3F9HA

Crystal structure of the f140a mutant of sars-coronovirus 3c-like protease at ph 7.6
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
299
structure length
299
Chain Sequence
b'GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSALNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Two adjacent mutations on the dimer interface of SARS coronavirus 3C-like protease cause different conformational changes in crystal structure.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 77
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3f9hA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f9hA02
1QL9A 1V2TT 2QAAA 1KXCA 2BTCE 3A7ZA 3RXHA 4JZEH 3GISB 1SHHB 3ATLA 8ESTE 1PYTD 2HVXA 3PTBA 4AGKA 4BAQB 4O03A 4UONA 2ZFPH 3LONA 3U98H 4ZKNU 1ZTJA 5J4QA 1IQIA 2G5VA 1QA0A 2FS9A 1C5YB 2FTLE 1YLCA 2D26C 1C5NH 3BEIB 4NIYA 3BF6H 2PKAA 1GBAA 1SG8B 1AB9C 3EGKH 3V3MA 3Q00A 2WPMS 4ZHAA 1W10U 2B7DH 1SC8U 1TGNA 2GMTC 4X2XA 1Y3YA 1ZPZA 3KEEA 1OYQA 1T7CA 2GCTC 2HALA 3ESTA 5EQRA 2ZPRA 1HAOH 1ZGIA 3L3TA 4GCHF 3V13A 3F68H 1T8LA 5AHGH 1ZMNA 2PR3A 4A1VA 3UUZA 3QDZB 2GZ9A 2VWOA 3PMHB 3RXEA 1IQKA 1A61H 3A87A 1V3XA 3A84A 2D2DA 2F9BH 2LIZA 3F9FA 1LQDB 2GDDA 4Y71A 3GY3A 3V7TA 2TRMA 1KY9A 3ZZ6A 2WPHS 3PV4A 4D7FA 1S6FA 4CHAB 4KGAA 1L0ZA 1XX9A 1C9TA 4X1NU 3ZZDA 4NA7A 1O37A 2TGAA 1BB0B 1Z71A 2OINA 3ZZAA 4FXGH 5C67A 3QZRA 3SGAE 5IDKA 2XBYA 1JIRA 4IGDA 1BHXB 1IQLA 1P2OA 5JBTA 4GUXA 2XCNA 1CU1A 4BOHA 1ELDE 1FONA 3GDVA 1AZZA 1NT1A 4BNRA 3GY2A 1EP5A 1DX5M 4NFFA 1O2NA 1GMDG 3K6ZA 4X6MA 3U69H 1O5BB 1RTFB 2AS9A 4X1QU 2G51A 3SGBE 1O38A 2PHBA 1IQEA 2FX6A 1C2KA 1J14A 2G00A 2KAIB 3RU4D 3MMGA 5AFYH 1XUIA 1NN6A 1SB1H 2QC2A 2QXHA 3RXLA 2VIVA 3RXTA 1BTYA 2BOHB 3AW0A 1NC6A 1S85A 4O3UA 2P95A 3P70B 1YPKH 5GDSH 1ZSJA 3VPKA 4B1TA 1L4DA 3CENA 3TLOA 1TALA 1GHXH 3LGUA 4CRCA 2PKAB 2W3IA 1A0LA 1ESTA 3DUXH 1BTWA 1AWHB 1TNLA 4AORA 3NXPA 2AERH 4FUDA 1TRNA 4D76A 1Y5AT 4GCHG 3RMOH 4DT7B 3SJ9A 3SORA 1S5SA 4JZFH 1TABE 4CBOA 4AFSA 1O3GA 1HB0B 1O3KA 3NKKA 3SNEA 1PPHE 1O31A 1ZTKA 1UCYK 1BMAA 4MG3A 4BXWA 3PMAB 3HKIB 3JZ1B 2FOBA 3HKJB 2AMPA 1C1MA 2A2QH 2ZWLH 1GCDA 4DCDA 3TGKE 3KL6A 4YLUA 3Q3XA 1WU1A 3RXKA 5DO4H 3PWBA 3R3GB 1SQAA 2ODQA 1ETTH 4ZROA 4MDSA 4Y6DA 4GHTA 2ANYA 2ZA5A 1TE0A 2P93A 3GYMA 3SNBA 3MOCA 4U30A 5AFZH 4XBCA 1Y5UT 1KXEA 1P09A 1GJ5H 4H6SB 2ZHQH 2AH4X 2CJIA 2HNTE 1PPFE 2VINA 4Q7ZA 3NUMA 1O2UA 1UTMA 2HLCA 2ZZUH 3I29A 1TLDA 3U1IB 2G81E 2WPJS 2BD8A 1ACBE 3ZZBA 1NS3A 2NWNA 2VJ1A 1FN6A 1C2JA 1IHSH 2WV4A 1O5DH 1OX1A 1P57B 1D6WA 4K1TA 1GBDA 1QQ4A 1IQMA 2GKVE 3QZQA 5H4IB 1C2IA 1RD3B 2YNBA 1AN1E 3W95A 1JIMA 5T6DA 4KELA 2R2WU 5JBAS 1MH0A 3A7VA 4KTCA 1EXFA 4OS6A 4B75A 2H9HA 1AKSA 1CBWB 1GI3A 4NIXA 3RLYH 1C4Y2 3KQDA 4UFFH 1V2LT 3MNSA 1FIZA 1S84A 1TMUH 3VB4A 2GP9B 1TOMH 3SUGA 3HATH 3GCOA 5FPTA 3PM3A 5F8XA 1FUJA 1EOLA 5FPYA 1SR5C 3EA9A 2P8OB 1LDTT 3ATMA 2FI5E 1NPMA 3EQ0H 4H6TA 1AUJA 2ZHFH 3MU4A 1UVOA 3RXOA 3RXGA 3KNXA 1P04A 4Q7XA 1W0ZU 1EOJA 4ZH8A 1K1JA 1KXDA 1DS2E 4WF8A 1E38B 4CH8B 4F4OC 2STBE 1OS8A 1O2HA 3UNSA 1QTFA 1FMGA 2BOKA 3A80A 5HXFA 4IS5A 5A8XA 1V2VT 1NZQH 4K69A 2RG3A 1ANBA 1KLJH 1NROH 4OS4A 3BTTE 2THFB 5FX6A 4ASHA 1HXEH 1YYY1 4CH2B 1MKXH 3FAOA 4MNYA 3OY6U 3TVJB 4J1YA 2Q6GA 1O3LA 4FUEA 1S83A 1KDQA 3A85A 1YPLH 1BJVA 1TX7A 3ZZ9A 5C1UA 3KCGH 1D3TB 1NU7B 2J4IA 1YKTA 3BV9B 3UTUH 1D3DB 2Z94A 1O3EA 6CHAC 1V6DA 1FNIA 1E0FD 1GI5A 2ALVA 1RXPA 1XUFA 4GSOA 3D62A 1J16A 1W7XH 1GI1A 2OC7A 2DUCA 2H1UA 4WH8A 3SQEE 5L30H 2HNTF 4A7IB 1UHBB 1GI6A 1F5KU 1SLUB 1LKAA 1EJNA 3PROA 2Z9JA 2A4QA 1TOCB 3ZV8A 2NU2E 4LK4A 4H4FA 3B8JA 2QN5T 2F3CE 1P12E 3LGIA 1DSTA 5EPYA 1V2UT 1C1OA 3S9CA 3Q76A 4A1XA 1DITH 3L33A 9LPRA 5TJXA 1A7SA 3NPSA 1FIWA 1HAPH 4X2YA 4RKJB 5JB9S 2ZP0H 2IPHA 3S9AA 1AD8H 1FY3A 1U6QA 1K22H 2FOFA 1RTLA 1NTPA 4DURA 1MTVA 3M7QA 5JBCS 1QR3E 3SJKA 1VGCB 3MYWA 3UY9A 1IQGA 4ABBA 1K1OA 1TBRH 4JMYA 1CHOF 4BAMB 4ZKSU 1C5XB 2LPRA 2XXLA 1GHZA 4AX9H 2P94A 4NIWA 4Q80A 4YESB 3RXDA 2A4RA 1GL0E 4WXIA 2EC9H 3B9FH 1HNEE 3CS7A 4ISHH 5LPEA 2H2ZA 1AQ7A 3RMMH 4AB9A 4JK6A 2XWBI 2ANMH 1AFQB 3RC5A 2VH0A 1NFXA 3PYHA 3KQEA 2G4TA 1CHGA 1O2YA 1SGTA 2F9OA 1UVUH 2XCFA 1C5MD 2K7XA 1FJSA 2NU1E 3DD2H 2PKSB 2PTCE 3SJIA 5LH8A 3M7UA 3P8OA 3QWCH 2P16A 4QT8C 1J17T 1O3CA 2A32A 2STAE 1Q3XA 1T4UH 4X8TH 1HLTH 1KTTB 1HIAB 1FLEE 2IOTA 3MO9A 2SGDE 4BTIB 1SGFA 4K2YA 5FPSA 4CR9A 2ZTXA 3SU2A 4DJZB 1ABJH 1MCTA 1C5LH 3FP6E 3URDA 1SLXB 5AVDA 1AUTC 3LOXA 2BLWA 2Z9KA 5EU8A 1QB1A 4AFUA 2PGBB 3E6PH 2GMTB 1BOQA 1EKBB 3VB3A 1VCPA 1ELEE 5FHTA 2GCTB 2PSYA 3MNCA 2AMQA 1A0HB 4K3JA 1GHWH 1E36B 4AOQA 1WBGB 3ELAH 5DP4A 3MNBA 4U32A 1GWAA 1FY5A 2BZAA 2P8OC 4YT7H 2SGQE 1THPB 3VXEH 2HOBA 3TNSA 1O3BA 3O8RA 1DDJA 1TNJA 3QK1A 2BD3A 1AFEH 5A8YA 4A5TS 2BDIA 3GY7A 3HK3B 3RXBA 2B8OH 1KXFA 8KME2 1CHOG 3T28A 2D8WA 3AASA 1OWIA 5F6MA 1K9OE 2AMDA 3VEQB 5JB8S 3ATWA 1QBVH 3D65E 4ZKRU 1FAXA 1QIXB 1T31A 3G01A 3GOVB 3ZVEA 1TA2A 3M5MA 3QUMP 4INLA 3SJ8A 2QYIA 5DP8A 3RC6A 1K28D 1CT2E 1KTSB 1A5IA 1ZTLA 3PLKA 4K60A 1C1UH 2HPPH 2ZFFH 3SNCA 3BTWE 4YLQH 5E2PA 2AIPA 2OD3B 2BY8X 4I8HA 3I77A 1QCPA 1O2OA 4TWYA 1GVLA 3TH3H 3KIDU 2BQ7B 4ZXXH 2C3SA 1DWDH 1LHGH 1LVBA 3MI4A 1SGIB 1W2KH 1MKWH 2O9QA 3BTQE 3K2UA 2BVRH 1LKBA 2A4OA 2BVSH 4DG4A 1NO9H 1C5QA 1OPHB 1ZR0A 4ABDA 3SN8A 3F9GA 3A8DA 1Y3VA 2GVFA 1H9LB 1ZJDA 2O8WA 3H5CB 4R8TB 1H4WA 4Y8XA 1MMJN 3T27A 3VB5A 2FMJA 1YPHC 2GGVB 5EPNA 1RIWC 3SUEA 1VITF 2Z6BD 5C2ZA 1G3CA 1A3BH 3LJJA 5DG6A 3O8BA 2R0KA 4ZHMU 3T26A 1ZMLA 1DWBH 2LNCA 2WUBA 5DP9A 1PPZA 2ZDMA 3LDXH 1WUNH 1HCGA 3LPRA 4BAHB 2VGCC 1MQ6A 1UTQA 1HAYB 2ZECA 1HGTH 5EG4A 1Y3UA 5A0AE 1XKBC 1P02A 2WUCA 2BD5A 2OXSA 1C9PA 3ZV9A 2FODA 3UOUA 3RXMA 4IN1A 1KLIH 1VGCC 4H42U 3SJOA 3QX5H 1K1LA 1FY4A 1ESAA 3M3TA 1QNJA 1OP2A 4DW2U 1QBNA 3BTFE 1G30B 2FYQA 2BXUH 5B6OA 4TYDA 5PTPA 3A89A 1AE5A 3M36A 1WQSA 2JKHA 3ITIA 1PQ8A 5TCCA 3PO1C 1EJAA 2OLGA 1ELVA 1AFQC 1XVMA 1O2XA 2BXTH 2UWOA 1O2VA 4GAWA 1QB9A 3W94A 3RU4E 2A5IA 4BAKB 1KSNA 2AYWA 1O3MA 4MNVA 1O2JA 2BY9X 4D9QA 1F2SE 1LHFH 1A3EH 4NFEA 1UTNA 5HYOA 3HK6B 2Q6DA 2B0FA 1GJDB 2J94A 1D3QB 1MBQA 1V2PT 2VIWA 4ISIH 5EQSA 1TYNA 1C1QA 1TNHA 1AMHA 3KF2A 3SHAH 3LC3A 1O3IA 1NRRH 5J4SA 1LMWB 1O2KA 2C8XB 1SGQE 2AFQB 1VITG 2CXVA 3DFLA 1TWXB 3E3TA 2ZU2A 3AVZA 1HRTH 4OS5A 1TPOA 1GHYH 2RA0A 4FU7A 5EODA 2EI7A 3SV7A 2SFAA 2JETC 2R2MB 4MTBA 3SO3A 4E7NA 1ABIH 2BYAX 5T6GA 2GCHF 3M3VA 4AGJA 2PLXA 2BDCA 1WCZA 4MVNA 1BTXA 3OTJE 2BX4A 2BX3A 4MQAA 5IYTA 1XUJA 2YNAA 1OKXA 1XM1A 2BLQA 1MKXK 2O8MA 1SGRE 4NWLA 2ZPQA 1BMMH 4X1SU 1O32A 1BHXF 5T3HA 1QRXA 1XXFA 3SI4H 1QL8A 4AFQA 1BTHH 3LGVA 1F0UA 1AGJA 1T8MA 2XNIA 5LGOA 5EW1H 1ZRKA 1O33A 2DE9A 1Z6EA 1O0DH 3SU4A 2V3OH 4MLFB 2W7UA 3KQBA 2G8TA 2P3TB 4WJG2 1ETRH 1ID5H 4WMEA 3SQHE 3GDUA 1EAWA 2ZTYA 1NY22 1SLVB 6CHAB 2BY7X 2IN2A 1A5HA 2ZKSA 1WQVH 1S0RA 3GY5A 2GX4A 3RXAA 4CREA 3A8CA 1GGDC 1CGIE 1MZAA 3T62A 1L1GA 1GBKA 3MHWU 2VWMA 1YF4A 2QA9E 3FP7E 1UTKA 2XRCA 3M7TA 3E90B 3TK6A 5FAHA 1LHEH 1BBRE 2QXGA 1ELGA 3ZZ3A 1F7ZA 3UR9A 1LQEA 1WYKA 1GBCA 2ZEBA 4JYVH 5DGJA 1GVZA 4IC5A 4HI3A 3C27B 1FXYA 2FYRA 4XDEA 1L4ZA 2R3UA 5EW2H 4Y8ZA 2GCHG 1N8OC 2G52A 2A7HA 2GT7A 5SGAE 1NFUA 2PWXA 1O3DA 3M61U 2ZQ2A 1C1NA 4KKDA 1P2JA 4RSPA 4FVDA 3M35A 1T8OA 5GPIB 2ZTZA 1MD8A 3RXQA 1Z8GA 1TAWA 2J95A 1BTUA 1ZMJA 1OWHA 3ZYEA 3PMBB 2I6SA 2ZCHP 3T5FH 3SUFA 2HGTH 4I31A 1DXPA 2EI6A 1GHBG 1S81A 3SBKA 1QFKH 4Q2KA 1SGYE 4OS7A 1ARBA 1BA8B 2CF8H 3NK8A 4BXSA 3E0NB 1J15A 3A86A 1PPBH 4ABGA 4D8NA 3F9HA 2ZCKP 1TGSZ 2BDBA 2QY0B 1JRTA 4IC6A 1SMFE 4K8BA 4MPUA 5L6NH 2GZ7A 1ZLRA 4XOJA 3ZVDA 4B71A 1UTPA 2FM2A 3SNDA 5DKMA 4NZLA 3STIA 1EASA 1GBIA 1C1VH 2NU0E 4U01A 4E06H 2Y5FA 4FU8A 1J8AA 4CR5A 1ZHRA 1QURH 2ZNKH 1O2TA 4YTAA 2Y5GA 1PQ7A 1NESE 1TMTH 4JYTA 1E35B 2ZHWH 4HFPB 2TBSA 3MNXA 1O2MA 4MNWA 5CMXH 2JH6D 2VIOA 4HTCH 4ZKOU 1C2EA 1UHBA 4FU9A 2ZGCA 4ABEA 4E7RG 1G37A 2OQ5A 4X2VA 2OBOA 2WYGA 4YOJA 2JH5D 2C4FH 2A31A 1IOEA 5DJ7A 1GBLA 2FOMB 2FTMA 2SNWA 2FOGA 1C2GA 2V6NA 1GMCG 2IJOB 2GDEH 2ZG0H 3TH2H 2Z7FE 1C1PA 1O35A 5FCRA 1IQHA 5GWZA 3EA7A 1GJCB 2QXIA 1HJAB 4LXBH 2WPLS 1LO6A 3Q3KA 5JDUB 2ZGXH 3M3SA 4HGCA 2TIOA 1MTUA 1O2PA 1VITH 2ZIQH 5A0BA 5A8ZA 1O34A 3Q3YA 2G55A 2FEQH 2ZDNA 1D9IA 1HXFH 1BITA 1P0SH 2V3HH 1C5OH 4DIIH 1O2IA 2WPIS 4K1EA 1Z7KA 3PLPA 1C1SA 3ZZ4A 3F9EA 1NRNH 1PJPA 3ATIA 3PB1E 1F5LA 1ELCA 7ESTE 4FUCA 1P8VC 1IHTH 1DUEA 3AW1A 1MKWK 2BD9A 2EEKA 1G36A 1WTHD 5EGMA 2BQWB 1O3PB 1KYNA 4INHA 3IITA 2BM2A 1K21H 4NA8A 1EQ9A 3FANA 1YLDA 2GD4B 1MU8B 4FUJA 3F1SB 3M37A 2V0BA 1EAUA 2UUJB 3TJOA 1SPJA 2PUQH 1A2CH 2Q1JA 2RDLA 4MNXA 3S69A 1QA7A 1Y8TA 2CN0H 1EZUC 2PGQB 1HIAA 3SZNA 1NRPH 1SGPE 3AAUA 2OC8A 1BJUA 4YOGA 1O39A 2OBQA 3TU7H 1L1JA 3FP8E 3S9BA 1T32A 1W11U 5ESTE 2TGDA 1Y3XA 2HPQH 1Y3WA 4Z6AH 3BTHE 3RXRA 2Z3DA 3GY6A 1OWKA 2C93B 3BG4B 4A6LA 1OWEA 1RIWB 1V2WT 1N6XA 5LPRA 3RP2A 5LPFA 5EXNA 1H8IH 4Y0ZE 4ZUHA 4O9VA 1LHCH 1GL1A 1QJ7B 1XUKA 1Z6JH 1O36A 1HAVA 1GDUA 4AZ2B 2ZU4A 1ANEA 1C2DA 1ZPBA 1GHAG 2VGCB 2ESTE 1TX6A 1C5RA 2ANKH 2WYJA 1WOFA 3RDZA 1P05A 1ELBA 1S0QA 3IWMA 4ZXYH 1G3BA 1MTWA 5GCHG 5FX5A 1QGFA 5DP7A 1O2SA 1UK4A 2UUYA 3JZ2B 1T4VH 4WVPE 2Y81A 1GDNA 3BG8A 1PQAA 4DIHH 5ABWA 2Y80A 1DT2A 1IQNA 1SSXA 2SGFE 3BTKE 3PO1B 1SLWB 1IAUA 1W8BH 5JBBS 2NU4E 3A88A 3MH7A 1ZPCA 3VXFH 2G4UA 4X2WA 2WV5A 3LGTA 4NSVA 4ESTE 1BRBE 1VCQA 3T29A 1SOZA 3SV9A 5HM9A 2Y82A 1OXGA 4IBLH 5HGGA 2HRVA 2AGIX 1HAGE 2SGAA 1C5TA 1MTNC 2XC0A 4BTUB 1QRWA 1ZSLA 5EXMA 4JYUH 1G3DA 2ZGJA 3E16B 2H5DA 1H9HE 1P03A 1THRH 2SGEE 2TGTA 1SGDE 1AVGH 1C4V2 2JETB 1G32B 2BMGB 1P9SA 4YO9A 3UWIA 2VU8E 2AEIH 1TNKA 3SU1A 2C8WB 1GJ6A 2BY6X 1K1NA 1DFPA 3MU8A 4SGBE 4AG1A 3SW2B 3NCLA 3EYDA 2ANWA 1Z1IA 1MAXA 1DSUA 1HAVB 1HJAC 1O3OA 3U9AH 1VCWA 1GCTB 3M5NA 1LVMA 3EA8A 3ZZCA 2GV6A 2AIQA 1IQJA 1C2MA 3MU1A 1BDAA 4I8KA 3OYPA 1Z1JA 4WH6A 1W3CA 2WPKS 1ETSH 1EPTC 1GBTA 4THNH 2BDHA 3FVFB 1OWDA 3BEUA 1UMAH 1BTZA 1O2QA 1FV9A 4WY3A 4AYYB 1N1LA 1EATA 1TA6A 5L2ZH 1GI9B 2J2UA 1AVXA 2PKSC 1G2MA 3MU0A 4JZ1A 1LHDH 4OGXA 2YOLA 5E0JA 4Z0KA 4AN7A 2Y7ZA 1RJXB 1C4U2 5A2MH 3CS0A 1DUAA 3DHKH 4YT6H 3UREA 3U8RH 1TX8A 1DE7H 4I32A 2FI4E 5GIBA 1TQ0B 2TGPZ 4GLYA 1N6YA 1CSOE 1GGDB 2FDAA 3A8BA 4Y8YA 1MQ5A 4CBNA 3RXVA 3SV8A 1SFIA 2PTNA 1SGNE 1ZZZA 1HAZB 1V2ST 3RC4A 3H7TA 3RMNH 3VGCB 1P3CA 1Y59T 1BRAA 1AU8A 1TMBH 3N7OA 3P17H 3O8CA 2TPIZ 3BG4C 5G4BA 1LPZB 3RXSA 1YGCH 1MTSA 1DOJA 1CGJE 1C1RA 4AFZA 2OC0A 3UWJH 3GICB 4X6NA 1HJ9A 1SGEE 3A82A 1N8OB 3GY4A 3ODFA 1O3AA 1NRQH 1QJ1B 3SOSA 1C5UA 2H9TH 2FWWA 3TK5A 4KTUA 3F6UH 1FAKH 2OTVA 2EA3A 4ABHA 3SV6A 1FI8A 1SGCA 1ZGVA 3SU0A 6GCHG 1F0TA 2ASUB 1UCYE 1BZXE 4DOQA 2ZHDA 4B2BA 2XBVA 1GJ8B 1P2NA 3T25A 2BB4A 2UWPA 1WSSH 4Y0YE 2HNTC 4Y11E 4ABJA 4TY6A 4K8YA 2QXJA 2ODPA 2ZU1A 1BBRH 1XKAC 3SI3H 1VJAU 4XE4A 3UOPA 3S7HB 4RN6A 1XUHA 4NIVA 3RXFA 4VGCC 1Y5BT 1GBEA 1TNGA 4X8UH 3DFJA 2Y7XA 4CRFA 2A2XH 2OUAA 5DPAA 5DP5A 2I6QA 1JWTA 1ARCA 2ULLA 4LZ4B 1TBZH 4X6OA 2FPZA 1EZSC 4FUFA 4FVBA 1SGFG 2QCYA 4ABFA 4TPIZ 1MZDA 1V2QT 5C5NA 2BD7A 4D7GA 3MH6A 3A83A 4AB8A 1BCUH 2VIDA 1SBWA 1K2I1 1XUGA 2CGAA 1OP8A 1AE8H 1XMNB 3A7TA 1YCPH 1O3NA 2W7SA 1DWEH 1ANDA 1CO7E 1HAXB 1TGBA 3TGJE 1O5CB 3QGNB 1TONA 1E37B 2VWNA 2A5KA 2QF0A 1W0YH 3GCHC 4RKOB 3D23A 1G9IE 1DY8A 1QQUA 1CQQA 2BDYA 3QO6A 2FOHA 4AG2A 4BANB 5FBIA 1SQTA 3P8GA 4Y7BA 6ESTA 1GJ9B 5FCKA 1TPAE 2FLRH 1FQ3A 3SGQE 1C5VA 1YP9A 1ELAA 4GPGA 2UUFB 1YBWA 2GTBA 4UEHH 1P2MA 4BAOB 1GCTC 2RA3A 5E0GA 2J38A 3TNTA 3EDXB 4E05H 2ZU5A 2W26A 1O5GH 2Y6TA 4OS1A 2AGEX 1TPPA 1ZHMA 3SU5A 3ENSB 1K1PA 1O5FH 1GHBF 3C1KA 4ABAA 1BRCE 1DWCH 1UVTH 2J34A 1V2RT 3GCNA 1H9IE 2A0QB 5E0HA 9ESTA 2VVVA 4JZIA 5F8TA 2VIQA 1EB2A 3A7WA 7GCHF 1GDQA 2PFEA 2B9LA 2A7CA 3DA9B 2FLBH 4PROA 1O5AB 1DVAH 2Z9IA 1HYLA 1GPZA 1A5GH 2XC4A 4ZMAH 2BVXH 2H5CA 2FS8A 1RGQA 2VIPA 3QTVH 1HDTH 5JPMH 1FPCH 2FZZA 4KP0A 1BT7A 3PLBA 4ZHLU 1KIGH 1CT0E 1P11E 3ATKA 1DPOA 1TFXA 1HJ8A 2ZFTA 3WY8A 1GG6B 3E0PB 3EAJA 1P10A 1H1BA 1HV7A 3TK9A 1B0EA 3RXUA 2C90B 3ZVFA 3U1JB 4NWKA 3VGCC 2A4GA 2F9UA 2UWLA 1Z8RA 2ZFRH 1BQYA 3HGNA 5C1XA 1V2NT 1ANCA 4IW4E 1QB6A 4HZHA 2FI3E 1INCA 5GJ4B 4I8LA 4A1TA 1V2JT 2HWLB 2FO9A 3ZVCA 4CRGA 1O30A 3URCA 3LH3A 1JBUH 1VJ9U 4TPYA 1C2HA 1XXDA 1YPMH 2R0LA 4R0IA 2A5AA 4YZUA 1F92A 2GT8A 3KQCA 1TNIA 1GMCF 3K65B 2O8UA 1PPEE 3K9XB 4ISNA 4B2AA 1MBMA 4Y76A 3TITA 4IN2A 1C1WH 1ZJKA 3RMLH 1RS0A 3TIUA 1SL3A 2XW9A 2VWLA 1KXAA 4X8VH 1EZXC 1AY6H 3PMJA 1O3HA 4X8SH 2ZU3A 1EPTA 2BDGA 4K1SA 1W13U 2PV9B 3A7XA 3B23B 1JXPA 3M5OA 4NG9H 1YCPM 1W14U 1A1RA 4Y7AA 5HM2A 1O5EH 3UFAA 1L2EA 4B73A 4YM9A 2ZCLP 5DP3A 2J92A 3MH4A 4J2YB 2PSXA 3ZVAA 1C1TA 2BD2A 4YOIA 4OS2A 1VZQH 1HBTH 3UQOA 1YPHE 1QRZA 7GCHG 1W12U 2C8ZB 2ILNA 1B0FA 4I33A 1ELFA 1GJ4H 2ZGBH 4O3TA 4ABIA 1EB1H 5I46H 2P3UB 5C5OA 2H9EH 5EXLA 1D6RA 2R9PA 4Y79A 1NFYA 1OOKB 1AZ8A 4FUHA 1C5PA 2VNTA 5EOKA 3E8LA 5TCAA 1C5SA 3EBNA 5E8EH 1ELTA 1RRKA 2FX4A 4UFGH 4B2CA 3KGPA 5L2YH 2SNVA 3SU3A 2ZDVH 2ZDLA 1TPSA 1QL7A 3MO3A 1FZZA 2CF9H 8LPRA 1NM6A 2R3YA 1MAYA 3MWIU 1OYTH 1FDPA 1RFNA 1HAIH 3TGIE 1S82A 2ZHEH 3RXPA 4F49A 1MTNB 3P8FA 5A09A 1GI4A 4NCYA 1GBJA 3ZYDA 4KTSA 3KN2A 2PW8H 2EI8A 4SGAE 3PTNA 3OY5U 2ZQ1A 4OGYA 2ZC9H 1AVWA 1E34B 1CA0B 5EQQA 3LJOA 2O8LA 3MFJA 4WWYA 1P06A 4LOYH 4UE7H 1DLEA 2XWAA 3R0FA 4DVAU 2ZO3H 2FP7B 4I7YH 1GI0A 3GCTF 1MCVA 1P01A 3E1XB 1GHAF 1LVOA 1O2ZA 1YC0A 4CRDA 2ZI2H 1UTLM 2CHAB 2JH0D 4FUIA 3EE0B 4NZQA 1BUIA 1EPTB 3VB7A 1DM4B 5ETXA 2VVCA 4TWWA 2XYAA 1YPJH 1C5ZB 5CHAB 1GVKB 1PPCE 3OU0A 3IG6B 5GCHF 3UR6A 4WMDA 1P2KA 4U2WA 2BD4A 3DT0H 1AWFH 2ZDAH 1GJBB 2F91A 4ISLA 1ZOMA 3VFEA 1PYTC 1DICA 1AHTH 1O3FA 1SI5H 3I78A 1FY1A 1CGHA 3BTME 2ZPSA 2QF3A 1DLKB 4CHAC 3UPEA 1OWJA 3UIRA 1FN8A 1XVOA 2BZ6H 5K7RA 3RM2H 2OCVB 1BTPA 1P2IA 1LTOA 1A4WH 3VB6A 1BMLA 4ISOA 1MUEB 1YPGH 2FXRA 5FXLA 3UNQA 1C2FA 1GG6C 1F0SA 4B74A 2BQ6B 3SU6A 2Z9LA 2XC5A 1QHRB 2FOCA 1EP6A 2BDAA 1AI8H 3BTDE 1EJMA 1GI8B 1UTOA 1NRSH 2W5EA 3L6PA 3AAVA 1D3PB 3S7KB 1OSSA 2Q6FA 1HFDA 2F83A 1MU6B 2XTTB 1EUFA 3FZDA 4IMQA 3ZZ7A 3BTGE 5C3NA 2RCEA 3PWCA 3QGJA 3RXJA 4CRBA 3U8TH 3GCTG 4JK5A 1HAHH 1LVYA 3V12A 1BBRK 1O2GH 5BPEA 1PQ5A 3HGPA 4I8GA 4TY7A 3RM0H 1GBMA 2ZGHA 1AKSB 1GJ7B 1YM0A 3O8DA 5T6FA 3A81A 3UNRA 1BMNH 4XBBA 4NA9H 4NGAH 4DGJA 2BLOA 1FPHH 2H6MA 1JMOH 1ESBA 1KXBA 1GBFA 3TJUA 4FUBA 6LPRA 5JYIA 1QJ6B 4O97A 5DP6A 1GHVH 1G2LA 4VGCB 2F9PA 4X6PA 4A92A 1IQFA 1Z8JB 2FESH 3ZZ5A 1SHYA 3LH1A 1V2OT 2ZFSA 3BIVH 2P59A 5E2OA 3D49H 3A7YA 1Q2WA 1SVPA 2OQUA 4MPWA 1HPGA 1YCPK 3MTYA 5F8ZA 2P3FH 1THSH 4B76A 2GZ8A 1C5WB 5DK1A 2GV7A 1SFQB 1UO6A 3LU9B 4XSKU 3SV2H 2ALPA 2C8YB 1CT4E 2Z9GA 1EZQA 1UCYH 2WINI 4X1PU 1EAIA 1ZSKA 2CMYA 3LKWA 1DY9A 2OP9A 2XBWA 3P8NA 5ESBA 5AF9H 3LGYA 1EAXA 1GJAB 3BN9A 1LPKB 2AGGX 3HPTB 1KDQB 4X0WU 3NWUA 1B7XB 1FY8E 5BRRE 1TQ7B 3RXIA 3GCHB 1J9CH 3ZZ8A 3ZVGA 4DY7B 4GVUA 4AYVB 2G5NA 3RXCA 3RLWH 3RUOA 1TIOA 1QBOA 3P6ZB 1PPGE 1CA0C 1HUTH 1UVPA 1CVWH 3LT3A 1O2RA 4BTTB 1TB6H 3BTEE 1UVSH 1P3EA 3V0XA 1LPGB 2F9NA 2O8TA 1WV7H 1OP0A 1W7GH 3QLPH 4LZ1H 1UK2A 3S0NA 2W3KA 3E91A 1AB9B 2XBXA 1CBWC 3QN7A 1GBHA 6GCHF 2BY5X 2FOEA 1ZYOA 2CHAC 2V35A 3KHVA 3A8AA 4D9RA 3MO6A 1BIOA 2QGRA 3BSQA 2QIQA 4ZAEA 5CHAC 1AO5A 1K1IA 4Q7YA 5F03A 2DE8A 2PUXB 3BIUH 3M5LA 2UUKB 2FOAA 3BEFB 1GI7B 1P9UA 1S6HA 4CRAA 3H7OA 4JZDH 5CE1A 2VB0A 1GMHF 3NZIA 1MD7A 8GCHF 1GBBA 3GY8A 3SHCH 7KMEH 2OC1A 1F5RA 2A7JA 3CP7A 4WMFA 4NSYA 3LIWA 2FIRH 3UQVA 4UFEH 1D4PB 4K5ZA 3SUDA 1G3EA 5A0CA 1ZHPA 1ZRBA 3SNAA 1O2LA 1VR1H 2Y5HA 2F9VA 4UDWH 1H8DH 2VVUA 3STJA 1LCYA 4Y10E 1TRYA 1Z8IB 4UFDH 4GHQA 3TPIZ 2VH6A 5GXPA 3QTOH 3FFGA 4WXVA 3T2NA 2ZF0H 3MH5A 2ODYB 5I25A 3FZZA 3K6YA 1CE5A 1UTJA 2SGPE 1SOTA 2D1JA 1WTGH 3GDSA 2K1QA 1X7AC 4INKA 1GI2A 1JRSA 4JCNA 4X1RU 2BLVA 2B5TB 3Q77A 1B5GH 5K0HA 1BRUP 1YPEH 2QV1A 1QY6A 1TBQH 5C1YA 1EX3A 3TJVA 1UK3A 2CV3A 2Z3CA 3P92A 3U8OH 1RTKA 1F0RA 1C2LA 4IMZA 3RU4T 3ZVBA 1Q31A 3GYLB 4XBDA 1A0JA 1TGTA 1GMHG 1L1NA 2NU3E 3LC5A 1M9UA 8GCHG 5C20A 1WAYB 3MU5A 1UJ1A 3TJNA 4XFQA 4M7GA 3OSYA 1O3JA 2ZFQH 1DXWA 1SQOA 5FBEA 1PFXC 4UD9H 7LPRA 4MPVA 4I8JA 1NU9A 2Z3EA 3TH4H 2M5TA 1AIXH 1V2KT 1JOUB 1P2QA 1NFWA 4FUGA 1O2WA 1T8NA 3OX7U 1DANH 1TGCA 2BHGA 2A45B 2J9NA 2A1DB 1K1MA 1KLTA 2ZDKA 3P95A 1V2MT 1TRMA 1A46H 1ORFA 3LGWA 1CA8B 4MPXA 1GMDF 5HMAA 3ODDA 2KAIA
chains in the Genus database with same CATH superfamily
1QL9A 4RI0A 1V2TT 2QAAA 1KXCA 2BTCE 3A7ZA 3RXHA 4JZEH 3GISB 1SHHB 3ATLA 8ESTE 1PYTD 2HVXA 3PTBA 4AGKA 4BAQB 4O03A 4UONA 2ZFPH 3LONA 3U98H 4ZKNU 1ZTJA 5J4QA 1IQIA 2G5VA 1QA0A 2FS9A 1C5YB 2VBCA 2FTLE 1YLCA 2D26C 1C5NH 3BEIB 4NIYA 3BF6H 2PKAA 1GBAA 1SG8B 1AB9C 3EGKH 3V3MA 2J98B 2WPMS 3Q00A 4ZHAA 1W10U 2B7DH 5C0TA 1SC8U 1TGNA 2GMTC 4X2XA 1Y3YA 1ZPZA 3KEEA 1OYQA 1T7CA 2GCTC 2HALA 3ESTA 5EQRA 2ZPRA 1HAOH 1ZGIA 3L3TA 4GCHF 3V13A 3F68H 1T8LA 5AHGH 1ZMNA 2PR3A 4A1VA 3UUZA 3QDZB 2GZ9A 2VWOA 3PMHB 3RXEA 1IQKA 1A61H 3A87A 1V3XA 3A84A 2D2DA 2F9BH 2LIZA 3F9FA 1LQDB 2GDDA 4Y71A 3GY3A 3V7TA 2TRMA 1KY9A 3ZZ6A 2WPHS 3PV4A 4D7FA 1S6FA 4CHAB 4KGAA 1L0ZA 1XX9A 1C9TA 4X1NU 3ZZDA 4NA7A 1O37A 2TGAA 1BB0B 1Z71A 2OINA 3SZEA 4FXGH 3ZZAA 5C67A 3QZRA 3SGAE 5IDKA 2XBYA 1JIRA 4IGDA 1BHXB 1IQLA 1P2OA 5JBTA 4GUXA 2XCNA 1CU1A 4BOHA 1ELDE 1FONA 3GDVA 1AZZA 1NT1A 4BNRA 2HLDD 3GY2A 1EP5A 1DX5M 4NFFA 1O2NA 1GMDG 3K6ZA 4X6MA 3U69H 1O5BB 1RTFB 2AS9A 4X1QU 2G51A 3SGBE 1O38A 5HKKD 2PHBA 1IQEA 2FX6A 1C2KA 1J14A 2G00A 2KAIB 3RU4D 3MMGA 3F2GA 5AFYH 1XUIA 1NN6A 1SB1H 2QC2A 2QXHA 3RXLA 2VIVA 3RXTA 1BTYA 2BOHB 3AW0A 2QF5A 1NC6A 1S85A 4O3UA 2P95A 3P70B 1YPKH 5GDSH 1ZSJA 3VPKA 4B1TA 1L4DA 3CENA 3TLOA 1TALA 1GHXH 3LGUA 4CRCA 2PKAB 5C0UA 2W3IA 1A0LA 1ESTA 3DUXH 1BTWA 2F4LA 1AWHB 1TNLA 4AORA 3NXPA 2AERH 4FUDA 1TRNA 4D76A 1Y5AT 4GCHG 3RMOH 4DT7B 3SJ9A 2AHME 3SORA 1S5SA 4JZFH 1TABE 4CBOA 4AFSA 1O3GA 1HB0B 1O3KA 3NKKA 3SNEA 2V3MA 1PPHE 1O31A 1ZTKA 1UCYK 1BMAA 4MG3A 4BXWA 3PMAB 3HKIB 3JZ1B 2FOBA 3HKJB 2AMPA 1C1MA 2A2QH 2ZWLH 1GCDA 4DCDA 3TGKE 3KL6A 4YLUA 3Q3XA 1WU1A 3RXKA 5DO4H 3PWBA 3R3GB 1SQAA 2ODQA 1ETTH 4ZROA 4MDSA 4Y6DA 4GHTA 2ANYA 2ZA5A 1TE0A 2P93A 3GYMA 3SNBA 3MOCA 4U30A 5AFZH 4XBCA 1Y5UT 1KXEA 4YXWD 1P09A 1GJ5H 4H6SB 2ZHQH 2AH4X 2CJIA 2HNTE 1PPFE 2VINA 4Q7ZA 3NUMA 1O2UA 1UTMA 2HLCA 2ZZUH 3I29A 1TLDA 3U1IB 2G81E 2WPJS 2BD8A 1ACBE 3ZZBA 1NS3A 2NWNA 2VJ1A 1FN6A 1C2JA 1IHSH 2WV4A 1O5DH 1OX1A 1P57B 1D6WA 4K1TA 1GBDA 1QQ4A 1IQMA 2GKVE 3QZQA 5H4IB 1C2IA 2XOKD 1RD3B 2YNBA 1AN1E 3W95A 1JIMA 5T6DA 4KELA 2R2WU 5JBAS 1MH0A 3A7VA 4KTCA 1EXFA 4OS6A 4B75A 2H9HA 1AKSA 1CBWB 1GI3A 4NIXA 3RLYH 1C4Y2 3KQDA 4UFFH 1V2LT 3MNSA 1FIZA 1S84A 1TMUH 3VB4A 2GP9B 1TOMH 3SUGA 3HATH 3GCOA 5FPTA 3PM3A 5F8XA 1FUJA 1EOLA 5FPYA 1SR5C 3EA9A 2P8OB 1LDTT 3ATMA 2FI5E 1NPMA 3EQ0H 4H6TA 1AUJA 2ZHFH 3MU4A 1UVOA 3RXOA 4XD7D 3RXGA 5EJZA 3KNXA 1P04A 4Q7XA 1W0ZU 1EOJA 4ZH8A 1K1JA 3UAIC 1UW7A 2KR7A 1KXDA 1DS2E 4WF8A 1E38B 4CH8B 4F4OC 4P02A 2STBE 1OS8A 1O2HA 3UNSA 1QTFA 1FMGA 2BOKA 3A80A 5HXFA 4IS5A 5A8XA 1V2VT 1NZQH 4K69A 2RG3A 1ANBA 1KLJH 1NROH 4OS4A 3BTTE 2THFB 5FX6A 4ASHA 1HXEH 1YYY1 4CH2B 1MKXH 3FAOA 4MNYA 3OY6U 3TVJB 4J1YA 2Q6GA 1O3LA 4FUEA 1S83A 1KDQA 3A85A 1YPLH 1BJVA 1TX7A 3ZZ9A 5C1UA 3KCGH 1D3TB 1NU7B 2J4IA 1YKTA 3BV9B 3UTUH 1D3DB 2Z94A 1O3EA 6CHAC 1V6DA 1FNIA 3VG8A 1E0FD 1GI5A 4RT1A 2ALVA 3F3BA 1RXPA 1XUFA 4GSOA 3D62A 1J16A 1W7XH 1GI1A 2OC7A 2DUCA 2H1UA 4WH8A 3SQEE 5L30H 2HNTF 4A7IB 1UHBB 1GI6A 1F5KU 1SLUB 1LKAA 1EJNA 3PROA 2Z9JA 1YY3A 2A4QA 1TOCB 3ZV8A 2NU2E 3F2FA 4LK4A 4H4FA 3B8JA 2QN5T 2F3CE 1P12E 3LGIA 1DSTA 5EPYA 1V2UT 1C1OA 3S9CA 3Q76A 4A1XA 1DITH 3L33A 9LPRA 5TJXA 1A7SA 3NPSA 4TSFD 1FIWA 1HAPH 4X2YA 4RKJB 5JB9S 2ZP0H 2IPHA 3S9AA 1AD8H 1FY3A 3OAAD 1U6QA 1K22H 2FOFA 1RTLA 1NTPA 4DURA 1MTVA 1WXRA 3M7QA 5JBCS 1QR3E 3SJKA 1VGCB 3MYWA 3UY9A 1IQGA 4HG6A 4ABBA 1K1OA 1TBRH 3CNRA 4JMYA 1CHOF 4BAMB 4ZKSU 1C5XB 2LPRA 2XXLA 1GHZA 4AX9H 2P94A 4NIWA 4Q80A 4YESB 3RXDA 2A4RA 1GL0E 4WXIA 2EC9H 3B9FH 1HNEE 3KYGA 3CS7A 4ISHH 5LPEA 2H2ZA 1AQ7A 3RMMH 4AB9A 4JK6A 2XWBI 2ANMH 1AFQB 3RC5A 2VH0A 1NFXA 3PYHA 3KQEA 2G4TA 1CHGA 1O2YA 1SGTA 2F9OA 1UVUH 2XCFA 4AC9A 1C5MD 2K7XA 1FJSA 2NU1E 3DD2H 2PKSB 2PTCE 3SJIA 5LH8A 3M7UA 3P8OA 3QWCH 2P16A 4QT8C 1J17T 1O3CA 2A32A 2STAE 1Q3XA 1T4UH 4X8TH 1HLTH 1KTTB 1HIAB 1FLEE 2IOTA 3MO9A 2SGDE 4BTIB 1SGFA 4K2YA 5FPSA 2KCPA 4CR9A 2ZTXA 3SU2A 4DJZB 1ABJH 1MCTA 1C5LH 3FP6E 3URDA 1SLXB 5AVDA 1AUTC 3LOXA 2BLWA 2Z9KA 5EU8A 1QB1A 4AFUA 2PGBB 3E6PH 1BOQA 1EKBB 2GMTB 3VB3A 1VCPA 2L6OA 2WHXA 1ELEE 5FHTA 2GCTB 2PSYA 3MNCA 2AMQA 1A0HB 4K3JA 1GHWH 1E36B 4AOQA 1WBGB 3ELAH 5DP4A 3MNBA 4U32A 1GWAA 5HIZA 3OE7D 1FY5A 2BZAA 2P8OC 4YT7H 2SGQE 1THPB 3VXEH 2HOBA 3TNSA 1O3BA 3O8RA 1DDJA 1TNJA 3QK1A 2BD3A 1AFEH 5A8YA 4A5TS 2BDIA 3GY7A 3HK3B 3RXBA 2B8OH 1KXFA 2LP6A 8KME2 1CHOG 3T28A 2M2AA 2D8WA 3FO8D 3AASA 1OWIA 5F6MA 1K9OE 2AMDA 3VEQB 5JB8S 3ATWA 1QBVH 3D65E 4ZKRU 1FAXA 1QIXB 1T31A 3G01A 3GOVB 3ZVEA 1TA2A 3M5MA 3QUMP 4INLA 3SJ8A 2QYIA 5DP8A 3RC6A 1K28D 3GS9A 1CT2E 1KTSB 1A5IA 1ZTLA 3PLKA 4K60A 1C1UH 2HPPH 2ZFFH 3SNCA 3BTWE 4YLQH 5E2PA 2AIPA 2OD3B 2BY8X 4I8HA 3I77A 1QCPA 1O2OA 4TWYA 1GVLA 3TH3H 3KIDU 2BQ7B 4ZXXH 2C3SA 1DWDH 1LHGH 4Q4LA 1LVBA 3MI4A 1SGIB 1W2KH 1MKWH 2O9QA 3BTQE 3K2UA 2BVRH 1LKBA 2A4OA 2BVSH 4DG4A 1NO9H 1C5QA 1OPHB 1ZR0A 4ABDA 3SN8A 3F9GA 3A8DA 1Y3VA 2GVFA 1H9LB 1ZJDA 2O8WA 3H5CB 3DSPA 4R8TB 1H4WA 4Y8XA 1MMJN 3T27A 3VB5A 2FMJA 1YPHC 2GGVB 5EPNA 1RIWC 2J98A 3SUEA 1VITF 2Z6BD 5C2ZA 1G3CA 1A3BH 3LJJA 5DG6A 2QF4A 3O8BA 2R0KA 4ZHMU 3T26A 1ZMLA 1DWBH 2LNCA 2WUBA 5EJ1A 5DP9A 1PPZA 2ZDMA 3LDXH 1WUNH 1HCGA 3LPRA 2JJ2D 4BAHB 2VGCC 1MQ6A 2XNDD 1UTQA 1HAYB 2ZECA 1HGTH 5EG4A 1Y3UA 5A0AE 1XKBC 1P02A 2WUCA 2BD5A 2OXSA 4XRNA 1C9PA 3ZV9A 2FODA 3UOUA 3RXMA 4IN1A 1KLIH 1VGCC 4H42U 2PP6A 3SJOA 3QX5H 1K1LA 1FY4A 1ESAA 3M3TA 1QNJA 1OP2A 4DW2U 1QBNA 3BTFE 1G30B 2FYQA 2BXUH 5GNDA 5B6OA 5C94A 4TYDA 5PTPA 3A89A 1AE5A 3M36A 1WQSA 2JKHA 3ITIA 1PQ8A 5TCCA 3PO1C 1EJAA 2OLGA 1ELVA 1AFQC 5B6LA 1XVMA 1O2XA 2BXTH 2UWOA 1O2VA 4GAWA 1QB9A 3W94A 3RU4E 2A5IA 4BAKB 1KSNA 1H8HD 2AYWA 1O3MA 4MNVA 1O2JA 2BY9X 4D9QA 1F2SE 1LHFH 1A3EH 4FOUC 4NFEA 1UTNA 5HYOA 3HK6B 2Q6DA 2B0FA 1GJDB 2J94A 3F0OA 1D3QB 1MBQA 1V2PT 2VIWA 4ISIH 1S6LA 4ACAA 5EQSA 1TYNA 1C1QA 1TNHA 1AMHA 3KF2A 3SHAH 3LC3A 1O3IA 1NRRH 5J4SA 1LMWB 1O2KA 2C8XB 1SGQE 2AFQB 1VITG 2CXVA 3DFLA 1TWXB 3E3TA 2ZU2A 3AVZA 1HRTH 4OS5A 1TPOA 1GHYH 3DCLA 2RA0A 4FU7A 5EODA 2EI7A 3SV7A 2SFAA 2JETC 2R2MB 4MTBA 3SO3A 4E7NA 1ABIH 2BYAX 5T6GA 2GCHF 3M3VA 4AGJA 2PLXA 2BDCA 1WCZA 4MVNA 1BTXA 3OTJE 2BX4A 2BX3A 4MQAA 5IYTA 1XUJA 3N99A 2YNAA 1OKXA 1XM1A 3SYJA 2BLQA 1MKXK 2O8MA 1SGRE 4NWLA 2ZPQA 1BMMH 4X1SU 1O32A 1BHXF 5T3HA 1QRXA 1XXFA 5DSFA 3SI4H 1QL8A 4AFQA 1BTHH 3LGVA 1F0UA 1AGJA 1T8MA 2XNIA 5LGOA 5EW1H 1ZRKA 1O33A 2DE9A 1Z6EA 1O0DH 3SU4A 2V3OH 4MLFB 3WWBA 2W7UA 3KQBA 2G8TA 2P3TB 4WJG2 1ETRH 1ID5H 4WMEA 3SQHE 3GDUA 1EAWA 2ZTYA 1NY22 1SLVB 6CHAB 2BY7X 2IN2A 2JIZD 1A5HA 2ZKSA 1WQVH 1S0RA 3GY5A 2GX4A 3RXAA 4CREA 3A8CA 1GGDC 1CGIE 1MZAA 3T62A 1L1GA 1GBKA 3OEED 3MHWU 2VWMA 1YF4A 2QA9E 3FP7E 1UTKA 2XRCA 3M7TA 3E90B 3TK6A 5FAHA 1LHEH 1BBRE 2QXGA 1ELGA 3ZZ3A 1F7ZA 3UR9A 1LQEA 1WYKA 1GBCA 2ZEBA 4JYVH 5DGJA 1GVZA 4IC5A 4HI3A 3C27B 1FXYA 2FYRA 4XDEA 1L4ZA 2R3UA 5EW2H 4Y8ZA 2GCHG 1N8OC 2G52A 2A7HA 2GT7A 5SGAE 1NFUA 2PWXA 1O3DA 3M61U 1FX0B 1C1NA 2ZQ2A 1P2JA 4RSPA 4FVDA 4KKDA 3M35A 3FKSD 1T8OA 5GPIB 2ZTZA 1MD8A 3RXQA 1Z8GA 1TAWA 2RFKC 2J95A 1BTUA 1ZMJA 1OWHA 3ZYEA 3PMBB 2I6SA 2ZCHP 3T5FH 3SUFA 2HGTH 4I31A 1DXPA 2EI6A 1GHBG 1S81A 2KZ4A 3SBKA 1QFKH 4Q2KA 1SGYE 4OS7A 1ARBA 1BA8B 2CF8H 3NK8A 4BXSA 3E0NB 3DSOA 1J15A 3A86A 1PPBH 4ABGA 4D8NA 3F9HA 2ZCKP 1TGSZ 2BDBA 2QY0B 1JRTA 4IC6A 1SMFE 4K8BA 4MPUA 5L6NH 2GZ7A 1ZLRA 4XOJA 3ZVDA 4B71A 1NBMD 1UTPA 2FM2A 3SNDA 5DKMA 4NZLA 3STIA 1EASA 1GBIA 1C1VH 2NU0E 4U01A 4E06H 2Y5FA 4FU8A 1J8AA 4CR5A 1ZHRA 1QURH 2ZNKH 1O2TA 4YTAA 1SQRA 2Y5GA 1PQ7A 1NESE 1TMTH 4JYTA 1E35B 2ZHWH 4HFPB 2TBSA 3MNXA 1O2MA 4MNWA 5CMXH 2JH6D 2VIOA 2J97A 4HTCH 4ZKOU 1C2EA 1UHBA 4FU9A 2ZGCA 2IJD1 2K0QA 4ABEA 4E7RG 1G37A 2OQ5A 4X2VA 2OBOA 2WYGA 4YOJA 2JH5D 2C4FH 2A31A 2QE7D 1IOEA 5DJ7A 1GBLA 2FOMB 2FTMA 2SNWA 2FOGA 1C2GA 2V6NA 1GMCG 2IJOB 2KCYA 2GDEH 2HVYB 2ZG0H 3TH2H 2Z7FE 1C1PA 1O35A 5FCRA 1IQHA 5GWZA 3EA7A 1GJCB 2QXIA 1HJAB 4LXBH 2WPLS 1LO6A 3Q3KA 5JDUB 2ZGXH 3M3SA 4HGCA 2TIOA 1MTUA 1O2PA 1VITH 2ZIQH 5A0BA 5A8ZA 1O34A 3Q3YA 2G55A 2LELA 2FEQH 2ZDNA 1D9IA 1HXFH 1BITA 1P0SH 2V3HH 1C5OH 4DIIH 1O2IA 2WPIS 4K1EA 1Z7KA 3PLPA 1C1SA 2WZQA 3ZZ4A 3F9EA 1NRNH 1PJPA 4B6EA 3ATIA 3PB1E 2WV9A 1F5LA 1ELCA 7ESTE 4FUCA 1P8VC 1IHTH 1DUEA 3AW1A 1MKWK 2BD9A 2EEKA 1G36A 1WTHD 5EGMA 2BQWB 1O3PB 1KYNA 4INHA 3IITA 2BM2A 1K21H 4NA8A 2RDEA 2W6JD 1EQ9A 3FANA 1YLDA 2GD4B 1K0HA 1MU8B 4FUJA 3F1SB 3M37A 2V0BA 1EAUA 2UUJB 3TJOA 1SPJA 2PUQH 1A2CH 2Q1JA 2RDLA 4MNXA 3S69A 1QA7A 1Y8TA 2CN0H 1EZUC 2PGQB 1HIAA 3SZNA 1NRPH 1SGPE 3AAUA 2OC8A 1BJUA 4YOGA 1O39A 2OBQA 3TU7H 1L1JA 3FP8E 3S9BA 1T32A 1W11U 5ESTE 2TGDA 1Y3XA 2HPQH 1Y3WA 4Z6AH 3BTHE 3RXRA 2Z3DA 3GY6A 1OWKA 2C93B 3BG4B 4A6LA 1OWEA 1RIWB 1V2WT 1N6XA 5LPRA 3RP2A 5LPFA 5EXNA 1H8IH 4Y0ZE 4ZUHA 4O9VA 1LHCH 1GL1A 1QJ7B 1XUKA 1Z6JH 1O36A 1HAVA 1GDUA 4AZ2B 3OFND 2ZU4A 1ANEA 1C2DA 1ZPBA 1GHAG 2VGCB 2ESTE 1TX6A 1C5RA 2ANKH 2WYJA 1WOFA 3RDZA 1P05A 1ELBA 1S0QA 3IWMA 4ZXYH 1G3BA 1MTWA 5GCHG 5FX5A 1QGFA 5DP7A 2KCOA 3OEHD 1O2SA 1UK4A 2UUYA 3JZ2B 1T4VH 4WVPE 2Y81A 1GDNA 3BG8A 1PQAA 4DIHH 5ABWA 2Y80A 1DT2A 1IQNA 1SSXA 2SGFE 3BTKE 1OHHD 3PO1B 1SLWB 1IAUA 1W8BH 5JBBS 2NU4E 3A88A 1QZ8A 1ZPCA 3MH7A 3VXFH 2G4UA 4X2WA 2WV5A 3LGTA 4NSVA 4ESTE 1BRBE 1VCQA 3T29A 1SOZA 3SV9A 5HM9A 2Y82A 1OXGA 4IBLH 5HGGA 2HRVA 2AGIX 1HAGE 2SGAA 1W0KD 1C5TA 1MTNC 2XC0A 4BTUB 1QRWA 1ZSLA 5EXMA 4JYUH 1G3DA 2ZGJA 3E16B 2H5DA 1H9HE 1P03A 1THRH 2SGEE 2TGTA 1SGDE 1AVGH 1C4V2 2JETB 3DSGA 1G32B 2BMGB 1P9SA 4YO9A 3UWIA 2VU8E 2AEIH 1TNKA 3SU1A 2C8WB 1GJ6A 2BY6X 1K1NA 1DFPA 3MU8A 4SGBE 4AG1A 3SW2B 3NCLA 3EYDA 2ANWA 1Z1IA 1MAXA 1DSUA 1HAVB 1HJAC 1O3OA 3U9AH 1VCWA 3W1EA 1GCTB 3M5NA 1LVMA 3EA8A 3ZZCA 2GV6A 2AIQA 1IQJA 1C2MA 3MU1A 1BDAA 4I8KA 3OYPA 1Z1JA 4WH6A 1W3CA 1YWUA 2WPKS 1ETSH 3N7EA 1EPTC 1GBTA 4THNH 2BDHA 3FVFB 1OWDA 3BEUA 3FOAA 1UMAH 1BTZA 1O2QA 1FV9A 4WY3A 4AYYB 1N1LA 1EATA 1TA6A 5KEDA 5L2ZH 1GI9B 2J2UA 1AVXA 2PKSC 1G2MA 3MU0A 4JZ1A 1LHDH 4OGXA 2YOLA 5E0JA 3N7DA 4Z0KA 4AN7A 2Y7ZA 1RJXB 1C4U2 5A2MH 3CS0A 1DUAA 3DHKH 4YT6H 3UREA 3U8RH 1TX8A 1DE7H 4I32A 2FI4E 3PRDA 5GIBA 1TQ0B 2TGPZ 4GLYA 1N6YA 1CSOE 1GGDB 2FDAA 3A8BA 4Y8YA 1MQ5A 4CBNA 3RXVA 1VKYA 3SV8A 1SFIA 2PTNA 1SGNE 1ZZZA 1HAZB 1V2ST 3RC4A 3H7TA 3RMNH 3VGCB 2GJGA 1P3CA 1Y59T 1MABB 1BRAA 1AU8A 1TMBH 3N7OA 3P17H 3O8CA 2TPIZ 3BG4C 5G4BA 3FN8A 1LPZB 3RXSA 1YGCH 1MTSA 1DOJA 1CGJE 1C1RA 4AFZA 2OC0A 2EQNA 3UWJH 3GICB 4X6NA 1HJ9A 1SGEE 3A82A 1N8OB 3GY4A 3ODFA 5EIYA 1O3AA 1NRQH 1QJ1B 3SOSA 1C5UA 1WDIA 2H9TH 2FWWA 3TK5A 4KTUA 3F6UH 1FAKH 2OTVA 2EA3A 4ABHA 3SV6A 1FI8A 1SGCA 1ZGVA 3SU0A 6GCHG 1F0TA 2ASUB 1UCYE 1BZXE 3KYFA 4DOQA 2ZHDA 4B2BA 2XBVA 1GJ8B 1P2NA 3T25A 2BB4A 2UWPA 1WSSH 4Y0YE 4FETA 2HNTC 4Y11E 4ABJA 4TY6A 4K8YA 2QXJA 2ODPA 2ZU1A 1BBRH 1XKAC 3SI3H 1VJAU 4XE4A 3UOPA 3S7HB 4RN6A 1XUHA 4NIVA 5DN6D 3RXFA 4VGCC 1Y5BT 1GBEA 1TNGA 4X8UH 3DFJA 2Y7XA 4CRFA 3MQKC 2A2XH 2OUAA 5DPAA 5DP5A 2I6QA 1JWTA 1ARCA 2ULLA 5T1VA 4LZ4B 1TBZH 4X6OA 2FPZA 1EZSC 4FUFA 4FVBA 1SGFG 2QCYA 4ABFA 4TPIZ 1MZDA 1V2QT 5F53A 5C5NA 2BD7A 4D7GA 3MH6A 3A83A 4AB8A 1BCUH 2VIDA 1SBWA 1K2I1 1XUGA 2CGAA 1OP8A 1AE8H 1XMNB 3A7TA 1YCPH 1O3NA 2W7SA 1DWEH 1ANDA 1CO7E 1HAXB 1TGBA 3TGJE 1O5CB 3QGNB 1TONA 1E37B 2VWNA 2A5KA 2QF0A 1W0YH 3GCHC 4RKOB 2YMSB 3D23A 1G9IE 1DY8A 1QQUA 1CQQA 2BDYA 3QO6A 2FOHA 4AG2A 4BANB 5FBIA 1SQTA 3P8GA 4Y7BA 6ESTA 1GJ9B 5FCKA 1TPAE 2FLRH 5EJLA 1FQ3A 3SGQE 1C5VA 1YP9A 1ELAA 4GPGA 2UUFB 1YBWA 2GTBA 4UEHH 1P2MA 4BAOB 1GCTC 2RA3A 5E0GA 2J38A 3TNTA 3EDXB 4E05H 2ZU5A 2W26A 1O5GH 2Y6TA 4OS1A 2AGEX 1TPPA 2J5UA 1ZHMA 2WPDD 3SU5A 3ENSB 1KMHB 2WSSD 1K1PA 1O5FH 1GHBF 4TT3D 3C1KA 4ABAA 1BRCE 1DWCH 1UVTH 2J34A 1V2RT 3GCNA 1H9IE 2A0QB 5E0HA 9ESTA 2VVVA 4JZIA 5F8TA 2VIQA 1EB2A 3A7WA 7GCHF 1NBME 1GDQA 2PFEA 2B9LA 2A7CA 3DA9B 2FLBH 4PROA 1O5AB 1DVAH 2Z9IA 1E1RD 1HYLA 1GPZA 1A5GH 2XC4A 4ZMAH 2BVXH 2H5CA 2FS8A 1RGQA 2VIPA 3QTVH 1HDTH 5JPMH 1FPCH 2FZZA 4KP0A 1BT7A 3PLBA 4ZHLU 4DT4A 1KIGH 1CT0E 1P11E 3ATKA 1DPOA 1TFXA 1HJ8A 2ZFTA 3WY8A 1GG6B 3E0PB 3EAJA 1P10A 1H1BA 1HV7A 3TK9A 1B0EA 3RXUA 2C90B 3ZVFA 3U1JB 4NWKA 3VGCC 2A4GA 2F9UA 2KX4A 2UWLA 1Z8RA 2ZFRH 1BQYA 3HGNA 5C1XA 1V2NT 1ANCA 4IW4E 1QB6A 4I86A 4HZHA 4Q63A 2FI3E 1INCA 5GJ4B 4I8LA 4A1TA 1V2JT 2HWLB 2FO9A 3ZVCA 4CRGA 1O30A 3URCA 3LH3A 1JBUH 1VJ9U 4TPYA 1C2HA 1XXDA 1YPMH 2R0LA 4R0IA 2A5AA 4YZUA 1F92A 2GT8A 3KQCA 1TNIA 1GMCF 3K65B 2O8UA 1PPEE 3K9XB 5CDFE 4ISNA 4B2AA 1MBMA 4Y76A 3TITA 4IN2A 1C1WH 1ZJKA 3RMLH 1RS0A 3TIUA 1SL3A 2XW9A 2VWLA 1KXAA 3OTPA 4X8VH 1EZXC 1AY6H 2K8IA 3PMJA 1O3HA 4X8SH 2ZU3A 1EPTA 2BDGA 4K1SA 1W13U 2PV9B 3A7XA 3B23B 1JXPA 3M5OA 4NG9H 1COWD 2CK3D 1YCPM 1W14U 1A1RA 4Y7AA 5HM2A 1O5EH 3UFAA 1L2EA 4B73A 4YM9A 2ZCLP 5DP3A 2J92A 3MH4A 4J2YB 2PSXA 3ZVAA 1C1TA 2BD2A 4YOIA 3PV5A 4OS2A 1VZQH 1HBTH 3UQOA 2JDID 1YPHE 1QRZA 7GCHG 1W12U 2C8ZB 2ILNA 1B0FA 4I33A 1ELFA 1GJ4H 2ZGBH 4O3TA 4ABIA 1EB1H 5I46H 2P3UB 5C5OA 2H9EH 5EXLA 1D6RA 2R9PA 4Y79A 1NFYA 1OOKB 1AZ8A 4FUHA 1C5PA 1E1QD 3PRBA 3U28C 2VNTA 5EOKA 3E8LA 5TCAA 1C5SA 3EBNA 5E8EH 1ELTA 1RRKA 2FX4A 4UFGH 4B2CA 3KGPA 4RT0A 5L2YH 2SNVA 3SU3A 2W6ID 2ZDVH 2ZDLA 1TPSA 1QL7A 3MO3A 1FZZA 2CF9H 8LPRA 1NM6A 2R3YA 1MAYA 3MWIU 1OYTH 1FDPA 2KM0A 1RFNA 1HAIH 3TGIE 1S82A 2ZHEH 3RXPA 4F49A 1MTNB 3P8FA 5A09A 1GI4A 4NCYA 1GBJA 3ZYDA 4KTSA 3KN2A 2PW8H 2EI8A 4SGAE 3KQ5A 3PTNA 3OY5U 2ZQ1A 4OGYA 2ZC9H 1AVWA 1E34B 2JJ1D 1CA0B 2YMSC 5EQQA 3LJOA 2O8LA 3MFJA 4OM9A 4WWYA 1P06A 4LOYH 4UE7H 1DLEA 2XWAA 3R0FA 4DVAU 2ZO3H 2FP7B 4I7YH 1GI0A 3GCTF 1MCVA 1P01A 3E1XB 1GHAF 1LVOA 1O2ZA 1YC0A 4CRDA 2ZI2H 1UTLM 2CHAB 2JH0D 4FUIA 3EE0B 4NZQA 1BUIA 1EPTB 3VB7A 1DM4B 5ETXA 2VVCA 4TWWA 2XYAA 1YPJH 1C5ZB 5CHAB 1GVKB 1PPCE 3OU0A 3IG6B 5GCHF 3UR6A 4WMDA 1P2KA 4U2WA 2BD4A 4B6FA 3DT0H 1AWFH 2ZDAH 5FL7D 1GJBB 2F91A 4ISLA 1ZOMA 3VFEA 1PYTC 1DICA 1AHTH 1BMFD 1O3FA 2L74A 1SI5H 3I78A 1FY1A 1CGHA 3BTME 2ZPSA 2QF3A 1DLKB 4CHAC 3UPEA 1OWJA 3UIRA 3ZIAD 1FN8A 1XVOA 2OK5A 2BZ6H 5K7RA 3RM2H 2OCVB 1BTPA 1P2IA 1LTOA 1A4WH 3UB0A 4ASUD 3VB6A 1BMLA 4ISOA 1MUEB 1YPGH 2FXRA 5FXLA 3UNQA 1C2FA 1GG6C 1F0SA 4B74A 2BQ6B 3SU6A 2Z9LA 2XC5A 2F43B 1QHRB 2FOCA 1EP6A 2BDAA 1AI8H 3BTDE 1EJMA 3WWFA 1GI8B 1UTOA 1NRSH 2W5EA 3L6PA 3AAVA 1D3PB 3S7KB 1OSSA 2Q6FA 1HFDA 2F83A 1MU6B 2XTTB 1EUFA 3FZDA 4IMQA 3ZZ7A 3BTGE 5C3NA 2RCEA 3PWCA 3QGJA 3RXJA 4CRBA 3U8TH 3GCTG 4JK5A 3H09A 1HAHH 1LVYA 3V12A 1BBRK 1O2GH 1YLNA 5BPEA 1PQ5A 3HGPA 4I8GA 4TY7A 3RM0H 1GBMA 2ZGHA 1AKSB 1GJ7B 1YM0A 3O8DA 5T6FA 3A81A 3UNRA 1BMNH 4XBBA 4NA9H 4NGAH 4DGJA 2BLOA 1FPHH 2H6MA 4Z1MD 1JMOH 1ESBA 5KGOA 1KXBA 1GBFA 3TJUA 4FUBA 4ACBA 6LPRA 5JYIA 1QJ6B 5C17A 4O97A 5DP6A 1GHVH 1G2LA 4VGCB 2F9PA 4X6PA 4A92A 1IQFA 5CHBA 1Z8JB 2FESH 3ZZ5A 1SHYA 3LH1A 1V2OT 2ZFSA 3BIVH 2P59A 5E2OA 3D49H 3A7YA 1Q2WA 1SVPA 2OQUA 4MPWA 1HPGA 1YCPK 3MTYA 5F8ZA 2P3FH 1THSH 4B76A 2GZ8A 1C5WB 5DK1A 2GV7A 1SFQB 1UO6A 3LU9B 4XSKU 3SV2H 2ALPA 2C8YB 1CT4E 2Z9GA 1EZQA 1UCYH 2WINI 4X1PU 1EAIA 1ZSKA 2CMYA 3LKWA 1DY9A 2OP9A 2XBWA 3P8NA 5ESBA 5AF9H 3LGYA 1EAXA 1GJAB 3BN9A 1LPKB 2AGGX 1EFRD 3HPTB 1KDQB 1H8ED 1E79D 4X0WU 3NWUA 1B7XB 2KCAA 1FY8E 5BRRE 1TQ7B 3RXIA 3GCHB 1J9CH 3ZZ8A 3ZVGA 4DY7B 4GVUA 4AYVB 2G5NA 3RXCA 3RLWH 3RUOA 1TIOA 1QBOA 3P6ZB 1PPGE 1CA0C 1HUTH 1UVPA 1CVWH 3LT3A 1O2RA 4BTTB 1TB6H 3BTEE 1UVSH 1P3EA 3V0XA 5IK2D 4F48B 1LPGB 2F9NA 2O8TA 1WV7H 1OP0A 1W7GH 3QLPH 4LZ1H 3F0PA 1UK2A 3S0NA 2W3KA 3E91A 1AB9B 2XBXA 1CBWC 3QN7A 1GBHA 4F55A 6GCHF 2BY5X 2FOEA 1ZYOA 2CHAC 2V35A 3KHVA 3A8AA 4D9RA 3MO6A 1BIOA 2QGRA 3BSQA 2QIQA 4ZAEA 2KFWA 5CHAC 1AO5A 3WW7A 1K1IA 4Q7YA 5F03A 2DE8A 2PUXB 3BIUH 5KECA 3M5LA 4M9FA 2UUKB 2FOAA 3BEFB 1GI7B 1P9UA 1S6HA 4CRAA 3H7OA 4JZDH 5CE1A 2VB0A 1GMHF 3NZIA 1MD7A 8GCHF 1GBBA 3GY8A 3SHCH 2IPQX 7KMEH 2OC1A 1F5RA 2A7JA 3CP7A 4WMFA 3NRLA 4NSYA 3LIWA 2FIRH 3UQVA 4UFEH 1D4PB 4K5ZA 3SUDA 1G3EA 5A0CA 1ZHPA 1ZRBA 3SNAA 1O2LA 1VR1H 2Y5HA 2F9VA 4UDWH 1H8DH 3PV2A 2VVUA 3STJA 1LCYA 4Y10E 1TRYA 1Z8IB 4UFDH 4GHQA 1W0JD 3TPIZ 2VH6A 5GXPA 3QTOH 3FFGA 4WXVA 3T2NA 1SKYE 2ZF0H 3MH5A 2ODYB 5I25A 3FZZA 3K6YA 1CE5A 1UTJA 2SGPE 1SOTA 5HIYA 2EY4C 2D1JA 1WTGH 3GDSA 2K1QA 1X7AC 4INKA 4P00A 1GI2A 1JRSA 4JCNA 4X1RU 2BLVA 2B5TB 3Q77A 1B5GH 5K0HA 1BRUP 1YPEH 3F2HA 2QV1A 1QY6A 1TBQH 5C1YA 1EX3A 3TJVA 1UK3A 2CV3A 2Z3CA 3P92A 3U8OH 1RTKA 1F0RA 1C2LA 4IMZA 3RU4T 3ZVBA 1Q31A 3GYLB 4XBDA 1A0JA 1TGTA 1GMHG 1L1NA 2NU3E 3LC5A 1M9UA 8GCHG 5C20A 1WAYB 2V7QD 2YMSD 3MU5A 1UJ1A 3TJNA 4XFQA 4M7GA 3OSYA 1O3JA 2ZFQH 4ZCNA 1DXWA 1SQOA 5FBEA 1PFXC 4UD9H 7LPRA 4MPVA 4I8JA 1NU9A 2Z3EA 3TH4H 2M5TA 1AIXH 3AK5A 1V2KT 1JOUB 1P2QA 1NFWA 4FUGA 1O2WA 1T8NA 3OX7U 1DANH 1TGCA 3EE7A 2BHGA 2A45B 2J9NA 2A1DB 1K1MA 1KLTA 2ZDKA 3P95A 1V2MT 1TRMA 1A46H 1ORFA 3LGWA 1CA8B 4MPXA 1GMDF 5HMAA 3ODDA 2KAIA
chains in the Genus database with same CATH topology
1QL9A 1V2TT 2QAAA 1KXCA 2BTCE 3A7ZA 3RXHA 4JZEH 3GISB 1SHHB 3ATLA 8ESTE 1PYTD 2HVXA 3PTBA 4AGKA 4BAQB 4O03A 4UONA 2ZFPH 3LONA 3U98H 4ZKNU 1ZTJA 5J4QA 1IQIA 2G5VA 1QA0A 2FS9A 1C5YB 2FTLE 1YLCA 2D26C 1C5NH 3BEIB 4NIYA 3BF6H 2PKAA 1GBAA 1SG8B 1AB9C 3EGKH 3V3MA 3Q00A 2WPMS 4ZHAA 1W10U 2B7DH 1SC8U 1TGNA 2GMTC 4X2XA 1Y3YA 1ZPZA 3KEEA 1OYQA 1T7CA 2GCTC 2HALA 3ESTA 5EQRA 2ZPRA 1HAOH 1ZGIA 3L3TA 4GCHF 3V13A 3F68H 1T8LA 5AHGH 1ZMNA 2PR3A 4A1VA 3UUZA 3QDZB 2GZ9A 2VWOA 3PMHB 3RXEA 1IQKA 1A61H 3A87A 1V3XA 3A84A 2D2DA 2F9BH 2LIZA 3F9FA 1LQDB 2GDDA 4Y71A 3GY3A 3V7TA 2TRMA 1KY9A 3ZZ6A 2WPHS 3PV4A 4D7FA 1S6FA 4CHAB 4KGAA 1L0ZA 1XX9A 1C9TA 4X1NU 3ZZDA 4NA7A 1O37A 2TGAA 1BB0B 1Z71A 2OINA 3ZZAA 4FXGH 5C67A 3QZRA 3SGAE 5IDKA 2XBYA 1JIRA 4IGDA 1BHXB 1IQLA 1P2OA 5JBTA 4GUXA 2XCNA 1CU1A 4BOHA 1ELDE 1FONA 3GDVA 1AZZA 1NT1A 4BNRA 3GY2A 1EP5A 1DX5M 4NFFA 1O2NA 1GMDG 3K6ZA 4X6MA 3U69H 1O5BB 1RTFB 2AS9A 4X1QU 2G51A 3SGBE 1O38A 2PHBA 1IQEA 2FX6A 1C2KA 1J14A 2G00A 2KAIB 3RU4D 3MMGA 5AFYH 1XUIA 1NN6A 1SB1H 2QC2A 2QXHA 3RXLA 2VIVA 3RXTA 1BTYA 2BOHB 3AW0A 1NC6A 1S85A 4O3UA 2P95A 3P70B 1YPKH 5GDSH 1ZSJA 3VPKA 4B1TA 1L4DA 3CENA 3TLOA 1TALA 1GHXH 3LGUA 4CRCA 2PKAB 2W3IA 1A0LA 1ESTA 3DUXH 1BTWA 1AWHB 1TNLA 4AORA 3NXPA 2AERH 4FUDA 1TRNA 4D76A 1Y5AT 4GCHG 3RMOH 4DT7B 3SJ9A 3SORA 1S5SA 4JZFH 1TABE 4CBOA 4AFSA 1O3GA 1HB0B 1O3KA 3NKKA 3SNEA 1PPHE 1O31A 1ZTKA 1UCYK 1BMAA 4MG3A 4BXWA 3PMAB 3HKIB 3JZ1B 2FOBA 3HKJB 2AMPA 1C1MA 2A2QH 2ZWLH 1GCDA 4DCDA 3TGKE 3KL6A 4YLUA 3Q3XA 1WU1A 3RXKA 5DO4H 3PWBA 3R3GB 1SQAA 2ODQA 1ETTH 4ZROA 4MDSA 4Y6DA 4GHTA 2ANYA 2ZA5A 1TE0A 2P93A 3GYMA 3SNBA 3MOCA 4U30A 5AFZH 4XBCA 1Y5UT 1KXEA 1P09A 1GJ5H 4H6SB 2ZHQH 2AH4X 2CJIA 2HNTE 1PPFE 2VINA 4Q7ZA 3NUMA 1O2UA 1UTMA 2HLCA 2ZZUH 3I29A 1TLDA 3U1IB 2G81E 2WPJS 2BD8A 1ACBE 3ZZBA 1NS3A 2NWNA 2VJ1A 1FN6A 1C2JA 1IHSH 2WV4A 1O5DH 1OX1A 1P57B 1D6WA 4K1TA 1GBDA 1QQ4A 1IQMA 2GKVE 3QZQA 5H4IB 1C2IA 1RD3B 2YNBA 1AN1E 3W95A 1JIMA 5T6DA 4KELA 2R2WU 5JBAS 1MH0A 3A7VA 4KTCA 1EXFA 4OS6A 4B75A 2H9HA 1AKSA 1CBWB 1GI3A 4NIXA 3RLYH 1C4Y2 3KQDA 4UFFH 1V2LT 3MNSA 1FIZA 1S84A 1TMUH 3VB4A 2GP9B 1TOMH 3SUGA 3HATH 3GCOA 5FPTA 3PM3A 5F8XA 1FUJA 1EOLA 5FPYA 1SR5C 3EA9A 2P8OB 1LDTT 3ATMA 2FI5E 1NPMA 3EQ0H 4H6TA 1AUJA 2ZHFH 3MU4A 1UVOA 3RXOA 3RXGA 3KNXA 1P04A 4Q7XA 1W0ZU 1EOJA 4ZH8A 1K1JA 1KXDA 1DS2E 4WF8A 1E38B 4CH8B 4F4OC 2STBE 1OS8A 1O2HA 3UNSA 1QTFA 1FMGA 2BOKA 3A80A 5HXFA 4IS5A 5A8XA 1V2VT 1NZQH 4K69A 2RG3A 1ANBA 1KLJH 1NROH 4OS4A 3BTTE 2THFB 5FX6A 4ASHA 1HXEH 1YYY1 4CH2B 1MKXH 3FAOA 4MNYA 3OY6U 3TVJB 4J1YA 2Q6GA 1O3LA 4FUEA 1S83A 1KDQA 3A85A 1YPLH 1BJVA 1TX7A 3ZZ9A 5C1UA 3KCGH 1D3TB 1NU7B 2J4IA 1YKTA 3BV9B 3UTUH 1D3DB 2Z94A 1O3EA 6CHAC 1V6DA 1FNIA 1E0FD 1GI5A 2ALVA 1RXPA 1XUFA 4GSOA 3D62A 1J16A 1W7XH 1GI1A 2OC7A 2DUCA 2H1UA 4WH8A 3SQEE 5L30H 2HNTF 4A7IB 1UHBB 1GI6A 1F5KU 1SLUB 1LKAA 1EJNA 3PROA 2Z9JA 2A4QA 1TOCB 3ZV8A 2NU2E 4LK4A 4H4FA 3B8JA 2QN5T 2F3CE 1P12E 3LGIA 1DSTA 5EPYA 1V2UT 1C1OA 3S9CA 3Q76A 4A1XA 1DITH 3L33A 9LPRA 5TJXA 1A7SA 3NPSA 1FIWA 1HAPH 4X2YA 4RKJB 5JB9S 2ZP0H 2IPHA 3S9AA 1AD8H 1FY3A 1U6QA 1K22H 2FOFA 1RTLA 1NTPA 4DURA 1MTVA 3M7QA 5JBCS 1QR3E 3SJKA 1VGCB 3MYWA 3UY9A 1IQGA 4ABBA 1K1OA 1TBRH 4JMYA 1CHOF 4BAMB 4ZKSU 1C5XB 2LPRA 2XXLA 1GHZA 4AX9H 2P94A 4NIWA 4Q80A 4YESB 3RXDA 2A4RA 1GL0E 4WXIA 2EC9H 3B9FH 1HNEE 3CS7A 4ISHH 5LPEA 2H2ZA 1AQ7A 3RMMH 4AB9A 4JK6A 2XWBI 2ANMH 1AFQB 3RC5A 2VH0A 1NFXA 3PYHA 3KQEA 2G4TA 1CHGA 1O2YA 1SGTA 2F9OA 1UVUH 2XCFA 1C5MD 2K7XA 1FJSA 2NU1E 3DD2H 2PKSB 2PTCE 3SJIA 5LH8A 3M7UA 3P8OA 3QWCH 2P16A 4QT8C 1J17T 1O3CA 2A32A 2STAE 1Q3XA 1T4UH 4X8TH 1HLTH 1KTTB 1HIAB 1FLEE 2IOTA 3MO9A 2SGDE 4BTIB 1SGFA 4K2YA 5FPSA 4CR9A 2ZTXA 3SU2A 4DJZB 1ABJH 1MCTA 1C5LH 3FP6E 3URDA 1SLXB 5AVDA 1AUTC 3LOXA 2BLWA 2Z9KA 5EU8A 1QB1A 4AFUA 2PGBB 3E6PH 2GMTB 1BOQA 1EKBB 3VB3A 1VCPA 1ELEE 5FHTA 2GCTB 2PSYA 3MNCA 2AMQA 1A0HB 4K3JA 1GHWH 1E36B 4AOQA 1WBGB 3ELAH 5DP4A 3MNBA 4U32A 1GWAA 1FY5A 2BZAA 2P8OC 4YT7H 2SGQE 1THPB 3VXEH 2HOBA 3TNSA 1O3BA 3O8RA 1DDJA 1TNJA 3QK1A 2BD3A 1AFEH 5A8YA 4A5TS 2BDIA 3GY7A 3HK3B 3RXBA 2B8OH 1KXFA 8KME2 1CHOG 3T28A 2D8WA 3AASA 1OWIA 5F6MA 1K9OE 2AMDA 3VEQB 5JB8S 3ATWA 1QBVH 3D65E 4ZKRU 1FAXA 1QIXB 1T31A 3G01A 3GOVB 3ZVEA 1TA2A 3M5MA 3QUMP 4INLA 3SJ8A 2QYIA 5DP8A 3RC6A 1K28D 1CT2E 1KTSB 1A5IA 1ZTLA 3PLKA 4K60A 1C1UH 2HPPH 2ZFFH 3SNCA 3BTWE 4YLQH 5E2PA 2AIPA 2OD3B 2BY8X 4I8HA 3I77A 1QCPA 1O2OA 4TWYA 1GVLA 3TH3H 3KIDU 2BQ7B 4ZXXH 2C3SA 1DWDH 1LHGH 1LVBA 3MI4A 1SGIB 1W2KH 1MKWH 2O9QA 3BTQE 3K2UA 2BVRH 1LKBA 2A4OA 2BVSH 4DG4A 1NO9H 1C5QA 1OPHB 1ZR0A 4ABDA 3SN8A 3F9GA 3A8DA 1Y3VA 2GVFA 1H9LB 1ZJDA 2O8WA 3H5CB 4R8TB 1H4WA 4Y8XA 1MMJN 3T27A 3VB5A 2FMJA 1YPHC 2GGVB 5EPNA 1RIWC 3SUEA 1VITF 2Z6BD 5C2ZA 1G3CA 1A3BH 3LJJA 5DG6A 3O8BA 2R0KA 4ZHMU 3T26A 1ZMLA 1DWBH 2LNCA 2WUBA 5DP9A 1PPZA 2ZDMA 3LDXH 1WUNH 1HCGA 3LPRA 4BAHB 2VGCC 1MQ6A 1UTQA 1HAYB 2ZECA 1HGTH 5EG4A 1Y3UA 5A0AE 1XKBC 1P02A 2WUCA 2BD5A 2OXSA 1C9PA 3ZV9A 2FODA 3UOUA 3RXMA 4IN1A 1KLIH 1VGCC 4H42U 3SJOA 3QX5H 1K1LA 1FY4A 1ESAA 3M3TA 1QNJA 1OP2A 4DW2U 1QBNA 3BTFE 1G30B 2FYQA 2BXUH 5B6OA 4TYDA 5PTPA 3A89A 1AE5A 3M36A 1WQSA 2JKHA 3ITIA 1PQ8A 5TCCA 3PO1C 1EJAA 2OLGA 1ELVA 1AFQC 1XVMA 1O2XA 2BXTH 2UWOA 1O2VA 4GAWA 1QB9A 3W94A 3RU4E 2A5IA 4BAKB 1KSNA 2AYWA 1O3MA 4MNVA 1O2JA 2BY9X 4D9QA 1F2SE 1LHFH 1A3EH 4NFEA 1UTNA 5HYOA 3HK6B 2Q6DA 2B0FA 1GJDB 2J94A 1D3QB 1MBQA 1V2PT 2VIWA 4ISIH 5EQSA 1TYNA 1C1QA 1TNHA 1AMHA 3KF2A 3SHAH 3LC3A 1O3IA 1NRRH 5J4SA 1LMWB 1O2KA 2C8XB 1SGQE 2AFQB 1VITG 2CXVA 3DFLA 1TWXB 3E3TA 2ZU2A 3AVZA 1HRTH 4OS5A 1TPOA 1GHYH 2RA0A 4FU7A 5EODA 2EI7A 3SV7A 2SFAA 2JETC 2R2MB 4MTBA 3SO3A 4E7NA 1ABIH 2BYAX 5T6GA 2GCHF 3M3VA 4AGJA 2PLXA 2BDCA 1WCZA 4MVNA 1BTXA 3OTJE 2BX4A 2BX3A 4MQAA 5IYTA 1XUJA 2YNAA 1OKXA 1XM1A 2BLQA 1MKXK 2O8MA 1SGRE 4NWLA 2ZPQA 1BMMH 4X1SU 1O32A 1BHXF 5T3HA 1QRXA 1XXFA 3SI4H 1QL8A 4AFQA 1BTHH 3LGVA 1F0UA 1AGJA 1T8MA 2XNIA 5LGOA 5EW1H 1ZRKA 1O33A 2DE9A 1Z6EA 1O0DH 3SU4A 2V3OH 4MLFB 2W7UA 3KQBA 2G8TA 2P3TB 4WJG2 1ETRH 1ID5H 4WMEA 3SQHE 3GDUA 1EAWA 2ZTYA 1NY22 1SLVB 6CHAB 2BY7X 2IN2A 1A5HA 2ZKSA 1WQVH 1S0RA 3GY5A 2GX4A 3RXAA 4CREA 3A8CA 1GGDC 1CGIE 1MZAA 3T62A 1L1GA 1GBKA 3MHWU 2VWMA 1YF4A 2QA9E 3FP7E 1UTKA 2XRCA 3M7TA 3E90B 3TK6A 5FAHA 1LHEH 1BBRE 2QXGA 1ELGA 3ZZ3A 1F7ZA 3UR9A 1LQEA 1WYKA 1GBCA 2ZEBA 4JYVH 5DGJA 1GVZA 4IC5A 4HI3A 3C27B 1FXYA 2FYRA 4XDEA 1L4ZA 2R3UA 5EW2H 4Y8ZA 2GCHG 1N8OC 2G52A 2A7HA 2GT7A 5SGAE 1NFUA 2PWXA 1O3DA 3M61U 2ZQ2A 1C1NA 4KKDA 1P2JA 4RSPA 4FVDA 3M35A 1T8OA 5GPIB 2ZTZA 1MD8A 3RXQA 1Z8GA 1TAWA 2J95A 1BTUA 1ZMJA 1OWHA 3ZYEA 3PMBB 2I6SA 2ZCHP 3T5FH 3SUFA 2HGTH 4I31A 1DXPA 2EI6A 1GHBG 1S81A 3SBKA 1QFKH 4Q2KA 1SGYE 4OS7A 1ARBA 1BA8B 2CF8H 3NK8A 4BXSA 3E0NB 1J15A 3A86A 1PPBH 4ABGA 4D8NA 3F9HA 2ZCKP 1TGSZ 2BDBA 2QY0B 1JRTA 4IC6A 1SMFE 4K8BA 4MPUA 5L6NH 2GZ7A 1ZLRA 4XOJA 3ZVDA 4B71A 1UTPA 2FM2A 3SNDA 5DKMA 4NZLA 3STIA 1EASA 1GBIA 1C1VH 2NU0E 4U01A 4E06H 2Y5FA 4FU8A 1J8AA 4CR5A 1ZHRA 1QURH 2ZNKH 1O2TA 4YTAA 2Y5GA 1PQ7A 1NESE 1TMTH 4JYTA 1E35B 2ZHWH 4HFPB 2TBSA 3MNXA 1O2MA 4MNWA 5CMXH 2JH6D 2VIOA 4HTCH 4ZKOU 1C2EA 1UHBA 4FU9A 2ZGCA 4ABEA 4E7RG 1G37A 2OQ5A 4X2VA 2OBOA 2WYGA 4YOJA 2JH5D 2C4FH 2A31A 1IOEA 5DJ7A 1GBLA 2FOMB 2FTMA 2SNWA 2FOGA 1C2GA 2V6NA 1GMCG 2IJOB 2GDEH 2ZG0H 3TH2H 2Z7FE 1C1PA 1O35A 5FCRA 1IQHA 5GWZA 3EA7A 1GJCB 2QXIA 1HJAB 4LXBH 2WPLS 1LO6A 3Q3KA 5JDUB 2ZGXH 3M3SA 4HGCA 2TIOA 1MTUA 1O2PA 1VITH 2ZIQH 5A0BA 5A8ZA 1O34A 3Q3YA 2G55A 2FEQH 2ZDNA 1D9IA 1HXFH 1BITA 1P0SH 2V3HH 1C5OH 4DIIH 1O2IA 2WPIS 4K1EA 1Z7KA 3PLPA 1C1SA 3ZZ4A 3F9EA 1NRNH 1PJPA 3ATIA 3PB1E 1F5LA 1ELCA 7ESTE 4FUCA 1P8VC 1IHTH 1DUEA 3AW1A 1MKWK 2BD9A 2EEKA 1G36A 1WTHD 5EGMA 2BQWB 1O3PB 1KYNA 4INHA 3IITA 2BM2A 1K21H 4NA8A 1EQ9A 3FANA 1YLDA 2GD4B 1MU8B 4FUJA 3F1SB 3M37A 2V0BA 1EAUA 2UUJB 3TJOA 1SPJA