3F9HA

Crystal structure of the f140a mutant of sars-coronovirus 3c-like protease at ph 7.6
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
299
structure length
299
Chain Sequence
b'GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Two adjacent mutations on the dimer interface of SARS coronavirus 3C-like protease cause different conformational changes in crystal structure.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 77
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3f9hA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9hA02
2FP7B 2QXIA 4YT6H 1P0SH 3TH2H 4DCDA 1XVMA 3U8OH 1BDAA 1NFUA 2FESH 4CRDA 4Y7AA 3CS0A 2A4RA 1MTSA 1O0DH 2ZEBA 3Q76A 3GISB 2R3UA 5LPEA 3ZZ6A 1SI5H 2TGPZ 1C4Y2 1ESTA 4CR5A 3T62A 2R0KA 1UVOA 2AMQA 1TGSZ 4X1NU 1SC8U 2RG3A 3AAVA 3H7OA 1GGDC 1ZTJA 2UWOA 1ANBA 1BTUA 1GJ4H 2TBSA 3ODDA 3QO6A 4WH8A 2BY7X 1KXDA 3MH5A 1MCTA 5HM9A 1KLIH 4GUXA 1T8OA 1CHOF 1TX8A 5C1YA 3QTOH 3BG4C 1A5HA 4K2YA 1H9HE 1W3CA 1NS3A 1BOQA 2PSYA 2F83A 3RMOH 1Y3WA 3ZZBA 4FVBA 3SHCH 5FCKA 2FOEA 1O2PA 1G32B 1O30A 3LKWA 2BVRH 3RLWH 2QY0B 4YTAA 2GTBA 1EKBB 2ZU2A 1DX5M 1V2PT 1C4U2 1HAPH 1A0HB 2P8OC 3KQCA 4MDSA 3BIUH 1AE8H 4WMFA 4CHAB 1NM6A 3AASA 4KKDA 5E0GA 1ELAA 1FV9A 5CE1A 1QA7A 1GBDA 1GMHG 3PLBA 3RU4E 3S9BA 1ESAA 3AVZA 1QL7A 3EYDA 1ELDE 1XVOA 1KYNA 1YGCH 1RIWC 1OYQA 1B7XB 2BOKA 1T7CA 1E35B 4MG3A 1L1JA 2ZHDA 1GMCF 1GMDF 4XFQA 1HLTH 3UOPA 1CT4E 2A4QA 1BB0B 1SOTA 2A7CA 1FY8E 4GCHF 1XUGA 3L33A 1VCQA 2H9HA 5DP5A 1MQ5A 3SV6A 3UWIA 4AB9A 1GCDA 2FO9A 5DP3A 1ZTLA 1C4V2 1P2KA 4X8VH 1TMBH 4HI3A 4AZ2B 1GBAA 2ZO3H 7KMEH 2BX3A 1GBCA 1MD8A 1UVTH 1UK4A 1S82A 1KXEA 5HXFA 1P2IA 3D65E 4IGDA 1NRSH 4F49A 3RUOA 2FS9A 1BMMH 3T5FH 4NWLA 4I32A 2LIZA 1DOJA 2C3SA 4ABEA 4BOHA 5C67A 3MI4A 1XUFA 5JDUB 1B0FA 5JB8S 3SQHE 4H6TA 2ZF0H 2TGDA 5PTPA 1O2VA 5DO4H 2P94A 1ZSLA 3A89A 1THSH 4YESB 3SJ9A 3KQBA 4D7FA 1G9IE 4Y76A 1SFIA 4K8YA 2A2XH 1EPTB 2ZHQH 2HPQH 4I8GA 4Y7BA 1AZZA 1UTJA 3AW1A 3ZVBA 4DURA 2BY5X 3PWBA 4IC6A 2WUBA 3BTME 1L0ZA 1DXWA 5JBTA 7GCHF 1CT0E 1C2JA 2Z9IA 1HAVB 1UMAH 1P2OA 2CN0H 3CENA 4XBBA 1L1GA 3TNSA 1ARBA 5AFZH 4YLQH 3SJKA 4CH2B 2GDDA 1OOKB 3M5NA 4DY7B 1AO5A 4BNRA 2AS9A 1TPSA 3URDA 1BRBE 2AH4X 3SI3H 3F9EA 1AKSB 2OBOA 4JZDH 4UONA 1P57B 4A1VA 1SGTA 1GBTA 2FI4E 3MH4A 3VB4A 1TOMH 1HBTH 1OS8A 1C2KA 1THPB 1OWKA 1FAKH 4XDEA 1DY9A 2W7SA 2FYQA 1V2KT 4FUJA 1QRXA 2VH0A 3Q3YA 2PSXA 2FZZA 5EPNA 4YT7H 1B5GH 1O3DA 2QF3A 3MNXA 2Z9KA 1DVAH 2NWNA 1GDQA 3B8JA 2D1JA 3F9GA 3UIRA 1QIXB 1F92A 4WXVA 5FAHA 3AAUA 2FDAA 3MYWA 1EAUA 1FNIA 3V3MA 4Q7ZA 1KDQA 1QURH 3ZZ5A 2Q6FA 2VIDA 1LKBA 2G00A 1O3PB 5A0BA 5DP9A 1LVMA 2H5CA 3PO1B 5L2ZH 1KXCA 1LQEA 1GJ5H 1EP6A 2BX4A 2CXVA 1NRNH 3RM2H 5AF9H 1SQOA 4D8NA 4JYTA 1TABE 3MOCA 1D3TB 3SJIA 3SUDA 1XUIA 1MAYA 1OYTH 1S6FA 1AB9B 2VH6A 2ZPSA 3A8CA 2V35A 3DT0H 3RP2A 3P6ZB 3ZZ3A 1C2FA 1HJ8A 1DANH 1W13U 1KXBA 2P95A 3BTTE 4THNH 4AFZA 2RDLA 3RXSA 1Z7KA 5CHAC 1UVSH 1MAXA 1P3EA 5J4QA 1JXPA 1MD7A 2BQ6B 4CBNA 1SSXA 3A8DA 1C1SA 1WTGH 1C2LA 2W3KA 4D9RA 1WOFA 1Y5BT 1INCA 5H4IB 3RXUA 1IQKA 3KNXA 1EJAA 4CRFA 4GAWA 3GCOA 1F5RA 4DJZB 2WV4A 3FFGA 2SNWA 1EAXA 2ZPRA 3NKKA 3RXCA 3M5OA 2Y7XA 1NY22 2BYAX 4CH8B 3T2NA 3NCLA 1QL8A 4IN2A 2NU1E 1TNKA 3LC3A 1O3GA 2ZFPH 4U32A 2FM2A 3BTFE 2QIQA 3STJA 2D26C 3RXBA 5B6OA 1FIZA 2GCHF 2CJIA 4YZUA 1BMLA 2Q6GA 3EA9A 1KXFA 1C5VA 3PMHB 5T6GA 4UE7H 1Z6JH 2ZU3A 1A0LA 5A0CA 2FMJA 4Y79A 2C90B 6CHAC 2VVCA 2BY8X 1UJ1A 4WMEA 3SHAH 1TRMA 3A87A 5FPTA 3MU8A 4I7YH 1V2RT 1VITF 1OWDA 2ZC9H 1HAIH 2TIOA 1AE5A 1O3HA 1PFXC 3UTUH 2PV9B 2QCYA 1LHCH 1VGCB 2VJ1A 2ZGCA 4I8LA 3I77A 4X2YA 1Y59T 4ZHAA 2B8OH 1O3OA 1GJBB 3T28A 3OTJE 5A0AE 1VJ9U 4E7RG 2FOCA 4AYYB 1NFWA 1MKWH 1T4VH 4TY7A 3M3SA 1K2I1 2P3FH 1TONA 1YF4A 4OGXA 3RXAA 2SFAA 1O2IA 2V3OH 4O9VA 4Y8ZA 4AYVB 2A32A 2ZGXH 1HFDA 1Y5UT 1TNJA 1GDNA 1YBWA 1SR5C 1OWEA 2PWXA 2C8ZB 1DLKB 1K1OA 1Y3YA 1OWJA 1A3EH 4FUHA 1CA8B 1N6YA 2FOFA 3QZRA 3AW0A 5EW1H 1O3AA 3P8OA 6ESTA 5A2MH 2BLOA 5GPIB 5FHTA 1O5EH 1ACBE 4Z6AH 1GDUA 3HPTB 1SLXB 1HXFH 3TH3H 1C1NA 2YNBA 2W26A 1C5RA 1P8VC 3UR6A 3U1IB 1V6DA 1TRYA 1T8MA 3VB5A 4RSPA 1MCVA 1A5GH 5I25A 4A6LA 4GSOA 1TNIA 2JETC 2NU2E 2H2ZA 2FYRA 2KAIB 5LPFA 3TJUA 3SO3A 1TE0A 3GY3A 3RMLH 2QC2A 1EOJA 1GHXH 1FMGA 1MKXH 2BLWA 2V0BA 2BHGA 1K28D 2XBWA 1MTNC 1TNLA 3LGUA 2P93A 2D2DA 4ZAEA 3E3TA 1IQIA 2NU3E 2G5VA 2G5NA 2HRVA 2VIOA 3SORA 2ODQA 1H8DH 4X0WU 3M3TA 3DUXH 1VCWA 1V2LT 1C5OH 4ZH8A 1K1IA 1AMHA 4OS5A 1J16A 1DWCH 1O2LA 2IN2A 2O9QA 2O8MA 4Q80A 3CP7A 5TJXA 2SGAA 1TBRH 4ZMAH 4HZHA 1FI8A 3PWCA 3V7TA 1M9UA 2PTNA 2FI3E 2FPZA 3R0FA 4WY3A 2A2QH 3SU4A 1GBBA 5LGOA 1YPEH 3TPIZ 3TK6A 1MUEB 3A8BA 5EGMA 1GGDB 2P16A 2J4IA 1ZHMA 1GBIA 1JMOH 2ULLA 1HAYB 1LHDH 1QB6A 2GZ9A 1O38A 2EI8A 4DIHH 5T6DA 1ELCA 3GY5A 4B1TA 3BG4B 1GBJA 2QXJA 3TJNA 3SJ8A 1O5DH 4KTCA 3MO6A 3MU4A 2JH0D 1UK3A 2QXGA 3M7TA 1TB6H 2OXSA 1HV7A 1O35A 3EBNA 1GL0E 3RXIA 1MBQA 1XM1A 4O3TA 2P8OB 2ZIQH 4PROA 1Q3XA 1CGIE 3KL6A 4K8BA 3QLPH 1QRZA 3SBKA 2G52A 2GX4A 1GJ8B 3ZVCA 2Z6BD 2IPHA 3MTYA 3MNSA 2BVSH 2GV6A 3S9AA 1RIWB 1C5YB 2XCFA 3ATIA 3RXJA 4B73A 2G4TA 3RXTA 3P17H 2ZG0H 3SZNA 1S83A 1Y3UA 4ESTE 1BHXB 3RC4A 3UFAA 1GBHA 3FP8E 4JK6A 1RTKA 5E2OA 1C1TA 1Y5AT 2GT8A 1W14U 1ZJKA 4ZHMU 4CRAA 4Q7YA 1GI2A 4X6NA 1O2MA 5DP7A 1BTYA 1W11U 3LDXH 3SU6A 2A4OA 4TYDA 3BTDE 2PGBB 3BTGE 4Y0YE 1SHYA 2XRCA 2BD7A 3M35A 3A7XA 1WU1A 3BTWE 2A7HA 5FPYA 3RXQA 1AHTH 2ZDLA 3STIA 5EQSA 1EB1H 2B7DH 2ZCKP 1TNGA 1MKWK 3B9FH 1BIOA 1O5FH 2PW8H 2Z3EA 3GDSA 1BQYA 1O2SA 2A45B 1JRTA 1OP8A 3RXGA 2QAAA 3RC6A 4FXGH 4XOJA 4JMYA 4NIXA 2GP9B 5C5OA 4UEHH 3MNCA 4I31A 3RXVA 2WYJA 4ABBA 1YC0A 1YCPH 3DD2H 2B0FA 3VFEA 1GVZA 5EQQA 1TMUH 3RDZA 1ELVA 2ZTXA 1O39A 4WWYA 1KTTB 4OS7A 4NGAH 1BITA 4DT7B 3A85A 2PKSC 1BCUH 1GI4A 4DW2U 2NU0E 1QBOA 2B9LA 3SU3A 1GWAA 3LJOA 1A7SA 2TRMA 2Z9JA 2BXUH 4ZKRU 5F6MA 1XXFA 2V3HH 2FOGA 3M36A 3EAJA 2Z9GA 3TK9A 2CF9H 2CV3A 1ZPCA 2XC4A 3P8FA 4FU9A 3GY6A 5GDSH 1OSSA 1KXAA 1JIMA 2DUCA 2Y80A 1QNJA 3PTNA 3GDVA 5FBEA 4ISLA 3SNCA 1MKXK 4MPVA 2QF0A 2I6SA 3GCNA 2ZDAH 2Y81A 2K1QA 1GI8B 1VR1H 2OLGA 4BAKB 3TGIE 1MH0A 1CT2E 1O2UA 3A7WA 3M7QA 1TQ7B 1S85A 1DWEH 3KF2A 3MH6A 2W3IA 3KCGH 4CRCA 4IBLH 1NRPH 1ZLRA 1XMNB 4LXBH 3SI4H 4BTTB 1SGIB 1GPZA 1O2YA 2LNCA 3GY2A 4AG1A 3IWMA 3VEQB 4YO9A 3A86A 2P3UB 2OC1A 1CHGA 5C3NA 1UTQA 3QDZB 3M3VA 4JYVH 2H1UA 1O3EA 2W7UA 2BDYA 1SGFG 5ESTE 3ZVDA 3S69A 5E0HA 5EG4A 3K9XB 3ZZCA 5CHAB 3TITA 5BPEA 2BDIA 1OKXA 3S7KB 1FXYA 1EX3A 1KY9A 2G81E 1JOUB 1HRTH 1P01A 3ZZ4A 1H8IH 2OQUA 4D7GA 2H6MA 3LPRA 1HDTH 3ITIA 2HALA 1O2QA 1QHRB 1RRKA 4O3UA 4X6OA 5C5NA 1KTSB 2WUCA 2R9PA 1X7AC 5FPSA 2BZ6H 4Q2KA 4UFFH 1C2DA 3FAOA 1QQUA 3BTQE 2ANYA 1Z1IA 4MPWA 2ZHWH 5GJ4B 1YPKH 5JBAS 3Q3KA 4NZLA 1UTOA 1PYTD 1V2ST 1GHYH 2J9NA 4HFPB 5GCHG 3UUZA 1WYKA 4NIYA 5C2ZA 1K21H 2BD8A 2WPHS 5JBBS 1SGPE 1H9LB 9LPRA 4WXIA 1YLDA 4CREA 1FPHH 5EODA 5JPMH 1DUAA 6CHAB 1P12E 1D9IA 4RKJB 1NRQH 2ODPA 2UUJB 5L30H 1ZSJA 2XYAA 2UUKB 2WV5A 2BLVA 1Q2WA 4DIIH 1SPJA 1TPOA 3L3TA 1UTPA 2SGDE 3VXFH 3OY5U 4FUGA 3EA8A 4ABAA 3UQVA 1A61H 1C5UA 3HGPA 1C5LH 1ANEA 4ZKOU 1NZQH 1E34B 4ISNA 3BN9A 4ZKNU 3LT3A 2SNVA 1WQSA 1YPGH 5E8EH 2H9EH 4I8JA 4AFUA 1GI7B 1YYY1 4MPXA 1AWHB 1U6QA 1D6RA 5TCAA 1QRWA 2FOAA 4K69A 2PUXB 2UWLA 1TA6A 3LGTA 1DT2A 3K65B 3GYMA 1C5SA 3M5MA 5GWZA 1WV7H 1HPGA 3SNEA 1YPJH 1F2SE 1ZSKA 2P59A 5G4BA 1Y3XA 4DG4A 3VB7A 3SN8A 1G30B 2A4GA 4MTBA 1S84A 3M5LA 1TIOA 4U30A 1T32A 2ZNKH 3PROA 1OWIA 3BEIB 1SLVB 1P06A 4CR9A 3PLPA 4KTUA 2GZ8A 1K1MA 4ISOA 3QX5H 1C1UH 4DGJA 1O3IA 1MZDA 4QT8C 1YCPK 1E37B 1W10U 4OS4A 1T8LA 3LGIA 4OS1A 5IDKA 2BQ7B 2VWLA 3RXRA 4IN1A 2OBQA 2BD4A 1W12U 2JETB 2ZTZA 1VJAU 1ZPBA 1HIAA 1G3EA 1LKAA 1KLTA 1ZMLA 1AD8H 1CBWC 3ATWA 1KDQB 2AFQB 1SGEE 2GD4B 1D3QB 3SGBE 2JH6D 2ZDKA 4OGYA 3SQEE 5EPYA 3BTEE 1MTNB 2AGGX 2VVUA 2PGQB 1TRNA 1THRH 3GY7A 2Y5HA 5ETXA 2FLRH 1ELBA 3V0XA 2BD3A 4YM9A 5JB9S 1EUFA 1DE7H 1QY6A 5E2PA 1Z6EA 3N7OA 3ZVFA 4AGKA 1CE5A 2ZWLH 3SGQE 3TK5A 4AG2A 2Q1JA 1HB0B 3CS7A 3ZVAA 3UWJH 1LVYA 2PR3A 1ZYOA 1NU9A 1AVXA 2ALPA 2PKAA 2VGCC 2FI5E 3M61U 3TJOA 1FQ3A 4CBOA 2A7JA 3GY4A 1GI3A 2Y5GA 1FY5A 3PYHA 3GCTG 1F5LA 2CHAC 2WINI 1YP9A 4ABHA 4TWWA 1DM4B 1LVOA 5HYOA 1ELFA 1JBUH 3P70B 1C1WH 5A8ZA 2R2WU 3SNBA 2RA3A 4ASHA 2FODA 3HGNA 2EEKA 3SU1A 4FU8A 3WY8A 1ZGIA 1TYNA 3RXPA 4VGCC 1SLWB 2AIPA 1LHGH 1YPHC 2XWBI 2BM2A 3TVJB 1GJDB 1W0YH 5LPRA 3A83A 1C1QA 1QB1A 2BD9A 3QN7A 5DPAA 1ZPZA 4NG9H 4X1RU 3RMMH 1AFQC 3RMNH 1BMAA 4A1XA 5J4SA 1AUTC 2WPIS 5EQRA 2Y6TA 4TWYA 4AOQA 1O2TA 4MNVA 3ZZ9A 2ZHEH 3GOVB 1YM0A 4JZFH 1LPZB 3BV9B 1SVPA 2A5KA 1FIWA 2XWAA 4IC5A 2Y7ZA 1DS2E 2THFB 2D8WA 3QZQA 4R0IA 1AWFH 2OD3B 3O8CA 2A1DB 3M37A 3FZZA 4FU7A 2CF8H 2VWMA 3LGVA 2XBVA 4NA8A 1ZZZA 2O8LA 4KTSA 4INHA 1IHSH 2EC9H 1C5XB 1AUJA 5A8YA 1HJ9A 4YOJA 1FUJA 1HGTH 3F9HA 4X8SH 4K60A 1E36B 1O2NA 2VWOA 4MNXA 5AHGH 1YPHE 5EU8A 4BAQB 2ZECA 2XC0A 2A31A 1ESBA 5FXLA 1TALA 1YKTA 1O3JA 2SGQE 1FPCH 3A81A 1UHBA 4AB8A 1BTPA 2AEIH 2CMYA 4BANB 4NA7A 4AN7A 1UCYE 1H9IE 1W2KH 3ESTA 1BUIA 1K1NA 1LDTT 1EASA 2ZTYA 4IMZA 3RXFA 4AORA 2XTTB 4ZXYH 1ANDA 1F0TA 4K1SA 1QR3E 1VZQH 1TNHA 1JIRA 2VIWA 3BSQA 1O3BA 1MMJN 1C5ZB 1NPMA 1P3CA 2R3YA 1GI5A 4FUBA 1BRCE 5DGJA 3EDXB 3KQDA 4RKOB 2FS8A 2VNTA 1XKAC 1ZRBA 4CRGA 1YCPM 1C5QA 3FP6E 2F9PA 2STAE 4K1EA 3RU4D 3E16B 1C2GA 3ZZAA 3A7ZA 4NZQA 1O2JA 1IQGA 3D62A 3FVFB 1C1RA 1WCZA 1GHAG 1AQ7A 2BDAA 2ZQ2A 1TX7A 1HNEE 3A7VA 4Y71A 1BRUP 1HYLA 1NROH 3SV7A 2FTMA 2PKSB 5FX5A 2FOBA 1G3CA 1LCYA 1EXFA 1PPCE 3HK6B 4LOYH 2Z7FE 2O8UA 2F9OA 4Q7XA 1IQJA 4GPGA 3KN2A 4A5TS 1ELTA 3A80A 2J34A 3VB6A 1D3DB 4MLFB 4E06H 1RTLA 1AGJA 2PTCE 2YOLA 1BRAA 4ABFA 3D23A 2ESTE 4WMDA 1TFXA 3ENSB 1GHBG 1UTNA 2ANWA 2HNTF 1D4PB 1LMWB 4Y6DA 1QB9A 4B2AA 1UCYH 3S7HB 3KEEA 2R2MB 3Q3XA 1FAXA 3RXDA 3QGJA 2XW9A 4X1SU 2DE9A 3LOXA 1FN6A 1QBNA 2G55A 6GCHG 3SGAE 1LPKB 3MWIU 1Z8GA 1TPAE 1Z8JB 1GCTC 1EB2A 1NRRH 4BAMB 1EATA 3BEFB 1PPHE 3W95A 2WPLS 3LIWA 1DICA 3TNTA 5F03A 1P09A 2EI6A 2JH5D 3I78A 2ZFFH 4FUCA 1GJAB 4D9QA 1OPHB 1P2MA 1SGRE 1QBVH 4K3JA 4X8TH 4B71A 1ETRH 2GCTC 5F8TA 8LPRA 5AVDA 1ZHPA 3RU4T 8GCHG 1SGQE 3NZIA 2ZCLP 4MVNA 3PLKA 1GI6A 3F6UH 2ZFTA 4K5ZA 2C93B 1TBQH 4MNYA 1AFEH 1H4WA 5TCCA 4X6MA 1EZUC 1SFQB 3ZVGA 4ZUHA 2Y82A 1DLEA 1AY6H 3UR9A 2BD2A 5DP8A 2C8XB 2OP9A 1LO6A 3E0PB 1NT1A 1F7ZA 1C2MA 1WUNH 2HWLB 1A3BH 2QXHA 2ZGJA 2VB0A 3QGNB 1EZSC 1QA0A 4RN6A 4KELA 1QFKH 4D76A 2BDBA 1ZGVA 4NIWA 1RD3B 1O37A 4ZHLU 1HAOH 1T31A 2FOHA 1A46H 2A5IA 1AU8A 1CQQA 1GBLA 2G8TA 1QGFA 1ZRKA 1C1VH 5A8XA 1IQNA 1IQMA 4YOIA 1Y3VA 1MQ6A 2TGAA 3RXHA 1GG6C 3BTKE 2IJOB 1ETSH 2XBYA 3KQEA 4FUDA 1D6WA 2VVVA 3QUMP 5GCHF 1TGBA 2FOMB 5T3HA 4B75A 5JYIA 1S81A 3E1XB 1O3FA 3VGCC 4B2BA 1BT7A 1T4UH 4ISHH 1GHZA 1OX1A 1N1LA 1L4ZA 5ESBA 4BXSA 3SV8A 1C5TA 2OUAA 3H7TA 1IQEA 1SL3A 3HK3B 5DG6A 1DFPA 1HAGE 3NUMA 1EJNA 2WPKS 3SOSA 3T27A 1L1NA 4Z0KA 3G01A 5SGAE 4JYUH 1IOEA 5DP4A 1RGQA 2SGPE 3NWUA 1AVWA 3JZ1B 2J95A 1SGFA 2GMTC 3MU1A 4UFGH 1SMFE 4ABIA 1NFXA 3KHVA 3O8RA 3TGJE 2BLQA 2ZFSA 1XKBC 2CGAA 2F9VA 1TGTA 1SG8B 2SGEE 3QK1A 3T29A 1RJXB 2G4UA 4FUEA 3F9FA 1G3BA 3UOUA 3ODFA 4Y8XA 3ZYEA 3PTBA 1O3CA 3P8GA 4ABGA 4XBCA 1GJ7B 3BG8A 3SU2A 1E0FD 1MU6B 4I8HA 1P03A 4FUIA 1YPMH 4M7GA 1G37A 4X2VA 3SV9A 1O2RA 1ID5H 3MMGA 7ESTE 5K7RA 2RCEA 1W0ZU 1XUHA 1GL1A 1C2HA 4NFEA 3SNAA 2OC8A 1G3DA 1Z71A 4J1YA 4UFEH 1RTFB 2FLBH 1IHTH 3SJOA 3P95A 4SGBE 1CBWB 1W7GH 1RXPA 1UO6A 1UTMA 2ZU4A 3VXEH 1C5NH 1GI0A 1K1LA 3BIVH 2AERH 4B2CA 4IW4E 2BOHB 4X2XA 1P2JA 1C2IA 4H42U 2TPIZ 2ZA5A 3MU5A 3ZZ7A 3LGYA 1PPEE 3LU9B 2GZ7A 1UVUH 2AIQA 1DWDH 1AN1E 4JZEH 1MTVA 3EGKH 3PMBB 1ZMJA 1V2NT 2K7XA 2F91A 1UCYK 3P92A 2EA3A 3SUEA 4NA9H 2UUFB 1HJAC 1Z8RA 4BTIB 1C9TA 2ZHFH 3U69H 2WPJS 3ZZ8A 1S0RA 5GXPA 1V2QT 2ZFRH 3A7TA 2VGCB 3MH7A 3T26A 1TGNA 3VPKA 1TQ0B 4GVUA 2O8WA 1FZZA 5EXNA 1DPOA 3SUGA 1VITH 3I29A 4INLA 2RA0A 2CHAB 2HNTC 3UREA 1MTWA 3VB3A 3UNRA 5BRRE 1EAIA 1N8OC 2HOBA 3DHKH 5I46H 2ZQ1A 2P3TB 1GJCB 1CA0C 1O2OA 2GV7A 1O5GH 1ETTH 4VGCB 2NU4E 3OSYA 5DP6A 2HLCA 3PV4A 3MO3A 2AGIX 3RXEA 4LZ1H 1QQ4A 3KGPA 3GCTF 2OINA 3UNQA 1V3XA 1PPFE 1ABJH 1AFQB 1O5CB 3E90B 1O31A 2ZU5A 3IG6B 3U9AH 3HKIB 3U8RH 1P02A 1VCPA 1Z8IB 4ISIH 3D49H 1O3LA 1SQAA 5EW2H 1O2GH 1W7XH 4SGAE 1NN6A 4Y0ZE 1IQFA 3MU0A 1W8BH 1EPTA 1YPLH 2VU8E 2XXLA 3RXKA 2BB4A 1NO9H 1F0UA 5C1XA 2Y5FA 2HNTE 1DITH 3PB1E 5FCRA 3GY8A 1HAVA 3A82A 2Z3CA 1P10A 1QJ7B 3O8DA 3HKJB 3ZYDA 2ILNA 3GCHC 4E7NA 1C1MA 1ELGA 1FJSA 3P8NA 1BBRE 3ATKA 3Q00A 5C1UA 1CU1A 1ZTKA 1PJPA 1BA8B 3C1KA 3SU5A 4NCYA 1EOLA 1AKSA 1LPGB 1J9CH 4MPUA 4X2WA 3W94A 1RS0A 3KIDU 2QN5T 4ABDA 1AI8H 3RXLA 4NSYA 1EQ9A 1SOZA 3SNDA 3E91A 1QCPA 1CHOG 2IOTA 4WJG2 1IQLA 4XE4A 3A7YA 5ABWA 2F9UA 2BTCE 1O2HA 1PQ5A 2BQWB 3MO9A 1SGDE 4X1PU 1J17T 2BDGA 2FX4A 2J2UA 3O8BA 2BXTH 3TIUA 1D3PB 3UY9A 2F3CE 4KGAA 3ELAH 3U1JB 1HUTH 1EP5A 1V2MT 4INKA 3URCA 1BJVA 1V2WT 1MBMA 1GHVH 2C8YB 1TPPA 2R0LA 3V12A 1S6HA 1TAWA 1ZOMA 2OQ5A 3L6PA 4UD9H 2STBE 4OS2A 2YNAA 4JK5A 3B23B 3S0NA 4MQAA 1O36A 2ALVA 4BTUB 1IQHA 4F4OC 1C1OA 2OC7A 1HIAB 2TGTA 3IITA 2PFEA 1HAXB 1N6XA 5EXMA 4ZKSU 2UUYA 5L2YH 2FIRH 2UWPA 3QWCH 3V13A 2BVXH 1P9SA 1O33A 2BY6X 1H1BA 1S5SA 1JWTA 1K9OE 1OXGA 4WVPE 4A7IB 4Y8YA 2BDCA 1GMCG 4CHAC 1PQ7A 1GMDG 5DK1A 3UPEA 1Y8TA 5F8XA 2BMGB 5HMAA 2C4FH 3MHWU 4K1TA 4GCHG 1LHEH 1V2VT 1FONA 1G2LA 1NTPA 2H5DA 2ANMH 1C5MD 4E05H 3H5CB 2AMPA 4A92A 1F5KU 4IMQA 1V2UT 3M7UA 2XNIA 1GI1A 1GHAF 1FN8A 1GVKB 1ZHRA 1DY8A 2AMDA 1SQTA 1BBRH 1BTZA 1FY1A 3NPSA 1DSTA 5EOKA 3OY6U 4LZ4B 2PKAB 2Q6DA 3UQOA 1QJ1B 1O5AB 3TH4H 1SBWA 4GHQA 1OWHA 1F0RA 5DKMA 1RFNA 3EA7A 4U2WA 2J92A 1WQVH 1F0SA 1Z1JA 3RXOA 4AX9H 2VIPA 4NFFA 1L4DA 2Z9LA 1TBZH 1UTLM 2OTVA 4I33A 2A0QB 5A09A 3RM0H 4TPYA 5C20A 2LPRA 1GBEA 2ZDMA 4JZIA 1BMNH 4TY6A 1GHBF 3NXPA 1GCTB 1PPZA 5HGGA 5IYTA 2HGTH 4OS6A 1XX9A 4ABJA 4GHTA 7GCHG 1UVPA 1XUJA 1A5IA 1ABIH 4BAOB 3DFJA 3C27B 1P2NA 1UTKA 1K1PA 1HAZB 3HATH 6GCHF 2GCTB 1WTHD 1EPTC 4B76A 4ZROA 1LQDB 1FY3A 4Y11E 4U01A 1GI9B 5HM2A 1WBGB 1O2XA 1V2TT 3E6PH 1ZR0A 3GDUA 3Q77A 3LC5A 4YOGA 2H9TH 3NK8A 3TGKE 4CRBA 2ZPQA 3RLYH 2ZZUH 1PYTC 2ZU1A 5FX6A 1CVWH 4UDWH 2ZGHA 1J15A 2XBXA 3BTHE 1QTFA 2ZGBH 3ATMA 3LONA 1P05A 4Y10E 1GBFA 2HVXA 3EE0B 8GCHF 7LPRA 4YLUA 4TPIZ 3F1SB 5F8ZA 5GIBA 1C9PA 2GGVB 1XXDA 2BY9X 3MFJA 1UHBB 4UFDH 2JKHA 3FANA 3R3GB 1DWBH 2ZFQH 2G51A 1AVGH 3F68H 1CSOE 1O32A 1LHFH 2QA9E 3ZV9A 1MZAA 3JZ2B 1CGHA 1O2KA 1V2JT 1BTXA 5L6NH 3LH3A 2KAIA 4JCNA 2WPMS 4HTCH 1GG6B 2FTLE 3EQ0H 2FX6A 3ZVEA 1ZMNA 1O5BB 2ZDVH 4HGCA 1E38B 1TLDA 1A2CH 1OP2A 2DE8A 1O3KA 5E0JA 3VGCB 1WSSH 3PO1C 4WF8A 4X6PA 1P04A 1CO7E 1FY4A 2VIVA 3E0NB 3DFLA 2XCNA 3PMAB 2BD5A 1DDJA 4NWKA 1TMTH 2OCVB 4I8KA 1DUEA 1LTOA 1DSUA 1NESE 1AB9C 4A1TA 1O34A 6LPRA 2F9BH 3LGWA 1EAWA 1OP0A 4BXWA 1SGCA 3K6YA 3U8TH 1O2WA 2GMTB 1JRSA 2ASUB 2ZCHP 2ANKH 3DA9B 1P11E 1AZ8A 1B0EA 1CGJE 4AGJA 3TJVA 2GCHG 2FEQH 4XSKU 3GICB 5K0HA 1HAHH 4IS5A 3S9CA 1T8NA 1BTHH 3K6ZA 2QYIA 1QJ6B 1BHXF 1MU8B 3UNSA 1BJUA 5AFYH 1QL9A 2GDEH 1SGNE 3SV2H 3E8LA 2W5EA 2B5TB 1VITG 1C1PA 1KIGH 3QTVH 2QGRA 1A1RA 1J14A 2PHBA 2C8WB 1G2MA 1BZXE 1C5PA 3SU0A 1GJ6A 3K2UA 1S0QA 4FUFA 1IAUA 1UK2A 2ZDNA 2M5TA 2OC0A 1O2ZA 2O8TA 3SUFA 3ZV8A 1BTWA 1MTUA 5CMXH 1G36A 2GT7A 1P2QA 4AFQA 5JBCS 3OYPA 1GBMA 4FVDA 5DJ7A 1FDPA 4NSVA 1C5WB 1SB1H 3A84A 1BBRK 3PMJA 1LVBA 2VINA 3A8AA 4GLYA 4XBDA 3ZZDA 9ESTA 4NIVA 1GJ9B 4DOQA 2AYWA 4O97A 1SLUB 2PUQH 2GVFA 1VGCC 2XC5A 3SW2B 2BZAA 4WH6A 5EXLA 2SGFE 2VIQA 2F9NA 4ZXXH 8ESTE 1GHWH 2FWWA 1V2OT 1TA2A 3LJJA 1KSNA 2EI7A 3FP7E 2ZKSA 1Q31A 1HJAB 4H6SB 4MNWA 2FXRA 3PM3A 2VWNA 1L2EA 5T6FA 3MNBA 1ARCA 2HPPH 1AIXH 3TLOA 2PLXA 1P9UA 2Z94A 1PQ8A 3LH1A 1EZQA 2BDHA 2I6QA 1PQAA 1FLEE 3BF6H 2V6NA 4H4FA 1N8OB 1J8AA 1GMHF 1KLJH 1C2EA 4B74A 1CA0B 3OX7U 2ZI2H 1TOCB 1K1JA 3RXMA 5LH8A 1SGYE 3TU7H 2GKVE 1GBKA 2ZP0H 2A5AA 1ZJDA 4X8UH 3BEUA 1EJMA 1HCGA 4KP0A 3A88A 1PPBH 1TGCA 1O3NA 1WAYB 8KME2 1DXPA 1XUKA 4X1QU 2ODYB 2WYGA 1K22H 1TX6A 1ORFA 3ATLA 3T25A 4R8TB 3GYLB 4BAHB 3FZDA 1A4WH 1HXEH 4LK4A 1ELEE 1NU7B 1YLCA 1EZXC 4DVAU 1PPGE 1ANCA 3RC5A 2AGEX 1O3MA 1TWXB 3U98H 1SHHB 4J2YB 4AFSA 2QV1A 3GCHB 1GVLA 1A0JA 2J38A 1NC6A 2J94A 4JZ1A 2Z3DA 1NFYA 3OU0A 4O03A 5FBIA
chains in the Genus database with same CATH superfamily
2FP7B 2WPDD 2QXIA 4YT6H 1P0SH 3TH2H 4DCDA 1XVMA 3U8OH 1BDAA 1NFUA 2FESH 4CRDA 4Y7AA 3CS0A 2A4RA 1MTSA 1O0DH 2ZEBA 3Q76A 3GISB 2R3UA 5LPEA 3ZZ6A 3OFND 1SI5H 2TGPZ 1C4Y2 1ESTA 4CR5A 3T62A 2R0KA 1UVOA 2AMQA 1TGSZ 4X1NU 1SC8U 2RG3A 5C17A 3AAVA 1KMHB 3H7OA 1GGDC 1ZTJA 2UWOA 1ANBA 1BTUA 1GJ4H 2TBSA 3ODDA 3QO6A 4WH8A 2BY7X 1KXDA 3MH5A 1MCTA 5HM9A 1KLIH 4RT0A 4GUXA 4ZCNA 1T8OA 1CHOF 1TX8A 5C1YA 3QTOH 2HLDD 3BG4C 1A5HA 4K2YA 1H9HE 1W3CA 1NS3A 1BOQA 2PSYA 2F83A 3RMOH 1Y3WA 3ZZBA 4FVBA 3SHCH 3SZEA 5FCKA 2FOEA 1O2PA 1G32B 1O30A 3LKWA 2BVRH 3RLWH 2HVYB 2QY0B 4YTAA 2GTBA 1EKBB 2ZU2A 1DX5M 1V2PT 1C4U2 1HAPH 1A0HB 2P8OC 1YWUA 3KQCA 4MDSA 3BIUH 1AE8H 4WMFA 4CHAB 1NM6A 3AASA 4KKDA 5E0GA 1ELAA 1FV9A 5CE1A 1QA7A 1GBDA 1GMHG 3PLBA 3RU4E 3S9BA 1ESAA 3AVZA 1QL7A 2J97A 3EYDA 1ELDE 1XVOA 1KYNA 1YGCH 1RIWC 1OYQA 1B7XB 2BOKA 1T7CA 1E35B 4MG3A 1L1JA 2ZHDA 1GMCF 1GMDF 4XFQA 1H8HD 1HLTH 3UOPA 1CT4E 2A4QA 1BB0B 1SOTA 2A7CA 1FY8E 4GCHF 1XUGA 3L33A 1VCQA 2H9HA 5DP5A 1MQ5A 3SV6A 3UWIA 2EY4C 1GCDA 2FO9A 5DP3A 4AB9A 1ZTLA 1C4V2 1P2KA 4X8VH 1TMBH 4HI3A 4AZ2B 1GBAA 2ZO3H 7KMEH 2BX3A 1GBCA 1MD8A 1UVTH 1UK4A 1S82A 1KXEA 5HXFA 1P2IA 3D65E 4IGDA 1NRSH 4F49A 3RUOA 2FS9A 1BMMH 3T5FH 2V7QD 4NWLA 4I32A 2LIZA 1DOJA 2C3SA 4ABEA 4BOHA 5C67A 3MI4A 1XUFA 5DSFA 5JDUB 1B0FA 5JB8S 3SQHE 4H6TA 2ZF0H 2TGDA 5PTPA 1O2VA 5DO4H 2P94A 1ZSLA 3A89A 1THSH 4YESB 3SJ9A 3KQBA 4D7FA 1G9IE 4Y76A 1SFIA 4K8YA 2A2XH 1EPTB 2WSSD 2ZHQH 2HPQH 4I8GA 4Y7BA 1AZZA 1UTJA 3AW1A 3ZVBA 4DURA 2BY5X 3PWBA 4IC6A 2WUBA 3BTME 1L0ZA 1DXWA 5JBTA 7GCHF 1CT0E 1C2JA 2Z9IA 1HAVB 1UMAH 1P2OA 2CN0H 3CENA 4XBBA 1L1GA 3TNSA 1ARBA 5AFZH 4YLQH 3SJKA 4CH2B 2GDDA 4DT4A 1OOKB 3M5NA 4DY7B 2YMSB 1AO5A 4BNRA 2AS9A 1TPSA 3URDA 1BRBE 2AH4X 3SI3H 3F9EA 3SYJA 1AKSB 2OBOA 4JZDH 4UONA 1P57B 4A1VA 1SGTA 1GBTA 2FI4E 3MH4A 3VB4A 1TOMH 1HBTH 1OS8A 1C2KA 1THPB 1OWKA 1FAKH 4XDEA 1DY9A 2W7SA 2FYQA 1V2KT 2KCYA 4FUJA 1QRXA 2VH0A 3Q3YA 2PSXA 2FZZA 5EPNA 4YT7H 1B5GH 1O3DA 2QF3A 3MNXA 2Z9KA 1E1RD 1DVAH 2NWNA 1GDQA 2XNDD 3B8JA 2D1JA 3F9GA 3UB0A 3UIRA 1QIXB 1F92A 4WXVA 5FAHA 2V3MA 3AAUA 2FDAA 3MYWA 1EAUA 1FNIA 3V3MA 4Q7ZA 1KDQA 1QURH 3ZZ5A 2Q6FA 2VIDA 1LKBA 2G00A 1O3PB 5A0BA 5DP9A 1LVMA 2H5CA 3PO1B 5L2ZH 1KXCA 1LQEA 1GJ5H 1EP6A 2BX4A 2CXVA 1NRNH 3RM2H 5AF9H 1SQOA 4D8NA 4JYTA 1TABE 3MOCA 1D3TB 3SJIA 3SUDA 1OHHD 1XUIA 1MAYA 1OYTH 1S6FA 1AB9B 2VH6A 2ZPSA 3A8CA 2V35A 3DT0H 3RP2A 3P6ZB 3ZZ3A 3H09A 1C2FA 1HJ8A 1DANH 1W13U 1KXBA 2P95A 3BTTE 4THNH 4AFZA 2RDLA 3RXSA 1Z7KA 5CHAC 1UVSH 1MAXA 4F55A 1P3EA 5J4QA 1JXPA 1MD7A 2BQ6B 4CBNA 4B6FA 1SSXA 3A8DA 1C1SA 1WTGH 1C2LA 1YY3A 2W3KA 1WOFA 1Y5BT 4D9RA 1INCA 5H4IB 4AC9A 3RXUA 1IQKA 3KNXA 1EJAA 4CRFA 4GAWA 3GCOA 1F5RA 4DJZB 2WV4A 3FFGA 2SNWA 1EAXA 2ZPRA 2W6ID 3NKKA 3RXCA 3M5OA 2Y7XA 1NY22 2BYAX 4CH8B 3T2NA 3NCLA 2WHXA 1QL8A 4IN2A 2NU1E 1TNKA 3LC3A 1O3GA 2ZFPH 4U32A 2FM2A 3BTFE 2QIQA 3STJA 2D26C 3RXBA 5B6OA 1FIZA 2GCHF 2CJIA 4YZUA 1BMLA 2Q6GA 3EA9A 1KXFA 1C5VA 3PMHB 5T6GA 4UE7H 1Z6JH 2ZU3A 1A0LA 5A0CA 2FMJA 4Y79A 2C90B 6CHAC 3WWFA 2VVCA 2BY8X 1UJ1A 4WMEA 3SHAH 1TRMA 3A87A 5FPTA 4ASUD 3MU8A 4I7YH 1V2RT 1VITF 1OWDA 2ZC9H 1HAIH 2KFWA 2TIOA 1AE5A 1O3HA 1PFXC 4ACBA 3UTUH 2PV9B 2QCYA 1LHCH 1VGCB 2VJ1A 2ZGCA 4I8LA 3I77A 4X2YA 1Y59T 4ZHAA 2B8OH 1O3OA 1GJBB 3T28A 3OTJE 3N99A 5A0AE 1VJ9U 4E7RG 2FOCA 4AYYB 1NFWA 1MKWH 1T4VH 4TY7A 3M3SA 1K2I1 2P3FH 1TONA 1YF4A 4OGXA 3RXAA 2SFAA 1O2IA 2V3OH 4O9VA 4Y8ZA 4AYVB 2A32A 2ZGXH 1HFDA 5T1VA 1Y5UT 1TNJA 1GDNA 1YBWA 1SR5C 1OWEA 2PWXA 2C8ZB 1DLKB 1K1OA 1Y3YA 1OWJA 1A3EH 4FUHA 1CA8B 1N6YA 2FOFA 3QZRA 3AW0A 5EW1H 1O3AA 3P8OA 6ESTA 5A2MH 2BLOA 5GPIB 5FHTA 1O5EH 1ACBE 4Z6AH 1GDUA 2KCPA 3HPTB 3KYFA 1SLXB 1HXFH 3TH3H 1C1NA 2YNBA 2W26A 1C5RA 1P8VC 3VG8A 3UR6A 3U1IB 1V6DA 1TRYA 1T8MA 3VB5A 4RSPA 1MCVA 1A5GH 5I25A 4A6LA 4GSOA 1TNIA 2WZQA 2JETC 2NU2E 2H2ZA 2FYRA 2KAIB 5LPFA 3TJUA 3SO3A 1TE0A 3GY3A 4F48B 3RMLH 2QC2A 2J98A 1EOJA 1GHXH 1FMGA 1MKXH 2BLWA 2V0BA 2BHGA 1K28D 2XBWA 1MTNC 1TNLA 3LGUA 2P93A 2D2DA 4ZAEA 3E3TA 1IQIA 2NU3E 2G5VA 2G5NA 2HRVA 2VIOA 3SORA 2ODQA 1H8DH 4X0WU 3M3TA 3DUXH 1VCWA 1V2LT 1C5OH 4ZH8A 1K1IA 1AMHA 4OS5A 1J16A 1DWCH 1O2LA 2IN2A 2GJGA 2O9QA 2O8MA 4P00A 4Q80A 3CP7A 5TJXA 2SGAA 1TBRH 4ZMAH 4HZHA 1FI8A 3PWCA 3V7TA 1M9UA 5C94A 2PTNA 2FI3E 3CNRA 2FPZA 3R0FA 4WY3A 2A2QH 3SU4A 5C0TA 1GBBA 5LGOA 1YPEH 3TPIZ 3TK6A 1MUEB 3A8BA 5EGMA 1GGDB 2P16A 3W1EA 2J4IA 1ZHMA 1GBIA 1JMOH 2ULLA 1HAYB 1LHDH 3DCLA 1QB6A 2GZ9A 1O38A 2EI8A 4DIHH 5T6DA 1ELCA 3GY5A 2JJ1D 4B1TA 3BG4B 1GBJA 2QXJA 3TJNA 3SJ8A 1NBME 1O5DH 4KTCA 3MO6A 3MU4A 2JH0D 1UK3A 2QXGA 3M7TA 1TB6H 2OXSA 1HV7A 1O35A 3EBNA 1GL0E 3RXIA 1MBQA 1XM1A 4O3TA 2KCAA 2P8OB 2ZIQH 4PROA 1Q3XA 1CGIE 2L6OA 3KQ5A 3KL6A 4K8BA 3QLPH 1QRZA 3SBKA 3DSOA 2L74A 2G52A 2GX4A 1GJ8B 3ZVCA 2Z6BD 2IPHA 1MABB 3MTYA 3MNSA 2BVSH 2M2AA 2GV6A 3S9AA 1RIWB 2KR7A 1C5YB 2XCFA 3ATIA 3RXJA 4B73A 2G4TA 3RXTA 3P17H 2ZG0H 3SZNA 1S83A 1Y3UA 4ESTE 5IK2D 1BHXB 3RC4A 3UFAA 1GBHA 3FP8E 4JK6A 1RTKA 5E2OA 1C1TA 1Y5AT 2GT8A 1W14U 1ZJKA 4ZHMU 4CRAA 4Q7YA 1GI2A 4X6NA 1O2MA 5DP7A 1BTYA 1W11U 3LDXH 3SU6A 2A4OA 4TYDA 3BTDE 2PGBB 3BTGE 4Y0YE 1SHYA 2XRCA 2BD7A 3M35A 3A7XA 1WU1A 3BTWE 2A7HA 5FPYA 3RXQA 1AHTH 2ZDLA 3STIA 5EQSA 1EB1H 2B7DH 2ZCKP 1TNGA 1MKWK 3B9FH 3WWBA 1BIOA 1O5FH 2PW8H 2Z3EA 2VBCA 3GDSA 1BQYA 1O2SA 2A45B 4TT3D 1JRTA 2EQNA 1OP8A 3RXGA 2QAAA 3RC6A 4FXGH 4XOJA 1SKYE 4JMYA 3DSGA 2GP9B 4NIXA 5C5OA 4UEHH 3MNCA 4I31A 3RXVA 2WYJA 4ABBA 1YC0A 1YCPH 3DD2H 2B0FA 3VFEA 1GVZA 5EQQA 1TMUH 3RDZA 1ELVA 2ZTXA 1O39A 4WWYA 1KTTB 4OS7A 4NGAH 1BITA 4DT7B 3A85A 2PKSC 1BCUH 1GI4A 4DW2U 2NU0E 3NRLA 1QBOA 2B9LA 3SU3A 1GWAA 2QE7D 3LJOA 1A7SA 2TRMA 3EE7A 2Z9JA 2BXUH 4ZKRU 5F6MA 1XXFA 2V3HH 2FOGA 3M36A 3EAJA 2Z9GA 3TK9A 2CF9H 2CV3A 1ZPCA 2CK3D 2XC4A 3P8FA 4FU9A 3GY6A 5GDSH 1OSSA 5KECA 1KXAA 1JIMA 2DUCA 2Y80A 1QNJA 3PTNA 3GDVA 5FBEA 4ISLA 3SNCA 1MKXK 4MPVA 1COWD 2QF0A 2I6SA 3GCNA 2ZDAH 2Y81A 2K1QA 1GI8B 1VR1H 2OLGA 4BAKB 3TGIE 1MH0A 1CT2E 1O2UA 3A7WA 3M7QA 4FOUC 1TQ7B 1S85A 1DWEH 3KF2A 3MH6A 2W3IA 3KCGH 4CRCA 4IBLH 1NRPH 1ZLRA 1XMNB 4LXBH 3SI4H 4BTTB 1SGIB 1GPZA 1O2YA 2LNCA 3GY2A 4AG1A 3FOAA 3IWMA 3VEQB 4YO9A 3A86A 2P3UB 2OC1A 1CHGA 5C3NA 1UTQA 3QDZB 3M3VA 3AK5A 4JYVH 2H1UA 1O3EA 2W7UA 2BDYA 1SGFG 5ESTE 3ZVDA 3S69A 5E0HA 5EG4A 3K9XB 3ZZCA 5CHAB 3TITA 5BPEA 2BDIA 1OKXA 3S7KB 1FXYA 1EX3A 1KY9A 2G81E 1JOUB 1HRTH 1P01A 3ZZ4A 1H8IH 2OQUA 4D7GA 2H6MA 3LPRA 3N7EA 1HDTH 3ITIA 2HALA 1O2QA 1QHRB 1RRKA 4O3UA 4X6OA 5C5NA 1KTSB 2WUCA 2R9PA 1X7AC 2LP6A 5FPSA 2BZ6H 4Q2KA 4UFFH 1C2DA 3FAOA 1QQUA 3BTQE 2ANYA 1Z1IA 4MPWA 2ZHWH 5GJ4B 1YPKH 5JBAS 3Q3KA 4NZLA 1UTOA 1PYTD 1V2ST 1GHYH 2J9NA 4HFPB 5GCHG 3UUZA 1WYKA 4NIYA 5C2ZA 1K21H 1W0JD 2BD8A 2WPHS 1SGPE 5JBBS 1H9LB 9LPRA 2YMSD 4WXIA 1YLDA 4CREA 1FPHH 5EODA 5JPMH 2IJD1 1DUAA 4I86A 6CHAB 1P12E 1D9IA 3UAIC 3N7DA 4RKJB 1NRQH 2ODPA 2UUJB 5L30H 1ZSJA 5HIYA 2XYAA 2UUKB 2WV5A 2BLVA 1Q2WA 4DIIH 1SPJA 1TPOA 3L3TA 1UTPA 2SGDE 3VXFH 3OY5U 4FUGA 3EA8A 3FN8A 4ABAA 3UQVA 1A61H 1C5UA 3HGPA 1C5LH 1ANEA 4ZKOU 1NZQH 1E34B 4ISNA 3BN9A 4ZKNU 3LT3A 2SNVA 1WQSA 1YPGH 5E8EH 2H9EH 4I8JA 4AFUA 1GI7B 1YYY1 4MPXA 1AWHB 1U6QA 1D6RA 5TCAA 1QRWA 2FOAA 4K69A 2PUXB 2UWLA 1TA6A 3LGTA 1DT2A 1WXRA 3K65B 3GYMA 1C5SA 3M5MA 2RDEA 5GWZA 1WV7H 1HPGA 3PV5A 3SNEA 1YPJH 1F2SE 1ZSKA 2P59A 5G4BA 1Y3XA 4DG4A 3VB7A 3SN8A 1G30B 2A4GA 4MTBA 1S84A 3M5LA 1TIOA 2W6JD 1T32A 2ZNKH 4U30A 3PROA 1OWIA 3BEIB 1SLVB 1P06A 4CR9A 3PLPA 4KTUA 2GZ8A 1K1MA 4ISOA 3QX5H 1C1UH 4DGJA 1O3IA 1MZDA 4QT8C 1YCPK 1E37B 1W10U 4OS4A 1T8LA 3LGIA 4OS1A 5IDKA 2BQ7B 2VWLA 3RXRA 4IN1A 2OBQA 2BD4A 1W12U 2JETB 2ZTZA 1VJAU 1ZPBA 1HIAA 1G3EA 1LKAA 1KLTA 1ZMLA 1AD8H 1CBWC 3ATWA 1KDQB 2AFQB 1SGEE 2GD4B 1D3QB 3SGBE 2JH6D 2F4LA 2ZDKA 4OGYA 3SQEE 5EPYA 3BTEE 1MTNB 2AGGX 2VVUA 2PGQB 1TRNA 1THRH 3GY7A 3F2HA 2Y5HA 5ETXA 2FLRH 1ELBA 3V0XA 2BD3A 4YM9A 5JB9S 1EUFA 1DE7H 1QY6A 5E2PA 1Z6EA 3N7OA 3ZVFA 4AGKA 3PRBA 1CE5A 2ZWLH 3SGQE 3TK5A 2JJ2D 4AG2A 2Q1JA 1HB0B 3CS7A 1E79D 3ZVAA 3UWJH 1LVYA 2LELA 2PR3A 1ZYOA 1NU9A 1AVXA 3U28C 2ALPA 2PKAA 2VGCC 2FI5E 3M61U 3TJOA 1FQ3A 4CBOA 2A7JA 3GY4A 1GI3A 2Y5GA 1FY5A 3PYHA 3GCTG 1F5LA 2CHAC 2WINI 1YP9A 4ABHA 4TWWA 1DM4B 1LVOA 5HYOA 1ELFA 1JBUH 3P70B 1C1WH 5A8ZA 2R2WU 3SNBA 2RA3A 4ASHA 2FODA 3HGNA 2EEKA 3SU1A 4FU8A 3WY8A 1ZGIA 1TYNA 3RXPA 5EJLA 4VGCC 1SLWB 2AIPA 1LHGH 1YPHC 2XWBI 2BM2A 3TVJB 1GJDB 1W0YH 5LPRA 3A83A 1C1QA 1QB1A 2BD9A 3QN7A 5DPAA 1ZPZA 4NG9H 4X1RU 3RMMH 1AFQC 3RMNH 1BMAA 4A1XA 5J4SA 1AUTC 2WPIS 5EQRA 2Y6TA 4TWYA 4AOQA 1O2TA 4MNVA 3ZZ9A 2ZHEH 3GOVB 1YM0A 4JZFH 1LPZB 3BV9B 1SVPA 2A5KA 1FIWA 4RI0A 2XWAA 3DSPA 4IC5A 2Y7ZA 1DS2E 2THFB 2D8WA 5F53A 3QZQA 4R0IA 1AWFH 2OD3B 3O8CA 2A1DB 3M37A 3FZZA 4FU7A 2CF8H 2VWMA 3LGVA 2XBVA 4NA8A 1ZZZA 2O8LA 4KTSA 4INHA 1IHSH 2EC9H 1C5XB 1AUJA 5A8YA 1HJ9A 4YOJA 1FUJA 1HGTH 3F9HA 4X8SH 4K60A 1E36B 1O2NA 2VWOA 4MNXA 5AHGH 1YPHE 5EU8A 4XRNA 4BAQB 2ZECA 2XC0A 2A31A 1ESBA 5DN6D 5FXLA 1TALA 1YKTA 1O3JA 2SGQE 1FPCH 3A81A 1UHBA 4AB8A 1BTPA 2AEIH 2CMYA 4BANB 4NA7A 2JDID 4AN7A 1UCYE 1H9IE 1W2KH 3ESTA 1BUIA 1K1NA 1LDTT 3OE7D 1EASA 2ZTYA 4IMZA 3RXFA 4AORA 2XTTB 4ZXYH 1ANDA 1F0TA 4K1SA 2RFKC 1QR3E 1VZQH 1TNHA 1JIRA 2VIWA 3BSQA 1O3BA 1MMJN 1C5ZB 1NPMA 1P3CA 4Q4LA 2R3YA 1E1QD 1GI5A 4FUBA 1BRCE 5DGJA 3EDXB 3KQDA 4RKOB 2FS8A 2VNTA 1XKAC 1ZRBA 4CRGA 1YCPM 1C5QA 3FP6E 2F9PA 2STAE 4K1EA 3RU4D 3E16B 5CHBA 1C2GA 1UW7A 3PRDA 3ZZAA 3A7ZA 4HG6A 4NZQA 1O2JA 1IQGA 3D62A 3FVFB 1C1RA 1WCZA 1GHAG 2J98B 1AQ7A 2BDAA 2ZQ2A 1TX7A 1HNEE 3A7VA 4Y71A 1BRUP 1HYLA 1NROH 3SV7A 3ZIAD 2FTMA 2PKSB 5FX5A 2FOBA 1G3CA 1LCYA 1EXFA 1PPCE 3HK6B 4LOYH 1VKYA 2Z7FE 2O8UA 2F9OA 4Q7XA 1IQJA 4GPGA 3KN2A 4A5TS 1ELTA 3A80A 2J34A 3VB6A 1D3DB 4MLFB 4E06H 1RTLA 1AGJA 2PTCE 2YOLA 1BRAA 4ABFA 3D23A 3FO8D 2ESTE 4WMDA 1TFXA 3ENSB 1GHBG 1UTNA 2ANWA 4M9FA 2HNTF 1D4PB 1LMWB 4Y6DA 1QB9A 4B2AA 1UCYH 3S7HB 1SQRA 3KEEA 2R2MB 3Q3XA 1FAXA 3RXDA 3QGJA 2XW9A 4X1SU 2DE9A 3LOXA 1FN6A 1QBNA 2G55A 3F3BA 6GCHG 3SGAE 1LPKB 3MWIU 1Z8GA 1TPAE 1Z8JB 1GCTC 1EB2A 1NRRH 4BAMB 1EATA 2IPQX 1S6LA 1BMFD 1PPHE 3BEFB 3W95A 2WPLS 3LIWA 1DICA 3TNTA 5F03A 1P09A 2EI6A 2JH5D 3I78A 2ZFFH 4FUCA 1GJAB 4D9QA 1OPHB 1P2MA 1SGRE 1QBVH 4K3JA 4X8TH 4B71A 1ETRH 2GCTC 5F8TA 8LPRA 5AVDA 1ZHPA 3RU4T 8GCHG 1SGQE 3NZIA 2ZCLP 4MVNA 3PLKA 1GI6A 3F6UH 2ZFTA 4K5ZA 2C93B 1TBQH 4MNYA 1AFEH 1H4WA 2KCOA 5TCCA 4X6MA 1EZUC 1SFQB 3ZVGA 4ZUHA 2Y82A 1DLEA 1AY6H 3UR9A 2BD2A 5DP8A 2C8XB 2OP9A 1LO6A 3E0PB 1NT1A 1F7ZA 4YXWD 1C2MA 1WUNH 2HWLB 1A3BH 2QXHA 3F2GA 2ZGJA 2VB0A 3QGNB 1EZSC 1QA0A 4RN6A 4KELA 1QFKH 4D76A 2BDBA 1ZGVA 4NIWA 1RD3B 1O37A 4ZHLU 1HAOH 1T31A 2FOHA 1A46H 2A5IA 1AU8A 1CQQA 1GBLA 2G8TA 1QGFA 1ZRKA 1C1VH 5A8XA 1IQNA 1IQMA 4YOIA 1Y3VA 1MQ6A 2TGAA 3RXHA 1GG6C 3BTKE 2IJOB 1ETSH 2XBYA 3KQEA 4FUDA 1D6WA 2VVVA 3QUMP 5GCHF 1TGBA 2FOMB 5T3HA 4B75A 5JYIA 1S81A 3E1XB 1O3FA 3VGCC 4B2BA 1BT7A 1T4UH 4ISHH 1GHZA 1OX1A 1N1LA 1L4ZA 5ESBA 5FL7D 4BXSA 3SV8A 1C5TA 2OUAA 3H7TA 1IQEA 1SL3A 3HK3B 5DG6A 1DFPA 1HAGE 3NUMA 1EJNA 2WPKS 3SOSA 3T27A 1L1NA 4Z0KA 3G01A 5SGAE 1K0HA 4JYUH 1IOEA 5DP4A 1RGQA 2SGPE 3NWUA 1AVWA 3JZ1B 2J95A 1SGFA 2GMTC 3MU1A 4UFGH 1SMFE 4ABIA 1NFXA 4XD7D 3KHVA 3O8RA 3TGJE 2BLQA 2ZFSA 1XKBC 2CGAA 2F9VA 1TGTA 1SG8B 2SGEE 3QK1A 3T29A 1RJXB 2G4UA 4FUEA 3F9FA 1G3BA 3UOUA 3ODFA 4Y8XA 3ZYEA 3PTBA 1O3CA 3P8GA 4ABGA 4XBCA 1GJ7B 3BG8A 3SU2A 1E0FD 1MU6B 2K0QA 4I8HA 1P03A 4FUIA 1YPMH 4M7GA 2KX4A 1G37A 4X2VA 3SV9A 1O2RA 1ID5H 3MMGA 7ESTE 5K7RA 2RCEA 1W0ZU 1XUHA 1GL1A 1C2HA 4NFEA 3SNAA 2OC8A 1G3DA 1Z71A 4J1YA 4UFEH 1FX0B 1RTFB 2FLBH 1IHTH 3SJOA 3P95A 4SGBE 1CBWB 1WDIA 1W7GH 1RXPA 1UO6A 1UTMA 2ZU4A 3VXEH 1C5NH 1GI0A 1K1LA 3BIVH 2AERH 4B2CA 4IW4E 2BOHB 4X2XA 1P2JA 1C2IA 4H42U 2TPIZ 2ZA5A 3MU5A 3ZZ7A 3LGYA 1PPEE 3LU9B 2GZ7A 1UVUH 2AIQA 1DWDH 1AN1E 4JZEH 1MTVA 3EGKH 3PMBB 1ZMJA 1V2NT 2K7XA 2F91A 1UCYK 3P92A 2EA3A 3SUEA 2QF4A 4NA9H 2UUFB 1HJAC 1Z8RA 4BTIB 1C9TA 2ZHFH 3U69H 2WPJS 3ZZ8A 1S0RA 5GXPA 1V2QT 2ZFRH 3A7TA 2VGCB 3MH7A 3T26A 1TGNA 3VPKA 1TQ0B 4GVUA 2O8WA 1FZZA 5EXNA 1DPOA 3SUGA 1VITH 3I29A 4INLA 2RA0A 2CHAB 2HNTC 3UREA 1MTWA 3VB3A 3UNRA 5BRRE 1EAIA 1N8OC 2HOBA 3DHKH 5I46H 2ZQ1A 2P3TB 1GJCB 1CA0C 1O2OA 2GV7A 1O5GH 1ETTH 4VGCB 2NU4E 3OSYA 5DP6A 2HLCA 3PV4A 3MO3A 2AGIX 3RXEA 4LZ1H 1QQ4A 3KGPA 3GCTF 2OINA 3UNQA 1V3XA 1PPFE 1ABJH 1AFQB 1O5CB 3E90B 1O31A 2ZU5A 3IG6B 3U9AH 3HKIB 3U8RH 1P02A 1VCPA 1Z8IB 4ISIH 3D49H 1O3LA 1SQAA 5EW2H 1O2GH 1W7XH 4SGAE 1NN6A 4Y0ZE 1IQFA 3MU0A 3F0PA 1W8BH 1EPTA 1YPLH 2VU8E 2XXLA 3RXKA 2BB4A 1NO9H 1F0UA 2J5UA 5C1XA 2Y5FA 2HNTE 1DITH 3PB1E 5FCRA 3GY8A 1HAVA 3A82A 2Z3CA 1P10A 1QJ7B 3O8DA 3HKJB 3ZYDA 2ILNA 3GCHC 4E7NA 1C1MA 1ELGA 1FJSA 3P8NA 1BBRE 3ATKA 3Q00A 5C1UA 1CU1A 1ZTKA 1PJPA 2XOKD 1BA8B 3C1KA 3SU5A 4NCYA 1EOLA 1AKSA 1LPGB 1J9CH 4MPUA 4X2WA 3W94A 1RS0A 3KIDU 2QN5T 4ABDA 1AI8H 3RXLA 4NSYA 1EQ9A 1SOZA 3SNDA 3E91A 1QCPA 1CHOG 2IOTA 4WJG2 1IQLA 1NBMD 4XE4A 3A7YA 5ABWA 3GS9A 3MQKC 2F9UA 2BTCE 1O2HA 1PQ5A 2BQWB 3MO9A 1SGDE 4X1PU 1J17T 2BDGA 2FX4A 2J2UA 3O8BA 2BXTH 3TIUA 1D3PB 3UY9A 2F3CE 4KGAA 3ELAH 3U1JB 1HUTH 1EP5A 1V2MT 4INKA 3URCA 1BJVA 1V2WT 1MBMA 1GHVH 2C8YB 1TPPA 2R0LA 3V12A 1S6HA 1TAWA 1ZOMA 2OQ5A 3L6PA 4UD9H 2STBE 4OS2A 2YNAA 4JK5A 3B23B 3S0NA 4MQAA 3WW7A 1O36A 2ALVA 4BTUB 1IQHA 4F4OC 1C1OA 2OC7A 4Q63A 1HIAB 2TGTA 3IITA 2PFEA 1HAXB 1N6XA 5EXMA 4ZKSU 2UUYA 5L2YH 2FIRH 2UWPA 1W0KD 3QWCH 3V13A 2BVXH 1P9SA 1O33A 2BY6X 1H1BA 1S5SA 1JWTA 1K9OE 1OXGA 4WVPE 4A7IB 4Y8YA 2BDCA 1GMCG 4CHAC 3OTPA 1PQ7A 1GMDG 4FETA 5DK1A 3UPEA 1Y8TA 5F8XA 2BMGB 5HMAA 2C4FH 3MHWU 2AHME 4K1TA 4GCHG 1LHEH 1V2VT 1FONA 1G2LA 1NTPA 2H5DA 3OEHD 2ANMH 1C5MD 4E05H 3H5CB 2AMPA 4A92A 1F5KU 4IMQA 1V2UT 3M7UA 2WV9A 2XNIA 1GI1A 1GHAF 1FN8A 1GVKB 1ZHRA 1DY8A 2AMDA 1SQTA 1BBRH 1BTZA 1FY1A 4P02A 3NPSA 1DSTA 5EOKA 3OY6U 4LZ4B 2PKAB 3KYGA 2Q6DA 3UQOA 1QJ1B 1O5AB 3TH4H 1SBWA 4GHQA 1OWHA 1F0RA 5DKMA 1RFNA 3EA7A 4U2WA 2J92A 4OM9A 5GNDA 1WQVH 1F0SA 1Z1JA 3RXOA 4AX9H 2VIPA 4NFFA 1L4DA 2Z9LA 1TBZH 1UTLM 2OTVA 2F43B 4I33A 2A0QB 5A09A 3RM0H 4TPYA 5KGOA 5C20A 2LPRA 1GBEA 2ZDMA 4JZIA 1BMNH 4TY6A 1GHBF 3NXPA 4B6EA 1GCTB 1PPZA 5HGGA 5IYTA 2HGTH 4OS6A 1XX9A 4ABJA 1YLNA 4GHTA 5C0UA 7GCHG 1UVPA 1XUJA 1A5IA 1ABIH 4BAOB 3DFJA 3C27B 1P2NA 1UTKA 2KM0A 1K1PA 1HAZB 3HATH 6GCHF 2GCTB 1WTHD 1EPTC 4B76A 4ZROA 1LQDB 1FY3A 4Y11E 4U01A 1GI9B 5HM2A 1WBGB 1O2XA 1V2TT 3E6PH 1ZR0A 3GDUA 3Q77A 3LC5A 4YOGA 2H9TH 3NK8A 3TGKE 4CRBA 2ZPQA 3RLYH 2ZZUH 1PYTC 2ZU1A 5FX6A 1CVWH 4UDWH 2ZGHA 1J15A 2XBXA 3BTHE 1QTFA 2ZGBH 3ATMA 3LONA 1P05A 4Y10E 1GBFA 2HVXA 3EE0B 2YMSC 8GCHF 7LPRA 4YLUA 4TPIZ 3F1SB 5F8ZA 5GIBA 1C9PA 1QZ8A 2GGVB 1XXDA 2BY9X 3MFJA 1UHBB 4UFDH 2JKHA 3FANA 4RT1A 4Z1MD 3R3GB 1DWBH 2ZFQH 2G51A 1AVGH 3F68H 1CSOE 1O32A 1LHFH 2QA9E 3ZV9A 1MZAA 3JZ2B 1CGHA 1O2KA 1V2JT 4TSFD 1BTXA 5L6NH 3LH3A 2KAIA 4JCNA 2WPMS 4HTCH 1GG6B 2FTLE 3EQ0H 2FX6A 3ZVEA 1ZMNA 2PP6A 1O5BB 2ZDVH 4HGCA 1E38B 1TLDA 1A2CH 1OP2A 5HIZA 2DE8A 1O3KA 5E0JA 3VGCB 1WSSH 3PO1C 4WF8A 4X6PA 1P04A 1CO7E 1FY4A 2VIVA 3E0NB 3DFLA 2XCNA 3PMAB 5CDFE 2BD5A 1DDJA 4NWKA 1TMTH 2OCVB 4I8KA 1DUEA 1LTOA 1DSUA 1NESE 1AB9C 4A1TA 1O34A 6LPRA 2F9BH 3LGWA 1EAWA 1OP0A 4BXWA 1EFRD 1SGCA 3K6YA 3U8TH 1O2WA 2GMTB 5EJZA 1JRSA 2ASUB 2ZCHP 2ANKH 3DA9B 1P11E 5KEDA 1AZ8A 1B0EA 3FKSD 1CGJE 4AGJA 3TJVA 2GCHG 2FEQH 4XSKU 3GICB 5K0HA 1HAHH 4IS5A 3S9CA 1T8NA 1BTHH 3K6ZA 2QYIA 1QJ6B 1BHXF 1MU8B 5HKKD 3UNSA 1BJUA 5AFYH 1QL9A 3OAAD 2GDEH 1SGNE 3SV2H 3E8LA 2W5EA 2B5TB 1VITG 1C1PA 3F2FA 1KIGH 3QTVH 2QGRA 1A1RA 1J14A 2PHBA 2C8WB 1G2MA 1BZXE 1C5PA 3SU0A 1GJ6A 3K2UA 1S0QA 4FUFA 2OK5A 1IAUA 3F0OA 2JIZD 1UK2A 2ZDNA 2M5TA 2OC0A 1O2ZA 2O8TA 3SUFA 3ZV8A 1BTWA 1MTUA 5CMXH 5EJ1A 1G36A 2GT7A 1P2QA 4AFQA 5JBCS 3OYPA 1GBMA 4FVDA 5DJ7A 1FDPA 4NSVA 1C5WB 1SB1H 3A84A 1BBRK 3PMJA 1LVBA 2VINA 3A8AA 4GLYA 4XBDA 3ZZDA 9ESTA 4NIVA 1GJ9B 4DOQA 2AYWA 4O97A 1SLUB 2PUQH 2GVFA 1VGCC 2XC5A 3SW2B 2BZAA 4WH6A 5EXLA 2SGFE 2VIQA 2F9NA 4ZXXH 8ESTE 1GHWH 2FWWA 1V2OT 4ACAA 1TA2A 3LJJA 1KSNA 2EI7A 3FP7E 2ZKSA 1Q31A 3OEED 1H8ED 1HJAB 4H6SB 4MNWA 2FXRA 3PM3A 2VWNA 1L2EA 5T6FA 3MNBA 2QF5A 1ARCA 2HPPH 1AIXH 2KZ4A 3TLOA 2PLXA 1P9UA 2Z94A 1PQ8A 3LH1A 1EZQA 2BDHA 2I6QA 1PQAA 1FLEE 3BF6H 2V6NA 4H4FA 1N8OB 1J8AA 1GMHF 1KLJH 3PV2A 1C2EA 4B74A 1CA0B 3OX7U 2ZI2H 1TOCB 1K1JA 5EIYA 3RXMA 5LH8A 1SGYE 3TU7H 2GKVE 1GBKA 2ZP0H 2A5AA 1ZJDA 4X8UH 3BEUA 1EJMA 1HCGA 4KP0A 3A88A 1PPBH 1TGCA 1O3NA 1WAYB 8KME2 1DXPA 1XUKA 4X1QU 2ODYB 2WYGA 1K22H 1TX6A 1ORFA 3ATLA 3T25A 4R8TB 3GYLB 4BAHB 3FZDA 1A4WH 1HXEH 4LK4A 1ELEE 1NU7B 1YLCA 1EZXC 4DVAU 1PPGE 1ANCA 3RC5A 2AGEX 1O3MA 1TWXB 3U98H 1SHHB 4J2YB 5B6LA 4AFSA 2QV1A 3GCHB 2K8IA 1GVLA 1A0JA 2J38A 1NC6A 2J94A 4JZ1A 2Z3DA 1NFYA 3OU0A 4O03A 5FBIA
chains in the Genus database with same CATH topology
2FP7B 2QXIA 4YT6H 1P0SH 3TH2H 4DCDA 1XVMA 3U8OH 1BDAA 1NFUA 2FESH 4CRDA 4Y7AA 3CS0A 2A4RA 1MTSA 1O0DH 2ZEBA 3Q76A 3GISB 2R3UA 5LPEA 3ZZ6A 1SI5H 2TGPZ 1C4Y2 1ESTA 4CR5A 3T62A 2R0KA 1UVOA 2AMQA 1TGSZ 4X1NU 1SC8U 2RG3A 3AAVA 3H7OA 1GGDC 1ZTJA 2UWOA 1ANBA 1BTUA 1GJ4H 2TBSA 3ODDA 3QO6A 4WH8A 2BY7X 1KXDA 3MH5A 1MCTA 5HM9A 1KLIH 4GUXA 1T8OA 1CHOF 1TX8A 5C1YA 3QTOH 3BG4C 1A5HA 4K2YA 1H9HE 1W3CA 1NS3A 1BOQA 2PSYA 2F83A 3RMOH 1Y3WA 3ZZBA 4FVBA 3SHCH 5FCKA 2FOEA 1O2PA 1G32B 1O30A 3LKWA 2BVRH 3RLWH 2QY0B 4YTAA 2GTBA 1EKBB 2ZU2A 1DX5M 1V2PT 1C4U2 1HAPH 1A0HB 2P8OC 3KQCA 4MDSA 3BIUH 1AE8H 4WMFA 4CHAB 1NM6A 3AASA 4KKDA 5E0GA 1ELAA 1FV9A 5CE1A 1QA7A 1GBDA 1GMHG 3PLBA 3RU4E 3S9BA 1ESAA 3AVZA 1QL7A 3EYDA 1ELDE 1XVOA 1KYNA 1YGCH 1RIWC 1OYQA 1B7XB 2BOKA 1T7CA 1E35B 4MG3A 1L1JA 2ZHDA 1GMCF 1GMDF 4XFQA 1HLTH 3UOPA 1CT4E 2A4QA 1BB0B 1SOTA 2A7CA 1FY8E 4GCHF 1XUGA 3L33A 1VCQA 2H9HA 5DP5A 1MQ5A 3SV6A 3UWIA 4AB9A 1GCDA 2FO9A 5DP3A 1ZTLA 1C4V2 1P2KA 4X8VH 1TMBH 4HI3A 4AZ2B 1GBAA 2ZO3H 7KMEH 2BX3A 1GBCA 1MD8A 1UVTH 1UK4A 1S82A 1KXEA 5HXFA 1P2IA 3D65E 4IGDA 1NRSH 4F49A 3RUOA 2FS9A 1BMMH 3T5FH 4NWLA 4I32A 2LIZA 1DOJA 2C3SA 4ABEA 4BOHA 5C67A 3MI4A 1XUFA 5JDUB 1B0FA 5JB8S 3SQHE 4H6TA 2ZF0H 2TGDA 5PTPA 1O2VA 5DO4H 2P94A 1ZSLA 3A89A 1THSH 4YESB 3SJ9A 3KQBA 4D7FA 1G9IE 4Y76A 1SFIA 4K8YA 2A2XH 1EPTB 2ZHQH 2HPQH 4I8GA 4Y7BA 1AZZA 1UTJA 3AW1A 3ZVBA 4DURA 2BY5X 3PWBA 4IC6A 2WUBA 3BTME 1L0ZA 1DXWA 5JBTA 7GCHF 1CT0E 1C2JA 2Z9IA 1HAVB 1UMAH 1P2OA 2CN0H 3CENA 4XBBA 1L1GA 3TNSA 1ARBA 5AFZH 4YLQH 3SJKA 4CH2B 2GDDA 1OOKB 3M5NA 4DY7B 1AO5A 4BNRA 2AS9A 1TPSA 3URDA 1BRBE 2AH4X 3SI3H 3F9EA 1AKSB 2OBOA 4JZDH 4UONA 1P57B 4A1VA 1SGTA 1GBTA 2FI4E 3MH4A 3VB4A 1TOMH 1HBTH 1OS8A 1C2KA 1THPB 1OWKA 1FAKH 4XDEA 1DY9A 2W7SA 2FYQA 1V2KT 4FUJA 1QRXA 2VH0A 3Q3YA 2PSXA 2FZZA 5EPNA 4YT7H 1B5GH 1O3DA 2QF3A 3MNXA 2Z9KA 1DVAH 2NWNA 1GDQA 3B8JA 2D1JA 3F9GA 3UIRA 1QIXB 1F92A 4WXVA 5FAHA 3AAUA 2FDAA 3MYWA 1EAUA 1FNIA 3V3MA 4Q7ZA 1KDQA 1QURH 3ZZ5A 2Q6FA 2VIDA 1LKBA 2G00A 1O3PB 5A0BA 5DP9A 1LVMA 2H5CA 3PO1B 5L2ZH 1KXCA 1LQEA 1GJ5H 1EP6A 2BX4A 2CXVA 1NRNH 3RM2H 5AF9H 1SQOA 4D8NA 4JYTA 1TABE 3MOCA 1D3TB 3SJIA 3SUDA 1XUIA 1MAYA 1OYTH 1S6FA 1AB9B 2VH6A 2ZPSA 3A8CA 2V35A 3DT0H 3RP2A 3P6ZB 3ZZ3A 1C2FA 1HJ8A 1DANH 1W13U 1KXBA 2P95A 3BTTE 4THNH 4AFZA 2RDLA 3RXSA 1Z7KA 5CHAC 1UVSH 1MAXA 1P3EA 5J4QA 1JXPA 1MD7A 2BQ6B 4CBNA 1SSXA 3A8DA 1C1SA 1WTGH 1C2LA 2W3KA 4D9RA 1WOFA 1Y5BT 1INCA 5H4IB 3RXUA 1IQKA 3KNXA 1EJAA 4CRFA 4GAWA 3GCOA 1F5RA 4DJZB 2WV4A 3FFGA 2SNWA 1EAXA 2ZPRA 3NKKA 3RXCA 3M5OA 2Y7XA 1NY22 2BYAX 4CH8B 3T2NA 3NCLA 1QL8A 4IN2A 2NU1E 1TNKA 3LC3A 1O3GA 2ZFPH 4U32A 2FM2A 3BTFE 2QIQA 3STJA 2D26C 3RXBA 5B6OA 1FIZA 2GCHF 2CJIA 4YZUA 1BMLA 2Q6GA 3EA9A 1KXFA 1C5VA 3PMHB 5T6GA 4UE7H 1Z6JH 2ZU3A 1A0LA 5A0CA 2FMJA 4Y79A 2C90B 6CHAC 2VVCA 2BY8X 1UJ1A 4WMEA 3SHAH 1TRMA 3A87A 5FPTA 3MU8A 4I7YH 1V2RT 1VITF 1OWDA 2ZC9H 1HAIH 2TIOA 1AE5A 1O3HA 1PFXC 3UTUH 2PV9B 2QCYA 1LHCH 1VGCB 2VJ1A 2ZGCA 4I8LA 3I77A 4X2YA 1Y59T 4ZHAA 2B8OH 1O3OA 1GJBB 3T28A 3OTJE 5A0AE 1VJ9U 4E7RG 2FOCA 4AYYB 1NFWA 1MKWH 1T4VH 4TY7A 3M3SA 1K2I1 2P3FH 1TONA 1YF4A 4OGXA 3RXAA 2SFAA 1O2IA 2V3OH 4O9VA 4Y8ZA 4AYVB 2A32A 2ZGXH 1HFDA 1Y5UT 1TNJA 1GDNA 1YBWA 1SR5C 1OWEA 2PWXA 2C8ZB 1DLKB 1K1OA 1Y3YA 1OWJA 1A3EH 4FUHA 1CA8B 1N6YA 2FOFA 3QZRA 3AW0A 5EW1H 1O3AA 3P8OA 6ESTA 5A2MH 2BLOA 5GPIB 5FHTA 1O5EH 1ACBE 4Z6AH 1GDUA 3HPTB 1SLXB 1HXFH 3TH3H 1C1NA 2YNBA 2W26A 1C5RA 1P8VC 3UR6A 3U1IB 1V6DA 1TRYA 1T8MA 3VB5A 4RSPA 1MCVA 1A5GH 5I25A 4A6LA 4GSOA 1TNIA 2JETC 2NU2E 2H2ZA 2FYRA 2KAIB 5LPFA 3TJUA 3SO3A 1TE0A 3GY3A 3RMLH 2QC2A 1EOJA 1GHXH 1FMGA 1MKXH 2BLWA 2V0BA 2BHGA 1K28D 2XBWA 1MTNC 1TNLA 3LGUA 2P93A 2D2DA 4ZAEA 3E3TA 1IQIA 2NU3E 2G5VA 2G5NA 2HRVA 2VIOA 3SORA 2ODQA 1H8DH 4X0WU 3M3TA 3DUXH 1VCWA 1V2LT 1C5OH 4ZH8A 1K1IA 1AMHA 4OS5A 1J16A 1DWCH 1O2LA 2IN2A 2O9QA 2O8MA 4Q80A 3CP7A 5TJXA 2SGAA 1TBRH 4ZMAH 4HZHA 1FI8A 3PWCA 3V7TA 1M9UA 2PTNA 2FI3E 2FPZA 3R0FA 4WY3A 2A2QH 3SU4A 1GBBA 5LGOA 1YPEH 3TPIZ 3TK6A 1MUEB 3A8BA 5EGMA 1GGDB 2P16A 2J4IA 1ZHMA 1GBIA 1JMOH 2ULLA 1HAYB 1LHDH 1QB6A 2GZ9A 1O38A 2EI8A 4DIHH 5T6DA 1ELCA 3GY5A 4B1TA 3BG4B 1GBJA 2QXJA 3TJNA 3SJ8A 1O5DH 4KTCA 3MO6A 3MU4A 2JH0D 1UK3A 2QXGA 3M7TA 1TB6H 2OXSA 1HV7A 1O35A 3EBNA 1GL0E 3RXIA 1MBQA 1XM1A 4O3TA 2P8OB 2ZIQH 4PROA 1Q3XA 1CGIE 3KL6A 4K8BA 3QLPH 1QRZA 3SBKA 2G52A 2GX4A 1GJ8B 3ZVCA 2Z6BD 2IPHA 3MTYA 3MNSA 2BVSH 2GV6A 3S9AA 1RIWB 1C5YB 2XCFA 3ATIA 3RXJA 4B73A 2G4TA 3RXTA 3P17H 2ZG0H 3SZNA 1S83A 1Y3UA 4ESTE 1BHXB 3RC4A 3UFAA 1GBHA 3FP8E 4JK6A 1RTKA 5E2OA 1C1TA 1Y5AT 2GT8A 1W14U 1ZJKA 4ZHMU 4CRAA 4Q7YA 1GI2A 4X6NA 1O2MA 5DP7A 1BTYA 1W11U 3LDXH 3SU6A 2A4OA 4TYDA 3BTDE 2PGBB 3BTGE 4Y0YE 1SHYA 2XRCA 2BD7A 3M35A 3A7XA 1WU1A 3BTWE 2A7HA 5FPYA 3RXQA 1AHTH 2ZDLA 3STIA 5EQSA 1EB1H 2B7DH 2ZCKP 1TNGA 1MKWK 3B9FH 1BIOA 1O5FH 2PW8H 2Z3EA 3GDSA 1BQYA 1O2SA 2A45B 1JRTA 1OP8A 3RXGA 2QAAA 3RC6A 4FXGH 4XOJA 4JMYA 4NIXA 2GP9B 5C5OA 4UEHH 3MNCA 4I31A 3RXVA 2WYJA 4ABBA 1YC0A 1YCPH 3DD2H 2B0FA 3VFEA 1GVZA 5EQQA 1TMUH 3RDZA 1ELVA 2ZTXA 1O39A 4WWYA 1KTTB 4OS7A 4NGAH 1BITA 4DT7B 3A85A 2PKSC 1BCUH 1GI4A 4DW2U 2NU0E 1QBOA 2B9LA 3SU3A 1GWAA 3LJOA 1A7SA 2TRMA 2Z9JA 2BXUH 4ZKRU 5F6MA 1XXFA 2V3HH 2FOGA 3M36A 3EAJA 2Z9GA 3TK9A 2CF9H 2CV3A 1ZPCA 2XC4A 3P8FA 4FU9A 3GY6A 5GDSH 1OSSA 1KXAA 1JIMA 2DUCA 2Y80A 1QNJA 3PTNA 3GDVA 5FBEA 4ISLA 3SNCA 1MKXK 4MPVA 2QF0A 2I6SA 3GCNA 2ZDAH 2Y81A 2K1QA 1GI8B 1VR1H 2OLGA 4BAKB 3TGIE 1MH0A 1CT2E 1O2UA 3A7WA 3M7QA 1TQ7B 1S85A 1DWEH 3KF2A 3MH6A 2W3IA 3KCGH 4CRCA 4IBLH 1NRPH 1ZLRA 1XMNB 4LXBH 3SI4H 4BTTB 1SGIB 1GPZA 1O2YA 2LNCA 3GY2A 4AG1A 3IWMA 3VEQB 4YO9A 3A86A 2P3UB 2OC1A 1CHGA 5C3NA 1UTQA 3QDZB 3M3VA 4JYVH 2H1UA 1O3EA 2W7UA 2BDYA 1SGFG 5ESTE 3ZVDA 3S69A 5E0HA 5EG4A 3K9XB 3ZZCA 5CHAB 3TITA 5BPEA 2BDIA 1OKXA 3S7KB 1FXYA 1EX3A 1KY9A 2G81E 1JOUB 1HRTH 1P01A 3ZZ4A 1H8IH 2OQUA 4D7GA 2H6MA 3LPRA 1HDTH 3ITIA 2HALA 1O2QA 1QHRB 1RRKA 4O3UA 4X6OA 5C5NA 1KTSB 2WUCA 2R9PA 1X7AC 5FPSA 2BZ6H 4Q2KA 4UFFH 1C2DA 3FAOA 1QQUA 3BTQE 2ANYA 1Z1IA 4MPWA 2ZHWH 5GJ4B 1YPKH 5JBAS 3Q3KA 4NZLA 1UTOA 1PYTD 1V2ST 1GHYH 2J9NA 4HFPB 5GCHG 3UUZA 1WYKA 4NIYA 5C2ZA 1K21H 2BD8A 2WPHS 5JBBS 1SGPE 1H9LB 9LPRA 4WXIA 1YLDA 4CREA 1FPHH 5EODA 5JPMH 1DUAA 6CHAB 1P12E 1D9IA 4RKJB 1NRQH 2ODPA 2UUJB 5L30H 1ZSJA 2XYAA 2UUKB 2WV5A 2BLVA 1Q2WA 4DIIH 1SPJA 1TPOA 3L3TA 1UTPA 2SGDE 3VXFH 3OY5U 4FUGA 3EA8A 4ABAA 3UQVA 1A61H 1C5UA 3HGPA 1C5LH 1ANEA 4ZKOU 1NZQH 1E34B 4ISNA 3BN9A 4ZKNU 3LT3A 2SNVA 1WQSA 1YPGH 5E8EH 2H9EH 4I8JA 4AFUA 1GI7B 1YYY1 4MPXA 1AWHB 1U6QA 1D6RA 5TCAA 1QRWA 2FOAA 4K69A 2PUXB 2UWLA 1TA6A 3LGTA 1DT2A 3K65B 3GYMA 1C5SA 3M5MA 5GWZA 1WV7H 1HPGA 3SNEA 1YPJH 1F2SE 1ZSKA 2P59A 5G4BA 1Y3XA 4DG4A 3VB7A 3SN8A 1G30B 2A4GA 4MTBA 1S84A 3M5LA 1TIOA 4U30A 1T32A 2ZNKH 3PROA 1OWIA 3BEIB 1SLVB 1P06A 4CR9A 3PLPA 4KTUA 2GZ8A 1K1MA 4ISOA 3QX5H 1C1UH 4DGJA 1O3IA 1MZDA 4QT8C 1YCPK 1E37B 1W10U 4OS4A 1T8LA 3LGIA 4OS1A 5IDKA 2BQ7B 2VWLA 3RXRA 4IN1A 2OBQA 2BD4A 1W12U 2JETB 2ZTZA 1VJAU 1ZPBA 1HIAA 1G3EA 1LKAA 1KLTA 1ZMLA 1AD8H 1CBWC 3ATWA 1KDQB 2AFQB 1SGEE 2GD4B 1D3QB 3SGBE 2JH6D 2ZDKA 4OGYA 3SQEE 5EPYA 3BTEE 1MTNB 2AGGX 2VVUA 2PGQB 1TRNA 1THRH 3GY7A 2Y5HA 5ETXA 2FLRH 1ELBA 3V0XA 2BD3A 4YM9A 5JB9S 1EUFA 1DE7H 1QY6A 5E2PA 1Z6EA 3N7OA 3ZVFA 4AGKA 1CE5A 2ZWLH 3SGQE 3TK5A 4AG2A 2Q1JA 1HB0B 3CS7A 3ZVAA 3UWJH 1LVYA 2PR3A 1ZYOA 1NU9A 1AVXA 2ALPA 2PKAA 2VGCC 2FI5E 3M61U 3TJOA 1FQ3A 4CBOA 2A7JA 3GY4A 1GI3A 2Y5GA 1FY5A 3PYHA 3GCTG 1F5LA 2CHAC 2WINI 1YP9A 4ABHA 4TWWA 1DM4B 1LVOA 5HYOA 1ELFA 1JBUH 3P70B 1C1WH 5A8ZA 2R2WU 3SNBA 2RA3A 4ASHA 2FODA 3HGNA 2EEKA 3SU1A 4FU8A 3WY8A 1ZGIA 1TYNA 3RXPA 4VGCC 1SLWB 2AIPA 1LHGH 1YPHC 2XWBI 2BM2A 3TVJB 1GJDB 1W0YH 5LPRA 3A83A 1C1QA 1QB1A 2BD9A 3QN7A 5DPAA 1ZPZA 4NG9H 4X1RU 3RMMH 1AFQC 3RMNH 1BMAA 4A1XA 5J4SA 1AUTC