3F9WA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y334f / h4-lys20 / adohcy
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD8
publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9wA00
4J7IA 4MI0A 1XQHA 3MO5A 5KJNA 5F59A 5HI7A 3RIBA 3F9WA 5ARGA 3QWWA 1PEGA 5AYFA 3SW9A 2W5ZA 5TEGA 3CBOA 3M57A 5EX0A 4YPAA 3CBMA 1MVHA 3M53A 3FPDA 4MI5A 3RJWA 3RAYA 4Z4PA 1MVXA 4AU7A 3MO0A 5JINA 3EP0A 5KJLA 4I51A 4O30A 2R3AA 3OXFA 4QENA 3F9YA 3VV0A 5T0KA 1N6CA 4FMUA 1H3IA 4YNMA 5EX3A 4YPUA 3KMJA 3M59A 4YNPA 2RFIA 3RQ4A 3F9XA 3M5AA 3MO2A 2BQZA 5TH7A 4J7FA 5KJMA 3K5KA 4YPEA 4QEOA 5EG2A 3CBPA 4WUYA 1O9SA 3M54A 4E47A 3OXGA 3OS5A 5F6LA 5T5GA 4IJDA 2O8JA 3QWVA 4O6FA 5F6KC 4RZ0A 2G46A 1N6AA 1N3JA 1ZKKA 4IJ8A 3TG5A 5CCLA 4NJ5A 3PDNA 4YNDA 3RU0A 1ML9A 5LSZA 4QEPA 3KMTA 5LSXA 3VUZA 2W5YA 5HQ8A 3N71A 3KMAA 3M56A 3M55A 3OXLA 3SWCA 3DB5A 5F5EA 3S7DA 5ARFA 4LDGA 3S8PA 3S7BA 2IGQA 4C1QA 5CPRB 3S7JA 1MT6A 3TG4A 3OPEA 3HNAA 1MUFA 4H12A 5KJKA 2JV0A 3M58A 3MEKA 2F69A 3OOIA 3DALA 5TTFA 5JHNA 4J83A 4NVQA 5JJ0A 3BO5A 3QWPA 4BUPA 4J8OA 3F9ZA 3IHXA 5T0MA 3S7FA 5JIYA 4JLGA 4JDSA 5CCMA 2QPWA
chains in the Genus database with same CATH superfamily
4J7IA 4MI0A 1XQHA 3MO5A 5KJNA 5F59A 5HI7A 3RIBA 3F9WA 5ARGA 3QWWA 1PEGA 5AYFA 3SW9A 2W5ZA 5TEGA 3CBOA 3M57A 5EX0A 4YPAA 3CBMA 1MVHA 3M53A 3FPDA 4MI5A 3RJWA 3RAYA 4Z4PA 1MVXA 4AU7A 3MO0A 5JINA 3EP0A 5KJLA 4I51A 4O30A 2R3AA 3OXFA 4QENA 3F9YA 3VV0A 5T0KA 1N6CA 4FMUA 1H3IA 4YNMA 5EX3A 4YPUA 3KMJA 3M59A 4YNPA 2RFIA 3RQ4A 3F9XA 3M5AA 3MO2A 2BQZA 5TH7A 4J7FA 5KJMA 3K5KA 4YPEA 4QEOA 5EG2A 3CBPA 4WUYA 1O9SA 3M54A 4E47A 3OXGA 3OS5A 5F6LA 5T5GA 4IJDA 2O8JA 3QWVA 4O6FA 5F6KC 4RZ0A 2G46A 1N6AA 1N3JA 1ZKKA 4IJ8A 3TG5A 5CCLA 4NJ5A 3PDNA 4YNDA 3RU0A 1ML9A 5LSZA 4QEPA 3KMTA 5LSXA 3VUZA 2W5YA 5HQ8A 3N71A 3KMAA 3M56A 3M55A 3OXLA 3SWCA 3DB5A 5F5EA 3S7DA 5ARFA 4LDGA 3S8PA 3S7BA 2IGQA 4C1QA 5CPRB 3S7JA 1MT6A 3TG4A 3OPEA 3HNAA 1MUFA 4H12A 5KJKA 2JV0A 3M58A 3MEKA 2F69A 3OOIA 3DALA 5TTFA 5JHNA 4J83A 4NVQA 5JJ0A 3BO5A 3QWPA 4BUPA 4J8OA 3F9ZA 3IHXA 5T0MA 3S7FA 5JIYA 4JLGA 4JDSA 5CCMA 2QPWA
chains in the Genus database with same CATH topology
4J7IA 4MI0A 1XQHA 3MO5A 5KJNA 5F59A 5HI7A 3RIBA 3F9WA 5ARGA 3QWWA 1PEGA 5AYFA 3SW9A 2W5ZA 5TEGA 3CBOA 3M57A 5EX0A 4YPAA 3CBMA 1MVHA 3M53A 3FPDA 4MI5A 3RJWA 3RAYA 4Z4PA 1MVXA 4AU7A 3MO0A 5JINA 3EP0A 5KJLA 4I51A 4O30A 2R3AA 3OXFA 4QENA 3F9YA 3VV0A 5T0KA 1N6CA 4FMUA 1H3IA 4YNMA 5EX3A 4YPUA 3KMJA 3M59A 4YNPA 2RFIA 3RQ4A 3F9XA 3M5AA 3MO2A 2BQZA 5TH7A 4J7FA 5KJMA 3K5KA 4YPEA 4QEOA 5EG2A 3CBPA 4WUYA 1O9SA 3M54A 4E47A 3OXGA 3OS5A 5F6LA 5T5GA 4IJDA 2O8JA 3QWVA 4O6FA 5F6KC 4RZ0A 2G46A 1N6AA 1N3JA 1ZKKA 4IJ8A 3TG5A 5CCLA 4NJ5A 3PDNA 4YNDA 3RU0A 1ML9A 5LSZA 4QEPA 3KMTA 5LSXA 3VUZA 2W5YA 5HQ8A 3N71A 3KMAA 3M56A 3M55A 3OXLA 3SWCA 3DB5A 5F5EA 3S7DA 5ARFA 4LDGA 3S8PA 3S7BA 2IGQA 4C1QA 5CPRB 3S7JA 1MT6A 3TG4A 3OPEA 3HNAA 1MUFA 4H12A 5KJKA 2JV0A 3M58A 3MEKA 2F69A 3OOIA 3DALA 5TTFA 5JHNA 4J83A 4NVQA 5JJ0A 3BO5A 3QWPA 4BUPA 4J8OA 3F9ZA 3IHXA 5T0MA 3S7FA 5JIYA 4JLGA 4JDSA 5CCMA 2QPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7I A;  4MI0 A;  1XQH A;  3MO5 A;  5KJN A;  5F59 A;  5HI7 A;  3RIB A;  3F9W A;  5ARG A;  3QWW A;  1PEG A;  5AYF A;  3SW9 A;  2W5Z A;  5TEG A;  3CBO A;  3M57 A;  5EX0 A;  4YPA A;  3CBM A;  1MVH A;  3M53 A;  3FPD A;  4MI5 A;  3RJW A;  3RAY A;  4Z4P A;  1MVX A;  4AU7 A;  3MO0 A;  5JIN A;  3EP0 A;  5KJL A;  4I51 A;  4O30 A;  2R3A A;  3OXF A;  4QEN A;  3F9Y A;  3VV0 A;  5T0K A;  1N6C A;  4FMU A;  1H3I A;  4YNM A;  5EX3 A;  4YPU A;  3KMJ A;  3M59 A;  4YNP A;  2RFI A;  3RQ4 A;  3F9X A;  3M5A A;  3MO2 A;  2BQZ A;  5TH7 A;  4J7F A;  5KJM A;  3K5K A;  4YPE A;  4QEO A;  5EG2 A;  3CBP A;  4WUY A;  1O9S A;  3M54 A;  4E47 A;  3OXG A;  3OS5 A;  5F6L A;  5T5G A;  4IJD A;  2O8J A;  3QWV A;  4O6F A;  5F6K C;  4RZ0 A;  2G46 A;  1N6A A;  1N3J A;  1ZKK A;  4IJ8 A;  3TG5 A;  5CCL A;  4NJ5 A;  3PDN A;  4YND A;  3RU0 A;  1ML9 A;  5LSZ A;  4QEP A;  3KMT A;  5LSX A;  3VUZ A;  2W5Y A;  5HQ8 A;  3N71 A;  3KMA A;  3M56 A;  3M55 A;  3OXL A;  3SWC A;  3DB5 A;  5F5E A;  3S7D A;  5ARF A;  4LDG A;  3S8P A;  3S7B A;  2IGQ A;  4C1Q A;  5CPR B;  3S7J A;  1MT6 A;  3TG4 A;  3OPE A;  3HNA A;  1MUF A;  4H12 A;  5KJK A;  2JV0 A;  3M58 A;  3MEK A;  2F69 A;  3OOI A;  3DAL A;  5TTF A;  5JHN A;  4J83 A;  4NVQ A;  5JJ0 A;  3BO5 A;  3QWP A;  4BUP A;  4J8O A;  3F9Z A;  3IHX A;  5T0M A;  3S7F A;  5JIY A;  4JLG A;  4JDS A;  5CCM A;  2QPW A; 
#chains in the Genus database with same CATH topology
 4J7I A;  4MI0 A;  1XQH A;  3MO5 A;  5KJN A;  5F59 A;  5HI7 A;  3RIB A;  3F9W A;  5ARG A;  3QWW A;  1PEG A;  5AYF A;  3SW9 A;  2W5Z A;  5TEG A;  3CBO A;  3M57 A;  5EX0 A;  4YPA A;  3CBM A;  1MVH A;  3M53 A;  3FPD A;  4MI5 A;  3RJW A;  3RAY A;  4Z4P A;  1MVX A;  4AU7 A;  3MO0 A;  5JIN A;  3EP0 A;  5KJL A;  4I51 A;  4O30 A;  2R3A A;  3OXF A;  4QEN A;  3F9Y A;  3VV0 A;  5T0K A;  1N6C A;  4FMU A;  1H3I A;  4YNM A;  5EX3 A;  4YPU A;  3KMJ A;  3M59 A;  4YNP A;  2RFI A;  3RQ4 A;  3F9X A;  3M5A A;  3MO2 A;  2BQZ A;  5TH7 A;  4J7F A;  5KJM A;  3K5K A;  4YPE A;  4QEO A;  5EG2 A;  3CBP A;  4WUY A;  1O9S A;  3M54 A;  4E47 A;  3OXG A;  3OS5 A;  5F6L A;  5T5G A;  4IJD A;  2O8J A;  3QWV A;  4O6F A;  5F6K C;  4RZ0 A;  2G46 A;  1N6A A;  1N3J A;  1ZKK A;  4IJ8 A;  3TG5 A;  5CCL A;  4NJ5 A;  3PDN A;  4YND A;  3RU0 A;  1ML9 A;  5LSZ A;  4QEP A;  3KMT A;  5LSX A;  3VUZ A;  2W5Y A;  5HQ8 A;  3N71 A;  3KMA A;  3M56 A;  3M55 A;  3OXL A;  3SWC A;  3DB5 A;  5F5E A;  3S7D A;  5ARF A;  4LDG A;  3S8P A;  3S7B A;  2IGQ A;  4C1Q A;  5CPR B;  3S7J A;  1MT6 A;  3TG4 A;  3OPE A;  3HNA A;  1MUF A;  4H12 A;  5KJK A;  2JV0 A;  3M58 A;  3MEK A;  2F69 A;  3OOI A;  3DAL A;  5TTF A;  5JHN A;  4J83 A;  4NVQ A;  5JJ0 A;  3BO5 A;  3QWP A;  4BUP A;  4J8O A;  3F9Z A;  3IHX A;  5T0M A;  3S7F A;  5JIY A;  4JLG A;  4JDS A;  5CCM A;  2QPW A; 
#chains in the Genus database with same CATH homology
 4J7I A;  4MI0 A;  1XQH A;  3MO5 A;  5KJN A;  5F59 A;  5HI7 A;  3RIB A;  3F9W A;  5ARG A;  3QWW A;  1PEG A;  5AYF A;  3SW9 A;  2W5Z A;  5TEG A;  3CBO A;  3M57 A;  5EX0 A;  4YPA A;  3CBM A;  1MVH A;  3M53 A;  3FPD A;  4MI5 A;  3RJW A;  3RAY A;  4Z4P A;  1MVX A;  4AU7 A;  3MO0 A;  5JIN A;  3EP0 A;  5KJL A;  4I51 A;  4O30 A;  2R3A A;  3OXF A;  4QEN A;  3F9Y A;  3VV0 A;  5T0K A;  1N6C A;  4FMU A;  1H3I A;  4YNM A;  5EX3 A;  4YPU A;  3KMJ A;  3M59 A;  4YNP A;  2RFI A;  3RQ4 A;  3F9X A;  3M5A A;  3MO2 A;  2BQZ A;  5TH7 A;  4J7F A;  5KJM A;  3K5K A;  4YPE A;  4QEO A;  5EG2 A;  3CBP A;  4WUY A;  1O9S A;  3M54 A;  4E47 A;  3OXG A;  3OS5 A;  5F6L A;  5T5G A;  4IJD A;  2O8J A;  3QWV A;  4O6F A;  5F6K C;  4RZ0 A;  2G46 A;  1N6A A;  1N3J A;  1ZKK A;  4IJ8 A;  3TG5 A;  5CCL A;  4NJ5 A;  3PDN A;  4YND A;  3RU0 A;  1ML9 A;  5LSZ A;  4QEP A;  3KMT A;  5LSX A;  3VUZ A;  2W5Y A;  5HQ8 A;  3N71 A;  3KMA A;  3M56 A;  3M55 A;  3OXL A;  3SWC A;  3DB5 A;  5F5E A;  3S7D A;  5ARF A;  4LDG A;  3S8P A;  3S7B A;  2IGQ A;  4C1Q A;  5CPR B;  3S7J A;  1MT6 A;  3TG4 A;  3OPE A;  3HNA A;  1MUF A;  4H12 A;  5KJK A;  2JV0 A;  3M58 A;  3MEK A;  2F69 A;  3OOI A;  3DAL A;  5TTF A;  5JHN A;  4J83 A;  4NVQ A;  5JJ0 A;  3BO5 A;  3QWP A;  4BUP A;  4J8O A;  3F9Z A;  3IHX A;  5T0M A;  3S7F A;  5JIY A;  4JLG A;  4JDS A;  5CCM A;  2QPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...