3F9WA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y334f / h4-lys20 / adohcy
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD8
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9wA00
3DB5A 3DALA 4YNPA 4YPUA 3K5KA 5EG2A 5JJ0A 5CPRB 3RJWA 4C1QA 3M56A 3KMAA 3RQ4A 5F59A 2W5ZA 5KJNA 1XQHA 5T0KA 4YNDA 4YPAA 2RFIA 4JDSA 3MO0A 5HI7A 3F9XA 5F5EA 3BO5A 1MUFA 3KMJA 4BUPA 4YPEA 5KJLA 5HQ8A 3SWCA 2JV0A 2BQZA 3PDNA 3EP0A 4IJ8A 4MI5A 3RAYA 3VV0A 1O9SA 4J7IA 1ZKKA 2G46A 3F9YA 2QPWA 2W5YA 4E47A 5JHNA 4QEPA 5KJMA 3CBPA 3HNAA 5F6KC 5TH7A 3RU0A 3OXFA 1N3JA 3OXLA 5T0MA 3S8PA 3KMTA 5CCMA 5EX0A 5JINA 4NVQA 3TG4A 3CBMA 4J8OA 1H3IA 3VUZA 5AYFA 3M55A 3CBOA 5KJKA 5F6LA 4O30A 3S7JA 3OPEA 2O8JA 4I51A 4WUYA 2R3AA 4QEOA 4MI0A 3F9ZA 3OXGA 5CCLA 3MO5A 3IHXA 4J83A 3QWVA 1MVHA 3QWPA 3RIBA 1ML9A 3QWWA 3S7FA 4JLGA 3M53A 5EX3A 4H12A 3OOIA 3OS5A 4FMUA 4NJ5A 1N6AA 4J7FA 3MO2A 2F69A 3M59A 4YNMA 5LSZA 1PEGA 3M5AA 5ARGA 4AU7A 4Z4PA 1MT6A 4O6FA 3S7BA 1N6CA 3N71A 3FPDA 4RZ0A 3TG5A 5T5GA 5LSXA 4QENA 4LDGA 3SW9A 3M58A 3F9WA 1MVXA 3M54A 5TTFA 5ARFA 4IJDA 5TEGA 3M57A 2IGQA 3S7DA 3MEKA 5JIYA
chains in the Genus database with same CATH superfamily
3DB5A 3DALA 4YNPA 4YPUA 3K5KA 5EG2A 5JJ0A 5CPRB 3RJWA 4C1QA 3M56A 3KMAA 3RQ4A 5F59A 2W5ZA 5KJNA 1XQHA 5T0KA 4YNDA 4YPAA 2RFIA 4JDSA 3MO0A 5HI7A 3F9XA 5F5EA 3BO5A 1MUFA 3KMJA 4BUPA 4YPEA 5KJLA 5HQ8A 3SWCA 2JV0A 2BQZA 3PDNA 3EP0A 4IJ8A 4MI5A 3RAYA 3VV0A 1O9SA 4J7IA 1ZKKA 2G46A 3F9YA 2QPWA 2W5YA 4E47A 5JHNA 4QEPA 5KJMA 3CBPA 3HNAA 5F6KC 5TH7A 3RU0A 3OXFA 1N3JA 3OXLA 5T0MA 3S8PA 3KMTA 5CCMA 5EX0A 5JINA 4NVQA 3TG4A 3CBMA 4J8OA 1H3IA 3VUZA 5AYFA 3M55A 3CBOA 5KJKA 5F6LA 4O30A 3S7JA 3OPEA 2O8JA 4I51A 4WUYA 2R3AA 4QEOA 4MI0A 3F9ZA 3OXGA 5CCLA 3MO5A 3IHXA 4J83A 3QWVA 1MVHA 3QWPA 3RIBA 1ML9A 3QWWA 3S7FA 4JLGA 3M53A 5EX3A 4H12A 3OOIA 3OS5A 4FMUA 4NJ5A 1N6AA 4J7FA 3MO2A 2F69A 3M59A 4YNMA 5LSZA 1PEGA 3M5AA 5ARGA 4AU7A 4Z4PA 1MT6A 4O6FA 3S7BA 1N6CA 3N71A 3FPDA 4RZ0A 3TG5A 5T5GA 5LSXA 4QENA 4LDGA 3SW9A 3M58A 3F9WA 1MVXA 3M54A 5TTFA 5ARFA 4IJDA 5TEGA 3M57A 2IGQA 3S7DA 3MEKA 5JIYA
chains in the Genus database with same CATH topology
3DB5A 3DALA 4YNPA 4YPUA 3K5KA 5EG2A 5JJ0A 5CPRB 3RJWA 4C1QA 3M56A 3KMAA 3RQ4A 5F59A 2W5ZA 5KJNA 1XQHA 5T0KA 4YNDA 4YPAA 2RFIA 4JDSA 3MO0A 5HI7A 3F9XA 5F5EA 3BO5A 1MUFA 3KMJA 4BUPA 4YPEA 5KJLA 5HQ8A 3SWCA 2JV0A 2BQZA 3PDNA 3EP0A 4IJ8A 4MI5A 3RAYA 3VV0A 1O9SA 4J7IA 1ZKKA 2G46A 3F9YA 2QPWA 2W5YA 4E47A 5JHNA 4QEPA 5KJMA 3CBPA 3HNAA 5F6KC 5TH7A 3RU0A 3OXFA 1N3JA 3OXLA 5T0MA 3S8PA 3KMTA 5CCMA 5EX0A 5JINA 4NVQA 3TG4A 3CBMA 4J8OA 1H3IA 3VUZA 5AYFA 3M55A 3CBOA 5KJKA 5F6LA 4O30A 3S7JA 3OPEA 2O8JA 4I51A 4WUYA 2R3AA 4QEOA 4MI0A 3F9ZA 3OXGA 5CCLA 3MO5A 3IHXA 4J83A 3QWVA 1MVHA 3QWPA 3RIBA 1ML9A 3QWWA 3S7FA 4JLGA 3M53A 5EX3A 4H12A 3OOIA 3OS5A 4FMUA 4NJ5A 1N6AA 4J7FA 3MO2A 2F69A 3M59A 4YNMA 5LSZA 1PEGA 3M5AA 5ARGA 4AU7A 4Z4PA 1MT6A 4O6FA 3S7BA 1N6CA 3N71A 3FPDA 4RZ0A 3TG5A 5T5GA 5LSXA 4QENA 4LDGA 3SW9A 3M58A 3F9WA 1MVXA 3M54A 5TTFA 5ARFA 4IJDA 5TEGA 3M57A 2IGQA 3S7DA 3MEKA 5JIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DB5 A;  3DAL A;  4YNP A;  4YPU A;  3K5K A;  5EG2 A;  5JJ0 A;  5CPR B;  3RJW A;  4C1Q A;  3M56 A;  3KMA A;  3RQ4 A;  5F59 A;  2W5Z A;  5KJN A;  1XQH A;  5T0K A;  4YND A;  4YPA A;  2RFI A;  4JDS A;  3MO0 A;  5HI7 A;  3F9X A;  5F5E A;  3BO5 A;  1MUF A;  3KMJ A;  4BUP A;  4YPE A;  5KJL A;  5HQ8 A;  3SWC A;  2JV0 A;  2BQZ A;  3PDN A;  3EP0 A;  4IJ8 A;  4MI5 A;  3RAY A;  3VV0 A;  1O9S A;  4J7I A;  1ZKK A;  2G46 A;  3F9Y A;  2QPW A;  2W5Y A;  4E47 A;  5JHN A;  4QEP A;  5KJM A;  3CBP A;  3HNA A;  5F6K C;  5TH7 A;  3RU0 A;  3OXF A;  1N3J A;  3OXL A;  5T0M A;  3S8P A;  3KMT A;  5CCM A;  5EX0 A;  5JIN A;  4NVQ A;  3TG4 A;  3CBM A;  4J8O A;  1H3I A;  3VUZ A;  5AYF A;  3M55 A;  3CBO A;  5KJK A;  5F6L A;  4O30 A;  3S7J A;  3OPE A;  2O8J A;  4I51 A;  4WUY A;  2R3A A;  4QEO A;  4MI0 A;  3F9Z A;  3OXG A;  5CCL A;  3MO5 A;  3IHX A;  4J83 A;  3QWV A;  1MVH A;  3QWP A;  3RIB A;  1ML9 A;  3QWW A;  3S7F A;  4JLG A;  3M53 A;  5EX3 A;  4H12 A;  3OOI A;  3OS5 A;  4FMU A;  4NJ5 A;  1N6A A;  4J7F A;  3MO2 A;  2F69 A;  3M59 A;  4YNM A;  5LSZ A;  1PEG A;  3M5A A;  5ARG A;  4AU7 A;  4Z4P A;  1MT6 A;  4O6F A;  3S7B A;  1N6C A;  3N71 A;  3FPD A;  4RZ0 A;  3TG5 A;  5T5G A;  5LSX A;  4QEN A;  4LDG A;  3SW9 A;  3M58 A;  3F9W A;  1MVX A;  3M54 A;  5TTF A;  5ARF A;  4IJD A;  5TEG A;  3M57 A;  2IGQ A;  3S7D A;  3MEK A;  5JIY A; 
#chains in the Genus database with same CATH topology
 3DB5 A;  3DAL A;  4YNP A;  4YPU A;  3K5K A;  5EG2 A;  5JJ0 A;  5CPR B;  3RJW A;  4C1Q A;  3M56 A;  3KMA A;  3RQ4 A;  5F59 A;  2W5Z A;  5KJN A;  1XQH A;  5T0K A;  4YND A;  4YPA A;  2RFI A;  4JDS A;  3MO0 A;  5HI7 A;  3F9X A;  5F5E A;  3BO5 A;  1MUF A;  3KMJ A;  4BUP A;  4YPE A;  5KJL A;  5HQ8 A;  3SWC A;  2JV0 A;  2BQZ A;  3PDN A;  3EP0 A;  4IJ8 A;  4MI5 A;  3RAY A;  3VV0 A;  1O9S A;  4J7I A;  1ZKK A;  2G46 A;  3F9Y A;  2QPW A;  2W5Y A;  4E47 A;  5JHN A;  4QEP A;  5KJM A;  3CBP A;  3HNA A;  5F6K C;  5TH7 A;  3RU0 A;  3OXF A;  1N3J A;  3OXL A;  5T0M A;  3S8P A;  3KMT A;  5CCM A;  5EX0 A;  5JIN A;  4NVQ A;  3TG4 A;  3CBM A;  4J8O A;  1H3I A;  3VUZ A;  5AYF A;  3M55 A;  3CBO A;  5KJK A;  5F6L A;  4O30 A;  3S7J A;  3OPE A;  2O8J A;  4I51 A;  4WUY A;  2R3A A;  4QEO A;  4MI0 A;  3F9Z A;  3OXG A;  5CCL A;  3MO5 A;  3IHX A;  4J83 A;  3QWV A;  1MVH A;  3QWP A;  3RIB A;  1ML9 A;  3QWW A;  3S7F A;  4JLG A;  3M53 A;  5EX3 A;  4H12 A;  3OOI A;  3OS5 A;  4FMU A;  4NJ5 A;  1N6A A;  4J7F A;  3MO2 A;  2F69 A;  3M59 A;  4YNM A;  5LSZ A;  1PEG A;  3M5A A;  5ARG A;  4AU7 A;  4Z4P A;  1MT6 A;  4O6F A;  3S7B A;  1N6C A;  3N71 A;  3FPD A;  4RZ0 A;  3TG5 A;  5T5G A;  5LSX A;  4QEN A;  4LDG A;  3SW9 A;  3M58 A;  3F9W A;  1MVX A;  3M54 A;  5TTF A;  5ARF A;  4IJD A;  5TEG A;  3M57 A;  2IGQ A;  3S7D A;  3MEK A;  5JIY A; 
#chains in the Genus database with same CATH homology
 3DB5 A;  3DAL A;  4YNP A;  4YPU A;  3K5K A;  5EG2 A;  5JJ0 A;  5CPR B;  3RJW A;  4C1Q A;  3M56 A;  3KMA A;  3RQ4 A;  5F59 A;  2W5Z A;  5KJN A;  1XQH A;  5T0K A;  4YND A;  4YPA A;  2RFI A;  4JDS A;  3MO0 A;  5HI7 A;  3F9X A;  5F5E A;  3BO5 A;  1MUF A;  3KMJ A;  4BUP A;  4YPE A;  5KJL A;  5HQ8 A;  3SWC A;  2JV0 A;  2BQZ A;  3PDN A;  3EP0 A;  4IJ8 A;  4MI5 A;  3RAY A;  3VV0 A;  1O9S A;  4J7I A;  1ZKK A;  2G46 A;  3F9Y A;  2QPW A;  2W5Y A;  4E47 A;  5JHN A;  4QEP A;  5KJM A;  3CBP A;  3HNA A;  5F6K C;  5TH7 A;  3RU0 A;  3OXF A;  1N3J A;  3OXL A;  5T0M A;  3S8P A;  3KMT A;  5CCM A;  5EX0 A;  5JIN A;  4NVQ A;  3TG4 A;  3CBM A;  4J8O A;  1H3I A;  3VUZ A;  5AYF A;  3M55 A;  3CBO A;  5KJK A;  5F6L A;  4O30 A;  3S7J A;  3OPE A;  2O8J A;  4I51 A;  4WUY A;  2R3A A;  4QEO A;  4MI0 A;  3F9Z A;  3OXG A;  5CCL A;  3MO5 A;  3IHX A;  4J83 A;  3QWV A;  1MVH A;  3QWP A;  3RIB A;  1ML9 A;  3QWW A;  3S7F A;  4JLG A;  3M53 A;  5EX3 A;  4H12 A;  3OOI A;  3OS5 A;  4FMU A;  4NJ5 A;  1N6A A;  4J7F A;  3MO2 A;  2F69 A;  3M59 A;  4YNM A;  5LSZ A;  1PEG A;  3M5A A;  5ARG A;  4AU7 A;  4Z4P A;  1MT6 A;  4O6F A;  3S7B A;  1N6C A;  3N71 A;  3FPD A;  4RZ0 A;  3TG5 A;  5T5G A;  5LSX A;  4QEN A;  4LDG A;  3SW9 A;  3M58 A;  3F9W A;  1MVX A;  3M54 A;  5TTF A;  5ARF A;  4IJD A;  5TEG A;  3M57 A;  2IGQ A;  3S7D A;  3MEK A;  5JIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...