3FA3A

Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, trigonal crystal form
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
301
structure length
301
Chain Sequence
b'PMVTAATSLRRALENPDSFIVAPGVYDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRCGHLAGKILVDTDTYVTRIRAAVQARQRIGSDIVVIARTDSLQTHGYEESVARLRAARDAGADVGFLEGITSREMARQVIQDLAGWPLLLNMVEHGATPSISAAEAKEMGFRIIIFPFAALGPAVAAMREAMEKLKRDGIPGLDKEMTPQMLFRVCGLDESMKVDAQAGGAAFDGGVDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3-dimethylmalate lyase
publication title Structure and function of 2,3-dimethylmalate lyase, a PEP mutase/isocitrate lyase superfamily member.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Lyase
total genus 111
structure length 301
sequence length 301
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 4.1.3.32: 2,3-dimethylmalate lyase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3fa3A00
4QG9A 4LSBA 1PKMA 3IS4A 1DIKA 3QTGA 1PKLA 3HQOA 3M0KA 1E0TA 1VBGA 1MUMA 3BJFA 1XG4A 3OYXA 4KCWA 2KX9A 4G1NA 3P0XA 4B2DA 3OYZA 2VGFA 4DRSA 1S2TA 3QV6A 3SRDA 4IP7A 2WQDA 3HQNA 2E28A 4B2DD 4MF4A 1PYMA 3T05A 3LYEA 3PP7A 4YJ5A 2QIWA 1S2WA 3GG8A 4L9ZA 1UJQA 3QZ6A 4B5XA 1KBLA 1A3XA 3T0TA 3SRFA 4L80A 2HROA 4TV5A 4B5TA 3QV8A 1E0UA 1T5AA 1KC7A 1XG3A 1O68A 1IGWA 1VBHA 3VAVA 1F3WA 2DIKA 1Z6KA 1F61A 4QGCA 3EZ4A 3LG3A 3SRHA 1DQUA 1M3UA 4B5UA 2HJPA 1F3XA 4KCVA 3ME3A 1PKNA 3EOOA 4HYVA 4QG8A 3I4EA 3EOEA 3SRKA 2XZ9A 2VGBA 3B8IA 1OQFA 1F8MA 3G2GA 3H6OA 4KCTA 4HYWA 4KS0A 4KRZA 3E0VA 3HQPA 4IMAA 4RPPA 3KHDA 4YNGA 1F8IA 4KCUA 3GQYA 1O5QA 3EOLA 3MA8A 1U5VA 3BJTA 3QV9A 1GGOA 1A3WA 1M1BA 2XZ7A 3T07A 1AQFA 3FA3A 4FXFA 4B5VA 1OY0A 3KTXA 3QQWA 3QLLA 2HWGA 3R4IA 4FXJA 1ZJHA 4IQDA 1JDEA 3U2ZA 3E0WA 4MG4A 1IZCA 1DXEA 3OQ8A 4JPGA 2R82A 2DUAA 1DXFA 1S2VA 5JVLA 3GR4A 2VGGA 2XDFA 4WJ8A 4L9YA 1U5HA 2V5JA 4QG6A 2HRWA 2BG5A 3E5BA 2OLSA 5TAOA 1S2UA 2G50A 1SGJA 3PUGA 4L7ZA 4B5SA 1ZLPA 3N25A 1PKYA 4B5WA 4ROQA 2VWTA 1A5UA 2ZE3A 2V5KA 4TV6A 1O66A 3QV7A 2VGIA 2L5HA 2VWSA 1A49A 3M0JA 2X0SA 4IQEA 3FA4A
chains in the Genus database with same CATH superfamily
1J5TA 1FDJA 3PN8A 3KX6A 4MFEA 1W9DM 3K4WA 3PNZA 2PDWA 5D9OA 2HNHA 2VFGA 1K7EA 1VAHA 4PEKA 3VE9A 4XUGA 4O57A 4QHRA 1F76A 4QDMA 5DMMA 4PA8A 1US3A 5AC5A 2J7FA 4H3DA 4UUIA 1YADA 1MW3A 2GVJA 3AU2A 4PBFA 4A29A 4D72A 1W3LA 5CGTA 3JU2A 1AQHA 1IV8A 1UPMB 1FHUA 4AZCB 1MWOA 3LDVA 4ADSA 1GOOA 3KVLA 1BQCA 2HJPA 3MV11 2VFIA 4MB4A 1J0KA 3B8IA 2C19A 4OQVA 3EB3A 4UQ9A 1H1YA 2XM2A 5DLCA 2E6DA 4DWDA 1O5QA 1IIHA 2XN2A 1F7BA 4CD6A 5A69A 1PBGA 2Z1VA 5G4WA 3S5ZA 3W7RA 1I45A 1O1HA 3E0LA 3L4UA 1I1XA 2ZDSA 1A4LA 1RP9A 1O94A 4YU1A 1GZJA 3SUVA 3GFYA 3M6DA 2OU4A 3MYPA 4CN1A 2QCHA 3ZFHA 3FDGA 3BG5A 4B5SA 3LXCA 1D7FA 5GNYA 2XH4A 2Z2AA 1EQCA 1NFPA 3AU6A 1KFEA 3AWNA 5C6MA 5D8WA 4XBKA 2RJHA 3CH0A 3W82A 4AD5A 4PTVA 1T8QA 1WBHA 4Y9MA 3L4ZA 3WBYA 3SUSA 3W1NA 1H51A 5LNWA 2XH7A 3TEVA 4F0HA 4Y8EA 1OFPA 1TX2A 1I2PA 1D8WA 5G1MA 3ITTA 1ALDA 3SI9A 2EPNA 1HP4A 5DRCA 4PUDA 2UBPC 3Q67A 5BWAA 2C91A 4YTTA 5HBFA 1DVJA 1DWAM 5BMXA 3EMZA 4UC5A 1K03A 6ALDA 3QV8A 1JCNA 4HZ7A 1QNQA 3SQMA 5A94A 4MDOA 2QJGA 1C29A 3U4FA 4EVZA 3CUXA 4XZHA 2NUYA 1X6LA 1F8IA 4O53A 3GHRA 3GDTA 3N1AA 3R5EA 4CN4A 3WQCA 1SMAA 1ADOA 3DI0A 4GY1A 1PTAA 4AXKA 3VGBA 3CV6A 3VDGA 1TE6A 2ZVRA 1N82A 3MT1A 2V2CA 3DDMA 4AD3A 1VRXA 4FOUA 4KF1A 4Q4SA 4ZSUA 1JCXA 1H7RA 4HCDA 1GCYA 3IJ6A 2PF0A 5LZLA 4NZ3A 2WHMA 1ML1A 4XTDA 1KBJA 1AZ1A 3LV6A 2VWSA 1FXPA 4PTMA 4JTTA 4TR9A 4EE9A 4Z2GA 3AYSA 4NF7A 3CZJA 1VB9A 3EX3A 4ZO8A 2FPTA 5HMDA 3UF9A 4LT9A 1UKPA 3S4TA 3TTEA 4BF5A 4R7OA 1FWWA 1UD2A 2VHLA 1RA5A 1GVSA 1S38A 4GZIA 3W25A 4Y90A 4ZA0A 2GJRA 3GG8A 1H1NA 3WQVA 2BASA 3TDFA 1SM9A 4W87A 2BXYA 2QKFA 3OPSA 3TCEA 1DIOA 3LM3A 3VAVA 2I5IA 2WJDA 3SCUA 3SADA 3KUMA 4B3KA 2YZRA 3ANUA 3AHTA 2DZBA 4AH7A 3USZA 3N2OA 3H54A 1H61A 3ICJA 3FJ6A 2A6LA 1VFMA 2PTYA 4W7UA 2V3DA 5FJTA 1GG1A 1IWBA 1GQLA 2WMHA 1XIDA 2YFNA 3L4YA 3L65A 1KFWA 4LGXA 2ZZ6A 3TOYA 2VZOA 4H41A 3FGCA 4WSHA 3OJGA 4ICMA 4Q4KA 1U5JA 1AG1O 4BWLA 4B90A 1TJ2A 3RLUA 1VJIA 3ZT6A 1ZRQA 1MQRA 1Q7MA 3RUBL 4C6EA 3GIQA 4RNIA 3W72A 3VGDA 3H2CA 3T6CA 1Q6OA 1M9HA 2XM1A 4PMNA 1IF2A 1FWSA 5D09A 1BPLB 1Y5VA 1PSCA 4O8AA 4GFSA 2CBVA 3VMPA 3F4VA 5C2CA 2PDJA 3MI2A 1OWQA 2IS7A 1XIEA 3S0CA 1WA3A 4C6PA 3S9YA 4ZO9A 4A6GA 4LF1A 2QIIA 4NJIA 3UPWA 2YZ5A 3ONCA 5M17A 4HPXA 3TYDA 1QOXA 4HSHA 1BWVA 5BOFA 4BQ2A 1R5YA 2PDFA 3U9IA 3G1FA 3TX9A 2PP3A 3R8HA 2Y88A 2INZA 4GI6A 3PZOA 4REQA 1NY1A 1Z89A 3MQTA 4GIAA 3BW3A 1M65A 3BG9A 3QKZA 5TIMA 3B0XA 2H3BA 4GKTA 4K8EA 3WL0A 3R8RA 3OTRA 1BLIA 4IMAA 2ZVIA 3XISA 1TX0A 1SZGA 3GQYA 1EH9A 4IMFA 2POTA 4FA3A 1SR9A 3WD0A 2G3IA 2X42A 4ZODA 4KFOA 3HGJA 3PFRA 2Q09A 2PWFA 1QRQA 3QR3A 4FB7A 1UWTA 3AS0A 3ARVA 4NKCA 2GJXB 1C7TA 4J2PA 1Q6RA 4G56A 4E8CA 4LAOA 2WM1A 3A21A 4H19A 4S3AA 3BOLA 4QSFA 4HGXA 1RPKA 1E1CA 3CEUA 3UESA 2VGIA 2YW4A 2CLHA 1DJWA 3PZNA 4LSBA 2QULA 2HXUA 4ZO7A 2C13A 1RK5A 2XSAA 2A5HA 1BWKA 1XYCA 1D3CA 1E6QM 2R94A 4CQ9A 4M6VA 4B2DA 2GK1B 2QEZA 4NXKA 3S6TA 5A8NA 2GSHA 2DH3A 3NQFA 4MLRA 3WQEA 1W31A 2KAUC 4BCEA 3GKFA 2QDDA 1XLEA 2O4MA 1KM3A 3EDFA 5XIAA 3W7KA 1PTGA 2DSVA 1F3TA 2OLAA 3EA2A 4NQ1A 4TV5A 1NVMA 3RF9A 3FA5A 1IIGA 5ABHA 4LBRA 2C3ZA 3M07A 2VEPA 1QI3A 3H21A 4OT7A 4XAFA 1V7AA 5XIMA 2WV8A 3TQPA 3PG8A 3WUGA 4OBSA 4DO4A 1XHGA 4WDTA 2CZVA 3DGRA 2VFFA 3G1HA 4IT1A 2Y2WA 3KOFA 3WJSA 3CK5A 2FMNA 4H6QA 5A8PA 2VTFA 2AGKA 2PURA 4XSLA 4IF2A 1P0KA 1JUEA 3MUY1 1UIOA 4U31A 4PYSA 4OHQA 5B80A 4QM1A 4OJYA 1CXLA 3LENA 5J5DA 2C0AA 2OXNA 3F2DA 1KRAC 1W1ZA 3TK7A 3ZVIA 5GPRA 1A0DA 1TV2A 4ZQPA 3INPA 2G41A 3PZIA 3RM9A 4LRTA 4LB4A 3REQB 3AXMA 2INFA 3MUZ1 2V8ZA 4UOQA 2WW5A 3KOWA 4JOMA 3SN4A 1HKJA 1XH2A 2TODA 3VZXA 4UTHA 1QU4A 3B8WA 2GDUA 4WKFA 3LY0A 1Q2SA 4EAMA 1GQKA 1YDNA 3HJZA 3EWUA 4ONVA 3NFUA 4ACYA 2BMBA 2PDYA 3WMBA 4C6BA 4V1YA 1TE1A 1MO0A 3NOYA 4AZBA 4KIEA 3DFTA 1QDSA 3S5NA 3KBWA 1AUSL 5GJMA 4AWUA 4QJ1A 4JHOA 4NP7A 1MMFA 4WUIA 1H1ZA 1K8XA 2C18A 2BOFX 4AZHA 4WXYA 3W9ZA 1JQVA 3ZJ6A 3WQFA 7ENLA 2PDIA 2HS8A 3W74A 2NXHA 2Y6ZA 2Z7KA 5AKQA 1IWAA 2X7VA 2BX7A 1DEDA 1MW0A 2VURA 3HQ1A 1JYWA 1Q6LA 1GKPA 2VR4A 3VOIA 4MWAE 2A21A 3F4NA 4Z1DA 4UQEA 3BCDA 4XTIA 3WH9A 3GTIA 4ZTYA 1S1RA 2ZX8A 3HGOA 2A2IA 3CBWA 3LXAA 3C0QA 4UFHA 1SQ7A 3TC7A 2HXTA 2WZIA 4H8VA 1HP5A 3LZ3A 3WBXA 2NWRA 3IGSA 3GLCA 4YHGA 1VFOA 4FNQA 1VFTA 3L0GA 4HOXA 1WYIA 3FY1A 4FF5A 2DPEA 2XH0A 3KCJA 4G8TA 3LB0A 2ZE0A 1QI0A 3N6HA 1L6GA 3IVTA 1SR0A 3NM1A 1MYRA 1DHPA 1SJAA 3P7YA 3WZ0E 2I9UA 2CW6A 5EMUA 1HKMA 2E09A 6XIMA 5CSSA 1FKWA 2PC4A 3A13A 2JK2A 4CQ8A 2PLCA 4ZQMA 4YIWA 3NJ3A 4HZ8A 4MVAA 3I6RA 4OOUA 3LCHA 4HN4A 2J27A 1EA0A 1PZ0A 1EXBA 2RH9A 3EOEA 1JZ6A 1JL8A 2QDEA 2WNWA 2NWSA 3A23A 1OSEA 1RAKA 3CYJA 4CNPA 3MA8A 4AC7C 2XIQA 3SCNA 2JEQA 4O52A 1C9WA 4J5NA 3ALGA 2YLAA 2Z1KA 5D4YA 5J8LA 3OQ8A 2ZADA 3GBDA 4MGGA 1G4SA 1XD1A 1J01A 1AK5A 2QCCA 3VKKA 1ITQA 3RJXA 3DC8A 3G1VA 4W5ZA 4J3TA 2WVSA 4R27A 3LN3A 1DQWA 1NIUA 5E1QA 3WQ6A 2D69A 4N4QA 4IL0A 1A5MC 2O55A 2CLIA 2FVLA 4P61A 3CO8A 2VX5A 3DYPA 4M56A 3CQKA 3FW6A 4GINA 5T26A 3NO3A 1MW2A 2FB2A 4PSPA 2PLJA 2XFRA 3I4KA 4DLFA 3HQNA 3HG4A 3MHFA 1PV8A 1EEXA 4UTWC 4LUIA 5F2MA 1VYSX 1SSGA 3PG9A 4LB3A 4PR4A 1YE4A 2C16A 4KIRA 4P8XA 4I7WA 1P7TB 1P0DA 2GGGA 2WNNA 4NAEA 3AC0A 3DH7A 4Q4OA 3NO5A 4QJ5B 2ACSA 1NDZA 4DEFA 2RDWA 3SRKA 4FO4A 2MNRA 1D8CA 1OX6A 1R7OA 4IGSA 3GAYA 3ITCA 1VKFA 2YYUA 4JTJA 3WD3A 2D0HA 3B8TA 2Z6JA 5BOEA 2DUZA 4M29A 3W7CA 1DP0A 2H9AB 1ICSA 1QNVA 4E2VA 3QLLA 2HWGA 4ASTA 8RUCA 3M5ZA 1KFJA 1ZBCA 2RGMA 3W29A 4PCNA 1XRSA 4PTXA 2OODA 1WP6A 1LROA 2GQ3A 2YCLA 4C6IA 1R0MA 3UJRA 3KBNA 3LV5A 4B4FA 3DYMA 4AVNA 5D04C 1O66A 1JG9A 4Z1AA 4DZAA 2VQTA 5DO8A 4DWSB 3RM4A 1XIBA 4URIA 1EGMA 4AZIA 1UZ1A 1B5TA 3W6YA 1G4PA 2Z2BA 3SCOA 2FDSA 3JUGA 5CGQA 3G0SA 4I90A 3OA3A 1IR2A 2C1GA 3LGEA 4Y7EA 4PN2A 5F1UA 1T0OA 4CCEA 1YX1A 2FTYA 3VUPA 1XCWA 2P88A 5AC7A 3W88A 1MNZA 3W2LA 3CMFA 3HFYA 1JNEA 3V7PA 4L80A 1OGGA 2GJLA 4AD1A 4CNNA 1TJ0A 4L9XA 3ZM8A 3KLLA 2V2HA 3FOKA 4IPNB 4H01A 4HJFA 2NSOA 1J11A 2WKGA 1LBLA 2PP1A 4AY7A 3LLXA 5C70A 6TAAA 1C90A 4JFVA 1VQTA 5TQLA 4XQ6A 4QS6A 3GDRA 3NL5A 7CGTA 5C71A 3ATZA 4WRHA 2PWUA 5K7JA 3W07A 3WFLA 3CIVA 4JTQA 3CT7A 4WX2A 2Y7EA 2A0NA 4F8XA 3FX4A 2XDFA 2DFAA 5TNVA 2HE5A 2I9EA 1E71M 1NTHA 3WEOA 2W0UA 2ZRUA 3GNPA 1OX4B 2F2KA 3LLFA 3BE7A 2EPMX 1A5UA 4GIEA 5B7YA 1DPMA 4H9UA 1BF6A 3EPMA 4MJ4A 1OX4A 1IWPA 3W87A 1JCYA 1EOMA 1EDTA 3TP4A 3EOUA 2D3LA 4U5IA 3RLHA 2QXWA 2BWGA 4CCZA 3CQ0A 1KD0A 3BZGA 2BXZA 4LYQA 1D3HA 2QGYA 2PRMA 1P6BA 2J13A 3F4WA 3OG3A 2ZUVA 5KETA 3QC3A 4I9TA 1NELA 4UQAA 5FCZA 2XGBA 2Y70A 1ZS2A 3PZGA 1VYPX 3G3DA 3OEXA 3VNKA 3LRKA 1K6AA 2OPJA 4K7VA 2XHYA 3N18A 2ALRA 2GL5A 3H6OA 5E93A 3PUEA 2PBGA 2DY3A 1IXQA 1UMLA 3B8UA 2VFHA 5FEXA 4FXJA 1CCWB 3ITXA 1SSDA 5D30A 5JUVA 1IZCA 1REQA 2QT3A 2QPSA 1BXBA 4IXHA 1H7PA 2W92A 2OTDA 2H6RA 2ACQA 3BLKA 1VFSA 1YQ2A 4DUWA 3QJAA 4AG0A 3BURA 4J1OA 3RG6A 1S5VA 1UR8A 2I5QA 3SY5A 1E40A 4X3ZA 5FJIA 3PBVA 2GJPA 3RRAA 5IDZA 4R5EA 4NSBA 4CU8A 4GISA 4DUOA 1JYVA 1AJ2A 3CV2A 3E2RA 3QFEA 2P76A 4Z42C 4V15A 4OWGA 1K4HA 4ZO6A 3SUWA 5LGXA 1UKTA 4QRNA 3RR1A 2FGZA 2WSQA 2PGWA 4JTIA 2IW0A 1GJPA 4UMBA 2WHLA 1UH3A 4TQTA 1HF6A 4ZENA 4R7WA 3KRZA 1F61A 1O1ZA 3CNYA 3FLUA 4IJBA 3ME3A 2ZA1A 3PBMA 2OGYA 1WZLA 2DZPA 3BPWA 5IHSA 2AQVA 2BFGA 2ON3A 3NDYA 1XD0A 4JZ5A 1OFAA 3OG2A 5D9NA 3MMTA 1LP6A 4JYDA 1WPCA 3CUIA 2ATMA 3BW2A 5AVNA 5E6ZA 1RVGA 4CQDA 5MHBA 4JKLA 4GQQA 4FS9A 3CAQA 1JD7A 3PF3A 3W2NA 5T9CE 2D0GA 4QG6A 1HL9A 2PDQA 1Q3NA 3T81A 2ACUA 3T8LA 4A8RA 3N15A 2OEKA 3JW7A 2EJ1A 3T2QA 3MCOA 2BODX 4GX9A 3AJ7A 1YIXA 2W91A 2YXGA 4K3ZA 2ZTKA 3LGDA 4DBWA 4QG9A 4GC4A 1A5LC 4QQ3A 3NAVA 3QTGA 1WDPA 4HBKA 3DXIA 1UUMA 1XBVA 4M5PA 1R46A 1DTNA 5I24A 4GXPA 1VIWA 1W9VA 3SRDA 2WLYA 1QJWA 1AMKA 2OB3A 3ARPA 4JHZA 4PUMA 3KW3A 4GUHA 4LCQA 3WQ4A 3SBFA 1E6ZA 3BV7A 3EB2A 5EBUA 3UXAA 7REQA 2I56A 4Q33A 1EIXA 5AZ1A 3SCVA 1W6TA 3O63A 2DVTA 3FNDA 3NXFA 2OX1A 3GWQA 1I0DA 2ZWYA 3A64A 1JPMA 3DEQA 4TVUA 4O54A 2C8NA 5I09A 3IAQA 3NQMA 4C6KA 3L23A 3RFAA 2B4GA 1QHPA 1M53A 3MS8A 2PDLA 3STFA 4ACZB 5U7SA 4W85A 4WVXA 1CI1A 4NAFB 5DN1A 1T96A 3A3XA 3A3HA 3AQUA 3KDOA 4CNUA 2LLEA 1UZHA 3UXIA 3GB6A 1WZMA 2P10A 4L6HA 1LZOA 3TROA 2DZUA 2Y5EA 5F1VA 3QFWA 2AAMA 4AW7A 1UWRA 4TV6A 1ZJBA 4Y9PA 3WMSA 4O1AA 4F3HA 4HHHA 5C8BB 2PAJA 4U3CA 2IPWA 1ZBVA 5C9WA 3IJ7A 5KZ6A 3SFKA 1SO6A 3BOFA 1RQHA 3UA3A 5D9MA 4H7CA 4U33A 1R6WA 4F40A 2OEMA 4TX6A 3C2VA 3MWAA 1GHRA 2DH2A 4LVFA 1OC6A 1UP3A 1LLOA 2E7FA 3IIXA 3ZJ7A 5GNZA 1SYTA 3R25A 2VZUA 3L2LA 3CL7A 1NH6A 3G24A 4NZ1A 1W2PA 4H6EA 1XIHA 3RITA 2GOUA 4R33A 4ILSA 1GTHA 3ZLFA 2QYGA 3CUHA 1BYAA 2C79A 1M3UA 3URNA 2GJNA 3E5PA 1KQZA 1KFKA 4J9JA 1E56A 2Q3OA 1DORA 4YHEA 5A8OA 1TIWA 1VCGA 3W7JA 2ZQ0A 4C65A 3K30A 1KBIA 4LYRA 4M1BA 4D6FA 2ZBTA 4MB5A 5JBDA 3PBWA 1UD5A 1W9XA 4MIMA 2VGGA 1QPQA 3LSCA 1DOSA 1MQQA 3DG6A 4Q8WA 1UW9A 4A05A 3UZJA 4XZIA 2INEA 3EX1A 3T40A 2HNEA 2YKKA 1VENA 3GRIA 3NQ6A 2VRQA 4NT0A 5I77A 3VOCA 4FOJA 3GHSA 4OBTA 2QVHA 3UWVA 1SJBA 2H8XA 3IARA 2DT2A 4ZB0A 4JN7A 5C2XA 4OV4A 4B3ZA 5BRPA 3B9OA 1XBXA 3W2UA 2GGIA 4PCTA 4JCLA 1YXYA 2XISA 3GTHA 1JUBA 4RK8A 2YCJA 3CUZA 3U5YA 2GWNA 2JKAA 2EG6A 2ZTJA 4KRUA 3CEPA 1ZTVA 3H24A 1ADSA 3W0KA 2ZRZA 4AEFA 4HSOA 1K9TA 4KWWA 5I6SA 4ZQOA 4PMDA 3SB0A 1I2QA 1NF0A 1G7VA 4NUWA 1J96A 3E96A 3TV8A 3AFBA 3HPSA 1Z6KA 5G2IA 1DQUA 1JF6A 3WH8A 4YWSA 3PZUA 4KWVA 1Z7AA 3WUBA 4KRZA 2BGQA 2BV9A 5A6BA 2ZCGA 4TMCA 2CCRA 1XRVA 3JZUA 4WK9A 3KP0A 4TTUA 1K02A 3SSJA 4JNYA 4OBRA 2E5CA 2VFEA 3LTSA 4GLEA 2Q02A 4XD3A 4H9XA 5EMLA 4FI4A 5DQPA 2PI6A 1YEYA 3TIMA 2ZA3A 4JQ1A 2HQAA 3CTTA 3OZYA 3IWPA 4X22A 4A22A 1V3LA 1KQYA 3UWZA 5ECVA 3FXYA 2Y89A 3KRSA 5DBTA 5D37A 2QNEA 4JX5A 2Y5SA 1RQBA 4S3FA 1AA1B 2R1NA 3TSBA 2O0TA 5CZTA 1S39A 1BGGA 3BWWA 1TRIA 1HJXA 3UT0A 5C55A 5FACA 1JVNA 4KT2A 4L61A 2OYLA 3PFMA 3LMZA 1R7AA 3VDBA 3AALA 4O1EA 4FR1A 3W7PA 1NP2A 3LCWA 4GNKB 4B2DD 5HWMA 5JIPA 3DFNA 4EWJA 3AIQA 3APTA 1LRTA 1RALA 4JTSA 3VGFA 3FHQA 1UZ4A 2G3MA 4UFMA 2CLMA 1ME8A 4ZBCA 4YXGA 4PRRA 2E68A 4W89A 1YTKA 1PAMA 2XIIA 4LFYA 1XYBA 1IEQA 4QS5A 4A3QA 3BLEA 3WJYA 5A95A 2R91A 1VLIA 1CPUA 4QP0A 4H9TA 4ZQNA 4PMOA 1XIIA 3SFWA 1EFZA 4JFSA 4D71A 3L21A 4KPLA 3DBPA 5C9XA 3USBA 3L5AA 2F6XA 3G8EA 5DELA 5DFAA 3CLMA 4XAZA 2TYSA 4Y9AA 3EWXA 3B05A 3C2EA 3MY9A 5EMKA 4E8DA 3QBUA 3TAKA 4IQLA 3L2MA 2QUNA 4IQEA 4AEEA 1QBAA 4IHCA 1PB0A 3NQAA 3A4WA 4RXGA 4Q8TA 1EO7A 1WUFA 3M0KA 3O7UA 2V9DA 1XH1A 3W7OA 3M9YA 5I7GA 3P61A 4M7SA 4UR7A 2ZXAA 3NPWA 1LL6A 3TCSA 2PC8A 5A6MA 3I7SA 5EMYA 2QF8A 1W5OA 1TR9A 3KS5A 4AFYA 5BW6A 4PUWA 1EA9C 3GU9A 2R14A 1V3MA 3MHGA 3BSHA 1G94A 2IQDA 1VJZA 3SJ3A 4HQVA 3PPHA 1XYMA 3LBCA 2Z26A 4XAPA 1LOLA 1K8YA 3LA4A 3BO9A 3TW6A 4AIEA 1JNDA 1KXHA 1DWJM 4XD6A 4CNTA 5C7HA 1J0ZA 1OJXA 2YB4A 5AHMA 4GXMA 4IQDA 1HX0A 1DXEA 3W70A 3UGVA 1QAPA 1UZDA 3R2GA 2PDMA 2PRLA 2HPMA 4LAUA 3EDDA 3SIZA 1PZ2A 1OABA 5BYWA 4GYPC 5TBOA 4US5A 1PWMA 5MF5A 3CHVA 4Q8PA 2X40A 4AVOA 1R3SA 4ALDA 4PCSA 4NASA 1GG0A 1XF0A 4OECA 2X09A 2VEGA 3W38A 1YPXA 2QAPA 3HIJA 3NQGA 4EX4A 1F4AA 4JTFA 3WQ8A 3UWQA 3GG7A 2E28A 1TFVA 4FSAA 3B0VC 1M41A 2FB3A 4DJDA 4XZ9A 2OWCA 4C1NA 5D32A 1TA3A 1W91A 1F9CA 1B3XA 1LL4A 2DSUA 4M6PA 3U5UA 4PE8A 3AWOA 3NNTA 3LTPA 2VNCA 4DNMA 1Z44A 1PS9A 2VQUA 2YBVA 4XIMA 3WLTA 5AVHA 1KR1A 2BHUA 1UC4A 4DO5A 1TTPA 1BVWA 3A9IA 3RDKA 4WKAA 1HJQA 2WSPA 2Q6ZA 1CLVA 4I5UA 1PZ3A 3I3DA 2NLIA 2Y1HA 1VYRA 1VPQA 3KXQA 1XGEA 3E9AA 1TUXA 1YPIA 4HNUA 4PCFA 3QQ0A 4HNOA 3T9PA 3SY1A 3IJDA 5HR7A 5HWNA 3N29A 1YBQA 3KLKA 1EJSC 2HS6A 3C86A 4DZHA 1FWDC 4BK9A 2I7GA 1V03A 3UEQA 1QXLA 4JL1A 3U7VA 1FCVA 1WDDA 3EKZA 3MSYA 4G5DA 2FYMA 3UY7A 1AODA 2GQ9A 3ARUA 5HATA 4JS3A 3TJXA 3WH5A 3VFCA 2JQXA 4DRSA 4EWND 2XIBA 1DJQA 3W7GA 3RCMA 3MKVA 1HGWA 2EHHA 5JIWA 1UUOA 2WBGA 3KDNA 4YJ5A 3G1SA 1U1UA 3AS3A 3WELA 2FDMA 1TG7A 1EPXA 5DMLA 3H4WA 3UXDA 4IFKB 1Y65A 4PUEA 4WJXA 2WANA 4CD8A 1MEWA 4K68A 5AECA 2ZA2A 4XWUA 1D2KA 1VFFA 3CYVA 2C1HA 3O16A 3CPGA 1FX6A 3AMGA 1OFEA 1BRLB 5KMYA 4GY0A 1ZAJA 4MZ8A 1CXEA 1EP2A 3B04A 2ABBA 2FZ8A 1W0MA 2BVTA 3ANVA 3R4IA 4H8HA 8A3HA 3EB4A 1KM2A 4KBXA 1W8SA 3MO4A 5DXYA 2TAAA 2WCAA 3V0UA 1RXOB 1XCXA 2EF9A 2QJNA 3UNDA 1TB3A 5JQ9A 1KRCC 3E1F1 2WVVB 4AXNA 4PMVA 2PGRA 2NVDA 3CL6A 3M0JA 1B54A 1DHKA 3M0MA 3O6AA 2VYOA 3IK4A 4JFTA 4RCXA 3IGXA 3EAUA 3IIZA 1J0IA 1XYAA 4LEFA 3L0NA 3TMLA 3N9RA 3VNYA 4G1NA 1TPUA 5E9XA 5HUPA 1FH7A 1XISA 3VD3A 3WF0A 3EYPA 1SW0A 8XIAA 5TD4A 3PTMA 3GTNA 4S2BA 5IM51 4WHBA 2WK2A 1Z69A 3VOFA 2E6YA 4LCRA 3C52A 2GUUA 2VP8A 3N9KA 4M51A 1Y0EA 2G3NA 2A3LA 4JQAA 2WCSA 1XBZA 3WNKA 4W93A 4F0RA 3CZ8A 3JVAA 2Z1WA 3CAWA 2UWFA 4H7VA 4GUFA 3MHUA 3WNNA 2CWNA 1W1TA 2NLYA 3CZKA 3S2LA 2BVYA 5E09A 1UOKA 3F7JA 4P7LA 5CPLA 3ARSA 2NQ5A 4LAMA 1JXJA 1ZZMA 2WM0A 4PBEA 4B92A 3NQBA 1QNSA 3UG8A 4M7TA 3BMWA 1TWZA 5HINA 1X1OA 3F2BA 4L9YA 3MMUA 1SZNA 3STEA 3GTXA 1L8PA 4C7GA 9RUBA 3AXIA 3LPFA 3WDHA 3UBPC 4AYGA 4HNNA 1UP2A 4AIOA 1LCOA 2CEQA 4D6GA 1IGSA 5D33A 1B30A 1Q6GA 3WDRA 1ADDA 5BXSA 2H8ZA 3MTWA 2XSXA 1QO5A 4F9JA 2J6VA 2XN1A 3K2GA 2X0YA 2ICSA 4K38A 2DT0A 2VX6A 4LXFA 3OLDA 4UFIA 4WSJA 1V3IA 2AOSA 5DY3A 2A3EA 4MNJA 1HL8A 1V02A 4AD2A 3NDOA 4DB7A 2P0IA 3O6DA 1PYMA 4GQ0A 4UTTC 3BAWA 2BTMA 2WZHA 3SUUA 2FKPA 3CWHA 4JTRA 4CU7A 1DKWA 4EANA 2WB5A 3TN5A 1DJXA 3LI1A 4XAYA 1RD5A 3OLEA 3KTSA 4RZ5A 2I5GA 2P5NA 2OKOA 3E38A 5I5RA 4C6QA 3C0LA 4GABA 5E0FA 3MP5A 4KCTA 4KS0A 5ABGA 2HPIA 3NR0A 1U2YA 3U2OA 3S8HA 3WIJA 1MXDA 3WLOA 3PVFA 1LF1A 1EJVC 2HDJA 1V6UA 3HURA 3ZLGA 1GOMA 4FZIA 1JCJA 4N9EA 2HE8A 1PPIA 4ZXLA 5KINA 1TQJA 3T2PA 4LBUA 4RZ6A 4JX4A 4WSKA 4D2JA 2P3EA 1G7UA 4DYJA 1XSIA 1CXIA 5DCEA 3S1WA 2AL2A 1V6TA 1VH7A 4GO9A 2V3GA 2CETA 1VCFA 4RV3A 4F0MA 5F2GA 3TQVA 1N7KA 4D6EA 4QEHA 1B3OA 4R34A 3GUGA 3WBAA 4EKJA 3U2EA 3T44A 4Q6JA 2CBIA 1SU5A 3Q45A 4XKYB 1Q4WA 4MWAB 1UKQA 4UMAA 4X0VA 1U33A 2YCEA 1X1NA 1MRQA 2PDNA 2YYTA 3QGKC 3KS6A 1F3WA 2VD9A 1TYGA 1YRRA 3L7RA 2DIJA 5LIXX 3LPOA 1A5AA 3EA1A 3HPAA 1A53A 4WDWA 1G4EA 1MEHA 2A1YA 4YTQA 2VEMA 2YDAA 1QHZA 4DF0A 4PUNA 3W6MA 2V5LA 3S2CA 3PPCA 2W67A 4F2TA 2AMGA 3D47A 3D46A 1PHWA 3PR2A 3TW9A 3ARZA 4HKPA 4DM1A 4GQBA 4YCOA 1JQXA 2DP3A 4GJIA 3GS6A 4HHMA 3OHMB 1DJNA 4M0XA 3N4EA 3GIPA 5I3JA 5E0CA 4ROQA 3K1GA 4IPLA 5HWJA 4DN1A 2Z1XA 3M0LA 3IVUA 2X0SA 3NEHA 2CERA 3VK5A 3LMYA 3MBDA 4JNZA 2Y8KA 4CEUC 3N14A 4RXFA 4DY1A 3QEZA 3UG4A 5HMFA 3VKBA 1KWGA 4GBDA 2R6OA 4EPBC 4ZOBA 3L9CA 1IXOA 3TSMA 1FWJC 1UP0A 5A6SA 2YDRA 3HG3A 4NG3A 4N9DA 4LBSA 4W84A 2QIWA 4K8HA 5BXPA 1A50A 1TV3A 1Y8BA 1V3HA 6CGTA 1UQYA 5EY5A 4AHOA 2FZNA 3O07A 2WZTA 1F6KA 1J8VA 4EOUA 3TR2A 4A8LA 4M6QA 1R9ZA 1QOQA 4C6CA 1FWHC 1X38A 4GZJA 1SFSA 4IG2A 3QXBA 2EG8A 1WE5A 4OOZA 5I07A 3RX4A 3SURA 5LXXA 2WQPA 2ZUTA 1OG6A 3BSGA 3PZVA 4O17A 3W73A 1LWJA 5DRIA 1MDRA 1BQGA 3H4GA 4A3RA 3PM6A 1WXYA 1RHCA 3R0UA 1AQFA 2REQA 4WLCA 4P7RA 3M5VA 1KR0A 3SCSA 3VIHA 4UFKA 3V3WA 1UBSA 1JZ5A 1GYMA 4FX7A 3UW6A 3W1PA 1A5CA 3S6DA 1XH0A 5HNNA 3KL0A 1KM1A 1W17A 3GR7A 1ISXA 1M68A 4E3VA 1LQAA 3QYQA 1LRNA 1JJKA 2E5BA 2Z0IA 5HUOA 1GOQA 3XINA 2ESCA 2E77A 1DIKA 4JL2A 2GGEA 1RBAA 2DZXA 1X7FA 2E1DA 4JN6A 1YPFA 3ARQA 4ADUA 3FYPA 4MSSA 4PMUA 4JFWA 3BV4A 4IP7A 2CLPA 4MF4A 5LKYA 3GXFA 3LYEA 1SW3A 3KBSA 3JZEA 3THQA 4C6JA 1KBLA 1HVQA 1H2JA 1AD4A 3U8GA 1TPWA 3NYZA 5FSDC 1XI3A 3UJ2A 3WX7A 2E6AA 1KBKA 2A7RA 4KETA 3B06A 2Z24A 2PCEA 1R47A 4S3KA 1M5WA 3K4DA 4RPPA 2PDHA 1ZALA 3IRDA 3SN1A 1HIZA 1ZJAA 3TNBA 1A3WA 4JIRA 1BXNA 1GOXA 3ZT7A 2QGHA 3DFHA 4BI5A 2R24A 4XZLX 5H1WA 3ATYA 1KXQA 1V7YA 3D6NA 5FKYA 1IEXA 1I8JA 3LUTA 4IUGA 3TJIA 1XCFA 4CQCA 3R58A 4WY0A 1A0CA 4X9SA 5AC4A 1HT6A 1WXJA 3GNXA 5EPDA 1E51A 3RM8A 3KL3A 4A8IA 3MYOA 1D7KA 3A3WA 4MADA 3OIHA 6REQB 3OA5A 3N4FA 1RK6A 1NSJA 4NILA 3VILA 4PEEA 5FJUA 3E3HA 4A35A 3O0KA 3UG5A 3S1XA 1LUCB 1R3VA 3VIOA 2QCGA 4Q6XA 3UZZA 3THAA 3MC5A 1XFCA 2BVWA 3HG2A 1NM9A 3KVKA 5HA7A 2V68A 4J3VA 2DIKA 3V16A 3TN4A 4CKQA 3SM0A 1H60A 3UGRA 4F4RA 1OZMA 2FVMA 4X9YA 2OSWA 1P0NA 2XWEA 1CW2A 2XJ7A 2YXOA 3OVPA 1QWKA 3WDIA 4BEQA 2NW0A 1OADA 1EBHA 4H9YA 1RJRA 4H6KA 5G2HA 3P80A 3GW3A 2G95A 1S5MA 1DWGM 4O1CA 4L4OA 1GW1A 3N11A 5C9UA 4E2DA 4FXSA 2C15A 4NI8A 4JFUA 1FWGC 1G69A 4U2ZA 5FEWA 1DE6A 4FEZA 3A4AA 1ISZA 1FHLA 3ZJKA 5A8QA 4Z2IA 3HB9A 4PC8A 3QHOA 3M7SA 3MJMA 3ZWSA 2E25A 2QCLA 3NO1A 5A8MA 4JAWA 4LC8A 2W62A 1FA2A 1ME7A 1K77A 1A5NC 1ZY9A 2VUYA 3A6OA 3NEVA 3GXIA 1Y7VA 4C5ZA 4ORIA 4OU1A 2V5DA 3M0HA 1TPH1 2BHYA 1Q7ZA 4HZ6A 1WDRA 4MY8A 4QLJA 1OYAA 4YS1A 1QBBA 4J2MA 3VNMA 3BZJA 2C1IA 4Y9OA 4IICA 2E4TA 3WCZA 3WQWA 4GVGA 2W4XA 1W3HA 2Z27A 5C0QA 2AL1A 1Q7QA 5IBXC 3OHIA 3ISIX 1VFLA 1UR0A 3IANA 4I5XA 4NJKA 1VCVA 1UYQA 4YNGA 1W1PA 1JF5A 4IQJA 1AH0A 4CU6A 1RSCA 1HKKA 1L6WA 1GGOA 2JGQA 4FOKA 3ZR4A 2WJZA 4FXRA 4AZGA 4TVCA 4S3BA 3PWIA 4PUUA 3CMGA 1YNQA 1KTCA 4GPNA 4UTFA 2QUUA 2ASHA 3V5OA 1M04A 3WYZA 3ARWA 1UWSA 5TAOA 1S1PA 3CT2A 1ZL1A 2WXDM 1VD6A 1MVYA 4JIEA 3UYCA 4GBUA 3CZEA 3UCDA 3TYBA 4IP5A 2P1FA 2QDHA 4XO7A 5JH1A 3BSMA 4ZEPA 4QISA 3ABZA 3E49A 3IV8A 3W7HA 1JZ2A 4RKAA 3O6CA 1OBAA 5GVJA 3ZO9A 5BOOA 4AAJA 3GC2A 2QR6A 3BK0A 5T8GA 2CZEA 4IFOA 4HA1A 4LH8A 5AHIA 1XDJA 2BZNA 3WEMA 2O4QA 2CC0A 4QX4A 3RMJA 5CC6A 3CS2A 4GO8A 2NQLA 3G1YA 4B5TA 2PTZA 4GJJA 5EL1A 5A2BA 3TYEA 3N4AA 5LNUA 4MOZA 2WHJA 1H4PA 3AMLA 5REQA 2QV5A 4ECLA 3SR7A 1R3YA 3HQPA 2F8QA 4V28A 1BXCA 4KCUA 4IMEA 3MP4A 2HEJA 3TWAA 2WC7A 3OLIA 2PODA 1CGWA 3KTXA 1RBOB 1XPYA 4MYXA 3W6LA 3AJXA 1FFRA 3AXHA 4X2RA 5MKGB 3WLRA 1W1B1 4K1WA 4ATWA 1VS1A 4CLMA 4W8LA 4NNAA 5B7ZA 4IPIA 1Y5XA 1XR2A 4UTMA 3EPNA 3GC4A 3GNDA 5HR6A 2WMKA 4MLJA 2CLFA 3VDHA 3WKZA 5AHNA 2VL4A 3CPUA 4IGHA 5F2LA 4QCEA 4Q4PA 5CPTA 4US5D 2DV0A 1W5MA 4W8AA 2EPOA 2YA1A 2FFCA 1UH4A 3V0SA 1YTDA 2VZSA 3UZ5A 2HBVA 4WJEA 1XLKA 3STGA 1QMLA 3L5LA 1JFXA 1C9DA 5AYZA 1H49A 1OFRA 3T05A 4MB3A 2QF7A 1RCQA 3PZMA 3FYYA 2PGFA 1NWSA 5CBJA 4NNBA 1C3FA 2OQYA 5EA9A 1LQ0A 2FQIA 3AROA 4WF7A 2D24A 4FX6M 4WGHA 7TAAA 4QE1A 1CYGA 3GSMA 4J28A 2OT1A 1FTXA 5EMJA 1VBUA 3XIMA 1UA3A 3GVRA 4DYKA 2ZUMA 3KRUA 1H7XA 2A79A 4JBRA 1FDZA 1JCMP 2IKIA 4N2YA 3E0IA 1W54A 3TN6A 1GKRA 1O5RA 3S2MA 5RUBA 1DWHM 4LQ1A 5GQBA 2PCQA 4TVDA 2KZHA 4FR6A 4X2PA 1RY0A 2HRWA 1AW1A 4A2RA 5BXRA 1AH4A 2OZ8A 3LCLA 2PMQA 1S2AA 3RJYA 2PUZA 3QPZA 1VEPA 3B03A 3TYAA 1LBMA 1QUMA 2QCDB 4GZ7A 4V33A 4YL2A 5FJOA 4MNMA 4DO7A 4OUEA 5D2TA 5ECUA 1Y5WA 5LXEA 1ZGDA 1IT8A 4Q22A 1V6VA 4RDVA 1KXVA 4IJRA 2OKTA 2VGFA 3OGRA 2F61A 5DY2A 1ZBWA 2B7NA 2PU0A 3W00A 3NSXA 1GZGA 4ZFMA 3P2VA 2OO6A 4AZCA 3IJQA 3H4XA 2PWGA 4D8ZA 1ZB5A 3W7QA 2XH2A 2XUCA 2TSYA 1K3UA 4XG1A 5CZKA 4HMNA 2VC6A 4JKMA 3PBGA 4UQBA 2AKZA 5FEZA 1E15A 2OGJA 1QPRA 1J6PA 3H2EA 3FCPA 1QVBA 5K2ZA 3BCJA 4S3EA 2D1ZA 4DXVA 3S46A 1AFSA 4HYWA 4RJEA 4RUBA 5CSRA 1GYNA 3RK8A 1HTIA 3FYOA 3NZ1A 2FHFA 1C7SA 3IIPA 4INFA 3S6OA 2BDQA 1QPKA 1BSIA 3WG6A 3NURA 3OGVA 2OYMA 2FGBA 4Z2KA 1GUVA 4CGTA 4GHRA 2I57A 1OX5A 4N42A 3PPGA 4I6VA 3ECQA 5FEPA 5HJXA 3IACA 3A4JA 3R94A 4HPGA 1U22A 3TKFA 1O6IA 2H3DA 2EGZA 1QW9A 4KEZA 1VF8A 2WCGA 1PZ1A 3BJFA 3WF2A 1ONXA 3STPA 5FA5A 1PIIA 3AHZA 4IX2A 3OYZA 3ZT5A 2Y5JA 3M6YA 4G6CA 4GYKA 1TUFA 3TJ4A 3UNTA 4HNVA 1TJPA 5D2WA 4U3AA 1LYXA 3SO7A 3B9DA 4ZE4A 1ONWA 4R9OA 2YA2A 1TWDA 2WVTA 1LLWA 2UY2A 4PUKA 1KM6A 5F7UA 3W1LA 2MUCA 3LM7A 3RXZA 1X6NA 1Z41A 2IKGA 2CWXA 5U4NA 4QJ4B 3UJEA 1NOUA 3E12A 2FTPA 2ZXBA 3H2FA 3TC3A 2BXVA 1IXPA 1A0EA 2J7DA 2YFOA 2WMIB 4FXFA 2VZTA 4GACA 1KCLA 3H53A 4MJZA 1E0WA 3DGBA 4RE3A 3FS2A 3COTA 4MTVA 2D2HA 1YNYA 2PFHA 2QJIA 2EBNA 4UTTA 2CPUA 1ZUAX 2G4JA 4AWEA 1EIBA 4O10A 4FLSA 5G4HC 4MB1A 3KCLA 5JBFA 2V5KA 3UERA 3O15A 4O1FA 2QCFA 3W02A 4O0ZA 4K1GA 3CJPA 1Q6CA 3LGGA 4XISA 3TWBA 3IJ8A 5BNKA 3C8FA 3W1AA 4DI8A 2PTXA 1ONRA 1WKYA 4GQRA 5G1TA 4UWMA 2R1KA 3DIPA 1ENUA 2Q71A 4BS0A 4H1ZA 4WIWA 2BGNE 3I7QA 3QV6A 2V81A 2VEIA 1KRMA 4FLOA 4QJ3B 4ZB5A 2W5FA 4PTNA 4N02A 3GD6A 1S3HA 4FNRA 4C6LA 3ERPA 3W1MA 3G3MA 5CCZA 1GVYA 5AY7A 1T5AA 3N2XA 2ISDA 3GXNA 1UWIA 3VIJA 3Q4DA 2ZC1A 1BTMA 3BXWA 3M0VA 2OWWA 4FMVA 1QNOA 4H2HA 4QQUA 2QCEA 1P0EA 3FSUA 3KP1A 3KVJA 3AIVA 3MCNA 3H8AA 2GDQA 4BEUA 1NU5A 3BLPX 4RE2A 1FY6A 3LPGA 4PFHA 1SW7A 4RW3A 1S2VA 3KBVA 4W86A 4AY8A 4U10A 5E0KA 4DPQA 2JALA 2X2YA 3Q58A 1OF6A 2B7QA 4NIRA 4AF0B 3PJXA 1DQXA 2YCIX 1X97A 1MZRA 1VZWA 2J7CA 2EAWA 4JQ4A 1OYCA 3VVGA 5JH2A 3W2MA 1XKJA 3LNMA 4DHGA 1HKWA 1E0TA 1TZZA 3LCGA 1QNRA 1DL3A 2OQLA 3LCXA 4CEXC 4OTKA 4G7EB 4TTGA 4BHYA 1W8GA 1GK8A 1TJ1A 1EKOA 2DZTA 1NOWA 3PSWA 4QFUA 3TAOA 4UOZA 3KHJA 3O2LA 2W27A 2CKSA 3MSDA 1YLVA 3SCTA 3RPTA 3W1XA 4NZCA 1CGYA 4U28A 4E2OA 4HB7A 2C6QA 1OFBA 4GFIA 4W8BA 1E43A 5DT5A 3R10A 1TCDA 3RU6A 4RNFA 3ZR6A 1GPFA 2VRKA 2G96A 3EDKA 1TTIA 2FZ9A 4P8UA 1WKEA 1RCXB 1RLDA 2A85A 1WDWA 3DN5A 2YLLA 1ECQA 2XVPA 3NA8A 5C5YA 2XVNA 4PH6A 2O92A 4O14A 1W3NA 2GJXA 2I14A 3LNPA 1ZJHA 3VMNA 2YX0A 4UFJA 1UR4A 1W2VA 3AAMA 3WQ5A 2B31A 1WKDA 2D3NA 1XYLA 3N12A 5E70A 4RDZA 3Q65A 2PWDA 5AC6A 1HW6A 2E67A 3P6LA 3EX4A 2EO7A 4FLQA 1B90A 2WSYA 1OIFA 4TO8A 3CU2A 1KW1A 2GK1A 3M7WA 2GUYA 3HJEA 4D1IA 1H5YA 5CG0A 4L4MA 4DJFC 4A3HA 4FNSA 2TMDA 3P3BA 4UZUA 2DW6A 4K6AA 5ABFB 5AOUA 4PFMA 1GT8A 3HPZA 2WSRA 2XU2A 1VJSA 4JY8A 1I75A 3DENA 1F74A 3UZXA 4WGXA 3GY1A 1WAWA 5HDRA 1PDZA 1G9HA 4YPJA 4DBUA 5FESA 2D0FA 2ZRWA 5FF0A 1JI2A 2PF8A 1KA9F 4PB5A 1XLJA 1WV2A 3UCQA 1H41A 1IGWA 3QPYA 3EEGA 4EF9A 3R8GA 4TX9A 5AYYA 4OUIA 3QMRA 2QMJA 1GYLA 4F0KA 3T0DA 4Q8MA 1E9IA 5LA2A 4PL1A 4S38A 1UMYA 3F1QA 3T42A 1P43A 4HYRA 4FPSA 1UUQA 3LBOA 8XIMA 2A3CA 1Q85A 4GNJA 1KTBA 3EPOA 4G1KA 3NM3A 1HXJA 3Q94A 4EPEC 1JPDX 1EX1A 3ORWA 2DUAA 4A3YA 1UJPA 1R38A 3OVQA 3DAQA 3NGFA 3REQA 3BL3A 2BY0A 2OJPA 4XK2A 3BOXA 2ZZ1A 2ODOA 2ZFAA 4AIUA 1E9LA 3VNZA 2J79A 3QHNA 3NWRA 1EJXC 2ZZ4A 1YW1A 1V5XA 1KFBA 2NV2A 1US0A 2V5CA 4O13A 1I0BA 3HO8A 1FQ0A 4RR4A 3URAA 3NGJA 3SCQA 4HPNA 1KGWA 1NFGA 1JDDA 1EGZA 3MDUA 3O0FA 5AHFA 3F4DA 4UCFA 3M64A 3VTRA 3M43A 1LLZA 5CXPA 1V0MA 5EMMA 1BKHA 3GFZA 2IPJA 5M1TA 3EBVA 4LF2A 4TOQA 4LS0A 1X6UA 4L4LA 4N0RA 4DJEC 1PKNA 3OZOA 2J7BA 4P5UA 3K46A 3ZSTA 1GJUA 5EYWA 4IIBA 3UD6A 1VPYA 1CLXA 3A24A 1J0JA 4HPJA 1TWIA 2OSYA 1GKQA 1GQIA 3VIPA 3S42A 2OYKA 2FFIA 1H7WA 2YL5A 4E4FA 3W23A 3V36A 4B91A 1XSKA 4AVFA 1XLGA 4IWWA 3GNOA 2DZVA 3HZ3A 1J5SA 2UY5A 1JUKA 1PX3A 3SEPA 4EF8A 1JCLA 3MUCA 4R88A 3DHUA 3MI3A 3NQCA 3UJSA 3VNLA 1WZKA 2FVKA 1E1FA 4BY3A 3STCA 2Y61A 4AQLA 4JR5A 3AIEA 4AWSA 4H7ZA 5CGMA 3IS4A 3U2CA 2QJJA 1AH3A 2EPLX 2A7PA 4IX0A 5HAOA 1O5KA 2QVNA 1DWFM 1K9EA 4P7NA 2CHNA 1OB0A 4K2SA 4F9DA 2NQZA 5CC7A 3MZ2A 3H70A 3DHFA 3CWNA 4XX6A 4D8LA 5ENLA 2D23A 4JTAA 4QNWA 1XKYA 4MKNA 3N17A 1G01A 3C8NA 3U57A 3T2OA 5JMUA 1XIGA 5HNUA 1ZSXA 3LEPA 4HT3A 1PWLA 4S2CA 5JXQA 4CUCA 2Z7GA 5AHEA 4E0CA 4F66A 2YA0A 3N2CA 4UQCA 4DJDC 4LX4A 2Y7FA 4NZ5A 3A22A 2C14A 1CDGA 2Z2UA 2HMCA 1JPHA 4LUSB 1M7XA 3DU0A 1X1ZA 3EKLA 4BI6A 1FWFC 3TXZA 3NVTA 2J78A 1TQXA 1XDLA 1OHLA 1OC5A 3NQVA 4PRTA 1XLDA 3CQJA 4JTEA 3TQKA 4YWIA 2F2HA 3F2CA 1MZHA 3WJXA 1FP8A 2XFWA 2C71A 2ATSA 3URBA 3RMEA 5KTLA 2G50A 6ENLA 3O1NA 4XBJA 1VP5A 3PPFA 1YE6A 1QHOA 5KITA 7A3HA 1ZBKA 2QV4A 3UR5A 1BEUA 4IFRA 4LVBA 4L64A 1OYBA 2Z1BA 3ZVHB 3H23A 4WEVX 3RCYA 5IBXA 1PCKA 3CUJA 2PSNA 1W9BM 1EC9A 1XFBA 3R6IA 2ZC8A 4ZGYA 3W83A 3WLSA 1MXGA 2XINA 1EF2A 4M6UA 1P7TA 3WJZA 2EPKX 2TRSA 4QBXA 3BG3A 4HP5A 2O7QA 4FK9A 2W63A 3GU1A 5EB8A 2X0HA 3E6EA 1CGTA 3CGTA 4ERAA 4LANA 3IUIA 1TMLA 4KW2A 2D20A 1RQEA 3PNUA 1DJZA 1U30A 2YB1A 1XX1A 3MB9A 1AL8A 3GXTA 3L66A 5CBIA 2TPSA 2XN0A 2PBOA 1XLAA 2H9AA 3TYUA 2VVNA 3FDKA 3WLQA 1OINA 4E3TA 2VZVA 4MKSA 2ZOXA 3D3AA 1KTNA 3M46A 3W76A 1EP1A 1OD0A 2ZRXA 4GE8A 4B16A 3VC5A 1WXZA 3C56A 3BGAA 3CHDA 5HQLA 4IIDA 1Q63A 1FVPA 4NU7A 2R82A 3SY8A 1XQLA 3UR7A 1YYAA 4RLIA 1TZ9A 4QIUA 1H63A 1BYDA 3LLDA 4WKHA 3W24A 2V63A 4DWSA 1JCTA 1VGAA 2JE8A 2UZ9A 2J25A 5HJYA 1S5WA 3PUGA 1I6NA 1ZLPA 5EFDA 1K7FA 3MU7A 1R8LA 5CLWA 1KXTA 4DUXA 5A6AA 4JICA 3U0HA 4AD4A 4HU0A 5DT7A 4Y9NA 1S5TA 1RP8A 4HZMA 3OZMA 4LUTB 5GJNA 2Y62A 1K1DA 2X1SA 3VGEA 3MP3A 1I9CB 1KB3A 3AUJA 3VNJA 3SQLA 4ZZ9A 3SGUA 1XLFA 4A21A 3AICA 3BICA 1J9YA 1TELA 2PDBA 4GI9A 3EKGA 3MPGA 5DXXA 7ODCA 1CXHA 2IXVA 4RNHA 2NT0A 4H8UA 3VZYA 3T4CA 1ICQA 4PULA 2GGHA 4KQNA 1KGXA 2Y7DA 4C6NA 3VM7A 3PB0A 3Q2DA 1X98A 1OQFA 5H8UA 1SZRA 3G2GA 1ZQ5A 5LIUX 1UKOA 1HUVA 1TPC1 2DSWA 2YOCA 5A1AA 2PDUA 3NG3A 3RR4A 3KHDA 4DAFA 3NQ8A 2IPGA 1JXKA 1TTQA 1M1BA 1FRBA 2MANA 1KBBA 1Q6EA 1UQZA 2NXIA 3S47A 4XZWA 1Q65A 1TV5A 3HV8A 1B4EA 4UTIA 4P7QA 2YJQA 4I7UA 5AYBA 3CHEA 2Y63A 2UV8G 4XAGA 3DKJA 3W27A 3MUAA 4HK5A 2FJUB 3NSMA 3RO6A 3W1RA 4AHQA 4UB9A 4OVXA 3P60A 2GLKA 2D2OA 1GWJA 5LA0A 4UNKA 3S1GA 2KX9A 4UQDA 2NVCA 3CV7A 3P82A 2RDXA 1ZNNA 3R1ZA 1N2VA 4C6DA 4LPCA 4JIQA 3RN6A 3MWCA 1A3HA 3TONA 1BKSA 3WLIA 4L1WA 3BAYA 1L8NA 4HA0A 2DQXA 1SJDA 4E2BA 3ABXA 1HG3A 1A3XA 2PZNA 3JRKA 1W1A1 3WLMA 5DEZA 2VMFA 2ZKMX 4W7WA 1JPKA 1OIMA 3EOOA 2FZBA 2P8BA 3L2IA 3WDQA 3C3NA 4H9VA 2Z4GA 4LEQA 2ISFA 1WBJA 1P4CA 5A5WA 3T07A 4DZIA 3NDZA 1EZ2A 3TC6A 3IIVA 1O4UA 2NV9A 3ITVA 1X96A 2J66A 1EZWA 5G2WA 3TR9A 1LORA 1TIMA 3ZR5A 4EXQA 1J2BA 4WY0F 3A9BA 4I9JA 3W01A 1CNVA 1J79A 1QO2A 4Q8NA 2PD9A 3AMKA 8TIMA 1YTEA 4L56A 3W7IA 1XPGA 4L7ZA 2ZUUA 3K8LA 1A47A 4HMEA 2BY1A 3FVDA 2X1TA 2ISSA 4FLRA 5CG7A 2DT3A 4QCFA 5LYRA 1EQPA 4CVWA 3TA9A 4KGJA 3WL1A 4IMCA 4W4QA 1F73A 1W3KA 1TJRA 2CLLA 2FMOA 3N9SA 3IPWA 3CXOA 1G6CA 2VM8A 3SCWA 3AIUA 3LTYA 4ML9A 3OZPA 3M47A 1EDQA 4H4IA 4YTUA 4TXEA 4O0KA 5E6YA 3QOMA 1FHDA 1K4GA 2D73A 1N8WA 4LY8A 4JQ2A 1ZP4A 4NXSA 1OF8A 3PTQA 1OCQA 1CIUA 2CXEA 4QITA 3JS3A 3N2TA 1C92A 4GK8A 5C54A 2G8ZA 1VFHA 3DCPA 4N7QA 1QTWA 5JU6A 1GW9A 2PEVA 4MWAC 4NI3A 4LTSA 1NARA 3I6EA 5CJMA 8CGTA 3GVWA 3C2YA 1LTDA 4QXIA 1T7LA 4CQAA 1JZ4A 2ZWZA 1W5NA 2YIHA 3WLNA 3N6QA 2R8WA 5EKYA 2NX1A 1MQPA 5AFDA 2ISVA 1R2SA 3AHVA 1V3KA 1BYCA 3FAXA 2V5JA 1BG4A 4W88A 2ZX9A 1SGJA 1OT2A 3MSRA 5CPQA 3H2MA 1N55A 3BCFA 3T08A 3VE7A 1VRDA 3W3OA 5C9RA 3FN9A 3WF1A 4HOWA 3QY8A 1PKMA 5HULA 3S3GA 4H8NA 3DYOA 2QUTA 3DBNA 1GVEA 1EHNA 3URQA 1GHSA 2XIOA 2DORA 4UTLA 4Q8VA 1PE1A 3V1PA 3V75A 3LU2A 4EK7A 5T91A 2CZFA 3TYCA 5AHLA 1TV4A 4YTSA 1EYWA 4KMQA 1E1EA 4S1FA 3QR0A 2WC4A 4U2YA 1M7JA 1XIFA 3L4XA 3KFTA 4E5TA 3LS9A 3KRBA 3V1HA 3AXXA 3H22A 4R7JA 4IISA 3B0UX 3LG3A 1ELSA 3GDLA 1WAUA 4ACZA 3T78A 3ANYA 3MBFA 4G7FA 3MUIA 4NAFA 1KCXA 3WK3A 1Z3NA 3RRXA 3WMLA 1XGZA 1JGMA 4YYCA 3FIGA 5FL1A 5CSUA 2DZWA 3RIKA 2BNJA 2FPVA 4GMEA 2FIQA 3PY2A 3FKKA 1AD1A 1ZENA 1JR1A 1H09A 4GZEA 3IJ9A 3GVVA 4Z1YA 2GGJA 4OE7A 5CQ1A 4Y6GA 3QOKA 3WLKX 3M5YA 2WNQA 3V4BA 2WMFA 3Q37A 1FFQA 3MZNA 4MJ2A 2GVGA 3BVJA 1F2JA 4HMDA 1E4IA 2J9ZA 3TNOA 1JAKA 5CAKA 1K9DA 1W9UA 2OCZA 1XG4A 4ZMGA 1YXCA 4ADTA 1EPVA 2Y4SA 1UR1A 2HBXA 1US2A 4L5ZA 2GQ8A 3SECA 1UD3A 2WKJA 3QPEA 1S2WA 1KV5A 4DUVA 4WDUA 2VR5A 2ZYFA 2PTWA 3LX9A 2GWGA 1TVPA 3T0TA 5CSYA 5PTDA 2YGYA 5FF7A 4H00A 2JF6A 3NQ7A 2IMRA 2X16A 3R43A 2FPYA 4Z0SA 1E5JA 3VIGA 1EJRC 1F5ZA 3EDJA 3QLDA 4HCHA 4O1DA 1B3WA 1ISYA 3SQSA 2P0OA 1ZPTA 1UR3M 3HG5A 1G5AA 3A47A 1R2TA 3APYA 1CLKA 1EEPA 1PCWA 4EXBA 1SMDA 4BQ4A 1J6OA 3I10A 3QM3A 5CPSA 2ZDRA 2D22A 3QSTA 2VC7A 3U2ZA 1RZMA 2I1OA 4ZOEA 3HMJG 2R1PA 4GVIA 2ABAA 4GNVA 4Z1CA 4HD5A 1OCBA 4GUIA 3LRMA 2PE4A 2WZMA 1XV8A 3E5BA 2HVNA 4J4KA 2EQDA 5FL0A 1S2UA 3NPVA 4GD0A 3FGCB 5D02A 1W1VA 1M01A 4HIBA 3UR8A 1EHAA 5K9CA 2OZ0A 3NPXA 3OQEA 1I60A 2FJKA 1RY8A 1JDCA 3CUFA 3W2KA 4BJHA 5CC5A 3GAKA 3WH7A 1B3VA 3VIMA 3ZWTA 3W81A 1TTJA 4E8GA 1KNWA 2BOGX 1P6CA 3UWUA 1J0YA 4MJMA 3KEHA 1CTNA 3B8DA 2V6AA 1EJ7L 1OT1A 3OODA 1NOFA 2RDUA 3DFQA 4AY1A 2RJGA 3UVAA 3KOXA 3PWAA 1E9ZB 4QGCA 4M81A 1WOBA 2VD8A 4GVFA 4ATDA 4QG8A 4ICNA 3VX0A 2ALDA 4DYEA 3TTSA 3TUUA 2VELA 4DJFA 2JEPA 3THDA 5CJ5A 4W5UA 3DG7A 3FJLA 1SFJA 4REQB 3WQGA 2BS9A 3CIXA 2AKMA 3VPLA 2ZICA 4P8VA 3EA3A 2YL9A 3ES7A 3QSRA 4BF7A 3F03K 1V77A 1C8XA 1PIFA 3LHVA 4ZSTA 1ITCA 3PTDA 3QKEA 2CZDA 3C5QA 1U83A 3R7MA 2ZZ5A 1KKRA 3EWBX 1F6YA 2VXNA 1RA0A 3HBLA 3A4XA 1UASA 4QSHA 1RBLA 4PMQA 1P5BA 5FJRA 4B9ZA 3FJNA 4HMCA 2V67A 4M24A 2BGSA 2R9RA 1W5QA 1E6SM 1FOBA 4GUJA 1H0GA 3OIXA 2WMJA 5F4XA 2EXOA 3S9IA 3OBEA 3FEMA 1O12A 1E1CB 4Z2LA 4JTGA 5FIPA 3QVQA 3T8QA 5IXEA 1VFUA 1ECEA 3KWSA 1WKFA 1HN1A 2QMKA 4N4PA 5C7VA 4H2CA 4L9ZA 4JTLA 3QN3A 3LRLA 1ZCOA 3WLPA 1IQ8A 3I3EA 3WSUA 1KCKA 2J24A 3GDMA 1E0UA 1V3JA 2OMAA 1E4MM 1UR9A 3MVIA 3L4VA 3OVGA 1XW8A 4IIFA 2PU1A 1XGDA 2VGBA 3KOZA 1NAL1 2OSXA 3P8IA 4K39A 3BAIA 2OZTA 4KKXA 4PCPA 1HNYA 3AUOA 2A3AA 3BJTA 4DBDA 4HNLA 1XUZA 2YW3A 2ACRA 1GPWA 1XP3A 4XUYA 3H26A 3OBKA 2J75A 1BGAA 1JEZA 4LV4A 2VEFA 2QJHA 1Q5MA 1V02E 3A12A 4JTCA 2ZXDA 1U5HA 3QRHA 3BDKA 2YSWA 1W1IE 1AJ0A 3TA6A 2FH8A 2NV1A 1NWTA 3V35A 2QHAA 4Q7IA 4DJEA 1UD4A 2V69A 2B7PA 4IZGA 2PWVA 3I7RA 2VX7A 1AJZA 5H8MA 4Z2HA 3FFSA 5HNRA 1V08A 1WX0A 1B2YA 2NQ9A 2NT1A 3VGHA 3ZOAA 2WQDA 1XXXA 1LM1A 1BVZA 1E0XA 3PZ9A 1UKSA 5I78A 1RV8A 4DXKA 1HFBA 2FZMA 1KM4A 1EC7A 1CGUA 5CH9A 2NZLA 5HPOA 1K6WA 1I2NA 3E74A 2NVAA 3BLFA 2RFGA 1BF2A 4JD4A 4LWWA 3SDOA 3DFPA 1NWRA 2VCAA 2YR1A 5D03A 1XC4A 3E0VA 1AQ0A 4LYPA 3BLLA 2G4FA 4Z1BA 4LUYA 1KGUA 1A80A 5I02A 1LBFA 3WNLA 5FJPA 3R89A 1J10A 4KEUA 4XD5A 1O7AA 2YDSA 4J27A 4I5RA 3VABA 3UG3A 3P81A 4HTBA 2J77A 3DESA 4CVUA 1GVOA 1PUDA 4DELA 4J3WA 1E0VA 3UA4A 1IT7A 3ARTA 3IJIA 2PP0A 3EWCA 4JTHA 4XV0A 3M0XA 1SPQA 3PUOA 5FOOA 2CKRA 2V3EA 4Y96A 1C8VA 4FNUA 2Z28A 2VWTA 3LHZA 5IFPA 4KWUA 2Z29A 2HVMA 5AN7A 2FLIA 4CN6A 2XGIA 2GVLA 3H7RA 4DBEA 4QLLA 1VBGA 5I3IA 1SZEA 1AW5A 1OFDA 1OGBA 1XQKA 2ISWA 4H83A 4GGHA 4XVEA 3ABSA 3II1A 3IAPA 3ELFA 4A4AA 4P7OA 3HV9A 3G5EA 2W66A 5DBUA 4GGBA 4AU0A 5H8PA 2WAGA 3M0YA 4C6OA 2Y0FA 3QY7A 3L12A 4GI8A 3U48A 5L9FA 4IL2A 5E5CA 1KC7A 3WUEA 1IR1A 4HSNA 2OLHA 2DU2A 2J62A 3VKAA 2HVOA 4HPHA 4S3GA 4JY9A 3WENA 4UTJA 4HOZA 5ABEA 3EX6A 2J47A 1Z9AA 3F4CA 1UIPA 4G9PA 4K37A 3E2SA 1BD0A 3CL8A 4IMDA 4EIVA 3BAXA 5IOBA 2QCNA 1JFHA 1C93A 3SZ8A 3K5XA 3M44A 1FWCC 4XVDA 4X63A 5FAJA 3S5YA 4D9PA 1J93A 2P53A 1FH8A 3PWGA 4BQ3A 3NTYA 2OOGA 4M80A 3WN6A 3NQ2A 2WYSA 4GY7A 2NQJA 4HNTA 2D2GA 1PX8A 1SZFA 5SWUA 3LD5A 4HNCA 2ANUA 1FWNA 3LI0A 4WXZA 1FWEC 2NUXA 2IKHA 3WF4A 2YBUA 2J7EA 3QTPA 4K8GA 3SIMA 2L5HA 3PSVA 3SJNA 4K7YA 3C0SA 1FWAC 1TKKA 3UFYA 3WDPP 2OO0A 3B9AA 3AS2A 2DJLA 3OGSA 2CLEA 3VC6A 1IZJA 2NSXA 3NVDA 1RJQA 1FCUA 1UBPC 4CNOA 1P1MA 2VKZG 2UY4A 1DJHA 4IFKA 3TFCA 5A8GA 4WZHA 1IZKA 4UMCA 1AMYA 2I16A 4WR3A 5LHEA 3C6CA 3GBEA 1HKIA 2BVDA 3HOJA 1KFCA 3UP8A 4WCJA 5CZJA 3ES8A 4XO6A 1FCQA 9XIAA 2WZEA 1BRLA 1XLHA 1XLCA 5LA1A 5L6UA 1BYBA 3T09A 3QC0A 4NAEB 3L68A 4JN8A 2DZAA 4QDPA 3LQLA 2IUZA 3N6JA 4GOAA 3QV9A 1EJTC 3WO8A 1J12A 1PX4A 3UYIA 3TU9A 3W37A 4BR1A 4O1BA 1HJVA 5M5DA 3NPUA 3DHDA 3S1VA 4QROA 2WVVA 5BCAA 4PMXA 3IVSA 3VCNA 2A7NA 1E4NA 3CLWA 4R85A 1E72M 3W26A 1MW1A 4AB4A 4DLMA 2OG9A 3C2RA 1E6XM 1W3IA 4DWSD 3ZMRA 5EU9A 4MDPA 3SW6A 5BU6A 3WQPA 3T0AA 2YCLB 1GVQA 1E6NA 3NZPA 3HGSA 3SCRA 1HO4A 5IHRA 3FHAA 4ERGA 2GVEA 3ENLA 3HU7A 1E6RA 4PZVA 4V27A 4H04A 1EGVA 5BWFA 1BWLA 3SN0A 5T9BG 3UWEA 3B4UA 3BLDA 3NCOA 2VX4A 4XBSA 1QR7A 2Y24A 3W1UA 3SGGA 3QYSA 2WNZA 3LPPA 4CD4A 1GQNA 3VOJA 5HOSA 1XYFA 4KCVA 3I4EA 4MY9A 1VHCA 2QQ6A 2DW7A 3DECA 4QTGA 2X1UA 2GSJA 1EUAA 5CPOA 4DI9A 2GSEA 2DT1A 4HTYA 3TOPA 5I23A 2WMGA 2CITA 1H0IA 3NSNA 3MANA 1CGVA 4NJJA 3FVMA 3TZFA 4UBPC 4HK6A 3P67A 3FXGA 1JDEA 2WC3A 5FD0A 1XIMA 4AHPA 3V5CA 4NZ4A 3GR4A 2XIJA 2Q01A 5A2CA 3P14A 1R30A 4MM1A 1FWIC 1MUWA 3D3FA 4RDYA 3OO2A 2O9PA 2P8CA 7XIMA 1EWDA 3N25A 2G37A 1GQJA 4HA3A 4FNPA 2EPHA 1TO3A 5FF4A 1NDYA 3H2NA 4C6FA 4RPQA 4LS2A 1DE5A 4ENLA 1O60A 3G18A 3LXBA 5I3GA 1QOPA 1YDOA 4FX8A 1UC5A 2GDVA 1QI2A 4AYSA 1NEYA 4QLKA 5LIKX 1S3TC 3VFLA 3U3HA 2XGZA 3PZTA 5D2YA 1MFUA 1HJWA 1UD6A 2DGAA 2RAGA 1G67A 1PDYA 4KEMA 4RW5A 4MFDA 4Q4MA 4GIRA 3T4WA 4R3UA 5CKSA 5HQEA 1W32A 2EG7A 4C1LA 1OK4A 4Z2JA 4E4PA 2V3FA 4C7DA 1H7NA 4YVXA 4I8YA 1E3XA 4NX0A 2W61A 1B9ZA 1SJCA 1ISVA 4RNJA 2XVGA 3EXSA 4F0SA 3D5HA 3BAJA 4J3SA 3RX3A 5CEWA 1QW7A 3W7EA 3GM8A 4RE4A 1FH9A 2CLKA 1V79A 3GIYA 1QASA 1K7XA 4AC1X 4LALA 1EC8A 2EJAA 2QDGA 4WDXA 3P62A 1WB0A 1GVRA 1QT1A 2OQHA 4C1KA 1IXNA 5FI8A 1TV8A 2VDGA 3ONBA 1PJ9A 4XZBA 4JHMA 4J35A 1YDVA 4C90A 3N3MA 4QAWA 3KWXA 4GCAA 1R87A 1PKYA 3ARRA 1REQB 3W4RA 1NF7A 1JI1A 1OG0A 4LC6A 4S3DA 3AISA 4GCXA 3K8KA 2RHGA 3QZEA 4XKYA 3OYXA 5HJLA 2IPFA 1VBRA 4MWAA 1YXDA 3RPMA 3N3TA 2BB0A 1TVLA 2E5DA 3DKLA 3BJSA 3IUHA 4HK7A 4FIQA 5HANA 2V82A 2GYIA 3CQHA 2A4AA 3WBWA 4P2VA 3S83A 5AZ0A 3E0FA 1FUYA 1WUEA 3IEBA 4JNMA 4JCMA 4D1JA 1V0KA 1QFEA 3H7UA 1E73M 4ZQRA 3HFTA 1NDVA 3QMSA 4OIFA 3CO4A 3O05A 3ZYZA 3U7BA 1W5PA 1EWEA 1DWIM 1H7OA 2E6FA 3CUGA 3YPIA 2BHZA 1RVKA 2XZ7A 4YMZA 3EWZA 3WQOA 3F5KA 3GYCA 3D0CA 3T0BA 1HQTA 4MG4A 1DXIA 3BGGA 2NUWA 2BSLA 2A6NA 4XKMA 7TIMA 4B3LA 4NJGA 2WPGA 2JFEX 1RD6A 3CIWA 4NY2A 3VA8A 2OOFA 1QI5A 2C7FA 3BLIA 3MMWA 3LOTA 3S2NA 1ODZA 1G0CA 4ZVJA 5I00A 3S5OA 4IUOA 4PGLA 5CZ0A 1L2UA 1TPFA 1BAGA 5DANA 3VZZA 1ISWA 3CZGA 5GJPA 4XZMX 4TX8A 4ZR8A 3PJWA 1XRFA 4O4VA 3UXKA 1FHVA 1G1YA 3V0TA 3CTLA 4LNYA 2QS8A 1XLIA 4ZCWA 2VFDA 1KLYA 3QH2A 2HCVA 4S3JA 1ZHAA 2X2GA 4DXXA 3DUGA 2GZXA 4NHVA 2YL6A 3DZ1A 6TIMA 4EP8C 2X7WA 4X60A 4IP4A 3LBMA 2GVYA 3M0ZA 1DIDA 1R2RA 7REQB 3B40A 4HU3A 3RNDA 3R79A 1PHQA 2A3HA 1NQKA 4GJ1A 5CJNA 4M1RA 5DMNA 1GJWA 4JTUA 3GTFA 1F07A 4MUPA 1DBTA 1OM0A 3RU8X 5IFTA 4I3GA 4WJ8A 3W7DA 2CHOA 3S9ZA 2FGLA 1XLMA 3ZS4A 3N19B 1MNSA 1XLLA 2HK1A 1U1HA 4C60A 2VI0A 1OFOA 6XIAA 1XUUA 3A5FA 3WK2A 1WZAA 4UNIA 1CZ1A 3ITOA 4F48A 4KCWA 2PD5A 1IT0A 4DX3A 1B3ZA 1SFLA 2Y8UA 1EX5A 1FP9A 2VOTA 4I9AA 4H9MA 1SO5A 4NRRA 3NZQA 2BY2A 2VDHA 1TV7A 3TSDA 3P74A 2QW5A 1FDYA 4PTDA 2EKCA 3CWOX 3UVIA 3ARYA 1XC6A 4JEJA 1T40A 1T8XA 4HN8A 1EJWC 1UH2A 1KO0A 4I7VA 4CCCA 4I6KA 2VEKA 1JYNA 2YBTA 4J40A 5HPCA 3N2BA 3UXLA 3P93A 2J8TA 4LRSA 1J2WA 3GFXA 4Q4RA 3BMVA 3IGHX 3WF3A 4UFLA 5IDIA 4MAZA 4UNLA 1L2QA 2OEJA 2FTWA 2WBKA 2W9MA 3PTKA 2Z25A 3HN3A 3VM5A 3P0WA 1T99A 3H2AA 4Z17A 1FXQA 4DZ5A 3RCNA 4EPKA 1FKXA 4JTDA 3CMJA 2PDPA 5LNVA 5DX7A 3H55A 3BQ5A 3GHUA 1UCWA 6REQA 1L0PA 1S2CA 4AMCA 1THFD 5FAGA 1TSIA 1MUMA 1EDGA 4AZ5A 3VD7A 2VVSA 4U5KA 1W3TA 5DF0A 1NJJA 1LUCA 2PGEA 3OOQA 4KESA 2V2DA 1E4LA 2G3FA 2VUNA 3UWWA 4UTUA 3UZWA 3T0CA 4ZOCA 3DI1A 2QZRA 2X8RA 4W7VA 4LV9A 3MI6A 3TYZA 2RUSA 3PS7A 5FSEC 1MDLA 2CHRA 4BA0A 3UPMA 2E8ZA 3WD4A 3C2OA 1OK6A 3TJLA 4UCGA 2QLYA 1Q8AA 5A6BD 3GZ3A 1XLBA 3GK0A 1E6PA 1WCGA 1B31A 4NZFA 4O12A 3ZIZA 4NRSA 4FHAA 3CQIA 3DERA 3B4YA 5LNSA 3HF3A 5C2GA 3DC0A 3W7NA 1W1YA 5I06A 1KM5A 1P48A 3GKAA 3VKDA 3AO0A 3V18A 4DJFD 1DJIA 3RILA 1EO5A 3AZRA 3ZSSA 2ZUNA 2YXXA 2R1MA 1UA7A 4PRWA 5I0DA 3ZJ8A 4A2SA 3MMDA 3EMCA 1MRAA 3ABRA 4AX6A 4S39A 1KV8A 4MNLA 4O19A 4W9TA 3O9NA 4AX7A 4R9XA 3VDCA 3PAOA 4RL3A 4BFAA 3EX2A 4BQ5A 3G6MA 4HU4A 5D38A 1F4HA 4RZ4A 4GYJA 1WDSA 1R3RA 2WVUA 2E9BA 3F5JA 3QZAA 9XIMA 3G0XA 1O5XA 3NL6A 2DVXA 3BARA 3NYDA 4ZOAA 2OVLA 3N13A 1XM3A 1POKA 1NWUA 1K8CA 3P5ZA 3PP7A 4LOCA 1ZFJA 3ITLA 1FWTA 2F6KA 4DPPA 1VEOA 1KCZA 4V1XA 3MVTA 2J9YA 3GVQA 3CV1A 3MO7A 1EL3A 3VU2A 3EZ4A 3WMCA 4B5UA 3B8SA 5A6TC 3CB8A 1UWQA 1JPIA 1Q6DA 1PIGA 4PMZA 2A3BA 3GU2A 5HXMA 3H7VA 1VIZA 2BOEX 1R85A 1H5VA 1L6SA 3GG0A 1D9EA 4Q7NA 6A3HA 1PO9A 1LRQA 1YNPA 2F84A 2VT0A 3ABQA 3W28A 1GEQA 1H3GA 2JKPA 3P8JA 3LQGA 3R0KA 1JZ3A 2G5WA 5D05A 2PPGA 4I9MA 4B15A 3SCPA 4L1GA 3GUWA 4UTKA 5K3VA 4H6RA 1VEMA 2OR2A 3OP2A 4B5WA 1CGXA 2RDTA 4PODA 3R0DA 1A49A 3RX2A 1PEZA 2Q8ZA 2E0PA 3FA4A 4JGDA 1RUSA 4DBSA 2CBUA 4DWSC 2J74A 2X1RA 4DJED 1R3QA 4WOZA 5EFFA 2DIEA 4ROPA 2O56A 3WEZA 5CLTA 2NX3A 1N8FA 2QUVA 3UJFA 2C0HA 1UROA 1V4YA 2AQOA 4LAZA 4IM4A 5FJJA 2DZSA 4QEEA 2Y8VA 3VIFA 3FK4A 4FF7A 3H12A 3M5XA 3CB3A 3WBEA 1OCJA 3EEZA 4ICCX 3DG3A 3LHUA 1Z8AA 1WQ5A 4EXAA 3TH6A 3GH7A 2Q3RA 3SRHA 3WK1A 1GEHA 4S23A 3GR8A 4HYVA 9CGTA 4M82A 4M3PA 4KRTA 3QW4B 5CPMA 4PMYA 3WFZA 4TIMA 5BRQA 2F6UA 5MKGA 4D6HA 2YPIA 4ZL1A 1EB3A 1R9XA 2OELA 3IIOA 3N04A 4CQBA 3MV01 1P1XA 1A5BA 2JF7A 4MAVA 5G4EA 4F79A 4G2DA 3B8VA 2SFPA 1ZAIA 3UETA 3VUSA 2DJXA 3UPBA 5KSWA 2AMXA 2ZXQA 2V38A 1NP0A 4CCDA 2O7SA 5M03A 3KBMA 2QCMA 4WOQA 4L6OA 5D2VA 1Z48A 1PTDA 2YL8A 2AGTA 1ICPA 5A6KA 1S46A 1QWGA 1SFTA 3NQDA 3LSBA 1CT5A 5G1YA 1TMQA 3AYTA 3W7MA 4Q4QA 1RLCL 2NQHA 4C5YA 1QATA 4DJDD 4GRSA 3THCA 3GH5A 1HZYA 1IE7C 1DJGA 1NFBA 3KZPA 1G4TA 4M8UA 5G5IA 2AAAA 2PLMA 3QZ6A 1TPEA 5K4ZA 2ZX5A 1WOAA 4IPJA 4N6FA 5H6HA 3BAKA 1JRCA 4LYKA 1XG3A 2CYGA 1SVDA 5E9AA 5F4WA 1J4EA 1EOKA 1OFQA 4O18A 2JBMA 4C1NB 3PJUA 1TA3B 1R3WA 5DCDA 2HZGA 1J0HA 4I8DA 4QNEA 4GH3A 3VCCA 3O06A 3B9EA 3EWDA 3C2FA 3NUKA 1V51A 5I03A 4JDBA 3EMQA 4OKDA 4PB3A 5A2AA 5HMEA 2ZZ2A 1VR6A 1XSJA 2QCDA 4HA4A 5F4SA 4GIYA 3PB2A 2OLSA 1IEWA 4MPKA 2J4GA 2W3ZA 5J5RA 4PTWA 3IK2A 4UTWA 1ME9A 2VCBA 3BLOA 4IXXA 3LERA 1NQ6A 1VPXA 1R3TA 1YBQB 4WD0A 1Z42A 4NYYA 1PL9A 7PTDA 1B1YA 4KGLA 2CIPA 3PUDA 1A5SA 3MSGA 1W56A 2DQWA 1CECA 4LUJA 4LVDA 5K4XA 2ZZ7A 6PTDA 1M6JA 3LZ5A 3BMXA 1V8EA 4AEOA 1ONEA 1VBHA 2HISA 3SAZA 1I2RA 3ALFA 1C8QA 1EP3A 4AWTA 4JX6A 5F2IA 1BSLA 3KVMA 2VENA 1AZ2A 1A4MA 2QPUA 2WJFA 4N9BA 2GUBA 3EOLA 1OCNA 4ZXOA 1UR2A 5AB3A 1V0NA 1OY0A 1CB2A 3GNNA 3M4HA 2RKXA 4EPDC 3WNOA 1ITUA 3O3RA 1IYXA 3E0WA 2VOMA 3MCMA 5K9XA 2OWXA 4LAKA 4GA8A 4HHLA 2OFJA 3VOGA 2CBJA 3AIRA 1M7PA 2ZRYA 5LIWX 1E3ZA 3AI0A 5FF3A 2OT0A 3NQEA 2CZ5A 3HPXA 1XWYA 2XVLA 3RYSA 1K8ZA 1ZP3A 2BLEA 1TWSA 1UD8A 1AVAA 3HQOA 2WWDA 4XD4A 3P84A 4IGNA 1FWBC 3NZRA 3S5SA 4ZB2A 4CNSA 1W9PA 4UXDA 1TPDA 5KEZA 2ADAA 3PHAA 3QHMA 4JDYA 4RV8A 1MUCA 3OU8A 4GQGA 5CBBA 4GVHA 1ZU8A 5FF2A 1BFNA 3W22A 5BU9A 3QGAC 3CZLA 4AISA 4ML4A 5M2FX 3IGUA 3AYRA 2DEPA 4DIAA 4RX0A 3QY6A 3W1TA 3KBJA 3KM8A 1AL7A 1Q2RA 2VCCA 4L6DA 5BROA 4UZSA 4IGMA 1E55A 1UHVA 4L65A 1HO1A 4MPQA 3N2MA 1LOSA 2NXGA 4YCPA 2WMIA 3CPRA 3AMCA 1SO4A 1GVFA 3GZAA 3QF0A 3RPDA 4RE0A 1B4KA 4E4UA 4O4WA 2VRJA 3DFYA 3FA3A 2PB1A 3KCOA 4IIGA 1XBYA 3WNPA 2PS2A 4JPGA 2G97A 3CAKA 4NJHA 3GVGA 3RGTA 4GKLA 4RZBA 3WLHA 1V0LA 3VCRA 1AW2A 3WNMA 3VINA 1TVNA 2O9TA 2WO5A 4OZOA 3OVRA 4B4HA 3BC9A 5HK4A 4MNKA 2EKGA 1QK0A 1JYXA 1I1WA 4CD7A 4TU1A 4J3XA 1RR2A 4NNCA 3APGA 1JIBA 3SGZA 3AMDA 3A5VA 3S1UA 4DF2A 3EDEA 3LHTA 4GX8A 3FKRA 1EXPA 3AOFA 3MKCA 2GFTA 1P0BA 1UJQA 3E2VA 4NL1A 2I17A 3U6WA 3PC0A 4KWOA 2XG9A 3KAOA 3OB8A 1S5NA 4DQWA 2PA6A 3VMOA 1WO2A 1ODUA 1ITXA 1X8CA 5JBEA 2Z00A 1KKOA 2GPTA 1I2OA 3HTWA 1C8YA 1EF3A 2GOKA 2BY3A 3VKJA 1GOWA 1FWRA 3M16A 2E8YA 4IOTA 2JIEA 4O15A 4Q8UA 4HJWA 1JULA 3L67A 1JD9A 4ERIA 1BG9A 4UR9A 2ZUSA 4C91A 3WLJA 4JQ3A 3G0UA 2XVKA 4LCSA 4MZYA 1DXFA 2IKJA 4AF0A 5CC3A 3VDAA 1H50A 3B97A 5HMSA 1E9YB 3DHPA 4E6MA 4PUJA 4O28A 4KFNA 1R9YA 2X41A 1PVNA 4QDWA 1LT7A 5A6JA 1X39A 3G8RA 2XSBA 3CHCA 1Q6FA 4BKNA 4B9YA 4S3CA 4G7EA 2E1WA 5LGZA 3SUTA 3LCFA 4MKVA 4D8AA 4MYAA 4X61A 5H91A 3VGGA 4KERA 3IJLA 3GNRA 4O50A 3ZLHA 4HHPA 4IPPA 3GHTA 4US6A 3JR2A 2AL2B 3WLLA 1XINA 4R53A 4AUBA 3RLGA 3CC1A 3GX9A 4BZYA 4MWAD 2O9RA 2VDIA 2Z1SA 3B0PA 4DO6A 2YDQA 4UOJA 3VO0A 1V6XA 3PK7A 3I3BA 3TTOA 3MW7A 4UR8A 1GVIA 3AIWA 4BWLC 1QPOA 2AQWA 1GONA 2X1IA 3VOHA 2PLKA 3BQ6A 4ZTXA 2B81A 1I4NA 4JXCA 1TREA 1MXSA 3ARXA 4L4PA 3MKKA 1UPPA 2VJXA 2X30A 3F5LA 2IQ0A 5AC8A 1RCOB 2XZ9A 3G22A 3VD4A 3VD9A 4GXWA 2Q8XA 2WLZA 3CASA 3VNDA 3HM7A 3THUA 1V93A 1F6PA 3GH4A 1LDCA 2ZRVA 4AZ6A 3UQNA 1CBGA 5ABTA 2CU0A 3K8MA 3BUVA 3TZNA 1YDYA 3QW3A 2O9OA 4B5VA 4PB4A 1IEVA 3NOEA 3L4WA 3QQWA 3GE7A 2XFYA 5K9DA 3BANA 3LHWA 4QAIA 2DUXA 2WPBA 3VYLA