3F9WA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y334f / h4-lys20 / adohcy
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
b'KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD8
publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9wA00
4NJ5A 3MO2A 5F6KC 3MO5A 5F5EA 3S7JA 3PDNA 3KMAA 5TTFA 5CCLA 5JIYA 5F59A 3KMTA 2F69A 4Z4PA 3RQ4A 3MO0A 5JHNA 5EX3A 3BO5A 3M5AA 3QWPA 2W5YA 3TG5A 3S7FA 3M53A 3M59A 4AU7A 5CPRB 4RZ0A 2BQZA 3M56A 3CBMA 4O6FA 3OXLA 3RIBA 2R3AA 3VV0A 5JJ0A 5T5GA 5HI7A 4MI0A 5CCMA 3IHXA 3CBPA 1ML9A 4O30A 4YNMA 4C1QA 3S7DA 5KJMA 3CBOA 4QENA 1MUFA 3M58A 2W5ZA 5ARFA 4FMUA 1N6AA 4J8OA 5TH7A 4J83A 2IGQA 1H3IA 5EX0A 2G46A 3RJWA 4I51A 5TEGA 1MT6A 2JV0A 5KJKA 4QEPA 3SWCA 3F9WA 1O9SA 5T0MA 3RAYA 4YNDA 5KJNA 4IJDA 4E47A 2RFIA 3DB5A 4H12A 3VUZA 3OXFA 4MI5A 5AYFA 3OOIA 1XQHA 1N6CA 2QPWA 3OPEA 3KMJA 1PEGA 4J7FA 3RU0A 5JINA 5HQ8A 3EP0A 5T0KA 3F9ZA 4BUPA 1MVHA 3M57A 4J7IA 5ARGA 3K5KA 3TG4A 1ZKKA 5LSZA 3MEKA 1MVXA 4YPEA 4NVQA 4IJ8A 4LDGA 3M54A 5F6LA 3S8PA 5KJLA 3S7BA 4YPUA 3M55A 4YPAA 3OXGA 4JLGA 4YNPA 3N71A 3QWWA 5EG2A 4WUYA 3QWVA 3SW9A 4JDSA 3FPDA 5LSXA 3F9XA 3F9YA 3DALA 4QEOA 1N3JA 2O8JA 3OS5A 3HNAA
chains in the Genus database with same CATH superfamily
4NJ5A 3MO2A 5F6KC 3MO5A 5F5EA 3S7JA 3PDNA 3KMAA 5TTFA 5CCLA 5JIYA 5F59A 3KMTA 2F69A 4Z4PA 3RQ4A 3MO0A 5JHNA 5EX3A 3BO5A 3M5AA 3QWPA 2W5YA 3TG5A 3S7FA 3M53A 3M59A 4AU7A 5CPRB 4RZ0A 2BQZA 3M56A 3CBMA 4O6FA 3OXLA 3RIBA 2R3AA 3VV0A 5JJ0A 5T5GA 5HI7A 4MI0A 5CCMA 3IHXA 3CBPA 1ML9A 4O30A 4YNMA 4C1QA 3S7DA 5KJMA 3CBOA 4QENA 1MUFA 3M58A 2W5ZA 5ARFA 4FMUA 1N6AA 4J8OA 5TH7A 4J83A 2IGQA 1H3IA 5EX0A 2G46A 3RJWA 4I51A 5TEGA 1MT6A 2JV0A 5KJKA 4QEPA 3SWCA 3F9WA 1O9SA 5T0MA 3RAYA 4YNDA 5KJNA 4IJDA 4E47A 2RFIA 3DB5A 4H12A 3VUZA 3OXFA 4MI5A 5AYFA 3OOIA 1XQHA 1N6CA 2QPWA 3OPEA 3KMJA 1PEGA 4J7FA 3RU0A 5JINA 5HQ8A 3EP0A 5T0KA 3F9ZA 4BUPA 1MVHA 3M57A 4J7IA 5ARGA 3K5KA 3TG4A 1ZKKA 5LSZA 3MEKA 1MVXA 4YPEA 4NVQA 4IJ8A 4LDGA 3M54A 5F6LA 3S8PA 5KJLA 3S7BA 4YPUA 3M55A 4YPAA 3OXGA 4JLGA 4YNPA 3N71A 3QWWA 5EG2A 4WUYA 3QWVA 3SW9A 4JDSA 3FPDA 5LSXA 3F9XA 3F9YA 3DALA 4QEOA 1N3JA 2O8JA 3OS5A 3HNAA
chains in the Genus database with same CATH topology
4NJ5A 3MO2A 5F6KC 3MO5A 5F5EA 3S7JA 3PDNA 3KMAA 5TTFA 5CCLA 5JIYA 5F59A 3KMTA 2F69A 4Z4PA 3RQ4A 3MO0A 5JHNA 5EX3A 3BO5A 3M5AA 3QWPA 2W5YA 3TG5A 3S7FA 3M53A 3M59A 4AU7A 5CPRB 4RZ0A 2BQZA 3M56A 3CBMA 4O6FA 3OXLA 3RIBA 2R3AA 3VV0A 5JJ0A 5T5GA 5HI7A 4MI0A 5CCMA 3IHXA 3CBPA 1ML9A 4O30A 4YNMA 4C1QA 3S7DA 5KJMA 3CBOA 4QENA 1MUFA 3M58A 2W5ZA 5ARFA 4FMUA 1N6AA 4J8OA 5TH7A 4J83A 2IGQA 1H3IA 5EX0A 2G46A 3RJWA 4I51A 5TEGA 1MT6A 2JV0A 5KJKA 4QEPA 3SWCA 3F9WA 1O9SA 5T0MA 3RAYA 4YNDA 5KJNA 4IJDA 4E47A 2RFIA 3DB5A 4H12A 3VUZA 3OXFA 4MI5A 5AYFA 3OOIA 1XQHA 1N6CA 2QPWA 3OPEA 3KMJA 1PEGA 4J7FA 3RU0A 5JINA 5HQ8A 3EP0A 5T0KA 3F9ZA 4BUPA 1MVHA 3M57A 4J7IA 5ARGA 3K5KA 3TG4A 1ZKKA 5LSZA 3MEKA 1MVXA 4YPEA 4NVQA 4IJ8A 4LDGA 3M54A 5F6LA 3S8PA 5KJLA 3S7BA 4YPUA 3M55A 4YPAA 3OXGA 4JLGA 4YNPA 3N71A 3QWWA 5EG2A 4WUYA 3QWVA 3SW9A 4JDSA 3FPDA 5LSXA 3F9XA 3F9YA 3DALA 4QEOA 1N3JA 2O8JA 3OS5A 3HNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ5 A;  3MO2 A;  5F6K C;  3MO5 A;  5F5E A;  3S7J A;  3PDN A;  3KMA A;  5TTF A;  5CCL A;  5JIY A;  5F59 A;  3KMT A;  2F69 A;  4Z4P A;  3RQ4 A;  3MO0 A;  5JHN A;  5EX3 A;  3BO5 A;  3M5A A;  3QWP A;  2W5Y A;  3TG5 A;  3S7F A;  3M53 A;  3M59 A;  4AU7 A;  5CPR B;  4RZ0 A;  2BQZ A;  3M56 A;  3CBM A;  4O6F A;  3OXL A;  3RIB A;  2R3A A;  3VV0 A;  5JJ0 A;  5T5G A;  5HI7 A;  4MI0 A;  5CCM A;  3IHX A;  3CBP A;  1ML9 A;  4O30 A;  4YNM A;  4C1Q A;  3S7D A;  5KJM A;  3CBO A;  4QEN A;  1MUF A;  3M58 A;  2W5Z A;  5ARF A;  4FMU A;  1N6A A;  4J8O A;  5TH7 A;  4J83 A;  2IGQ A;  1H3I A;  5EX0 A;  2G46 A;  3RJW A;  4I51 A;  5TEG A;  1MT6 A;  2JV0 A;  5KJK A;  4QEP A;  3SWC A;  3F9W A;  1O9S A;  5T0M A;  3RAY A;  4YND A;  5KJN A;  4IJD A;  4E47 A;  2RFI A;  3DB5 A;  4H12 A;  3VUZ A;  3OXF A;  4MI5 A;  5AYF A;  3OOI A;  1XQH A;  1N6C A;  2QPW A;  3OPE A;  3KMJ A;  1PEG A;  4J7F A;  3RU0 A;  5JIN A;  5HQ8 A;  3EP0 A;  5T0K A;  3F9Z A;  4BUP A;  1MVH A;  3M57 A;  4J7I A;  5ARG A;  3K5K A;  3TG4 A;  1ZKK A;  5LSZ A;  3MEK A;  1MVX A;  4YPE A;  4NVQ A;  4IJ8 A;  4LDG A;  3M54 A;  5F6L A;  3S8P A;  5KJL A;  3S7B A;  4YPU A;  3M55 A;  4YPA A;  3OXG A;  4JLG A;  4YNP A;  3N71 A;  3QWW A;  5EG2 A;  4WUY A;  3QWV A;  3SW9 A;  4JDS A;  3FPD A;  5LSX A;  3F9X A;  3F9Y A;  3DAL A;  4QEO A;  1N3J A;  2O8J A;  3OS5 A;  3HNA A; 
#chains in the Genus database with same CATH topology
 4NJ5 A;  3MO2 A;  5F6K C;  3MO5 A;  5F5E A;  3S7J A;  3PDN A;  3KMA A;  5TTF A;  5CCL A;  5JIY A;  5F59 A;  3KMT A;  2F69 A;  4Z4P A;  3RQ4 A;  3MO0 A;  5JHN A;  5EX3 A;  3BO5 A;  3M5A A;  3QWP A;  2W5Y A;  3TG5 A;  3S7F A;  3M53 A;  3M59 A;  4AU7 A;  5CPR B;  4RZ0 A;  2BQZ A;  3M56 A;  3CBM A;  4O6F A;  3OXL A;  3RIB A;  2R3A A;  3VV0 A;  5JJ0 A;  5T5G A;  5HI7 A;  4MI0 A;  5CCM A;  3IHX A;  3CBP A;  1ML9 A;  4O30 A;  4YNM A;  4C1Q A;  3S7D A;  5KJM A;  3CBO A;  4QEN A;  1MUF A;  3M58 A;  2W5Z A;  5ARF A;  4FMU A;  1N6A A;  4J8O A;  5TH7 A;  4J83 A;  2IGQ A;  1H3I A;  5EX0 A;  2G46 A;  3RJW A;  4I51 A;  5TEG A;  1MT6 A;  2JV0 A;  5KJK A;  4QEP A;  3SWC A;  3F9W A;  1O9S A;  5T0M A;  3RAY A;  4YND A;  5KJN A;  4IJD A;  4E47 A;  2RFI A;  3DB5 A;  4H12 A;  3VUZ A;  3OXF A;  4MI5 A;  5AYF A;  3OOI A;  1XQH A;  1N6C A;  2QPW A;  3OPE A;  3KMJ A;  1PEG A;  4J7F A;  3RU0 A;  5JIN A;  5HQ8 A;  3EP0 A;  5T0K A;  3F9Z A;  4BUP A;  1MVH A;  3M57 A;  4J7I A;  5ARG A;  3K5K A;  3TG4 A;  1ZKK A;  5LSZ A;  3MEK A;  1MVX A;  4YPE A;  4NVQ A;  4IJ8 A;  4LDG A;  3M54 A;  5F6L A;  3S8P A;  5KJL A;  3S7B A;  4YPU A;  3M55 A;  4YPA A;  3OXG A;  4JLG A;  4YNP A;  3N71 A;  3QWW A;  5EG2 A;  4WUY A;  3QWV A;  3SW9 A;  4JDS A;  3FPD A;  5LSX A;  3F9X A;  3F9Y A;  3DAL A;  4QEO A;  1N3J A;  2O8J A;  3OS5 A;  3HNA A; 
#chains in the Genus database with same CATH homology
 4NJ5 A;  3MO2 A;  5F6K C;  3MO5 A;  5F5E A;  3S7J A;  3PDN A;  3KMA A;  5TTF A;  5CCL A;  5JIY A;  5F59 A;  3KMT A;  2F69 A;  4Z4P A;  3RQ4 A;  3MO0 A;  5JHN A;  5EX3 A;  3BO5 A;  3M5A A;  3QWP A;  2W5Y A;  3TG5 A;  3S7F A;  3M53 A;  3M59 A;  4AU7 A;  5CPR B;  4RZ0 A;  2BQZ A;  3M56 A;  3CBM A;  4O6F A;  3OXL A;  3RIB A;  2R3A A;  3VV0 A;  5JJ0 A;  5T5G A;  5HI7 A;  4MI0 A;  5CCM A;  3IHX A;  3CBP A;  1ML9 A;  4O30 A;  4YNM A;  4C1Q A;  3S7D A;  5KJM A;  3CBO A;  4QEN A;  1MUF A;  3M58 A;  2W5Z A;  5ARF A;  4FMU A;  1N6A A;  4J8O A;  5TH7 A;  4J83 A;  2IGQ A;  1H3I A;  5EX0 A;  2G46 A;  3RJW A;  4I51 A;  5TEG A;  1MT6 A;  2JV0 A;  5KJK A;  4QEP A;  3SWC A;  3F9W A;  1O9S A;  5T0M A;  3RAY A;  4YND A;  5KJN A;  4IJD A;  4E47 A;  2RFI A;  3DB5 A;  4H12 A;  3VUZ A;  3OXF A;  4MI5 A;  5AYF A;  3OOI A;  1XQH A;  1N6C A;  2QPW A;  3OPE A;  3KMJ A;  1PEG A;  4J7F A;  3RU0 A;  5JIN A;  5HQ8 A;  3EP0 A;  5T0K A;  3F9Z A;  4BUP A;  1MVH A;  3M57 A;  4J7I A;  5ARG A;  3K5K A;  3TG4 A;  1ZKK A;  5LSZ A;  3MEK A;  1MVX A;  4YPE A;  4NVQ A;  4IJ8 A;  4LDG A;  3M54 A;  5F6L A;  3S8P A;  5KJL A;  3S7B A;  4YPU A;  3M55 A;  4YPA A;  3OXG A;  4JLG A;  4YNP A;  3N71 A;  3QWW A;  5EG2 A;  4WUY A;  3QWV A;  3SW9 A;  4JDS A;  3FPD A;  5LSX A;  3F9X A;  3F9Y A;  3DAL A;  4QEO A;  1N3J A;  2O8J A;  3OS5 A;  3HNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...