 2BD7A 3SJ8A 3A83A 4X2YA 1EZUC 4A92A 2WPLS 3QK1A 1EJMA 2XC4A 2ZZUH 3ZVEA 1V2LT 3EA9A 3GDSA 4D8NA 4ISNA 2BD9A 2BOKA 1H9HE 4B73A 2JETB 3K6ZA 3GCNA 3A86A 1O3EA 2GCTB 3RXBA 1JXPA 5GWZA 1OYTH 3QGNB 1A0JA 4KP0A 2ZQ2A 2UWLA 2P59A 1LKAA 1O0DH 3NPSA 3Q3XA 3MH5A 2QGRA 1MKWK 1O39A 4OGXA 1ANEA 4JK6A 1C5WB 2H1UA 3RXPA 3KCGH 1KDQA 2H9HA 5T3HA 1C5NH 4ESTE 5FHTA 2A5AA 1Z6JH 4K3JA 2G00A 4IN2A 1MTNB 3RM0H 3UR9A 4DURA 2VB0A 3TGJE 1GI6A 1GI9B 1OWKA 1DWDH 3RXKA 4H4FA 4NIWA 1D4PB 4MQAA 3M3TA 4BAHB 4CHAC 2GZ8A 1P57B 1DM4B 1O2RA 2FO9A 2BD3A 3Q00A 1EXFA 3M7TA 1P8VC 3MU5A 3RXFA 2NU2E 3A7ZA 4XDEA 2R2WU 4X6NA 1LHFH 1GBDA 1MTSA 1Z8RA 2P3TB 1TA6A 2WV4A 4A6LA 3UQOA 3T25A 3R3GB 1IAUA 3F9GA 1S85A 1SGNE 4BAQB 1KLTA 4GHTA 1MZAA 1BBRK 1TOMH 4FUCA 1V2OT 1CGJE 4B1TA 1AKSA 1LHCH 2QXIA 1RFNA 1F0TA 2ALPA 1AB9B 4ZMAH 4WF8A 1ESAA 1TRNA 1W7XH 3B9FH 2BD4A 5IDKA 5SGAE 2EA3A 4NA9H 2AMQA 1F2SE 7ESTE 2BY7X 1SLWB 2Q1JA 1MBMA 4MTBA 1Z8GA 2O8TA 1BRCE 3K2UA 3UREA 1AU8A 1UTQA 1SFQB 6LPRA 3PO1B 1Z8IB 4K2YA 1VITF 1GJAB 2QY0B 4NGAH 1HAXB 4HI3A 4CRGA 3A7WA 1G3EA 3E16B 2W26A 2FLRH 1VGCB 1AMHA 2HRVA 2P8OB 1K22H 1Y5AT 1AFQC 2V3HH 1YPMH 2TGTA 2Y81A 5L30H 2ZGJA 3SGBE 4AGJA 3GDUA 1QL7A 1HXEH 1GDQA 2BVSH 1C1QA 1ELBA 3KN2A 1LKBA 2FM2A 4Q7XA 2PSYA 4ABDA 2RDLA 3OTJE 4IBLH 2J2UA 1IQGA 1BMMH 3GCTG 3TK5A 1W11U 3UNSA 4CBOA 2C3SA 1C5TA 2FLBH 3OSYA 2W3KA 3PV4A 2PR3A 1K1IA 5LPRA 5FPTA 1D3DB 4BAOB 1XUGA 2SGEE 4INKA 1GHAF 2C4FH 1FAXA 5DK1A 3GY8A 5FPSA 2HOBA 1OP8A 3V0XA 1UCYH 1V2PT 3MHWU 4U2WA 2GT8A 4Y0ZE 3T27A 1UVSH 1C5XB 2ZDKA 1SGRE 3RC6A 1F5LA 1VR1H 1E37B 1PPBH 1HXFH 5CHAB 1CT2E 1HDTH 1UO6A 2KAIB 3DD2H 1LVYA 1EZSC 2Y7XA 1TNHA 2FZZA 1PYTC 1O2SA 2GT7A 1GBKA 3W95A 1XX9A 2BX3A 3FAOA 2G5VA 1GJ7B 3SUFA 3FZZA 3RXSA 3SI3H 1GMHF 2J94A 2BVRH 3FZDA 1V3XA 3RXEA 1YBWA 1YPEH 5DG6A 3F68H 1ZHMA 1VITH 5LGOA 4AB9A 3SU6A 1DY9A 1DS2E 3ZZCA 3DFLA 1VJAU 1GBAA 4BNRA 2HGTH 1TOCB 3NUMA 1GI1A 1GJDB 1HIAB 2XRCA 8LPRA 1CT0E 4Y8YA 4SGAE 1CE5A 1G3CA 5TJXA 2AGEX 5E0GA 1GHBG 3SUGA 3NKKA 3M7QA 3HATH 3SV8A 4BXWA 4X2VA 1Y8TA 4YM9A 1HIAA 1SGCA 3BTHE 1MKXH 1GJ5H 1CA8B 1FN6A 1O3CA 2FYQA 4H6TA 3TH2H 1FNIA 3VPKA 3BIVH 3HPTB 4I8LA 1GJ8B 4ABEA 1S84A 1HAIH 1SG8B 3SI4H 3SW2B 2W5EA 3MU8A 4X8UH 4WMEA 3JZ2B 2A4QA 2VIVA 8GCHG 2O9QA 5JB8S 5EG4A 1QA7A 2GCHF 2OBOA 5T6FA 1TGTA 2Q6FA 2A5KA 1ID5H 3ZV9A 2Z6BD 3F1SB 3PWBA 2ZP0H 1T7CA 1T32A 1UTJA 4DY7B 3M61U 1ETSH 1Y5UT 1KTTB 1ESBA 1RS0A 3C1KA 2VIQA 4X8VH 2GDEH 5A2MH 1HAGE 5E0HA 3TJUA 4B74A 1ZTLA 1IQEA 2R3YA 1XM1A 2ZHEH 1QFKH 2P16A 4MNVA 5T6GA 3W94A 3E1XB 3U8RH 3A8DA 3ELAH 3GYLB 3LC5A 3QO6A 2P8OC 2DE9A 3DFJA 1C2GA 4UFDH 3P8NA 1GBCA 3HGNA 3UNRA 2GGVB 3I77A 1QL8A 4XSKU 5L2YH 1SMFE 1N1LA 3GISB 3VFEA 4Y6DA 1Y5BT 2NWNA 3PO1C 1H8DH 4Y7AA 3TNSA 3SGAE 4D7GA 4BAMB 1Z71A 1ZOMA 2G5NA 1T4VH 1AFEH 2EI6A 2UUJB 1O2LA 2ZU2A 1P09A 2FI3E 1QRXA 4JZFH 3U9AH 4AG2A 2AMDA 2LPRA 1EZQA 1SI5H 2UUFB 2BQ7B 3A85A 2OLGA 1BIOA 3M5OA 3NCLA 3FANA 2NU1E 4IGDA 4GLYA 2J9NA 2ZTZA 2BOHB 1P0SH 3E0PB 1EPTB 1E0FD 3MFJA 3SU2A 1SQAA 1WOFA 3ZZ3A 3G01A 5HMAA 4YOGA 1IHTH 3MOCA 4GCHG 1G37A 3F6UH 1ZSKA 1EAIA 5ETXA 5JBTA 5DPAA 2QXJA 1V6DA 5I46H 1DLEA 2J95A 3T28A 3IWMA 3SORA 5CE1A 2QN5T 1AGJA 1YCPK 5A0CA 2B7DH 1OSSA 1YPJH 5DP7A 2AH4X 2B9LA 1YKTA 4U30A 3BTQE 6CHAC 3KGPA 5EQSA 1ZRBA 4XBBA 1O2PA 4A7IB 3QWCH 2P93A 1OXGA 2XTTB 3PWCA 1H1BA 4FUJA 1ZPZA 1P9SA 3MNBA 2FODA 5T6DA 1GI8B 1XUFA 1ARBA 2HNTC 2BY5X 2G4UA 1TX6A 2VIPA 3LOXA 1BOQA 3U8OH 1Z6EA 2ZECA 2AFQB 3DA9B 1KYNA 1S6HA 3ATLA 1EZXC 3U98H 2GZ7A 1DITH 4UEHH 3M3SA 5HM2A 5GPIB 3NXPA 1A2CH 1O38A 2FOBA 4WXIA 2OINA 4CR5A 1ELDE 4I8JA 1GVZA 3QGJA 3A84A 1DANH 1J9CH 2V3OH 4LZ1H 5GIBA 1AZ8A 2GKVE 4TWYA 3T62A 4FUEA 1G3BA 1F0UA 1O36A 4FU8A 2BMGB 1EUFA 2GV7A 1Y3WA 1G9IE 5DP6A 1GJCB 1GL1A 2TGPZ 3ATIA 1EOLA 4WWYA 1K1LA 3ZYEA 2ZKSA 2WPHS 4INHA 2SNWA 4KKDA 5JB9S 4O3TA 3ZZBA 1GMDG 3M35A 1LVOA 1LVBA 1FXYA 2FX6A 4XBCA 4CBNA 1GI4A 2F9BH 2UWOA 1EJAA 1BBRE 3D49H 2CN0H 5AFYH 5F8ZA 1LHDH 2VU8E 1C1PA 1ZMNA 1QGFA 1FY8E 1F0RA 1IHSH 3DT0H 1NC6A 3VEQB 3MTYA 1WSSH 5AVDA 2C90B 3MNXA 1T8MA 2ZDVH 1TPSA 2CXVA 2KAIA 1G30B 3EDXB 1ZTKA 1XKAC 2JH6D 1SGQE 3AAUA 2K7XA 1DE7H 1FY4A 3ATMA 2JH0D 3DHKH 2Z3CA 2ODPA 3F9EA 3RXDA 2AEIH 3QN7A 5FCRA 2GCTC 4ZHAA 1CA0C 1J15A 1GBBA 3H7OA 1FIWA 1W12U 1Z7KA 5EPNA 4X6MA 4TWWA 1C5RA 1FY3A 4ISLA 1XVMA 1BTUA 2BB4A 2FDAA 1V2VT 3BG8A 4JZEH 3ZZ7A 5B6OA 4OS7A 4NSYA 2FOCA 6ESTA 4OS5A 1TB6H 1DPOA 1A3EH 1Z1IA 4YOJA 1ZTJA 2HPPH 2BY9X 3SUDA 1DUEA 2P95A 4FUGA 3SJOA 2TIOA 3MO9A 2VIOA 1K1JA 2QXGA 2J4IA 3ZV8A 1LHGH 4Y0YE 2ILNA 4Y8XA 4JZDH 2G4TA 2ZWLH 2FI5E 4YLQH 3VB7A 2J38A 2Z7FE 5FX5A 3IG6B 1O5FH 2GDDA 1O5DH 1V2ST 2LIZA 3SV7A 3LGYA 4A5TS 5CHAC 1NM6A 3BTWE 7GCHF 3AW1A 1UTKA 4DIIH 1RXPA 1YPGH 1K28D 2XXLA 2EEKA 4FXGH 2A45B 1ELFA 1PPEE 2FYRA 4AFUA 5E2PA 1ELEE 1O34A 1GL0E 1VCQA 2I6SA 3P6ZB 1K1MA 5GJ4B 2IPHA 1DICA 3ZVDA 3TJVA 1CQQA 1NO9H 1LO6A 3ZYDA 2AIQA 1IQHA 5JBAS 1ETRH 1P2OA 2WPJS 1C5PA 3SV6A 1WQVH 2FIRH 3SN8A 2HNTE 1OWJA 2R9PA 1FUJA 2WPIS 1XUIA 1XUHA 1JWTA 1O2NA 4BOHA 1S5SA 1CBWB 3SJIA 2J92A 3TVJB 1WQSA 3RLWH 1GJBB 1O2KA 1AO5A 1UK4A 1W13U 2BDBA 2GTBA 2VWOA 1U6QA 1RD3B 2ZPQA 2FX4A 3SUEA 1EAXA 1TQ7B 1A1RA 1YM0A 1ESTA 3VB4A 1L4DA 1OP2A 1Q31A 4GPGA 2QF3A 4TYDA 1WAYB 1O3IA 4X2XA 1ACBE 1ZHRA 5GDSH 1OWDA 1T31A 2OC0A 1MQ6A 3I78A 1O3HA 3TH4H 1AWFH 1MU6B 3M36A 4ZKOU 1S83A 1GBEA 1HV7A 3QDZB 1B0EA 1VCPA 4INLA 4I32A 1V2NT 1TGSZ 1UTOA 1BTPA 1L1GA 3PMJA 4YZUA 1TALA 1OWIA 2D8WA 1LQDB 3LH3A 1W10U 3E6PH 1TX8A 3A89A 1LPGB 1C2HA 1CBWC 1ZMLA 2PUXB 2Z3DA 5TCAA 3BTEE 3CENA 2EC9H 1BRAA 2AGGX 1BBRH 1TABE 2PSXA 2ZHWH 3MNCA 1N6YA 1GBFA 3T26A 4ABGA 5GCHG 1ELTA 1DSTA 1YPLH 2SGDE 2CHAB 2H5DA 4E7NA 4ABHA 4HZHA 3GY2A 5C3NA 1YLDA 1CO7E 3PTBA 4J2YB 1TNKA 3RP2A 4ASHA 2OQUA 1IOEA 3S7KB 3HKJB 1AUTC 3T2NA 1YYY1 1DX5M 3TJOA 2XBWA 1TNGA 1H4WA 1TPOA 1AD8H 1ZPBA 1C1VH 3UOPA 3KHVA 2Q6GA 4X8SH 5FAHA 1DOJA 3E0NB 3PLPA 3UNQA 4I8KA 1Y3UA 3QX5H 2OCVB 4NSVA 1O2YA 1V2KT 1TRMA 2SGQE 3LU9B 5EQQA 1GVLA 3KL6A 1P2MA 1HGTH 2FESH 1BMNH 1PYTD 1ZPCA 1F0SA 1C1NA 1TNLA 1BZXE 1Y3YA 5EOKA 1GJ6A 3EYDA 2QYIA 3LC3A 2H9EH 1GWAA 3UY9A 1PQAA 3MWIU 2IJOB 2VWLA 1QY6A 3LPRA 1KY9A 1C2FA 2LNCA 1GMCF 2ZGCA 1ZRKA 4Z0KA 1WTGH 3S9AA 1C5ZB 4E05H 2BDIA 2QF0A 2VNTA 1BDAA 3A7TA 1MU8B 3A88A 1OX1A 1UHBA 4HGCA 3UWIA 3QLPH 1GHWH 4JYTA 4I31A 1ORFA 1O5CB 1EQ9A 6GCHF 5EPYA 2ZO3H 1MAYA 1O2ZA 1A61H 1SQOA 1TE0A 1G2MA 1LDTT 4I8HA 1GI3A 3EBNA 5A8YA 4MPWA 3D62A 1O30A 5LPEA 1O5EH 2RA0A 1ABIH 1A0HB 1DDJA 4Y8ZA 3RXRA 1NRQH 1BTWA 2CV3A 3HKIB 2R0LA 1IQLA 3Q76A 4TY6A 3TK9A 1RIWB 1YCPH 3DUXH 2BY8X 4D76A 3T29A 1SGFA 2BD8A 2BD2A 1UK3A 3M5LA 2ZEBA 1P04A 4JYUH 4K8YA 1WBGB 1N8OB 3MU1A 1FY1A 2BDYA 1DFPA 2ZDMA 2F3CE 1MAXA 2F83A 3MU4A 4KTUA 3LT3A 5G4BA 2G8TA 1GCTB 2GP9B 3SU0A 5FCKA 4D7FA 1C5YB 1GBLA 1HLTH 3CP7A 3RMOH 4ABIA 4BTUB 2ZDLA 2A4RA 1S81A 1NFUA 1O3GA 2FWWA 4ZKRU 1UVTH 1C4V2 1YPHE 1V2WT 2ANKH 1L4ZA 3UFAA 2FOAA 1AUJA 4K8BA 3AVZA 2GV6A 2BDGA 5DGJA 1HJAB 1VGCC 5F8TA 3SJKA 2A0QB 2AIPA 1SGEE 2ODYB 5F8XA 2F9NA 1DUAA 1AFQB 5FBEA 3RXTA 1D3PB 1JIMA 1KXDA 3B23B 1D6WA 2RG3A 1DY8A 9LPRA 2QCYA 4KELA 1DT2A 1MD8A 1PQ7A 4HTCH 1WYKA 1CGHA 4IMZA 3BSQA 4QT8C 6CHAB 1O2OA 1QTFA 2DE8A 4DW2U 5DP3A 1HAPH 1FI8A 1GDUA 2CF9H 2PHBA 1O2XA 2SGAA 3EAJA 2XCNA 2UUKB 4FU9A 1O3JA 2V35A 2VWNA 2B0FA 1ZSLA 3M5NA 3V7TA 1QBOA 2AGIX 2HWLB 4DIHH 3TK6A 1KDQB 5EGMA 5AF9H 5HM9A 1E36B 4E06H 4DOQA 1CHOF 3VGCC 1NU7B 1UVUH 3TPIZ 1OPHB 4ZKNU 5FPYA 1UK2A 1AIXH 3LGUA 1G32B 2Z9KA 3LJJA 1X7AC 3ZZ6A 5JDUB 2H9TH 1BTHH 2K1QA 1W3CA 2HLCA 1YCPM 4RKJB 3RMMH 2P94A 4GUXA 2ALVA 3O8RA 4O3UA 4JCNA 4ZXXH 2BD5A 1O2QA 2CF8H 1GBHA 1QRWA 1BHXF 2ZDAH 1C1SA 4Y10E 2ESTE 1ZGIA 5EXMA 3SQEE 1GBTA 3KNXA 2Z9JA 1QIXB 1CHGA 2FOEA 4JZ1A 4NWLA 4I8GA 5BRRE 2EI7A 3SO3A 1GI0A 3MH4A 1A5HA 3GY5A 2ZPRA 2A5IA 2O8WA 1V2JT 1WUNH 4LZ4B 4H42U 4KTSA 1O3PB 1UMAH 2OBQA 2TPIZ 3A87A 4AG1A 1AWHB 1FLEE 3SU5A 2BLOA 1BJVA 1NRPH 3C27B 4H6SB 1INCA 1GGDC 2W7UA 1C4U2 3B8JA 1C5LH 1UCYE 3ODFA 4BTIB 4ZHLU 1SLXB 3ZZAA 2FI4E 1TFXA 2PW8H 8ESTE 4M7GA 1O3LA 1NTPA 3SV9A 5E2OA 2ZGXH 1O35A 4GAWA 1LTOA 3RC4A 4X0WU 3GCOA 1TAWA 3S69A 4F49A 1ETTH 4NWKA 3RXOA 1TNJA 1FJSA 1MH0A 2BLVA 1GG6B 2TGAA 1GDNA 3FP6E 3PB1E 4YESB 5DP8A 1C1UH 3E91A 4OS4A 8KME2 4ZXYH 1IQJA 1MBQA 1QBNA 1GCTC 1HNEE 2D1JA 3D65E 2ASUB 3GCHB 1GHVH 1S0QA 1QR3E 2J34A 1EP6A 8GCHF 3O8CA 1ANBA 3RXGA 3TITA 1HJ9A 1O2HA 5C1YA 1C9PA 4KGAA 1C1RA 1SLVB 2ZTYA 1GHBF 3JZ1B 2F9OA 1GMHG 1DSUA 4WVPE 4AX9H 1N8OC 2FTLE 3MO6A 3L33A 2CHAC 1WCZA 1FPHH 3M3VA 4CH2B 3UWJH 1S6FA 4CREA 3LGWA 3RLYH 4D9RA 5A8XA 1C1TA 1O3NA 1W14U 2SNVA 4FUIA 2PKSB 2BZ6H 3OY5U 3PLKA 1ZJDA 3RXAA 3HK6B 5DP4A 1CHOG 1MTWA 1P10A 1XMNB 1BMAA 2A2QH 1BQYA 3ZVGA 5DP9A 4GVUA 3FP8E 3LIWA 2GD4B 3AASA 1BRUP 4X1NU 3TU7H 4AN7A 1G3DA 1BT7A 1D6RA 1UHBB 1GG6C 1XKBC 1K1OA 1YLCA 3K6YA 2G81E 2W3IA 1GPZA 3P8FA 1SSXA 2VIWA 4X1SU 3ZVAA 3UQVA 5HGGA 1N6XA 2Z94A 4NFFA 7GCHG 2BM2A 1SOZA 1C2DA 1P2IA 1QBVH 4WJG2 1YPHC 3KF2A 5I25A 2P3UB 4AYVB 3RC5A 4RSPA 1JIRA 1EPTC 2BVXH 1D3TB 5ESBA 2BY6X 4HFPB 2Y80A 2GCHG 1C9TA 1O5GH 2XBYA 2ZNKH 1Y3VA 2FS8A 4Q2KA 3SU1A 4K1EA 4ABAA 5HXFA 2ZQ1A 2AS9A 4LK4A 4FU7A 2C8YB 2VGCB 3RUOA 4IC6A 3BF6H 1HCGA 1RTFB 1C5VA 3A80A 3TGIE 2HNTF 2VWMA 2FPZA 3AW0A 1YC0A 2A7JA 4O9VA 1YP9A 2A2XH 1G2LA 3EA7A 1TMTH 1HJ8A 1C1OA 1HAVA 5GCHF 3GY4A 4XBDA 1AI8H 3F9HA 5F6MA 1KLJH 4DG4A 4SGBE 3K9XB 3MU0A 1PFXC 1DWCH 3S7HB 2Q6DA 1LMWB 1JBUH 3RXHA 1EATA 1SGIB 3NZIA 2D26C 2ZHQH 1GVKB 5EQRA 1UJ1A 2XBXA 1GGDB 3A8CA 1MD7A 1V2QT 2ZHDA 1LQEA 3BTDE 3E3TA 1UVPA 1NROH 2QXHA 4NFEA 1JRSA 2BX4A 1MTNC 3SZNA 2VIDA 4K5ZA 3P95A 1E35B 4YTAA 1A5GH 1SHHB 4IMQA 1O3KA 2NU0E 4CRBA 1ARCA 1B0FA 4CHAB 3LKWA 2ZHFH 2BXUH 2G55A 3NK8A 4X8TH 4FUDA 1DWEH 1T8LA 2BQ6B 3KQEA 2QIQA 3ZVFA 2CMYA 3SV2H 4BANB 2OQ5A 5A0AE 1F92A 3OY6U 4CRDA 1C5QA 1SL3A 1DWBH 3STJA 1TMUH 1ZZZA 1LHEH 2JETC 4ABJA 2CGAA 2ZU1A 2A31A 1AVWA 2Z9LA 5K7RA 1FQ3A 1NZQH 3EE0B 1O2IA 1CGIE 4CRFA 2O8UA 2VINA 2XW9A 3E8LA 1QNJA 1C5OH 4YO9A 5TCCA 3TLOA 4Y11E 1O5BB 4LOYH 4RN6A 2ZU5A 1J8AA 3RXQA 1OS8A 4UD9H 3D23A 3PROA 3R0FA 3MH7A 1MQ5A 3MMGA 4R8TB 5C2ZA 1XXDA 1QRZA 3QTVH 2PGBB 2JKHA 4UE7H 3URCA 1HRTH 2D2DA 4IS5A 1KXAA 1MUEB 1PQ5A 5ESTE 1O2WA 1EB2A 1PPFE 3BIUH 3SU4A 1K2I1 1SGPE 2BTCE 1UVOA 3ITIA 2PKAB 3ZZDA 4JMYA 4K1SA 2PGQB 2ODQA 2XWAA 2XWBI 4ISIH 2OD3B 1P3EA 3BTME 3RU4E 2BHGA 1KXBA 2FOMB 1ZSJA 7LPRA 3M5MA 3U1JB 3GY3A 3OU0A 1KSNA 4AFQA 1NY22 3VXFH 1P2QA 4TY7A 2F9UA 2ZFTA 1XXFA 2YNBA 1Q2WA 2NU3E 3BTKE 1ABJH 4MPXA 1MMJN 2W7SA 4B2AA 1P02A 4DJZB 2Y5HA 3MO3A 3OYPA 1C2IA 3VGCB 3SBKA 2F9PA 4WXVA 3SNEA 2YOLA 4NA7A 3LGVA 4ISHH 4OS2A 5C67A 2Y5FA 1THRH 3BEFB 3I29A 1C2LA 1JMOH 2SGPE 2YNAA 1RGQA 1O33A 4MG3A 3L6PA 2PWXA 3V12A 1BRBE 3TH3H 1SHYA 1EJNA 2VGCC 2IOTA 2B8OH 1H9LB 1O2UA 1NRRH 1OWHA 1GJ4H 1SOTA 1KXEA 1QB9A 1A4WH 2NU4E 2PFEA 2AERH 1BTXA 1OKXA 2A7HA 1HUTH 3A82A 3VB3A 3VB6A 1TLDA 2A32A 3UR6A 1ANDA 1K9OE 3SNAA 1TPAE 4BAKB 2BDCA 2FEQH 2SGFE 3PLBA 2XC0A 1A46H 1VITG 4ZUHA 1IQFA 2WPMS 5DO4H 1L2EA 3A7VA 2ZCHP 3RXJA 4B75A 2C8XB 2WPKS 1BA8B 2ZA5A 4NA8A 7KMEH 5L2ZH 3AAVA 4O03A 1C1WH 5EXLA 1HB0B 2ANWA 5C20A 1LPZB 3GCHC 3U8TH 2Z3EA 4K69A 5J4SA 1ANCA 1TIOA 5EW1H 1ZMJA 4BXSA 5EU8A 1ZYOA 2BQWB 4MDSA 3VB5A 4NG9H 3RXCA 2UUYA 1O31A 1PJPA 1NESE 5EXNA 3PMBB 1TNIA 9ESTA 5FX6A 5E8EH 1O2GH 2WYJA 1ELCA 3FVFB 1L1JA 2OC7A 2XNIA 2GZ9A 1THSH 4K1TA 3UOUA 1K1NA 4JYVH 2ZC9H 2BLWA 1O2TA 2GMTC 1ZGVA 2ZDNA 1OYQA 4VGCC 4ABFA 1A3BH 2VH6A 5FBIA 1BCUH 1P05A 1VZQH 2DUCA 3EA8A 1TWXB 2F9VA 1TQ0B 3U1IB 5A8ZA 1EASA 3SJ9A 2ZFFH 1SC8U 1L0ZA 1AB9C 1HAYB 1BTYA 2WUBA 5H4IB 1YF4A 1XUJA 1T4UH 4XE4A 2ZG0H 4A1TA 3HGPA 1H9IE 4WH8A 5DJ7A 1MCVA 3ZZ9A 1OP0A 1HAZB 1LPKB 5F03A 2V0BA 1G36A 1C5UA 3RXLA 2VH0A 2ANYA 3TIUA 3SHAH 4ZHMU 2WINI 1GMDF 3BTTE 1L1NA 2THFB 3CS7A 1NT1A 4MPVA 3TGKE 4ZKSU 1IQNA 2FOGA 1XVOA 1JRTA 4Y71A 2O8MA 5AHGH 5HYOA 1BUIA 1TGNA 1P3CA 3P17H 1MKWH 1D9IA 1GBMA 3PTNA 3SHCH 3TNTA 1FIZA 1GHXH 4NIYA 1KTSB 3LJOA 2ZFSA 1SFIA 1T8NA 5C5NA 5LPFA 3S9CA 2WYGA 3RXVA 1WTHD 4GSOA 3QZRA 1JOUB 2WV5A 2ZFRH 4YLUA 2Z9GA 1S0RA 2QA9E 1SR5C 2WUCA 1K1PA 3A7YA 4YT7H 4WY3A 2STBE 1THPB 1M9UA 4UFGH 1SGFG 4U01A 1AHTH 4AB8A 1EP5A 2ZU3A 2H5CA 1Z8JB 3A7XA 3MYWA 4Y7BA 1GHZA 1AY6H 4IC5A 3RXIA 3RU4T 1J17T 2STAE 1FV9A 1Y59T 2ZPSA 2OC1A 5AFZH 1DVAH 4NCYA 3TJNA 3ODDA 4NZQA 1C5SA 2ULLA 3K65B 2OTVA 3ZZ5A 1P11E 4ZROA 1PQ8A 1CA0B 4B71A 2ZI2H 1SGTA 5IYTA 1FZZA 2VVUA 3KQCA 4JK5A 3URDA 1TX7A 1TBQH 2H2ZA 2QAAA 1C4Y2 1O2VA 4DGJA 1P2KA 2PKAA 2QC2A 5C5OA 1W7GH 2ZCKP 3OX7U 1EPTA 1NFYA 1HFDA 3WY8A 4IN1A 5JYIA 1CSOE 1H8IH 2O8LA 3QTOH 2Y7ZA 3P8GA 1RTLA 1MTUA 2C93B 2M5TA 2RA3A 3BTFE 3GOVB 3ATWA 2G52A 2FXRA 1QJ1B 1KXFA 2BLQA 4MNXA 1KIGH 3PM3A 3BTGE 1NN6A 3V3MA 1QJ6B 3ZZ4A 4ISOA 4U32A 3SOSA 3GY7A 1C2MA 3O8BA 1UTNA 1YPKH 3BEUA 3O8DA 3SGQE 1W0ZU 1LVMA 3Q3KA 3UIRA 2VVCA 1E38B 1OOKB 3T5FH 4Y79A 1ELGA 1HAOH 1ZR0A 4ZAEA 1UTMA 3SNCA 2BZAA 4X6PA 1V2TT 4UFEH 1C5MD 2A1DB 2HALA 2G51A 2BDAA 1J16A 4IW4E 2JH5D 4I33A 2OP9A 2GMTB 5L6NH 1QCPA 5DP5A 2FS9A 4X1RU 4ZH8A 3VXEH 1MZDA 1EB1H 1SQTA 1PPCE 3P70B 1BMLA 1NFWA 1DLKB 5PTPA 1NS3A 4AOQA 3L3TA 3RXMA 2OUAA 3QZQA 2VVVA 1UTLM 1T8OA 1UTPA 1GHYH 3EGKH 1EKBB 1W8BH 3FFGA 3BV9B 4UDWH 4F4OC 1Q3XA 1OWEA 3IITA 4E7RG 4FVBA 1EX3A 4JZIA 1QB1A 1O3MA 4Q80A 3ENSB 1E34B 1O3FA 2FOFA 5FXLA 5BPEA 1SBWA 2R3UA 1AE5A 3ATKA 1RTKA 4X6OA 3F9FA 3LGIA 1P03A 2A4GA 4D9QA 1B5GH 1TPPA 1HPGA 1GHAG 3BN9A 2ZGHA 3RXUA 1P2JA 2H6MA 1AQ7A 3KQDA 3PMAB 1FAKH 2Y82A 1CU1A 2ZTXA 4FUFA 3M37A 4MPUA 4O97A 2PLXA 1QQ4A 2ZGBH 1VJ9U 1IQIA 1WU1A 1PPGE 5EW2H 1DXWA 1A0LA 2OC8A 1HBTH 2Z9IA 4UONA 2FMJA 1AZZA 1K21H 4NIVA 3STIA 1F5KU 2BDHA 4R0IA 1PPHE 4GCHF 2F91A 2R2MB 1LCYA 2TRMA 4MVNA 3M7UA 3SNDA 1RJXB 3FP7E 3BG4C 3GDVA 2BXTH 3RM2H 3UUZA 1BB0B 1GBIA 3S9BA 1FN8A 2A7CA 3MNSA 4X1PU 1ELVA 1AKSB 5EODA 1KLIH 2ZU4A 1MKXK 3BEIB 1C2JA 2CJIA 3P92A 4XFQA 1A5IA 1VCWA 4X2WA 1Z1JA 4AYYB 1NFXA 5GXPA 1V2MT 1FY5A 1P2NA 4K60A 2AMPA 1C1MA 1TA2A 1EAUA 4A1XA 3U69H 1TYNA 1ELAA 3RDZA 1D3QB 4TPIZ 3LGTA 1HAVB 3PMHB 1GBJA 4FVDA 4AGKA 5JPMH 3MH6A 1XUKA 3RMLH 3SQHE 2QV1A 1SPJA 4AORA 4CR9A 5E0JA 1QURH 1SLUB 2PTCE 4CRCA 4DT7B 1GI5A 1SGDE 1SGYE 5DKMA 4I7YH 1S82A 2SFAA 2GVFA 4AFSA 1C2EA 1TONA 4GHQA 1HYLA 2PV9B 4OGYA 4UFFH 4TPYA 4Q7ZA 1J14A 5ABWA 1TBRH 3V13A 4RKOB 1NRNH 1O37A 4FUHA 1Y3XA 4ABBA 6GCHG 1GI2A 3CS0A 2XYAA 1TRYA 4XOJA 5C1XA 1GJ9B 5JBCS 1UCYK 4MNWA 3GYMA 1O3BA 1AE8H 4NZLA 2ZFQH 1BITA 1PPZA 5LH8A 1O2MA 2FP7B 1F7ZA 1F5RA 2XC5A 2PKSC 1TGCA 1FMGA 3KEEA 2FOHA 1SB1H 5J4QA 1AVXA 1V2UT 3KQBA 2XCFA 4Y76A 4NIXA 1O5AB 4CRAA 3UTUH 3ZVCA 3KIDU 1TGBA 3LH1A 3RMNH 4X1QU 4LXBH 4Z6AH 2PUQH 1RIWC 1WV7H 3LONA 4AZ2B 4BTTB 2AYWA 1GI7B 5JBBS 1FDPA 3E90B 3GY6A 3SU3A 3UPEA 1V2RT 2A4OA 1TBZH 4CH8B 5K0HA 3Q77A 2BYAX 2PTNA 3H5CB 1AVGH 1ZHPA 2EI8A 4OS6A 3LDXH 1SVPA 2IN2A 3RU4D 1MTVA 2RCEA 2HVXA 3HK3B 4WMFA 1QHRB 2TBSA 4YOIA 1CT4E 4PROA 1GMCG 2XBVA 1P06A 2R0KA 4THNH 3SNBA 4YT6H 2FTMA 1KXCA 4MNYA 1A7SA 1ZLRA 2P3FH 1CVWH 1FPCH 3P8OA 4Q7YA 4DVAU 3A81A 1B7XB 1IQMA 2Y5GA 2Y6TA 1O3OA 2VJ1A 1IQKA 2UWPA 1BJUA 2ZF0H 4DCDA 1ZJKA 1BTZA 1P12E 2HPQH 2ZCLP 4WMDA 3N7OA 1O2JA 5C1UA 1QL9A 2GX4A 3QUMP 4KTCA 1YGCH 1FONA 2ZFPH 4B76A 1C2KA 1HJAC 1P01A 3PYHA 1QQUA 1EAWA 2C8WB 3ZVBA 1EOJA 4A1VA 1QA0A 3ESTA 1O3DA 4MLFB 3EQ0H 3Q3YA 3S0NA 1W2KH 2TGDA 2OXSA 1MCTA 5CMXH 1DXPA 5A09A 1GCDA 2ANMH 3A8AA 3H7TA 4B2CA 4B2BA 2I6QA 1P9UA 4FUBA 3ZZ8A 2C8ZB 4VGCB 1O3AA 4AFZA 1O32A 1TMBH 1W0YH
chains in the Genus database with same CATH superfamily
3GCTF 3BG4B 1HAHH 1QJ7B 1NU9A 1QB6A 3F3BA 1NRSH 2B5TB 4OS1A 2ZIQH 3GICB 3MI4A 4WH6A 1BHXB 3NWUA 5A0BA 4J1YA 2V6NA 1RRKA 1AN1E 1NPMA 3A8BA 2BD7A 3SJ8A 3A83A 4X2YA 1EZUC 4A92A 4B6EA 2WPLS 3QK1A 1EJMA 2XC4A 2ZZUH 3ZVEA 1V2LT 3EA9A 3GDSA 4D8NA 4ISNA 2BD9A 2BOKA 1H9HE 3F0PA 4B73A 2JETB 3K6ZA 3GCNA 3A86A 1O3EA 2GCTB 3RXBA 1JXPA 5GWZA 1OYTH 3QGNB 1A0JA 4KP0A 2ZQ2A 2UWLA 2P59A 4Z1MD 1OHHD 1LKAA 1O0DH 3NPSA 3Q3XA 3MH5A 2QGRA 1MKWK 1O39A 4OGXA 1ANEA 4JK6A 1C5WB 2H1UA 3RXPA 3KCGH 1KDQA 2H9HA 5T3HA 1C5NH 4ESTE 5FHTA 2A5AA 1Z6JH 4K3JA 2G00A 4IN2A 1MTNB 3RM0H 3UR9A 4DURA 2VB0A 3TGJE 1GI6A 1GI9B 1OWKA 1DWDH 3RXKA 4H4FA 4NIWA 1D4PB 4MQAA 3M3TA 4BAHB 4CHAC 2GZ8A 1P57B 1H8HD 1DM4B 1NBME 1O2RA 2FO9A 2BD3A 1YLNA 3Q00A 1EXFA 3M7TA 1P8VC 4HG6A 3MU5A 2QF5A 3RXFA 2NU2E 3A7ZA 4XDEA 2R2WU 4X6NA 5EIYA 1LHFH 1GBDA 2W6ID 1MTSA 1Z8RA 2P3TB 1TA6A 2WV4A 4A6LA 3UQOA 3T25A 4RT1A 4ASUD 3R3GB 1IAUA 3F9GA 1S85A 1SGNE 2AHME 4BAQB 1KLTA 4GHTA 1MZAA 1BBRK 1TOMH 2EY4C 4FUCA 1V2OT 1CGJE 4B1TA 1AKSA 1LHCH 2QXIA 1RFNA 1F0TA 2ALPA 1AB9B 4ZMAH 4WF8A 1ESAA 1TRNA 1W7XH 3B9FH 2BD4A 4FETA 5IDKA 5SGAE 2EA3A 3OEHD 4NA9H 2AMQA 1F2SE 7ESTE 2VBCA 2BY7X 1SLWB 2Q1JA 1MBMA 4MTBA 1Z8GA 2O8TA 2IJD1 1BRCE 3K2UA 2KR7A 3UREA 1WXRA 1AU8A 1UTQA 1SFQB 6LPRA 3PO1B 1Z8IB 4K2YA 1VITF 1GJAB 2QY0B 4NGAH 1HAXB 4HI3A 4CRGA 3A7WA 1G3EA 3E16B 2W26A 2FLRH 1VGCB 1AMHA 2HRVA 2P8OB 1K22H 1Y5AT 1AFQC 2HVYB 2V3HH 1YPMH 2TGTA 2Y81A 5L30H 2ZGJA 3SGBE 4AGJA 3GDUA 1QL7A 1HXEH 1GDQA 2BVSH 1C1QA 2WZQA 1ELBA 4P02A 3KN2A 1LKBA 2FM2A 4Q7XA 2PSYA 4ABDA 2RDLA 3OTJE 4IBLH 2J2UA 1IQGA 1BMMH 3GCTG 3TK5A 1W11U 2JDID 3UNSA 4CBOA 2C3SA 1C5TA 2FLBH 3OSYA 2W3KA 3PV4A 2PR3A 1K1IA 5LPRA 5FPTA 1D3DB 4BAOB 1XUGA 2SGEE 4INKA 1GHAF 2J98A 2C4FH 1FAXA 5DK1A 3GY8A 3KQ5A 2HOBA 1OP8A 5FPSA 3V0XA 1UCYH 1V2PT 3MHWU 4U2WA 2GT8A 4Y0ZE 3T27A 2J98B 1UVSH 1C5XB 2ZDKA 1SGRE 3RC6A 1F5LA 1VR1H 1E37B 1PPBH 1HXFH 5CHAB 1CT2E 1HDTH 1UO6A 2KAIB 3DD2H 1LVYA 1EZSC 2Y7XA 1TNHA 2FZZA 1PYTC 1O2SA 2GT7A 1GBKA 1NBMD 3W95A 1XX9A 2BX3A 3FAOA 2G5VA 1GJ7B 3OFND 1SQRA 3SUFA 3FZZA 3RXSA 3SI3H 1GMHF 2J94A 2BVRH 3FZDA 1V3XA 3RXEA 1YBWA 1YPEH 5DG6A 3F68H 1ZHMA 1VITH 5LGOA 4AB9A 3SU6A 2RDEA 1DY9A 1DS2E 3ZZCA 3DFLA 1VJAU 1GBAA 4BNRA 2HGTH 1TOCB 3NUMA 1GI1A 1GJDB 1HIAB 2XRCA 8LPRA 1CT0E 4Y8YA 4SGAE 1CE5A 1G3CA 5TJXA 2AGEX 5E0GA 1GHBG 3SUGA 3NKKA 3M7QA 3HATH 3SV8A 4BXWA 4X2VA 1Y8TA 4YM9A 1HIAA 1SGCA 3BTHE 1MKXH 1GJ5H 1CA8B 1FN6A 1O3CA 2FYQA 4H6TA 3TH2H 3F2FA 1FNIA 3VPKA 3BIVH 3HPTB 4I8LA 1GJ8B 4ABEA 1S84A 1HAIH 1SG8B 3SI4H 3SW2B 2W5EA 3MU8A 4X8UH 4WMEA 3JZ2B 2A4QA 2VIVA 8GCHG 2O9QA 5JB8S 5EG4A 1QA7A 2GCHF 2OBOA 5C17A 5T6FA 1TGTA 2Q6FA 2A5KA 1ID5H 3ZV9A 2Z6BD 3F1SB 3PWBA 2HLDD 2ZP0H 1T7CA 1T32A 1UTJA 4DY7B 3M61U 1ETSH 1Y5UT 1KTTB 1ESBA 1RS0A 3C1KA 2VIQA 4X8VH 2GDEH 5A2MH 1HAGE 5E0HA 3TJUA 4B74A 1ZTLA 1IQEA 2R3YA 1XM1A 2ZHEH 1QFKH 3F2HA 2P16A 4MNVA 5T6GA 3W94A 3E1XB 3U8RH 3A8DA 3ELAH 3GYLB 3LC5A 3QO6A 2P8OC 2DE9A 3DFJA 1C2GA 4UFDH 3P8NA 1GBCA 3HGNA 3UNRA 2GGVB 3I77A 1QL8A 4XSKU 5L2YH 1SMFE 1N1LA 3GISB 3VFEA 4Y6DA 1Y5BT 2NWNA 3PO1C 4XRNA 1H8DH 4Y7AA 3TNSA 3SGAE 4D7GA 3N7DA 4BAMB 1Z71A 1ZOMA 2G5NA 1T4VH 1AFEH 2EI6A 2UUJB 1O2LA 2ZU2A 1P09A 2FI3E 1QRXA 4JZFH 3U9AH 4AG2A 2AMDA 2LPRA 2J97A 1EZQA 1SI5H 2UUFB 2BQ7B 3A85A 2OLGA 1BIOA 3M5OA 3NCLA 3FANA 2NU1E 4IGDA 4GLYA 2J9NA 2ZTZA 2BOHB 1P0SH 3E0PB 1EPTB 1E0FD 3MFJA 3SU2A 1SQAA 1WOFA 3ZZ3A 3G01A 5HMAA 4YOGA 1IHTH 3MOCA 4GCHG 1G37A 3F6UH 1ZSKA 1EAIA 5ETXA 5JBTA 5DPAA 2QXJA 1V6DA 5I46H 1DLEA 2J95A 3T28A 3IWMA 3SORA 5CE1A 2QN5T 1AGJA 1YCPK 5A0CA 3PRBA 2B7DH 1OSSA 2WHXA 1YPJH 5DP7A 2AH4X 2B9LA 1YKTA 4U30A 3BTQE 6CHAC 3KGPA 5EQSA 1ZRBA 4XBBA 1O2PA 4A7IB 3QWCH 2P93A 1OXGA 2XTTB 3PWCA 1H1BA 4FUJA 1ZPZA 1P9SA 3MNBA 2FODA 5T6DA 1GI8B 1XUFA 1ARBA 2HNTC 2BY5X 2G4UA 1TX6A 2VIPA 3LOXA 1BOQA 3U8OH 1Z6EA 2ZECA 2AFQB 3DA9B 1KYNA 1S6HA 3ATLA 1EZXC 3U98H 2GZ7A 1DITH 5C0UA 4UEHH 3M3SA 5HM2A 5GPIB 3NXPA 1A2CH 1O38A 2FOBA 4WXIA 2OINA 4CR5A 4FOUC 1ELDE 3DCLA 4I8JA 1GVZA 3QGJA 3A84A 1DANH 1J9CH 2V3OH 4LZ1H 5GIBA 1AZ8A 2GKVE 4TWYA 3T62A 4FUEA 1G3BA 1F0UA 1O36A 4FU8A 2BMGB 1EUFA 2GV7A 1Y3WA 3GS9A 2M2AA 1G9IE 5DP6A 1GJCB 1GL1A 2TGPZ 3ATIA 1EOLA 4WWYA 3OTPA 1K1LA 3ZYEA 2ZKSA 3EE7A 2WPHS 4INHA 2SNWA 4KKDA 5JB9S 4O3TA 3ZZBA 1GMDG 3M35A 1LVOA 1LVBA 1FXYA 2FX6A 4XBCA 4CBNA 1GI4A 2F9BH 2UWOA 1EJAA 1BBRE 3D49H 2CN0H 5AFYH 5F8ZA 1LHDH 2VU8E 4ACAA 1UW7A 1C1PA 1ZMNA 1QGFA 1FY8E 1F0RA 1IHSH 3DT0H 1NC6A 3VEQB 1YY3A 3MTYA 1WSSH 3N7EA 5AVDA 5F53A 2C90B 3MNXA 1T8MA 2ZDVH 1TPSA 2CXVA 2KAIA 1G30B 3EDXB 1ZTKA 1W0KD 1XKAC 2JH6D 1SGQE 2KCYA 5KGOA 3AAUA 2K7XA 1DE7H 1FY4A 3WWBA 3ATMA 2JH0D 3DHKH 2Z3CA 2ODPA 3F9EA 3RXDA 2AEIH 3QN7A 5FCRA 2GCTC 4ZHAA 1CA0C 1J15A 1GBBA 3H7OA 1FIWA 1W12U 1Z7KA 5EPNA 4X6MA 4TWWA 1C5RA 1FY3A 4ISLA 1XVMA 1BTUA 2BB4A 2FDAA 1V2VT 3BG8A 4JZEH 3ZZ7A 5B6OA 4OS7A 4NSYA 2FOCA 6ESTA 4OS5A 1TB6H 1DPOA 1A3EH 1Z1IA 4YOJA 1ZTJA 2HPPH 2BY9X 3SUDA 1DUEA 2P95A 2L74A 4FUGA 2OK5A 3SJOA 2TIOA 3MO9A 3OAAD 2VIOA 1K1JA 2QXGA 2J4IA 3ZV8A 1LHGH 4Y0YE 2ILNA 4Y8XA 4JZDH 2G4TA 2ZWLH 2FI5E 4YLQH 3VB7A 2J38A 2Z7FE 5FX5A 1H8ED 1O5FH 3IG6B 2GDDA 1O5DH 1V2ST 2LIZA 3SV7A 3LGYA 3PV2A 4A5TS 3U28C 3DSOA 5CHAC 1NM6A 3VG8A 3BTWE 7GCHF 3AW1A 1UTKA 4DIIH 1S6LA 1RXPA 1YPGH 1K28D 2XXLA 2EEKA 4FXGH 2A45B 1ELFA 1PPEE 2FYRA 2WV9A 4AFUA 5E2PA 1ELEE 1O34A 1GL0E 1VCQA 2I6SA 3P6ZB 1K1MA 5GJ4B 2IPHA 1DICA 3ZVDA 2IPQX 3TJVA 1CQQA 1NO9H 1LO6A 3ZYDA 2AIQA 1IQHA 5JBAS 1ETRH 1P2OA 2WPJS 1C5PA 3SV6A 1WQVH 2FIRH 3SN8A 2HNTE 1OWJA 1FUJA 2R9PA 2WPIS 1XUIA 1XUHA 1JWTA 1O2NA 4BOHA 1S5SA 1CBWB 3SJIA 2J92A 3TVJB 5IK2D 2V3MA 1WQSA 3RLWH 1GJBB 1O2KA 3PRDA 1AO5A 1UK4A 1W13U 2BDBA 2GTBA 2VWOA 1KMHB 5C94A 1U6QA 1RD3B 2ZPQA 4Q63A 2FX4A 3SUEA 1EAXA 1TQ7B 1A1RA 1YM0A 1ESTA 3VB4A 1L4DA 1OP2A 1Q31A 4GPGA 2QF3A 4TYDA 1WAYB 1O3IA 2J5UA 4X2XA 1ACBE 1ZHRA 5GDSH 1OWDA 1T31A 2OC0A 1MQ6A 3I78A 1O3HA 3TH4H 1AWFH 1MU6B 3M36A 4ZKOU 1S83A 1GBEA 1HV7A 3QDZB 1B0EA 1VCPA 4INLA 4I32A 1V2NT 1TGSZ 1UTOA 3DSGA 4M9FA 1BTPA 1L1GA 3PMJA 4YZUA 1TALA 1OWIA 2D8WA 1LQDB 3LH3A 1W10U 3E6PH 1TX8A 3A89A 1LPGB 1C2HA 5T1VA 1CBWC 1ZMLA 2PUXB 2Z3DA 5TCAA 3BTEE 3CENA 2EC9H 1BRAA 2AGGX 1BBRH 1TABE 2PSXA 2ZHWH 3MNCA 1N6YA 2KFWA 1GBFA 3PV5A 3T26A 4ABGA 5GCHG 1ELTA 1DSTA 1YPLH 2SGDE 2CHAB 2H5DA 4E7NA 4ABHA 4HZHA 3GY2A 5C3NA 1YLDA 1CO7E 3F0OA 3PTBA 4J2YB 1TNKA 3RP2A 4ASHA 2OQUA 1IOEA 3S7KB 3HKJB 4AC9A 1AUTC 3T2NA 1YYY1 1DX5M 3TJOA 5HIZA 2XBWA 1TNGA 1H4WA 1TPOA 2EQNA 1AD8H 1ZPBA 2KZ4A 1C1VH 3UOPA 3KHVA 2Q6GA 4X8SH 5FAHA 1DOJA 3E0NB 3PLPA 3UNQA 4I8KA 1Y3UA 3QX5H 2OCVB 4NSVA 1O2YA 1V2KT 5FL7D 1TRMA 2SGQE 3LU9B 5EQQA 1GVLA 3KL6A 1P2MA 1HGTH 2FESH 1BMNH 1PYTD 1ZPCA 1F0SA 1C1NA 1TNLA 1BZXE 1Y3YA 5EOKA 1GJ6A 3EYDA 2QYIA 3LC3A 2H9EH 1GWAA 3UY9A 1PQAA 3MWIU 2IJOB 2VWLA 1QY6A 3LPRA 5EJ1A 1KY9A 1C2FA 2LNCA 1GMCF 2ZGCA 4RT0A 4Q4LA 1ZRKA 5EJLA 4Z0KA 1WTGH 3S9AA 1C5ZB 4E05H 2BDIA 2QF0A 2VNTA 4XD7D 1BDAA 3A7TA 3W1EA 1MU8B 3A88A 1OX1A 1UHBA 4HGCA 3UWIA 3QLPH 1GHWH 4JYTA 4I31A 1ORFA 1O5CB 1EQ9A 6GCHF 5EPYA 2ZO3H 1MAYA 1O2ZA 1A61H 1SQOA 1TE0A 1G2MA 1LDTT 4I8HA 1GI3A 3EBNA 5A8YA 4MPWA 3D62A 1O30A 5LPEA 1O5EH 2RA0A 1ABIH 1A0HB 1DDJA 4Y8ZA 3RXRA 1NRQH 1BTWA 2CV3A 3HKIB 2R0LA 1IQLA 3Q76A 4TY6A 3TK9A 1RIWB 1YCPH 3DUXH 2BY8X 4D76A 3T29A 1SGFA 2BD8A 2BD2A 1UK3A 3M5LA 2ZEBA 1P04A 4JYUH 4K8YA 1WBGB 5CDFE 1N8OB 3MU1A 1FY1A 2BDYA 1DFPA 2ZDMA 2F3CE 1MAXA 2F83A 3MU4A 4KTUA 3LT3A 5G4BA 2G8TA 1GCTB 2GP9B 3SU0A 5FCKA 4D7FA 1C5YB 1GBLA 1HLTH 3CP7A 3RMOH 4ABIA 4BTUB 2ZDLA 2A4RA 1S81A 1NFUA 1O3GA 2FWWA 4ZKRU 1UVTH 1C4V2 1YPHE 1V2WT 2ANKH 1L4ZA 3UFAA 2FOAA 1AUJA 4K8BA 3AVZA 2GV6A 2BDGA 5DGJA 1HJAB 1VGCC 5F8TA 3SJKA 2A0QB 2AIPA 1SGEE 2ODYB 5F8XA 3AK5A 1FX0B 2F9NA 1DUAA 1AFQB 5FBEA 3RXTA 1D3PB 1JIMA 1KXDA 3B23B 1D6WA 2RG3A 1DY8A 9LPRA 3FN8A 2QCYA 4KELA 1DT2A 1MD8A 1PQ7A 4HTCH 1WYKA 1CGHA 4IMZA 3BSQA 4QT8C 6CHAB 1O2OA 1QTFA 2DE8A 4DW2U 5DP3A 1HAPH 1FI8A 1GDUA 2CF9H 1SKYE 2PHBA 1O2XA 2SGAA 3EAJA 2XCNA 2UUKB 2YMSB 4FU9A 1O3JA 2V35A 2VWNA 2B0FA 1ZSLA 3M5NA 3V7TA 1QBOA 2AGIX 4TT3D 2HWLB 4DIHH 3TK6A 1KDQB 5EGMA 5AF9H 5HM9A 1E36B 4E06H 4DOQA 1CHOF 5HIYA 3VGCC 1NU7B 1UVUH 3TPIZ 1OPHB 4ZKNU 5FPYA 1UK2A 1AIXH 3LGUA 1G32B 2Z9KA 3LJJA 1X7AC 3ZZ6A 5JDUB 2QF4A 2H9TH 1BTHH 2K1QA 1W3CA 2HLCA 1YCPM 4RKJB 3RMMH 2P94A 3KYFA 4GUXA 2ALVA 3O8RA 4O3UA 5DSFA 4JCNA 5B6LA 4ZXXH 2BD5A 1O2QA 2CF8H 1GBHA 1QRWA 1BHXF 1YWUA 2ZDAH 1C1SA 4Y10E 2ESTE 2W6JD 1ZGIA 5EXMA 3SQEE 1GBTA 3KNXA 2Z9JA 1QIXB 4F48B 1CHGA 2FOEA 4JZ1A 4NWLA 4I8GA 3NRLA 5BRRE 2EI7A 3SO3A 1GI0A 3MH4A 2V7QD 1A5HA 3GY5A 2ZPRA 2A5IA 2JJ2D 2O8WA 1V2JT 1WUNH 4LZ4B 4H42U 4KTSA 1O3PB 1UMAH 2OBQA 2TPIZ 3A87A 4AG1A 1AWHB 1FLEE 3CNRA 3SU5A 3UB0A 2BLOA 1BJVA 1NRPH 3C27B 4H6SB 1INCA 1GGDC 2W7UA 1C4U2 3B8JA 1C5LH 1UCYE 3ODFA 4BTIB 4ZHLU 1SLXB 3ZZAA 2FI4E 1TFXA 2RFKC 2PW8H 8ESTE 4M7GA 1O3LA 1NTPA 3SV9A 5E2OA 2ZGXH 1O35A 4GAWA 1LTOA 3RC4A 4X0WU 3GCOA 2LP6A 1TAWA 3S69A 1COWD 2XOKD 4F49A 1ETTH 4NWKA 3RXOA 1TNJA 1FJSA 1MH0A 2BLVA 1GG6B 2TGAA 1GDNA 3FP6E 3PB1E 4YESB 5DP8A 1C1UH 3E91A 4OS4A 8KME2 4ZXYH 1IQJA 1MBQA 3FKSD 1QBNA 1GCTC 1HNEE 2D1JA 3D65E 2ASUB 5EJZA 3GCHB 1GHVH 1S0QA 1QR3E 2J34A 1EP6A 8GCHF 3O8CA 1ANBA 3RXGA 3TITA 1HJ9A 1O2HA 5C1YA 1C9PA 1BMFD 4KGAA 1C1RA 1SLVB 2ZTYA 1GHBF 3JZ1B 2F9OA 1GMHG 1DSUA 4WVPE 4AX9H 1N8OC 2FTLE 3MO6A 3L33A 5GNDA 2CHAC 1WCZA 1FPHH 3M3VA 4CH2B 3UWJH 1S6FA 4CREA 3LGWA 3RLYH 4D9RA 5A8XA 2XNDD 1C1TA 1O3NA 1W14U 2SNVA 4FUIA 2PKSB 2BZ6H 3OY5U 2KCPA 1ZJDA 3PLKA 3RXAA 3HK6B 5DP4A 1CHOG 1MTWA 1P10A 1XMNB 1BMAA 2A2QH 1BQYA 3ZVGA 5DP9A 1MABB 4GVUA 3FP8E 3LIWA 2GD4B 3AASA 1BRUP 4X1NU 3TU7H 4AN7A 1G3DA 1BT7A 1D6RA 1UHBB 2L6OA 1GG6C 1XKBC 1K1OA 1YLCA 3K6YA 2G81E 1E79D 2W3IA 1GPZA 3P8FA 1SSXA 2VIWA 4X1SU 3ZVAA 3UQVA 5HGGA 1N6XA 3F2GA 2Z94A 4NFFA 7GCHG 2KCAA 2BM2A 1SOZA 1C2DA 1P2IA 1QBVH 4WJG2 1YPHC 3KF2A 5I25A 2P3UB 4AYVB 3RC5A 4RSPA 1JIRA 4P00A 1EPTC 2BVXH 1D3TB 5ESBA 2BY6X 4HFPB 2Y80A 2GCHG 1C9TA 1O5GH 2XBYA 2ZNKH 1Y3VA 2FS8A 4Q2KA 3SU1A 4K1EA 4ABAA 5HXFA 2ZQ1A 2AS9A 4LK4A 4FU7A 2C8YB 2VGCB 3RUOA 4IC6A 3BF6H 5KECA 1HCGA 1RTFB 1C5VA 3A80A 3TGIE 2HNTF 2VWMA 2FPZA 3AW0A 1YC0A 2A7JA 4O9VA 1YP9A 2A2XH 2KX4A 1G2LA 3EA7A 1TMTH 1HJ8A 1C1OA 1HAVA 5GCHF 3GY4A 4XBDA 1AI8H 3F9HA 5F6MA 1KLJH 4DG4A 4SGBE 3K9XB 3MU0A 1PFXC 3FOAA 1DWCH 3S7HB 2Q6DA 1LMWB 1JBUH 3RXHA 1EATA 1SGIB 3WWFA 3NZIA 2D26C 2ZHQH 1GVKB 5EQRA 1UJ1A 2XBXA 1GGDB 3A8CA 1MD7A 1V2QT 2ZHDA 1LQEA 3BTDE 3E3TA 1UVPA 1NROH 2QXHA 3OE7D 4NFEA 1JRSA 2BX4A 1MTNC 3SZNA 2VIDA 4K5ZA 3P95A 1E35B 4YTAA 1A5GH 1SHHB 4IMQA 1O3KA 2NU0E 4CRBA 1ARCA 1B0FA 4CHAB 3LKWA 2ZHFH 2BXUH 2G55A 3NK8A 4X8TH 4OM9A 4FUDA 1DWEH 1T8LA 2BQ6B 3KQEA 2QIQA 3ZVFA 2CMYA 3SV2H 4BANB 2OQ5A 5A0AE 1F92A 3OY6U 1E1RD 4CRDA 1C5QA 1SL3A 1DWBH 3STJA 1TMUH 1ZZZA 1LHEH 3SZEA 2JETC 4ABJA 2CGAA 2ZU1A 2A31A 1AVWA 2Z9LA 5K7RA 1FQ3A 1NZQH 3DSPA 3EE0B 1O2IA 1CGIE 4CRFA 1QZ8A 2O8UA 2VINA 2XW9A 3E8LA 1QNJA 1C5OH 4YO9A 5TCCA 3TLOA 4Y11E 1O5BB 4LOYH 4RN6A 2ZU5A 1J8AA 3RXQA 1OS8A 4UD9H 3D23A 3PROA 3R0FA 3MH7A 2YMSD 1MQ5A 3MMGA 4R8TB 5C2ZA 1XXDA 1QRZA 3QTVH 2PGBB 2JKHA 4UE7H 3URCA 1HRTH 2D2DA 4IS5A 1KXAA 1MUEB 1PQ5A 2YMSC 5ESTE 1O2WA 1EB2A 1PPFE 3BIUH 3SU4A 1K2I1 1SGPE 2BTCE 1UVOA 3ITIA 2PKAB 3ZZDA 4JMYA 4K1SA 2PGQB 2ODQA 2XWAA 2XWBI 4ISIH 2OD3B 1P3EA 3BTME 3RU4E 2BHGA 1KXBA 2FOMB 1ZSJA 7LPRA 3M5MA 3U1JB 3GY3A 3OU0A 1KSNA 4AFQA 1NY22 3VXFH 1P2QA 4TY7A 2F9UA 2ZFTA 1XXFA 2YNBA 1Q2WA 2NU3E 3BTKE 1ABJH 4MPXA 1MMJN 2W7SA 4B2AA 1P02A 4DJZB 2Y5HA 3MO3A 3OYPA 1C2IA 3VGCB 4F55A 3SBKA 2WPDD 2F9PA 4WXVA 3SNEA 2YOLA 4NA7A 3LGVA 4ISHH 4OS2A 5C67A 2Y5FA 1THRH 3BEFB 3I29A 1C2LA 1JMOH 2SGPE 2YNAA 1RGQA 4RI0A 1O33A 4MG3A 3L6PA 2PWXA 3V12A 1BRBE 3TH3H 1SHYA 1EJNA 2VGCC 2IOTA 2B8OH 1H9LB 1O2UA 1NRRH 1OWHA 1GJ4H 1SOTA 1KXEA 1QB9A 1A4WH 2NU4E 2PFEA 2AERH 1BTXA 1OKXA 2A7HA 1HUTH 3A82A 3VB3A 2JIZD 3VB6A 1TLDA 2A32A 3UR6A 1ANDA 1K9OE 3SNAA 1TPAE 4BAKB 2BDCA 2FEQH 2SGFE 3PLBA 2XC0A 1A46H 1VITG 4ZUHA 1IQFA 2WPMS 5DO4H 1L2EA 3A7VA 2ZCHP 3RXJA 4B75A 2C8XB 2WPKS 1BA8B 2ZA5A 4YXWD 4NA8A 7KMEH 5L2ZH 3AAVA 4O03A 1C1WH 5EXLA 1HB0B 2ANWA 5C0TA 5C20A 1LPZB 3GCHC 3U8TH 2Z3EA 4K69A 5J4SA 1ANCA 1TIOA 5EW1H 1ZMJA 4BXSA 5EU8A 1ZYOA 2BQWB 4MDSA 3VB5A 4NG9H 3RXCA 2UUYA 1O31A 1PJPA 1NESE 5EXNA 3PMBB 1TNIA 9ESTA 5FX6A 5E8EH 1O2GH 2WYJA 1ELCA 3FVFB 1L1JA 2OC7A 2XNIA 2GZ9A 1THSH 4K1TA 3UOUA 1K1NA 1E1QD 4JYVH 2ZC9H 2BLWA 1O2TA 2GMTC 1ZGVA 2ZDNA 1OYQA 4VGCC 4ABFA 1A3BH 2VH6A 5FBIA 1BCUH 1P05A 3SYJA 1VZQH 2DUCA 3EA8A 1TWXB 2F9VA 1TQ0B 3U1IB 5A8ZA 1EASA 2JJ1D 3SJ9A 2ZFFH 1SC8U 1L0ZA 1AB9C 3FO8D 1HAYB 1BTYA 2WUBA 5H4IB 1YF4A 1XUJA 1T4UH 4XE4A 2ZG0H 1WDIA 4A1TA 3HGPA 1H9IE 4WH8A 5DJ7A 1MCVA 3ZZ9A 1OP0A 1HAZB 1LPKB 2K8IA 2V0BA 5F03A 1G36A 1C5UA 1VKYA 3RXLA 2VH0A 2ANYA 3TIUA 3SHAH 4ZHMU 2WINI 1GMDF 3BTTE 1L1NA 3MQKC 2THFB 3CS7A 1NT1A 4MPVA 3TGKE 4ZKSU 1IQNA 2FOGA 1XVOA 1JRTA 4Y71A 2O8MA 5AHGH 5HYOA 1BUIA 1TGNA 1P3CA 3P17H 1MKWH 1D9IA 1W0JD 1GBMA 3PTNA 3SHCH 3TNTA 1FIZA 1GHXH 4NIYA 1KTSB 3LJOA 2ZFSA 1SFIA 1T8NA 5C5NA 5LPFA 3S9CA 2WYGA 3RXVA 1WTHD 4GSOA 3QZRA 1JOUB 2WV5A 2KM0A 2ZFRH 4YLUA 2Z9GA 1S0RA 2QA9E 1SR5C 2WUCA 1K1PA 3A7YA 4YT7H 4WY3A 2STBE 1THPB 1M9UA 4UFGH 1SGFG 4U01A 1AHTH 4AB8A 1EP5A 2ZU3A 2H5CA 1Z8JB 3A7XA 3MYWA 4Y7BA 1GHZA 1AY6H 4IC5A 3RXIA 3RU4T 1J17T 2STAE 1FV9A 1Y59T 2ZPSA 2OC1A 5AFZH 1DVAH 2GJGA 4NCYA 3TJNA 3ODDA 4NZQA 4B6FA 1C5SA 2ULLA 3K65B 2OTVA 3ZZ5A 1P11E 4ZROA 1PQ8A 1CA0B 4B71A 2ZI2H 1SGTA 5IYTA 1FZZA 2VVUA 3KQCA 4JK5A 3URDA 1TX7A 1TBQH 2H2ZA 2QAAA 1C4Y2 1O2VA 3H09A 4DGJA 1P2KA 2PKAA 2QC2A 5C5OA 1W7GH 2ZCKP 3OX7U 1EPTA 1NFYA 1HFDA 3WY8A 5DN6D 2LELA 4IN1A 2WSSD 5JYIA 1CSOE 1H8IH 2O8LA 3QTOH 2Y7ZA 3P8GA 1RTLA 1MTUA 2C93B 2M5TA 2RA3A 3BTFE 3GOVB 3ATWA 2G52A 2FXRA 1QJ1B 1KXFA 2BLQA 3N99A 4MNXA 1KIGH 3PM3A 3BTGE 1NN6A 3V3MA 1QJ6B 3ZZ4A 4ISOA 4U32A 3SOSA 3GY7A 1C2MA 3O8BA 1UTNA 1YPKH 3BEUA 3O8DA 3SGQE 2PP6A 1W0ZU 1LVMA 3Q3KA 3UIRA 2VVCA 1E38B 1OOKB 3T5FH 4Y79A 1ELGA 1HAOH 1ZR0A 4ZAEA 1UTMA 3SNCA 2BZAA 4X6PA 1V2TT 4UFEH 1C5MD 2A1DB 2HALA 2G51A 2BDAA 1J16A 4IW4E 2JH5D 4I33A 2OP9A 2GMTB 5L6NH 1QCPA 5DP5A 2FS9A 4X1RU 4ZH8A 3VXEH 1MZDA 1EB1H 1SQTA 1PPCE 3P70B 1BMLA 1NFWA 1DLKB 5PTPA 1NS3A 4AOQA 3L3TA 3RXMA 2OUAA 3QZQA 2VVVA 1UTLM 1T8OA 1UTPA 1GHYH 3EGKH 3OEED 1EKBB 1W8BH 2QE7D 3FFGA 3BV9B 4UDWH 4F4OC 1Q3XA 1OWEA 3IITA 4E7RG 4FVBA 1EX3A 4JZIA 1QB1A 1O3MA 4Q80A 3ENSB 1E34B 1O3FA 2FOFA 5FXLA 5BPEA 1SBWA 2R3UA 1AE5A 3ATKA 4ZCNA 1RTKA 4X6OA 3F9FA 3UAIC 3LGIA 1P03A 2A4GA 4D9QA 1B5GH 1TPPA 1HPGA 1GHAG 3BN9A 2ZGHA 3RXUA 1P2JA 2H6MA 1AQ7A 3KQDA 3PMAB 1FAKH 2Y82A 1CU1A 2ZTXA 4FUFA 3M37A 4MPUA 4O97A 2PLXA 1QQ4A 2ZGBH 1VJ9U 1IQIA 1WU1A 1PPGE 5EW2H 1DXWA 1A0LA 2OC8A 1HBTH 2Z9IA 4UONA 2FMJA 1AZZA 1K21H 4NIVA 3STIA 1F5KU 2BDHA 4R0IA 1PPHE 4GCHF 2F91A 2R2MB 1LCYA 2TRMA 4MVNA 3M7UA 3SNDA 1RJXB 3FP7E 3BG4C 4DT4A 3GDVA 2BXTH 3RM2H 3UUZA 1BB0B 1GBIA 3S9BA 1FN8A 2A7CA 3MNSA 4X1PU 1ELVA 1AKSB 5EODA 1KLIH 2ZU4A 1MKXK 3BEIB 1C2JA 2CJIA 3P92A 4XFQA 1A5IA 1VCWA 4X2WA 1Z1JA 4AYYB 1NFXA 5CHBA 3WW7A 2KCOA 4ACBA 5GXPA 1V2MT 1FY5A 1P2NA 4K60A 2AMPA 1C1MA 1TA2A 1EAUA 4A1XA 3U69H 1TYNA 1ELAA 4TSFD 3RDZA 1D3QB 4TPIZ 3LGTA 1HAVB 3PMHB 1GBJA 4FVDA 4AGKA 5JPMH 3MH6A 1XUKA 3RMLH 3SQHE 2QV1A 1SPJA 4AORA 4CR9A 5E0JA 1QURH 1SLUB 2PTCE 4CRCA 4DT7B 1GI5A 1SGDE 1SGYE 5DKMA 4I7YH 1S82A 2SFAA 2GVFA 4AFSA 1C2EA 1TONA 4GHQA 1HYLA 2PV9B 4OGYA 4UFFH 4TPYA 4Q7ZA 1J14A 5ABWA 1TBRH 3KYGA 3V13A 4RKOB 1NRNH 1O37A 4FUHA 1Y3XA 4ABBA 6GCHG 1GI2A 3CS0A 2XYAA 1TRYA 4XOJA 5C1XA 1GJ9B 5JBCS 1UCYK 4MNWA 3GYMA 1O3BA 1AE8H 4NZLA 2ZFQH 1BITA 1PPZA 5LH8A 1O2MA 2FP7B 1F7ZA 1F5RA 2K0QA 2XC5A 2PKSC 1TGCA 1FMGA 3KEEA 2FOHA 1SB1H 5J4QA 1AVXA 1V2UT 3KQBA 2F43B 2XCFA 4Y76A 4NIXA 1O5AB 4CRAA 3UTUH 3ZVCA 3KIDU 1TGBA 3LH1A 3RMNH 4X1QU 2F4LA 4LXBH 4Z6AH 2PUQH 1RIWC 1WV7H 3LONA 4AZ2B 4BTTB 2AYWA 1GI7B 5JBBS 1FDPA 3E90B 3GY6A 3SU3A 3UPEA 1V2RT 2A4OA 1TBZH 4CH8B 5K0HA 3Q77A 2BYAX 2PTNA 3H5CB 1AVGH 1ZHPA 2EI8A 4OS6A 3LDXH 1SVPA 2IN2A 3RU4D 1MTVA 2RCEA 2HVXA 3HK3B 4I86A 4WMFA 1QHRB 2TBSA 4YOIA 1CT4E 4PROA 1GMCG 3ZIAD 2XBVA 1P06A 2R0KA 4THNH 3SNBA 4YT6H 2FTMA 1KXCA 4MNYA 1A7SA 1ZLRA 2P3FH 1K0HA 1CVWH 1FPCH 3P8OA 4Q7YA 4DVAU 3A81A 1B7XB 1IQMA 2Y5GA 2Y6TA 5KEDA 1O3OA 2VJ1A 1IQKA 2UWPA 1BJUA 2ZF0H 4DCDA 1ZJKA 1BTZA 1P12E 2HPQH 2ZCLP 4WMDA 3N7OA 1O2JA 5C1UA 1QL9A 2GX4A 3QUMP 4KTCA 1YGCH 1FONA 2ZFPH 4B76A 1C2KA 1HJAC 1P01A 3PYHA 1QQUA 1EAWA 2C8WB 3ZVBA 1EOJA 4A1VA 1QA0A 2CK3D 3ESTA 1O3DA 4MLFB 3EQ0H 3Q3YA 3S0NA 1W2KH 2TGDA 2OXSA 1EFRD 1MCTA 5CMXH 1DXPA 5A09A 1GCDA 2ANMH 3A8AA 3H7TA 4B2CA 4B2BA 2I6QA 1P9UA 4FUBA 3ZZ8A 2C8ZB 4VGCB 1O3AA 4AFZA 1O32A 1TMBH 5HKKD 1W0YH
chains in the Genus database with same CATH topology
3GCTF 3BG4B 1HAHH 1QJ7B 1NU9A 1QB6A 1NRSH 2B5TB 4OS1A 2ZIQH 3GICB 3MI4A 4WH6A 1BHXB 3NWUA 5A0BA 4J1YA 2V6NA 1RRKA 1AN1E 1NPMA 3A8BA 2BD7A 3SJ8A 3A83A 4X2YA 1EZUC 4A92A 2WPLS 3QK1A 1EJMA 2XC4A 2ZZUH 3ZVEA 1V2LT 3EA9A 3GDSA 4D8NA 4ISNA 2BD9A 2BOKA 1H9HE 4B73A 2JETB 3K6ZA 3GCNA 3A86A 1O3EA 2GCTB 3RXBA 1JXPA 5GWZA 1OYTH 3QGNB 1A0JA 4KP0A 2ZQ2A 2UWLA 2P59A 1LKAA 1O0DH 3NPSA 3Q3XA 3MH5A 2QGRA 1MKWK 1O39A 4OGXA 1ANEA 4JK6A 1C5WB 2H1UA 3RXPA 3KCGH 1KDQA 2H9HA 5T3HA 1C5NH 4ESTE 5FHTA 2A5AA 1Z6JH 4K3JA 2G00A 4IN2A 1MTNB 3RM0H 3UR9A 4DURA 2VB0A 3TGJE 1GI6A 1GI9B 1OWKA 1DWDH 3RXKA 4H4FA 4NIWA 1D4PB 4MQAA 3M3TA 4BAHB 4CHAC 2GZ8A 1P57B 1DM4B 1O2RA 2FO9A 2BD3A 3Q00A 1EXFA 3M7TA 1P8VC 3MU5A 3RXFA 2NU2E 3A7ZA 4XDEA 2R2WU 4X6NA 1LHFH 1GBDA 1MTSA 1Z8RA 2P3TB 1TA6A 2WV4A 4A6LA 3UQOA 3T25A 3R3GB 1IAUA 3F9GA 1S85A 1SGNE 4BAQB 1KLTA 4GHTA 1MZAA 1BBRK 1TOMH 4FUCA 1V2OT 1CGJE 4B1TA 1AKSA 1LHCH 2QXIA 1RFNA 1F0TA 2ALPA 1AB9B 4ZMAH 4WF8A 1ESAA 1TRNA 1W7XH 3B9FH 2BD4A 5IDKA 5SGAE 2EA3A 4NA9H 2AMQA 1F2SE 7ESTE 2BY7X 1SLWB 2Q1JA 1MBMA 4MTBA 1Z8GA 2O8TA 1BRCE 3K2UA 3UREA 1AU8A 1UTQA 1SFQB 6LPRA 3PO1B 1Z8IB 4K2YA 1VITF 1GJAB 2QY0B 4NGAH 1HAXB 4HI3A 4CRGA 3A7WA 1G3EA 3E16B 2W26A 2FLRH 1VGCB 1AMHA 2HRVA 2P8OB 1K22H 1Y5AT 1AFQC 2V3HH 1YPMH 2TGTA 2Y81A 5L30H 2ZGJA 3SGBE 4AGJA 3GDUA 1QL7A 1HXEH 1GDQA 2BVSH 1C1QA 1ELBA 3KN2A 1LKBA 2FM2A 4Q7XA 2PSYA 4ABDA 2RDLA 3OTJE 4IBLH 2J2UA 1IQGA 1BMMH 3GCTG 3TK5A 1W11U 3UNSA 4CBOA 2C3SA 1C5TA 2FLBH 3OSYA 2W3KA 3PV4A 2PR3A 1K1IA 5LPRA 5FPTA 1D3DB 4BAOB 1XUGA 2SGEE 4INKA 1GHAF 2C4FH 1FAXA 5DK1A 3GY8A 5FPSA 2HOBA 1OP8A 3V0XA 1UCYH 1V2PT 3MHWU 4U2WA 2GT8A 4Y0ZE 3T27A 1UVSH 1C5XB 2ZDKA 1SGRE 3RC6A 1F5LA 1VR1H 1E37B 1PPBH 1HXFH 5CHAB 1CT2E 1HDTH 1UO6A 2KAIB 3DD2H 1LVYA 1EZSC 2Y7XA 1TNHA 2FZZA 1PYTC 1O2SA 2GT7A 1GBKA 3W95A 1XX9A 2BX3A 3FAOA 2G5VA 1GJ7B 3SUFA 3FZZA 3RXSA 3SI3H 1GMHF 2J94A 2BVRH 3FZDA 1V3XA 3RXEA 1YBWA 1YPEH 5DG6A 3F68H 1ZHMA 1VITH 5LGOA 4AB9A 3SU6A 1DY9A 1DS2E 3ZZCA 3DFLA 1VJAU 1GBAA 4BNRA 2HGTH 1TOCB 3NUMA 1GI1A 1GJDB 1HIAB 2XRCA 8LPRA 1CT0E 4Y8YA 4SGAE 1CE5A 1G3CA 5TJXA 2AGEX 5E0GA 1GHBG 3SUGA 3NKKA 3M7QA 3HATH 3SV8A 4BXWA 4X2VA 1Y8TA 4YM9A 1HIAA 1SGCA 3BTHE 1MKXH 1GJ5H 1CA8B 1FN6A 1O3CA 2FYQA 4H6TA 3TH2H 1FNIA 3VPKA 3BIVH 3HPTB 4I8LA 1GJ8B 4ABEA 1S84A 1HAIH 1SG8B 3SI4H 3SW2B 2W5EA 3MU8A 4X8UH 4WMEA 3JZ2B 2A4QA 2VIVA 8GCHG 2O9QA 5JB8S 5EG4A 1QA7A 2GCHF 2OBOA 5T6FA 1TGTA 2Q6FA 2A5KA 1ID5H 3ZV9A 2Z6BD 3F1SB 3PWBA 2ZP0H 1T7CA 1T32A 1UTJA 4DY7B 3M61U 1ETSH 1Y5UT 1KTTB 1ESBA 1RS0A 3C1KA 2VIQA 4X8VH 2GDEH 5A2MH 1HAGE 5E0HA 3TJUA 4B74A 1ZTLA 1IQEA 2R3YA 1XM1A 2ZHEH 1QFKH 2P16A 4MNVA 5T6GA 3W94A 3E1XB 3U8RH 3A8DA 3ELAH 3GYLB 3LC5A 3QO6A 2P8OC 2DE9A 3DFJA 1C2GA 4UFDH 3P8NA 1GBCA 3HGNA 3UNRA 2GGVB 3I77A 1QL8A 4XSKU 5L2YH 1SMFE 1N1LA 3GISB 3VFEA 4Y6DA 1Y5BT 2NWNA 3PO1C 1H8DH 4Y7AA 3TNSA 3SGAE 4D7GA 4BAMB 1Z71A 1ZOMA 2G5NA 1T4VH 1AFEH 2EI6A 2UUJB 1O2LA 2ZU2A 1P09A 2FI3E 1QRXA 4JZFH 3U9AH 4AG2A 2AMDA 2LPRA 1EZQA 1SI5H 2UUFB 2BQ7B 3A85A 2OLGA 1BIOA 3M5OA 3NCLA 3FANA 2NU1E 4IGDA 4GLYA 2J9NA 2ZTZA 2BOHB 1P0SH 3E0PB 1EPTB 1E0FD 3MFJA 3SU2A 1SQAA 1WOFA 3ZZ3A 3G01A 5HMAA 4YOGA 1IHTH 3MOCA 4GCHG 1G37A 3F6UH 1ZSKA 1EAIA 5ETXA 5JBTA 5DPAA 2QXJA 1V6DA 5I46H 1DLEA 2J95A 3T28A 3IWMA 3SORA 5CE1A 2QN5T 1AGJA 1YCPK 5A0CA 2B7DH 1OSSA 1YPJH 5DP7A 2AH4X 2B9LA 1YKTA 4U30A 3BTQE 6CHAC 3KGPA 5EQSA 1ZRBA 4XBBA 1O2PA 4A7IB 3QWCH 2P93A 1OXGA 2XTTB 3PWCA 1H1BA 4FUJA 1ZPZA 1P9SA 3MNBA 2FODA 5T6DA 1GI8B 1XUFA 1ARBA 2HNTC 2BY5X 2G4UA 1TX6A 2VIPA 3LOXA 1BOQA 3U8OH 1Z6EA 2ZECA 2AFQB 3DA9B 1KYNA 1S6HA 3ATLA 1EZXC 3U98H 2GZ7A 1DITH 4UEHH 3M3SA 5HM2A 5GPIB 3NXPA 1A2CH 1O38A 2FOBA 4WXIA 2OINA 4CR5A 1ELDE 4I8JA 1GVZA 3QGJA 3A84A 1DANH 1J9CH 2V3OH 4LZ1H 5GIBA 1AZ8A 2GKVE 4TWYA 3T62A 4FUEA 1G3BA 1F0UA 1O36A 4FU8A 2BMGB 1EUFA 2GV7A 1Y3WA 1G9IE 5DP6A 1GJCB 1GL1A 2TGPZ 3ATIA 1EOLA 4WWYA 1K1LA 3ZYEA 2ZKSA 2WPHS 4INHA 2SNWA 4KKDA 5JB9S 4O3TA 3ZZBA 1GMDG 3M35A 1LVOA 1LVBA 1FXYA 2FX6A 4XBCA 4CBNA 1GI4A 2F9BH 2UWOA 1EJAA 1BBRE 3D49H 2CN0H 5AFYH 5F8ZA 1LHDH 2VU8E 1C1PA 1ZMNA 1QGFA 1FY8E 1F0RA 1IHSH 3DT0H 1NC6A 3VEQB 3MTYA 1WSSH 5AVDA 2C90B 3MNXA 1T8MA 2ZDVH 1TPSA 2CXVA 2KAIA 1G30B 3EDXB 1ZTKA 1XKAC 2JH6D 1SGQE 3AAUA 2K7XA 1DE7H 1FY4A 3ATMA 2JH0D 3DHKH 2Z3CA 2ODPA 3F9EA 3RXDA 2AEIH 3QN7A 5FCRA 2GCTC 4ZHAA 1CA0C 1J15A 1GBBA 3H7OA 1FIWA 1W12U 1Z7KA 5EPNA 4X6MA 4TWWA 1C5RA 1FY3A 4ISLA 1XVMA 1BTUA 2BB4A 2FDAA 1V2VT 3BG8A 4JZEH 3ZZ7A 5B6OA 4OS7A 4NSYA 2FOCA 6ESTA 4OS5A 1TB6H 1DPOA 1A3EH 1Z1IA 4YOJA 1ZTJA 2HPPH 2BY9X 3SUDA 1DUEA 2P95A 4FUGA 3SJOA 2TIOA 3MO9A 2VIOA 1K1JA 2QXGA 2J4IA 3ZV8A 1LHGH 4Y0YE 2ILNA 4Y8XA 4JZDH 2G4TA 2ZWLH 2FI5E 4YLQH 3VB7A 2J38A 2Z7FE 5FX5A 3IG6B 1O5FH 2GDDA 1O5DH 1V2ST 2LIZA 3SV7A 3LGYA 4A5TS 5CHAC 1NM6A 3BTWE 7GCHF 3AW1A 1UTKA 4DIIH 1RXPA 1YPGH 1K28D 2XXLA 2EEKA 4FXGH 2A45B 1ELFA 1PPEE 2FYRA 4AFUA 5E2PA 1ELEE 1O34A 1GL0E 1VCQA 2I6SA 3P6ZB 1K1MA 5GJ4B 2IPHA 1DICA 3ZVDA 3TJVA 1CQQA 1NO9H 1LO6A 3ZYDA 2AIQA 1IQHA 5JBAS 1ETRH 1P2OA 2WPJS 1C5PA 3SV6A 1WQVH 2FIRH 3SN8A 2HNTE 1OWJA 2R9PA 1FUJA 2WPIS 1XUIA 1XUHA 1JWTA 1O2NA 4BOHA 1S5SA 1CBWB 3SJIA 2J92A 3TVJB 1WQSA 3RLWH 1GJBB 1O2KA 1AO5A 1UK4A 1W13U 2BDBA 2GTBA 2VWOA 1U6QA 1RD3B 2ZPQA 2FX4A 3SUEA 1EAXA 1TQ7B 1A1RA 1YM0A 1ESTA 3VB4A 1L4DA 1OP2A 1Q31A 4GPGA 2QF3A 4TYDA 1WAYB 1O3IA 4X2XA 1ACBE 1ZHRA 5GDSH 1OWDA 1T31A 2OC0A 1MQ6A 3I78A 1O3HA 3TH4H 1AWFH 1MU6B 3M36A 4ZKOU 1S83A 1GBEA 1HV7A 3QDZB 1B0EA 1VCPA 4INLA 4I32A 1V2NT 1TGSZ 1UTOA 1BTPA 1L1GA 3PMJA 4YZUA 1TALA 1OWIA 2D8WA 1LQDB 3LH3A 1W10U 3E6PH 1TX8A 3A89A 1LPGB 1C2HA 1CBWC 1ZMLA 2PUXB 2Z3DA 5TCAA 3BTEE 3CENA 2EC9H 1BRAA 2AGGX 1BBRH 1TABE 2PSXA 2ZHWH 3MNCA 1N6YA 1GBFA 3T26A 4ABGA 5GCHG 1ELTA 1DSTA 1YPLH 2SGDE 2CHAB 2H5DA 4E7NA 4ABHA 4HZHA 3GY2A 5C3NA 1YLDA 1CO7E 3PTBA 4J2YB 1TNKA 3RP2A 4ASHA 2OQUA 1IOEA 3S7KB 3HKJB 1AUTC 3T2NA 1YYY1 1DX5M 3TJOA 2XBWA 1TNGA 1H4WA 1TPOA 1AD8H 1ZPBA 1C1VH 3UOPA 3KHVA 2Q6GA 4X8SH 5FAHA 1DOJA 3E0NB 3PLPA 3UNQA 4I8KA 1Y3UA 3QX5H 2OCVB 4NSVA 1O2YA 1V2KT 1TRMA 2SGQE 3LU9B 5EQQA 1GVLA 3KL6A 1P2MA 1HGTH 2FESH 1BMNH 1PYTD 1ZPCA 1F0SA 1C1NA 1TNLA 1BZXE 1Y3YA 5EOKA 1GJ6A 3EYDA 2QYIA 3LC3A 2H9EH 1GWAA 3UY9A 1PQAA 3MWIU 2IJOB 2VWLA 1QY6A 3LPRA 1KY9A 1C2FA 2LNCA 1GMCF 2ZGCA 1ZRKA 4Z0KA 1WTGH 3S9AA 1C5ZB 4E05H 2BDIA 2QF0A 2VNTA 1BDAA 3A7TA 1MU8B 3A88A 1OX1A 1UHBA 4HGCA 3UWIA 3QLPH 1GHWH 4JYTA 4I31A 1ORFA 1O5CB 1EQ9A 6GCHF 5EPYA 2ZO3H 1MAYA 1O2ZA 1A61H 1SQOA 1TE0A 1G2MA 1LDTT 4I8HA 1GI3A 3EBNA 5A8YA 4MPWA 3D62A 1O30A 5LPEA 1O5EH 2RA0A 1ABIH 1A0HB 1DDJA 4Y8ZA 3RXRA 1NRQH 1BTWA 2CV3A 3HKIB 2R0LA 1IQLA 3Q76A 4TY6A 3TK9A 1RIWB 1YCPH 3DUXH 2BY8X 4D76A 3T29A 1SGFA 2BD8A 2BD2A 1UK3A 3M5LA 2ZEBA 1P04A 4JYUH 4K8YA 1WBGB 1N8OB 3MU1A 1FY1A 2BDYA 1DFPA 2ZDMA 2F3CE 1MAXA 2F83A 3MU4A 4KTUA 3LT3A 5G4BA 2G8TA 1GCTB 2GP9B 3SU0A 5FCKA 4D7FA 1C5YB 1GBLA 1HLTH 3CP7A 3RMOH 4ABIA 4BTUB 2ZDLA 2A4RA 1S81A 1NFUA 1O3GA 2FWWA 4ZKRU 1UVTH 1C4V2 1YPHE 1V2WT 2ANKH 1L4ZA 3UFAA 2FOAA 1AUJA 4K8BA 3AVZA 2GV6A 2BDGA 5DGJA 1HJAB 1VGCC 5F8TA 3SJKA 2A0QB 2AIPA 1SGEE 2ODYB 5F8XA 2F9NA 1DUAA 1AFQB 5FBEA 3RXTA 1D3PB 1JIMA 1KXDA 3B23B 1D6WA 2RG3A 1DY8A 9LPRA 2QCYA 4KELA 1DT2A 1MD8A 1PQ7A 4HTCH 1WYKA 1CGHA 4IMZA 3BSQA 4QT8C 6CHAB 1O2OA 1QTFA 2DE8A 4DW2U 5DP3A 1HAPH 1FI8A 1GDUA 2CF9H 2PHBA 1O2XA 2SGAA 3EAJA 2XCNA 2UUKB 4FU9A 1O3JA 2V35A 2VWNA 2B0FA 1ZSLA 3M5NA 3V7TA 1QBOA 2AGIX 2HWLB 4DIHH 3TK6A 1KDQB 5EGMA 5AF9H 5HM9A 1E36B 4E06H 4DOQA 1CHOF 3VGCC 1NU7B 1UVUH 3TPIZ 1OPHB 4ZKNU 5FPYA 1UK2A 1AIXH 3LGUA 1G32B 2Z9KA 3LJJA 1X7AC 3ZZ6A 5JDUB 2H9TH 1BTHH 2K1QA 1W3CA 2HLCA 1YCPM 4RKJB 3RMMH 2P94A 4GUXA 2ALVA 3O8RA 4O3UA 4JCNA 4ZXXH 2BD5A 1O2QA 2CF8H 1GBHA 1QRWA 1BHXF 2ZDAH 1C1SA 4Y10E 2ESTE 1ZGIA 5EXMA 3SQEE 1GBTA 3KNXA 2Z9JA 1QIXB 1CHGA 2FOEA 4JZ1A 4NWLA 4I8GA 5BRRE