3F9WA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y334f / h4-lys20 / adohcy
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
b'KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD8
publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9wA00
4Z4PA 4MI5A 5F59A 5ARFA 5T0KA 5T5GA 1MVXA 4E47A 1MVHA 4YPEA 4O30A 4YPAA 4BUPA 3PDNA 3QWWA 4QEOA 3RJWA 4LDGA 3M56A 5F6KC 3VUZA 3K5KA 4I51A 5JJ0A 5KJNA 3HNAA 4J7FA 5CCMA 4AU7A 4H12A 3CBMA 3KMTA 3F9WA 3M58A 1ZKKA 3F9ZA 3SWCA 4JDSA 4J7IA 3M54A 3M55A 5KJKA 4NVQA 3M57A 3OXLA 4MI0A 2O8JA 4JLGA 4NJ5A 5CPRB 3CBPA 1N6CA 2QPWA 3M53A 3M59A 4QENA 4YNPA 3S7DA 3TG5A 5HQ8A 3TG4A 1ML9A 3OOIA 3RU0A 5EG2A 2R3AA 5LSZA 5HI7A 3DB5A 4C1QA 3RQ4A 5TTFA 2F69A 4IJDA 5EX3A 4YNDA 4WUYA 3S7BA 4RZ0A 3KMAA 3DALA 5KJLA 5CCLA 3S8PA 3F9YA 1MT6A 5JINA 3RAYA 3BO5A 4J8OA 4O6FA 3QWVA 1O9SA 1N6AA 4J83A 2RFIA 3QWPA 2JV0A 3OXFA 1MUFA 3CBOA 2IGQA 3RIBA 2W5ZA 3S7FA 5KJMA 5F5EA 3FPDA 3OPEA 3OXGA 5AYFA 1N3JA 4QEPA 3OS5A 5EX0A 1H3IA 5JHNA 3MO2A 3MO5A 3S7JA 3M5AA 5T0MA 3IHXA 5TH7A 2G46A 3SW9A 5LSXA 4FMUA 5ARGA 2W5YA 1PEGA 4YNMA 5JIYA 5TEGA 2BQZA 3MEKA 3EP0A 3MO0A 5F6LA 1XQHA 3N71A 4YPUA 3F9XA 3VV0A 4IJ8A 3KMJA
chains in the Genus database with same CATH superfamily
4Z4PA 4MI5A 5F59A 5ARFA 5T0KA 5T5GA 1MVXA 4E47A 1MVHA 4YPEA 4O30A 4YPAA 4BUPA 3PDNA 3QWWA 4QEOA 3RJWA 4LDGA 3M56A 5F6KC 3VUZA 3K5KA 4I51A 5JJ0A 5KJNA 3HNAA 4J7FA 5CCMA 4AU7A 4H12A 3CBMA 3KMTA 3F9WA 3M58A 1ZKKA 3F9ZA 3SWCA 4JDSA 4J7IA 3M54A 3M55A 5KJKA 4NVQA 3M57A 3OXLA 4MI0A 2O8JA 4JLGA 4NJ5A 5CPRB 3CBPA 1N6CA 2QPWA 3M53A 3M59A 4QENA 4YNPA 3S7DA 3TG5A 5HQ8A 3TG4A 1ML9A 3OOIA 3RU0A 5EG2A 2R3AA 5LSZA 5HI7A 3DB5A 4C1QA 3RQ4A 5TTFA 2F69A 4IJDA 5EX3A 4YNDA 4WUYA 3S7BA 4RZ0A 3KMAA 3DALA 5KJLA 5CCLA 3S8PA 3F9YA 1MT6A 5JINA 3RAYA 3BO5A 4J8OA 4O6FA 3QWVA 1O9SA 1N6AA 4J83A 2RFIA 3QWPA 2JV0A 3OXFA 1MUFA 3CBOA 2IGQA 3RIBA 2W5ZA 3S7FA 5KJMA 5F5EA 3FPDA 3OPEA 3OXGA 5AYFA 1N3JA 4QEPA 3OS5A 5EX0A 1H3IA 5JHNA 3MO2A 3MO5A 3S7JA 3M5AA 5T0MA 3IHXA 5TH7A 2G46A 3SW9A 5LSXA 4FMUA 5ARGA 2W5YA 1PEGA 4YNMA 5JIYA 5TEGA 2BQZA 3MEKA 3EP0A 3MO0A 5F6LA 1XQHA 3N71A 4YPUA 3F9XA 3VV0A 4IJ8A 3KMJA
chains in the Genus database with same CATH topology
4Z4PA 4MI5A 5F59A 5ARFA 5T0KA 5T5GA 1MVXA 4E47A 1MVHA 4YPEA 4O30A 4YPAA 4BUPA 3PDNA 3QWWA 4QEOA 3RJWA 4LDGA 3M56A 5F6KC 3VUZA 3K5KA 4I51A 5JJ0A 5KJNA 3HNAA 4J7FA 5CCMA 4AU7A 4H12A 3CBMA 3KMTA 3F9WA 3M58A 1ZKKA 3F9ZA 3SWCA 4JDSA 4J7IA 3M54A 3M55A 5KJKA 4NVQA 3M57A 3OXLA 4MI0A 2O8JA 4JLGA 4NJ5A 5CPRB 3CBPA 1N6CA 2QPWA 3M53A 3M59A 4QENA 4YNPA 3S7DA 3TG5A 5HQ8A 3TG4A 1ML9A 3OOIA 3RU0A 5EG2A 2R3AA 5LSZA 5HI7A 3DB5A 4C1QA 3RQ4A 5TTFA 2F69A 4IJDA 5EX3A 4YNDA 4WUYA 3S7BA 4RZ0A 3KMAA 3DALA 5KJLA 5CCLA 3S8PA 3F9YA 1MT6A 5JINA 3RAYA 3BO5A 4J8OA 4O6FA 3QWVA 1O9SA 1N6AA 4J83A 2RFIA 3QWPA 2JV0A 3OXFA 1MUFA 3CBOA 2IGQA 3RIBA 2W5ZA 3S7FA 5KJMA 5F5EA 3FPDA 3OPEA 3OXGA 5AYFA 1N3JA 4QEPA 3OS5A 5EX0A 1H3IA 5JHNA 3MO2A 3MO5A 3S7JA 3M5AA 5T0MA 3IHXA 5TH7A 2G46A 3SW9A 5LSXA 4FMUA 5ARGA 2W5YA 1PEGA 4YNMA 5JIYA 5TEGA 2BQZA 3MEKA 3EP0A 3MO0A 5F6LA 1XQHA 3N71A 4YPUA 3F9XA 3VV0A 4IJ8A 3KMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4P A;  4MI5 A;  5F59 A;  5ARF A;  5T0K A;  5T5G A;  1MVX A;  4E47 A;  1MVH A;  4YPE A;  4O30 A;  4YPA A;  4BUP A;  3PDN A;  3QWW A;  4QEO A;  3RJW A;  4LDG A;  3M56 A;  5F6K C;  3VUZ A;  3K5K A;  4I51 A;  5JJ0 A;  5KJN A;  3HNA A;  4J7F A;  5CCM A;  4AU7 A;  4H12 A;  3CBM A;  3KMT A;  3F9W A;  3M58 A;  1ZKK A;  3F9Z A;  3SWC A;  4JDS A;  4J7I A;  3M54 A;  3M55 A;  5KJK A;  4NVQ A;  3M57 A;  3OXL A;  4MI0 A;  2O8J A;  4JLG A;  4NJ5 A;  5CPR B;  3CBP A;  1N6C A;  2QPW A;  3M53 A;  3M59 A;  4QEN A;  4YNP A;  3S7D A;  3TG5 A;  5HQ8 A;  3TG4 A;  1ML9 A;  3OOI A;  3RU0 A;  5EG2 A;  2R3A A;  5LSZ A;  5HI7 A;  3DB5 A;  4C1Q A;  3RQ4 A;  5TTF A;  2F69 A;  4IJD A;  5EX3 A;  4YND A;  4WUY A;  3S7B A;  4RZ0 A;  3KMA A;  3DAL A;  5KJL A;  5CCL A;  3S8P A;  3F9Y A;  1MT6 A;  5JIN A;  3RAY A;  3BO5 A;  4J8O A;  4O6F A;  3QWV A;  1O9S A;  1N6A A;  4J83 A;  2RFI A;  3QWP A;  2JV0 A;  3OXF A;  1MUF A;  3CBO A;  2IGQ A;  3RIB A;  2W5Z A;  3S7F A;  5KJM A;  5F5E A;  3FPD A;  3OPE A;  3OXG A;  5AYF A;  1N3J A;  4QEP A;  3OS5 A;  5EX0 A;  1H3I A;  5JHN A;  3MO2 A;  3MO5 A;  3S7J A;  3M5A A;  5T0M A;  3IHX A;  5TH7 A;  2G46 A;  3SW9 A;  5LSX A;  4FMU A;  5ARG A;  2W5Y A;  1PEG A;  4YNM A;  5JIY A;  5TEG A;  2BQZ A;  3MEK A;  3EP0 A;  3MO0 A;  5F6L A;  1XQH A;  3N71 A;  4YPU A;  3F9X A;  3VV0 A;  4IJ8 A;  3KMJ A; 
#chains in the Genus database with same CATH topology
 4Z4P A;  4MI5 A;  5F59 A;  5ARF A;  5T0K A;  5T5G A;  1MVX A;  4E47 A;  1MVH A;  4YPE A;  4O30 A;  4YPA A;  4BUP A;  3PDN A;  3QWW A;  4QEO A;  3RJW A;  4LDG A;  3M56 A;  5F6K C;  3VUZ A;  3K5K A;  4I51 A;  5JJ0 A;  5KJN A;  3HNA A;  4J7F A;  5CCM A;  4AU7 A;  4H12 A;  3CBM A;  3KMT A;  3F9W A;  3M58 A;  1ZKK A;  3F9Z A;  3SWC A;  4JDS A;  4J7I A;  3M54 A;  3M55 A;  5KJK A;  4NVQ A;  3M57 A;  3OXL A;  4MI0 A;  2O8J A;  4JLG A;  4NJ5 A;  5CPR B;  3CBP A;  1N6C A;  2QPW A;  3M53 A;  3M59 A;  4QEN A;  4YNP A;  3S7D A;  3TG5 A;  5HQ8 A;  3TG4 A;  1ML9 A;  3OOI A;  3RU0 A;  5EG2 A;  2R3A A;  5LSZ A;  5HI7 A;  3DB5 A;  4C1Q A;  3RQ4 A;  5TTF A;  2F69 A;  4IJD A;  5EX3 A;  4YND A;  4WUY A;  3S7B A;  4RZ0 A;  3KMA A;  3DAL A;  5KJL A;  5CCL A;  3S8P A;  3F9Y A;  1MT6 A;  5JIN A;  3RAY A;  3BO5 A;  4J8O A;  4O6F A;  3QWV A;  1O9S A;  1N6A A;  4J83 A;  2RFI A;  3QWP A;  2JV0 A;  3OXF A;  1MUF A;  3CBO A;  2IGQ A;  3RIB A;  2W5Z A;  3S7F A;  5KJM A;  5F5E A;  3FPD A;  3OPE A;  3OXG A;  5AYF A;  1N3J A;  4QEP A;  3OS5 A;  5EX0 A;  1H3I A;  5JHN A;  3MO2 A;  3MO5 A;  3S7J A;  3M5A A;  5T0M A;  3IHX A;  5TH7 A;  2G46 A;  3SW9 A;  5LSX A;  4FMU A;  5ARG A;  2W5Y A;  1PEG A;  4YNM A;  5JIY A;  5TEG A;  2BQZ A;  3MEK A;  3EP0 A;  3MO0 A;  5F6L A;  1XQH A;  3N71 A;  4YPU A;  3F9X A;  3VV0 A;  4IJ8 A;  3KMJ A; 
#chains in the Genus database with same CATH homology
 4Z4P A;  4MI5 A;  5F59 A;  5ARF A;  5T0K A;  5T5G A;  1MVX A;  4E47 A;  1MVH A;  4YPE A;  4O30 A;  4YPA A;  4BUP A;  3PDN A;  3QWW A;  4QEO A;  3RJW A;  4LDG A;  3M56 A;  5F6K C;  3VUZ A;  3K5K A;  4I51 A;  5JJ0 A;  5KJN A;  3HNA A;  4J7F A;  5CCM A;  4AU7 A;  4H12 A;  3CBM A;  3KMT A;  3F9W A;  3M58 A;  1ZKK A;  3F9Z A;  3SWC A;  4JDS A;  4J7I A;  3M54 A;  3M55 A;  5KJK A;  4NVQ A;  3M57 A;  3OXL A;  4MI0 A;  2O8J A;  4JLG A;  4NJ5 A;  5CPR B;  3CBP A;  1N6C A;  2QPW A;  3M53 A;  3M59 A;  4QEN A;  4YNP A;  3S7D A;  3TG5 A;  5HQ8 A;  3TG4 A;  1ML9 A;  3OOI A;  3RU0 A;  5EG2 A;  2R3A A;  5LSZ A;  5HI7 A;  3DB5 A;  4C1Q A;  3RQ4 A;  5TTF A;  2F69 A;  4IJD A;  5EX3 A;  4YND A;  4WUY A;  3S7B A;  4RZ0 A;  3KMA A;  3DAL A;  5KJL A;  5CCL A;  3S8P A;  3F9Y A;  1MT6 A;  5JIN A;  3RAY A;  3BO5 A;  4J8O A;  4O6F A;  3QWV A;  1O9S A;  1N6A A;  4J83 A;  2RFI A;  3QWP A;  2JV0 A;  3OXF A;  1MUF A;  3CBO A;  2IGQ A;  3RIB A;  2W5Z A;  3S7F A;  5KJM A;  5F5E A;  3FPD A;  3OPE A;  3OXG A;  5AYF A;  1N3J A;  4QEP A;  3OS5 A;  5EX0 A;  1H3I A;  5JHN A;  3MO2 A;  3MO5 A;  3S7J A;  3M5A A;  5T0M A;  3IHX A;  5TH7 A;  2G46 A;  3SW9 A;  5LSX A;  4FMU A;  5ARG A;  2W5Y A;  1PEG A;  4YNM A;  5JIY A;  5TEG A;  2BQZ A;  3MEK A;  3EP0 A;  3MO0 A;  5F6L A;  1XQH A;  3N71 A;  4YPU A;  3F9X A;  3VV0 A;  4IJ8 A;  3KMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...