3FA3A

Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, trigonal crystal form
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
301
structure length
301
Chain Sequence
PMVTAATSLRRALENPDSFIVAPGVYDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRCGHLAGKILVDTDTYVTRIRAAVQARQRIGSDIVVIARTDSLQTHGYEESVARLRAARDAGADVGFLEGITSREMARQVIQDLAGWPLLLNMVEHGATPSISAAEAKEMGFRIIIFPFAALGPAVAAMREAMEKLKRDGIPGLDKEMTPQMLFRVCGLDESMKVDAQAGGAAFDGGVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3-dimethylmalate lyase
publication title Structure and function of 2,3-dimethylmalate lyase, a PEP mutase/isocitrate lyase superfamily member.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Lyase
total genus 111
structure length 301
sequence length 301
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 4.1.3.32: 2,3-dimethylmalate lyase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3fa3A00
1MUMA 3PP7A 4QG9A 1O5QA 4KCVA 2HWGA 3E0WA 3MA8A 1E0TA 1DQUA 2KX9A 3T05A 3SRFA 4RPPA 3FA3A 2XZ7A 3H6OA 3ME3A 4G1NA 3KTXA 3QV7A 4B5WA 1M1BA 3QV8A 3KHDA 2OLSA 2DIKA 1XG3A 2VGGA 3QTGA 3I4EA 4HYVA 3IS4A 4B5SA 4MF4A 3LG3A 3PUGA 4KCWA 1O66A 4FXFA 4IP7A 4YNGA 3T07A 1E0UA 3QZ6A 1F8IA 2QIWA 1F3XA 2VGBA 2XDFA 1UJQA 1KBLA 4QGCA 4TV5A 1F61A 1F3WA 3R4IA 3EOOA 2VWSA 2E28A 4JPGA 4KCUA 1Z6KA 3LYEA 1VBGA 3N25A 4YJ5A 4B5TA 3E0VA 1S2UA 3M0KA 1IGWA 4KS0A 1F8MA 3SRKA 3HQPA 3QV6A 3SRDA 2X0SA 1PKMA 3OYXA 4L7ZA 3B8IA 3QQWA 2ZE3A 1DIKA 3HQNA 1OY0A 3GG8A 4KCTA 1ZLPA 1VBHA 1PYMA 5TAOA 3QLLA 1S2WA 4QG8A 4QG6A 4B2DD 4MG4A 1KC7A 2XZ9A 1ZJHA 4IQDA 1O68A 4L9YA 4B2DA 3E5BA 2BG5A 1A5UA 1S2TA 1SGJA 1AQFA 4DRSA 1DXEA 3QV9A 2HROA 3P0XA 3U2ZA 2HJPA 3G2GA 2L5HA 3OYZA 1PKNA 1XG4A 4FXJA 1A3WA 3EZ4A 1GGOA 3VAVA 2G50A 3EOLA 1PKYA 1S2VA 1OQFA 4WJ8A 2VWTA 3T0TA 1T5AA 2VGFA 4HYWA 2VGIA 4B5UA 4B5VA 1U5VA 4L80A 4TV6A 2HRWA 4IMAA 1A49A 3M0JA 4ROQA 3FA4A 2DUAA 3OQ8A 4B5XA 1DXFA 4LSBA 3GQYA 3HQOA 3GR4A 1IZCA 3BJFA 4KRZA 2WQDA 3SRHA 3EOEA 4L9ZA 1PKLA 1U5HA 2R82A 4IQEA 1M3UA 2V5KA 1JDEA 3BJTA 5JVLA 1A3XA 2V5JA
chains in the Genus database with same CATH superfamily
4O1FA 5K9CA 3B3DA 3OLDA 4ZQRA 1QWGA 1G4TA 3WJXA 3WEOA 4H9YA 1IXQA 3ME3A 5TQLA 1XIHA 1LRTA 3S1VA 3E0LA 1HKWA 5BU9A 4A8IA 4X22A 3ZR4A 3QZ6A 3R10A 1J0JA 3UESA 4MFEA 4IL2A 1R38A 5AHMA 3W23A 1GJUA 3FXGA 1VFLA 4NZFA 2O9PA 1L2UA 3EKGA 3EWXA 1W3IA 3UG3A 5C7HA 8XIAA 2UBPC 5LHEA 4S1FA 3VABA 2W27A 4EPDC 4EACA 3HO8A 3RLVA 2C7FA 2MNRA 4HK7A 1OG6A 3AS3A 3GH4A 4RLIA 3M0MA 3CHDA 1A5NC 1JJKA 1G01A 2O9OA 4LUTA 1V0NA 2PWUA 2VD8A 2X09A 3CL8A 4N6FA 1PIGA 3RM4A 3C2VA 3QY6A 3SI9A 4DQWA 2PGFA 1J93A 5F2IA 2XG9A 5AKQA 1XYLA 4M19A 3REQA 4U5IA 3E0WA 1TPH1 1SO6A 4ZGYA 3N2MA 2UY5A 4JTHA 5AC4A 3W6YA 5AOUA 5I79A 5FAJA 3QV7A 1V0MA 3VGBA 1H51A 1QAPA 3ARVA 1LZOA 3GVRA 3W2NA 4DUXA 2IKJA 1BGGA 5A6JA 5CZSA 2BVWA 1CWYA 3MVTA 3C6CA 3GFZA 1E6QM 3NL6A 3VD5A 4JPGA 3P60A 2FJKA 2JBMA 1CGXA 3TC6A 2DW7A 3MUAA 2D23A 4X63A 5G4EA 3EYPA 3ARXA 2FH8A 3OGRA 5G1TA 1DIKA 4OKDA 4A29A 3GTFA 5D04C 4JS3A 4DXVA 1EFZA 1FKWA 1SFSA 2QDDA 1HP4A 1XLCA 2X1SA 1XRVA 5U7SA 1V02E 1IR1A 1RBOB 3L23A 3AQUA 3QMRA 3RR4A 2V2HA 2FVMA 3W7JA 2CXGA 2QAFA 1US0A 1VRDA 2NX3A 4MIMA 1MQPA 3QQ1A 1RP9A 1SJBA 4J7RA 2IKHA 2WO5A 4ADSA 5KSWA 2XSBA 2QCDB 3GR4A 3GE7A 2J62A 3POCA 3W22A 3UGVA 2POTA 2ACSA 5CAHA 2ISFA 2ISVA 4IMDA 1Y7VA 3UCDA 4OWGA 4HHHA 3O8AA 3NQVA 1UMLA 2JEQA 3UZJA 3N4AA 1OBAA 3FVDA 1QI3A 4DPPA 1PE1A 1YXDA 1F6KA 1UWTA 4JR5A 3KHDA 3CZLA 4CQDA 2E1WA 2WC3A 5K4XA 1UH2A 2E0PA 4H04A 3H2OA 3GAYA 3ZS4A 4H4IA 3PC0A 1JRBA 4OUIA 3EMCA 3V5OA 1SSGA 3HPFA 1JPKA 1O1ZA 2GGIA 3B05A 5FF0A 4CU7A 1MSSA 3NOYA 5DMNA 1VBGA 1UASA 3GBDA 1PWLA 2IPJA 3VGFA 1F3TA 2QEZA 4GD0A 4XUYA 4M0XA 4E8DA 1QPOA 4L7ZA 1BD0A 1VBHA 3P14A 5E1QA 4GI8A 3WIJA 1T0OA 1F73A 1Q8JA 4HZMA 3UPMA 3MO7A 1JG9A 2C16A 2OSWA 1TJ2A 3P0XA 2P10A 3G77A 2HVMA 3LHWA 2QUNA 3EZ4A 1JZ2A 2EKCA 3K8KA 1TE1A 3B9NA 2GK1B 3AYRA 3UVIA 2IQDA 3DC8A 2CWXA 3LNMA 4GKLA 3F2DA 4ROQA 1FWCC 4F0MA 1A0EA 1G9HA 4CLMA 4XZIA 3CGTA 2E9MA 2WMJA 1XW8A 3UXKA 4IOTA 3UVAA 4REQB 2YBUA 2DZUA 4FOUA 3S1GA 4O54A 5DELA 3O2LA 4LXFA 3WF3A 1H4PA 1H0IA 4UCFA 3CXOA 4GHRA 2AMXA 3I6EA 3IIVA 2PB1A 4UZUA 2NV9A 1KV8A 3RF9A 4V1YA 3KW3A 2W61A 1XC6A 3OA3A 1ZU8A 4X2RA 2ACUA 4WSHA 1JEZA 1S5MA 3EB4A 3M6DA 1V6WA 3S5ZA 4MDPA 1B9ZA 3O1NA 4AVOA 4H8HA 3SBFA 1FBAA 3TYZA 4UQ9A 5C8BB 2ZIDA 1S5NA 5BXRA 2O4QA 4J27A 3I3EA 3PBVA 4NX5A 2IUZA 1RBAA 3KTCA 3DYMA 3A5VA 4HK6A 5D09A 3M5ZA 4GH1A 2OSXA 3NQ2A 2WLZA 1J5SA 1BVZA 3A6OA 4GFIA 4H00A 4JD4A 2H3BA 3A4JA 1QI5A 3N04A 1Y5XA 3WL1A 1SVDA 2Q3RA 4H19A 3RAOA 3U2CA 4DNHA 5I3FA 3VIKA 3QYQA 4IQLA 3ZT5A 2Y85A 4GLEA 4CGTA 3NQAA 4UFHA 1A0DA 1AW1A 1JCJA 1PDZA 1WDQA 2ZUVA 1E9IA 4I9AA 1CGUA 2FHFA 3MHUA 3L2MA 4NVTA 4O0KA 2OZ8A 2X1UA 2Z7GA 2CLFA 4XG1A 1WUEA 5REQB 3S42A 6REQB 3DN5A 1CCWB 1X1ZA 2VZTA 3P62A 3R5EA 3LRLA 3TKFA 3EMQA 4X3ZA 1KQYA 1ODZA 4OV9A 4DVOA 1VCFA 2V3FA 4R85A 1JDFA 3TMQA 4RPPA 4U2YA 1ZAIA 1PCWA 3V5FA 4PUWA 3BQ6A 3H21A 4I5UA 3HPAA 1R7AA 4XO7A 1EPXA 1A0CA 2Z2BA 4IPLA 5KETA 5A6SA 4P7NA 4A8NA 1L0PA 3PHAA 3AU2A 4C6CA 1CBGA 4LS1A 4V1XA 2FDSA 4PUDA 1SW0A 1L8PA 2OELA 5IBXC 1VIWA 3QV6A 3SRDA 4MB3A 4H2HA 4DWSC 4AX6A 4Z2JA 1U1JA 3MVIA 3OLGA 3H7VA 3QLLA 2CIPA 4WSKA 3TYCA 4Q8NA 2ZZ7A 3TTOA 2IPGA 2ZBTA 1EYWA 1X97A 1HKJA 1OYBA 2FZ8A 1FWJC 1V3HA 3CZGA 5BWFA 2XH4A 4QBXA 3V5CA 1F4HA 1VAHA 2I5IA 1DHPA 4GE8A 4MKVA 4MB5A 3DFNA 1EGMA 1S2VA 4G6CA 4DO6A 1XD0A 4X60A 4PTVA 4YXGA 4KETA 3UR8A 1KM3A 3P5YA 2C8NA 4DM1A 2BY1A 1K3UA 4I9MA 3GU1A 1JYWA 3BJFA 1JDCA 3H2FA 1UZ4A 3TEVA 5FL1A 3O16A 1PTAA 1TPFA 2AGTA 3BJTA 4TQTA 3FAXA 3S1XA 3WH7A 3HG3A 3SGGA 2DSVA 2A3AA 5IDIA 1DJWA 3PJXA 5AZ0A 3AOFA 4YPJA 3HGRA 4JL1A 1QASA 1BFNA 1QI0A 3RG6A 1UD6A 5XIAA 3S1UA 3WDIA 3ZJ7A 3BMWA 2VXNA 1G4SA 1BKSA 4MKNA 3HQPA 3WD3A 1XLGA 4DLFA 3T78A 3CPRA 3EXRA 1VFTA 4O57A 4AQLA 8TIMA 1QPRA 2QPXA 3PUOA 3B9OA 1LWHA 4IQDA 4JTJA 1H1YA 1B5TA 4YTQA 2QDEA 2WNQA 2PLJA 1SGJA 1NP0A 2YGYA 3S2CA 4Y7EA 4QDPA 2V5DA 4K1WA 4RDZA 1TMHA 4R53A 5DMLA 1D7FA 4OE7A 3TFCA 4JQ2A 2V2CA 3SN4A 4XAYA 3WCZA 3M44A 1E4MM 2Z4GA 4Q7BA 1VKFA 2FB2A 3IGXA 2J7DA 1H7RA 4LAOA 4JAWA 2E1DA 1TJRA 4LALA 4CN4A 3NQMA 3TJIA 3R8HA 2ATMA 4U33A 1ISZA 3VM7A 1KM0A 3VOFA 1MWOA 3N15A 4WLCA 1LDCA 1UYQA 3ZT6A 1FP9A 4US6A 1JZ5A 3LI0A 2G97A 3EMZA 5A2CA 3G1SA 1FH8A 3N2BA 2DZWA 3IJ6A 4UMBA 3WD4A 1RY8A 2G95A 1V3LA 1ZALA 3NAVA 1ZCOA 3ARQA 4JIRA 5DBUA 4Q33A 4ZBCA 1UP3A 1W91A 2VEPA 2ADAA 2XM1A 2VOTA 3CUJA 3MW7A 2D0FA 3MI3A 3IJDA 4J4KA 2BY3A 2XGBA 2YFOA 1XIGA 3QJAA 3PZNA 3GHTA 1WBHA 2WYSA 1TWSA 1J0ZA 3LMZA 1UMYA 1NFGA 3TLLA 4ZB5A 4H9VA 5BRQA 1JYVA 3BOLA 4NQ1A 1FH9A 1LYXA 1UQYA 2PLCA 3N19B 4L4LA 4O28A 4PFMA 2WNWA 3Q58A 3VAVA 3VOJA 3Q45A 4HOXA 5D03A 1KFEA 1DE5A 4GYJA 1NDYA 3USZA 3WNOA 3STPA 4EP8C 3IWPA 3S3GA 3GDMA 4LYKA 3QTPA 1YPFA 4LEFA 5IDZA 3P93A 2MUCA 4C6IA 2A7NA 3BLLA 1X7IA 3KX6A 1RD5A 1R8LA 4KIEA 3W1RA 3CV7A 2JKEA 4PB3A 3FHAA 3W84A 4L6DA 2VX7A 4US5A 1EC7A 4PCSA 2WAGA 3VKKA 1M1BA 5GNZA 5BMWA 1DJHA 3EWYA 3MWAA 3CQKA 2WKGA 3ZR6A 4HA0A 1W5PA 4KKXA 5A8OA 1OYCA 2REQA 4EKJA 4ZQMA 4FNRA 4LUYA 4D6GA 1Q63A 1X39A 4FNTA 1F61A 3GU2A 2YA0A 2CFFA 4KT2A 2CKSA 4Z08A 1V0KA 1IGWA 4JTUA 3FA5A 5DT5A 3ZFHA 3TAKA 4CCCA 1YTDA 2ZKMX 3P6LA 5KITA 4RXFA 2OVLA 1KXQA 2YDSA 1K4HA 3U57A 1XH2A 2ZDRA 3FW6A 5D38A 2I9UA 3GFXA 1QXLA 1XF0A 1HQTA 1VZWA 3HPZA 1BXNA 3KLLA 4J28A 3U2ZA 2POZA 3SCVA 2XVNA 5HDRA 1QNSA 4IJRA 3L0KA 3GX9A 2GVEA 2YJQA 4KFNA 1C7TA 2BODX 4CCDA 4QQUA 4N9CA 1E43A 5ABHA 3I3DA 4C5ZA 1MFVA 4IGHA 2DY3A 1EOKA 4EAYA 4L80A 1NFPA 1A49A 3UF9A 1YDVA 3ABQA 4Y9OA 2CU0A 5D8WA 2J75A 1YPXA 1NWUA 4F79A 3T55A 4QS6A 2DJLA 4JN7A 2Q8XA 2UWFA 3S9YA 3M46A 2PDFA 1JL8A 4DJDC 3RHGA 2JK2A 5C7VA 5LIUX 4UXDA 2ZCGA 4LC8A 3ANVA 2Q3OA 3HQ1A 1G1YA 5LNWA 1K7XA 5GJPA 3ZXWA 1M68A 3P8JA 5D02A 4ILSA 1XCXA 4WOQA 5GJNA 4PCFA 3WNMA 3GUWA 4HPNA 2Y7GA 4R27A 5DO8A 1IYXA 5BRPA 4QGCA 1RQEA 3UCQA 1E72M 2Z1BA 4X0VA 3FK4A 3ZYZA 1OYAA 5AHNA 3TTEA 4AEOA 4JNZA 2WK2A 3NEVA 4BCEA 5RUBA 4GY0A 1W56A 2O92A 2ZE3A 3GHUA 4NJIA 2QVHA 3N6QA 4QJ1A 4IFOA 4R3UA 1SFJA 2W62A 5IM51 3DDMA 1FCQA 3LPGA 3T0AA 4A21A 1YRRA 1P43A 3AHYA 5LNUA 5ABGA 4F4RA 4LQ1A 4IMGA 1ME9A 4JTQA 4XZHA 2OU4A 1AJ0A 1IZJA 3W37A 4R33A 2PODA 4O13A 1X6UA 3IRDA 1RD6A 1QBAA 3CJPA 3B04A 3VUSA 1AJ2A 1Z41A 1QW8A 1FHLA 3WK1A 1GG0A 1P4CA 3NXLA 1BAGA 1R3RA 4LVFA 1RHCA 3DECA 3GXPA 3WEMA 3WN6A 4QJ4B 1QNRA 7CGTA 1W2PA 3NL2A 3F2BA 5A6MA 5CJ5A 3GC2A 4KCWA 4HJFA 3PM6A 3W7EA 4WDTA 5XINA 3UA4A 1TWIA 3N14A 1RCXB 3CZ8A 1BF2A 3MMDA 1G7VA 3WUGA 1KTCA 1HJVA 3M16A 4JFVA 4ALDA 4OECA 1LL6A 1TREA 2AKZA 2ZOXA 3HV9A 3MB9A 3R58A 3PZUA 4FI4A 1FWTA 2QXWA 4GZEA 4AD2A 4E3VA 5KZ6A 3SM0A 1W1TA 5FJUA 2HK1A 3MKKA 2ZUTA 3CQJA 4HSOA 1TVNA 1H60A 1SJAA 2XWEA 4QDWA 3F4VA 4JEJA 2PZNA 4AZIA 4MB4A 3QC3A 3W24A 1KXHA 3DZ1A 3TV8A 4NUWA 2FZBA 1QPQA 1DJYA 2QZRA 4GQBA 1NQ6A 1CI1A 1K9EA 1EYEA 4S3BA 4GGBA 3BCJA 2O55A 2PI6A 2D73A 3UWWA 4BI6A 1DWHM 2IQTA 4ACZA 3AJXA 4GJIA 4PA8A 2JFEX 3O63A 3VUPA 3NG3A 3AZTA 2WKJA 1OFAA 3VZXA 1OC5A 3NL3A 4JDBA 4YTTA 1NJJA 2E3ZA 3AIUA 3KDOA 3WDPP 5AHEA 3UZZA 2J9YA 2J27A 2PP3A 1XIEA 5J04A 4LY4A 4AZCA 3GDLA 3GW0A 1VLIA 3HFYA 4UNIA 2YL8A 3B9AA 4ZQNA 3E49A 4EANA 4ZVJA 3LI1A 1KCXA 2ONEA 1WZKA 3WMLA 4FNQA 3W86A 3AXMA 5CBJA 2W5FA 2WWCA 4ADTA 3RM9A 3NZRA 4RE0A 2WPGA 2V81A 4K7VA 3KBSA 5AVNA 1QATA 1K4GA 3UERA 3TJ4A 2W6RA 3I3BA 2QYGA 4BQ3A 4TR9A 4CU8A 4LF1A 3M5XA 1I2RA 2YDRA 4PCTA 2TPSA 3LXAA 3KUMA 1EPVA 3BTNA 3WKZA 4Y9AA 1QOXA 3IV8A 2WMFA 3HG4A 3LHYA 3D3AA 1NQKA 1R9XA 2J4GA 3V35A 3PPGA 6XIMA 1ESWA 3WLQA 3BAJA 1O6IA 4NZ1A 4AZ5A 3WQ8A 3FFSA 3IIZA 4AH7A 2B7OA 3IGHX 1UA7A 3MHFA 3MV11 3ARWA 3QFWA 3AIQA 4F66A 4XD6A 1RVKA 5CC5A 2CLKA 2NVDA 4RR4A 4Q7IA 4US5D 5F2LA 3BLEA 4YTSA 4KF1A 1HVQA 1ZSXA 3FA3A 3TNOA 1JPMA 4AIBA 3SAZA 3QV8A 3LEPA 1NH6A 2Z2AA 3GR7A 1ICQA 4A4AA 3SN1A 4RZ6A 3U8GA 1P0KA 3DBPA 4EXAA 3T9PA 1EKOA 2Y5SA 1OM0A 1NY1A 2EF9A 4F9DA 1NDZA 3PB0A 1J12A 3NYZA 2BXZA 3BOFA 3BICA 3TYBA 1TUXA 2QMJA 5F4SA 2YL9A 5G5IA 3ELFA 1Z8AA 4WGXA 4EK7A 5M5DA 4WSJA 3RPTA 3L5LA 3E3HA 1XKYA 2GSEA 5FJTA 1LBFA 3L2LA 2Y8UA 3G1RA 2YXXA 4NF7A 4XV0A 5LA0A 1WBJA 1DXEA 3WLJA 4QITA 6PTDA 3ZSSA 4X61A 4I6KA 2RKXA 4ZQPA 5J5DA 1TFVA 1LL7A 4G9PA 2YB4A 1HL9A 4B91A 5CSYA 1XIJA 4DAFA 5H8MA 3WEZA 3P7YA 7XIMA 3GHSA 3MBFA 2XISA 3KVKA 3CPUA 4CNSA 3SY1A 2XH7A 1YNQA 5BCAA 3CEPA 5L9FA 2E25A 4V15A 2QS8A 5BW6A 3QR1A 4B4HA 4E5TA 3SRFA 2GVJA 3VKDA 1LOSA 2GDQA 3UP8A 4HIBA 2VNCA 3QW4B 4LUTB 2OLSA 3SW6A 4B15A 3PNZA 1B3OA 2CHRA 2BHUA 1XI3A 1AH0A 4YNGA 4MJ2A 5FJIA 4K3ZA 1UD3A 3ZWTA 4IGMA 3DFOA 5HINA 1DJXA 4AVFA 2PLKA 1IWBA 3WK3A 4U28A 2V3DA 1TPB1 1D3CA 5HANA 5KZEA 1SZEA 3V18A 1W3TA 1S38A 2J7EA 1C8XA 1JF5A 1B3VA 3REQB 1F6YA 3SCTA 5A2AA 3URBA 2WNNA 4QG8A 2VR5A 4IT1A 3ARRA 4HMNA 5T91A 4V33A 4I6VA 1XYAA 1B3WA 1UH3A 1V79A 3BLFA 1QNVA 1WA3A 1JZ7A 1GGOA 4MAVA 3BANA 3S4TA 3WUFA 2Q02A 4JGDA 1UWIA 4LYPA 2PDLA 5FEZA 2J7HA 1G67A 4N0RA 3AHZA 1L6GA 3B4YA 1J2BA 2E4TA 4E6MA 4OIFA 2OWCA 2O7QA 3WQCA 1ONWA 3RLUA 1G7UA 1FCUA 2HXTA 4AC7C 5HK4A 1VR6A 2VRKA 3T8QA 3EXSA 4YTUA 3H4XA 1E6RA 2A5HA 3NGFA 4A3YA 2GGHA 3WNNA 5L6UA 1UC4A 1GJPA 1OWQA 4Q8WA 1VPXA 4CNOA 3H53A 1DWAM 2R14A 2W3ZA 3M0HA 3LD5A 1SFTA 1KR1A 4L9XA 3VIIA 1EGVA 4JQ3A 5EMMA 1XISA 3O0KA 3P8IA 3EEGA 4H9ZA 4PTDA 4J3SA 1K7EA 5I3DA 3CZJA 3QQ0A 4S3DA 1RLCL 1F8MA 2INZA 3BC9A 4GJJA 1OIMA 2YCJA 4O53A 3G1HA 3WQDA 2AAAA 5JIWA 1RALA 3U2EA 2C1IA 2GVYA 1E6XM 2XZ9A 1R3YA 1TPC1 4BR1A 1XBVA 3TWBA 3VCNA 4MDOA 4DRSA 3SCPA 3WZ0E 1NOWA 5CXPA 4HU3A 3IANA 2XFFA 4XZLX 2PEVA 4C6EA 3UR5A 1K8ZA 5A8MA 1NFBA 1A5MC 1UG6A 4K37A 5LGXA 3W7HA 4EX4A 3VDAA 1MYRA 3T40A 4LSBA 3GD6A 3S0CA 1QHOA 5DT7A 5KZDA 4BJHA 1C91A 1B90A 2V5KA 1TZ9A 4J9JA 3WMSA 4WY0B 2Y1HA 1WDRA 4P8UA 3LQGA 4TO8A 5BXTA 1RAKA 1CZ1A 5LA2A 5A69A 4AUBA 3TN3A 4JTFA 4WQ6A 1IXNA 2VGGA 3NQFA 2GGEA 3FEMA 2XN0A 4QFUA 5A94A 1VJSA 1V6XA 1U33A 3KE0A 1R47A 4BA0A 3MSDA 2PTZA 3ABRA 2P0IA 1BEUA 2UV8G 3WO8A 1KR0A 4W87A 2RFGA 1JFXA 4FB7A 4MMWA 1US2A 1GKQA 3U2OA 1PYMA 1WDPA 4MVAA 5CPSA 4CVWA 3KDNA 3DYPA 4KERA 1UUMA 2B4GA 2VM8A 4UR7A 2VC9A 4Z0JA 4F2UA 3VD4A 3SFWA 3C5QA 3HBLA 3THQA 1TKKA 4EWND 2WVUA 3K1DA 1A4LA 3MUIA 3H2EA 2G4FA 4YYFA 1YNYA 2FJUB 3OZYA 1EJSC 1YPIA 1EGZA 5FA5A 4W85A 1AA1B 4TV6A 2D2HA 3P61A 1EX5A 2X2YA 4ZOCA 3CL6A 4L61A 4D6JA 4ZE5A 1VH7A 2ZYFA 1EIBA 2NXGA 4E4UA 2JQXA 3MJMA 1AD1A 3AROA 3W26A 2A3HA 1OFRA 4LEQA 1ISWA 2V0TA 8A3HA 2CLEA 3AWNA 2YL5A 1U83A 2WHMA 2XVLA 3VIMA 4D72A 3V0TA 4Q4MA 1S39A 2D2OA 1IEWA 1XGEA 4ERGA 5EKYA 1GK8A 4TVCA 3EB2A 3CT2A 4W8LA 5F4XA 2G5WA 5D9PA 3RFAA 4A3RA 2DZSA 3CMJA 1IIGA 2YBTA 4GVIA 3C2RA 4F2BA 4QAWA 2QCGA 1Z9AA 2Y62A 3LZ3A 2ISSA 2XIQA 3W9ZA 1Q66A 3CAQA 1XBZA 1YX1A 5D2TA 1EDQA 1NTHA 3GG8A 1PIFA 4RZBA 2QVNA 3PZVA 4PUMA 4TX6A 1KC7A 2J9ZA 1UUOA 3M07A 1IV8A 3GUGA 3CB8A 2CXEA 4PYSA 5D9MA 3WLMA 3ITLA 2ZQ0A 3DU0A 1KFCA 3LXCA 1QNQA 4GVGA 4CNTA 2KAUC 3W4RA 3RDKA 4DEFA 4HNNA 4UFKA 2ABBA 1K77A 4CNUA 1OJXA 3GDKA 3GIPA 4O1DA 1HJWA 3LU2A 2CZFA 1NOFA 4JQ1A 1PKLA 1XLJA 3AHVA 4MWAA 1BGAA 1W5NA 5LHFA 2VVNA 4HNOA 2ZRYA 3EAUA 2OOFA 4S23A 1E4LA 4V2XA 4LAUA 2RDXA 2V5CA 4XIMA 1E15A 4HGXA 2VUNA 1E1FA 4BI5A 3DI0A 4CQ9A 2ZRVA 3A64A 1W9UA 1UP2A 3ZLHA 4TV5A 2AQVA 5AC5A 3AO0A 4AZGA 5LIXX 5CPNA 4BEUA 1H1NA 3E0VA 3NZ1A 3I6TA 3KFTA 3LS9A 3V75A 1XPYA 2X0SA 2Y63A 1Z89A 1FWBC 4HNCA 3IVTA 4JYFA 4JQ4A 4GX8A 4RDVA 4YWIA 1V6TA 4KWSA 3P84A 3W7DA 2NW0A 4Y9NA 4R5EA 2Y7EA 4LNYA 3T0BA 3VNKA 1LQAA 1F2JA 3ATZA 3TU9A 5I0DA 3GDTA 4JFSA 4DI8A 4QIUA 1GZJA 3TROA 1FUYA 4WGHA 1E51A 3TVAA 3QMSA 4E2DA 2PMQA 5K9DA 3FIGA 2VWTA 1JPDX 4GBUA 3VGHA 4R9OA 2OSYA 3VU2A 1O95A 2WMIA 1PX3A 1JCXA 3FGCA 3QPYA 3CO4A 3SRHA 2ATSA 1TIMA 4ML4A 1PDYA 4Z1DA 3VNMA 4PBGA 3W7QA 1MUWA 1EWDA 2PC4A 3WDQA 4LGXA 4OT7A 2HCVA 2BASA 3OQEA 2KX9A 4IZGA 3HIJA 1J5TA 4MSSA 3MTWA 2XZ7A 1QOPA 3KTXA 2GL5A 3W2UA 1ISVA 1SO4A 2YSWA 5F4WA 1KKRA 1XH0A 4J3VA 5TIMA 5IFTA 1E0WA 4G1KA 4QROA 1SU5A 4NSBA 4PE8A 4KFPA 3KBWA 4MY9A 5ABEA 3WK0A 4XTDA 4D1IA 1R3WA 2WCAA 2QW5A 1H61A 2TAAA 3VIPA 3L21A 1IGSA 4YYCA 1ZJHA 4KEZA 4Z42C 1N2VA 2GSJA 4BF7A 4DI9A 4JHZA 2AGKA 3S5YA 2EO7A 1MW1A 4UQEA 1E5JA 2ZZ6A 1CTNA 4H7CA 2INFA 2BXYA 3W02A 1K8CA 2OGJA 4S3CA 4ROPA 2NX1A 3ALFA 4EPEC 2CHNA 4YVVA 3MDWA 3AXIA 3PTDA 3S47A 3VIJA 3B0PA 4C5YA 2VR4A 1F6PA 5IHRA 1H11A 3GG7A 5HUOA 1V8EA 3CEUA 3LHTA 3R25A 1DXIA 1XLIA 5HQMA 2NSXA 3CAKA 1KD0A 1LL4A 4FOJA 5HUPA 1Q6OA 1PCKA 1TR1A 3FLUA 5DCDA 2HS8A 2V5JA 1R46A 2NUWA 3IK4A 1IEXA 2I5GA 3F4NA 4S38A 2XM2A 3T05A 4RZ5A 1LQ2A 3W1TA 2R94A 5I09A 3OJGA 4MKSA 1U1HA 4LRSA 2P50A 2ZRWA 4DBDA 4H9UA 2WBKA 1TIWA 1P1MA 2Y7DA 2VQTA 3PUGA 1Y5VA 1RA5A 4OZOA 5HWMA 4CD5A 2BVDA 4L64A 4BS0A 1UJQA 2C0HA 3WUBA 3PUDA 4KQNA 4LAMA 1BF6A 4NT0A 4C6KA 3E02A 3G0SA 1HXJA 1UZHA 3TQKA 1C8QA 2GJPA 3GBEA 2QULA 1ISXA 5JIPA 5GQBA 1UR2A 1V4YA 1WZAA 2WVTA 4XAFA 1GZGA 1FWFC 4XZMX 1O1HA 1O68A 1Q6FA 2DEPA 3GRIA 2Y7FA 5C5YA 3N6HA 3WJZA 2UY3A 2VKZG 3KTSA 3MCNA 2ZXQA 4Z2IA 9CGTA 4O10A 2QCHA 2REQB 1A3WA 3IVUA 4QDMA 3W71A 1A4MA 3VNLA 3MSGA 4RCXA 5CZTA 1Q4NX 2YA2A 2QKFA 1C9DA 1GVYA 4ZMGA 1MI3A 3S6OA 2PC8A 3VGDA 2XSAA 5I03A 1LLZA 1QHZA 2DSKA 2GSHA 3NYDA 3DAQA 1QPNA 3KCOA 3W01A 7TAAA 3LCGA 4R34A 5G4WA 2ZX9A 4UOQA 3AIEA 2HTMA 3GDRA 3E0IA 4GIEA 4AWSA 1F05A 4NU7A 4XBKA 3W7LA 1EJ7L 1H0GA 4UQDA 4XSLA 2YIHA 3PTQA 5FF3A 4H41A 2YOCA 4QR6A 4MOZA 4KIRA 1CGVA 3E38A 4B5WA 2I16A 1K9DA 9RUBA 3UWUA 3LNPA 7A3HA 1WZMA 4V28A 3NO1A 1HO4A 3HGSA 6REQA 3VOGA 1MQQA 5AFDA 2FZNA 1XYCA 1BTCA 5K2ZA 4I5RA 3DYOA 2RJGA 3OIXA 1RPXA 4E0CA 1TTIA 3ZZ1A 1OX4A 3W81A 4AYGA 3TXVA 1NF0A 1A80A 3QQWA 2FZMA 3V0UA 1HVXA 3W72A 2QCCA 4W4QA 3L66A 1ECQA 3WSUA 2I1OA 4EWJA 1H7NA 3B8TA 4H6RA 3MY9A 4HA1A 2G3MA 1U30A 1W5QA 2DW6A 5CQ1A 2ZUNA 1H5YA 1X96A 2GUBA 1R7OA 4GUJA 1EJUC 3DERA 3GW3A 1UBSA 2RGMA 1XGZA 3EX6A 2XYLA 3O3RA 1I8JA 3G24A 3CC1A 3UW6A 2GFTA 2BZNA 4G7FA 2D24A 2VFGA 4A3HA 5BNKA 3A12A 2EAWA 3PBUA 2DV0A 4UTMA 4MWAD 4AEFA 1MDRA 4GZ7A 1UR4A 3W0KA 1WKEA 1V51A 4E4PA 1J6PA 3TONA 3ZLGA 2FGBA 5EGRA 1SZNA 1G4EA 1UD2A 3EWWA 3II1A 1M41A 1VPQA 4QRNA 1ZAJA 1UIPA 1UR8A 4MGGA 2FZ9A 5DANA 5I3JA 3H26A 3NQCA 4CCZA 4DIAA 4GKTA 4HU0A 1KBLA 4PMZA 3WH9A 2BNJA 4M81A 1UZ1A 4O12A 3RPDA 2QNEA 1Q5MA 4IG2A 1X1OA 3DKLA 4TXEA 3E2RA 1I9CB 2TODA 3H22A 3UNTA 2G3NA 3GXDA 1SW3A 3HQNA 4UZSA 4I8DA 1S2WA 1K9FA 1KNWA 1Q6CA 1HO1A 4P7LA 4C6PA 3R2GA 5DCBA 2QJJA 1S3HA 4ML9A 3EWZA 4M8UA 4HPHA 2J66A 1D8CA 3WFZA 3PSWA 1H49A 1SO3A 3L4UA 4LJ3A 1OADA 4Q8VA 3VKJA 3R0KA 1JD9A 3DG3A 4TU1A 3W00A 4MUZA 4HNTA 1QO2A 3W7MA 3K4WA 3QLDA 3IGUA 2ACQA 1KRMA 4MYAA 1GTEA 4KMQA 3C56A 5C9ZA 1X98A 2O0TA 3A21A 1A5OC 4IXXA 3B0XA 4C6LA 5HNUA 1R2SA 1NVMA 4FLOA 2O56A 3ITXA 1NDVA 4OTKA 2QV5A 2DT3A 4BK9A 2O7SA 3TJXA 1VCVA 4MY8A 2VZSA 1ZBCA 4CNNA 3STFA 2OLHA 2F2KA 3NVDA 3S2JA 5G4HC 4P5UA 1XP3A 1DJZA 4CN6A 2F6UA 4E8CA 2DIKA 4ACZB 4XISA 3Q94A 3QKZA 3RITA 3O6AA 5B7ZA 5I00A 1W6TA 1KCKA 1VHNA 2HV5A 5U4NA 1DE6A 3L65A 3S6TA 4WKFA 2Z28A 3UT0A 4Q7NA 1PZ0A 5CGMA 4ZO8A 5HATA 2WJZA 1W5OA 1CB2A 1I1WA 3WD1A 1GQLA 1A5SA 1RV8A 3AXKA 3SJ3A 1W3KA 4AZCB 3GVQA 1B9BA 2W67A 4L9YA 4IPJA 1XBXA 3GH7A 3KS5A 3Q65A 2HJPA 1K6AA 2XN2A 4MUPA 4PMXA 5BU6A 4PN2A 3SN0A 1P6WA 1A53A 4AU0A 1UBPC 4EF9A 5LNSA 3NQDA 3T0DA 4DZ5A 4QP0A 3LLFA 1VC4A 4NRRA 4FIQA 1RXOB 2V67A 2FPVA 4P8VA 3CH9A 4HPGA 2WKLA 3BJSA 4FNUA 3B06A 3HGOA 2Z1KA 4B5XA 3C0QA 4CD6A 4DF1A 4LAKA 4GC4A 3GWQA 1E1CA 3VK5A 2WQPA 4IPIA 1OK4A 3PAOA 3P67A 4K2SA 1E71M 1SR9A 1TTJA 2PWGA 3ITVA 1JIBA 1YQ2A 1FHVA 4IMFA 3WDRA 1ITCA 2BB0A 3WF2A 3H12A 4PEKA 5C70A 5TNVA 2HSAA 3P2VA 3APGA 1JXJA 1SMDA 2GQ3A 4WKHA 2WVVA 1Q65A 1B3YA 3TH6A 4YLWA 1GYNA 1ZP3A 4KWWA 1RQBA 2X05A 1KQZA 3VC6A 3A13A 4INFA 4JTTA 1E4NA 2F61A 3T2QA 5DY2A 2CESA 2PD5A 4GI6A 4HSNA 1O5XA 1MDLA 1RQHA 3QY8A 2ZE0A 2GWGA 4ZFCA 1AVAA 4WEVX 1KWKA 3O0FA 1QK0A 3A9BA 1UKSA 3C4UA 2BG5A 3F4WA 1DBTA 3W6LA 4LV4A 2FGLA 1B0IA 2G41A 4IMCA 1BKHA 1IXOA 3CHEA 3T2OA 3G2GA 3NCOA 5IOBA 1UIOA 1PVNA 1JD7A 3PZQA 3WLTA 2YL6A 3URQA 4J40A 1V7AA 3QHMA 3UPWA 2OYKA 3T2PA 5ABFA 1EHAA 4U5KA 1GVIA 2HRWA 1VYPX 3JU2A 2CHOA 3MMUA 4O1AA 3WBYA 4D71A 4A8LA 3CB3A 2WM0A 3UWEA 3FJ6A 3W1PA 2WOQA 4R7JA 4HN8A 4R7OA 1KKOA 1XFBA 4Q6XA 4YCPA 5H8UA 4ZQCA 1LBMA 2Z29A 3JS3A 2ZA1A 2VRJA 3D47A 1KB3A 3GY1A 4NZCA 1LQ0A 2AOSA 4KH2A 4GQGA 2QCMA 3DBNA 4FK9A 2W4XA 3OTRA 1XRTA 3GXTA 2OWWA 4F8XA 1PUDA 2BOFX 3IGSA 4GY1A 4K1GA 2HS6A 5A6AA 2NVCA 4NJGA 4AD5A 4LNCA 3MCMA 1TMLA 3UJEA 1GHSA 2GLKA 3U9IA 5FF7A 4PUNA 4B16A 3M0LA 5FI8A 4AZ6A 1PKMA 1TVPA 4JFUA 1BQCA 1ZLPA 4GY7A 2OEJA 4DBUA 3COTA 1I75A 3K13A 1EUAA 4M7SA 1M01A 2V3GA 1V08A 3TNBA 2CZ5A 3W1AA 1DWFM 4JXCA 4HOZA 3RJYA 1XSKA 1EJTC 1S5WA 2PE4A 3QF0A 4AIEA 4QQ3A 3CTLA 2O9TA 4GNKB 2WANA 3FKKA 1LWIA 3UYCA 2YYUA 4F2TA 3GZ3A 3MWCA 1US3A 3ZJ6A 5E6ZA 3WDHA 1NWSA 5AYIA 1FHUA 1M3UA 3UJ2A 4O1CA 4GI4A 5FIPA 2BVYA 4GYKA 2JGYA 4AY7A 4IFRA 2J7BA 3RLGA 2X40A 3AMGA 3NURA 5BMXA 3PZIA 1TQJA 4GCAA 1UUQA 1SZGA 4O19A 5C55A 4JNYA 4QEEA 3FS2A 2ALDA 1G94A 4PTXA 4D6FA 5LIKX 5CC6A 2X0HA 1MXSA 3WLRA 1QR7A 1IEVA 3VE9A 2VWSA 2HQAA 4GNJA 4YJ5A 1Z7AA 2DZXA 3N4FA 3EPNA 2HNEA 5EFDA 3UJRA 1LG2A 3DIPA 3AMKA 5K3VA 3I7QA 7REQA 3HGJA 2VDHA 3CWHA 3W70A 2I57A 4A2RA 1KM5A 1JPHA 3BGGA 3ITYA 4CQCA 4AY8A 3L67A 5AVHA 2J6XA 1XYMA 3KBJA 4PB4A 3UXIA 2Y70A 2F8QA 1UJPA 3TYUA 3URAA 1UQZA 5TD4A 1QFEA 1M7OA 3BAIA 4L6HA 4C7FA 5JU6A 3MYPA 1CX9A 5G1MA 5LYRA 1LT8A 1J79A 3C0SA 3MPGA 4KRZA 5AYYA 4MZYA 2YA1A 2BHZA 5C9UA 2Z26A 2YB1A 4IX0A 3E2QA 3AC0A 1X8CA 3G8RA 1J6OA 3SO7A 3IVSA 3VNZA 1WOBA 3NPXA 1H1ZA 3LRMA 1CXFA 4ZOEA 2XIBA 4OVXA 4G1NA 2C19A 1V93A 3FY1A 5XIMA 3QTGA 1EJVC 4B5SA 2GZXA 4MF4A 3UXLA 4DJEC 3GNPA 3AXXA 3TN5A 4AEEA 1VBRA 2D3NA 1KBJA 2J8GA 4PCNA 1KBBA 3OBEA 1XDJA 3OG3A 1RCQA 2BSLA 1Y8BA 3R0DA 2CZDA 2VEIA 2Q01A 4G56A 4CD4A 5I24A 2W92A 2QAPA 2HDJA 3CM4A 1ZPTA 1RLDA 2BGSA 2WBGA 3QOKA 2V30A 5I3GA 3SUWA 1OZQA 3GM8A 4S3GA 3WQVA 1R9ZA 1L6FA 1R86A 3GVGA 2QF7A 3TE9A 2HPMA 4O0ZA 1EX1A 3W7KA 4TVDA 1ZBKA 2AQOA 2Q8LA 3N2XA 4PR4A 1PPIA 4WF7A 3VIFA 1PHQA 1EXBA 3ZM8A 4RE3A 2WSQA 3ES7A 3UYIA 5IBXA 3FYOA 1VYSX 3CL7A 4DWSA 3GVWA 4Z2LA 3RRXA 3E1F1 1LP6A 3FOKA 1JZ4A 1TRDA 4AD3A 1KBKA 5GPRA 1C3FA 1ENUA 1BQGA 1M7PA 2XU2A 3NPVA 3UZ5A 5E0FA 2ZVRA 4XQ6A 2ZX7A 5HJLA 2FPTA 3W1UA 2R6OA 3VMOA 2WC7A 1X8FA 3BV4A 1TV4A 2OPJA 4FXFA 1DEDA 4ZQOA 5JH2A 1G6CA 5A8QA 4C6MA 2BV9A 3BSGA 4N2YA 2GJRA 4OV4A 3W7IA 4UC5A 3IJ9A 4UUIA 3VDGA 3OHIA 2YCKX 3W7RA 3KWXA 3CUFA 2CW6A 4EF8A 2NUXA 4U3CA 3NSNA 2IXUA 2FB3A 5CJNA 4KEMA 3UPBA 3VCCA 1V3JA 1HG3A 2VI0A 3CPGA 5F1VA 1KTNA 4BWLA 5KTLA 3WX7A 2OFJA 3WQ4A 4LS0A 2OTDA 1D9EA 3ENLA 4JHOA 1HL2A 1Q8AA 2OEMA 3KCJA 3WLSA 2PZ0A 2LLEA 1JF6A 1CEOA 1CXEA 3M5YA 4C1NA 2PDJA 4J3TA 4IMAA 4UFIA 2C15A 2DUAA 3T1GA 1MW3A 3WENA 2QCFA 4S3FA 3CH0A 1BYCA 1C92A 1TJ0A 3TA9A 1GW1A 3EOEA 1ONEA 3GR8A 1IXPA 2CPUA 2ZUUA 3GNDA 5KZMA 4MNMA 2B31A 1O5QA 2JKAA 4H2CA 2DIEA 4IIGA 3PZTA 1BYAA 2YCLA 4CEXC 3UGRA 4OGZA 4Z1CA 2PWVA 1FOBA 2AKMA 2JEPA 1ECEA 5CC3A 1IHIA 3LG3A 1XWYA 3P0WA 4H6KA 1U22A 3SURA 5EBUA 2YKKA 4B9ZA 3QFEA 5HQEA 4D9PA 4JBRA 3F5LA 3A3XA 4D8ZA 3GNOA 4KWOA 1SW7A 1O12A 1PTGA 4MWAB 3UJSA 3CHCA 3NPUA 1R0MA 1CXLA 3H4GA 1XLFA 4C6OA 3BMXA 3CLWA 1HJXA 3BLKA 4NAEB 3GYCA 3OW1A 3RX2A 3DGRA 5EA9A 3G1DA 3U3HA 1KFKA 1PL9A 3Q4DA 3GNXA 3JRKA 1XPGA 4ENLA 1V02A 1KM4A 3BZGA 3VVGA 2ZC1A 4FNPA 4ZL1A 3TP4A 3LOTA 1PSCA 2DSZA 1U2YA 4O16A 2GOKA 3EDJA 3UXAA 3WQFA 3UR7A 4PEEA 1F3EA 1GVQA 1H7PA 4BF9A 3N4EA 2PBOA 4CQAA 1EA0A 4K39A 2ANUA 1QMLA 5DF0A 4QS5A 3BSMA 1SR0A 1Q3NA 1GQKA 4Q8MA 4MLRA 3W82A 5D9OA 4R7WA 1ZBVA 4QG9A 2HE8A 2Q71A 4J3UA 4ZXLA 3PK7A 5B7YA 4B3KA 3G0UA 4E38A 2VVSA 5CBIA 4DF2A 1N8WA 2ESCA 3EDFA 3R6IA 4Z0SA 3TIMA 4IUOA 2A6LA 2WMIB 4AYSA 4DO4A 5C2CA 2QUMA 2QT3A 4XZ9A 4KEUA 2PBGA 3FGCB 3NO5A 1GORA 3QGVA 3FSUA 3NDZA 1OGSA 3H24A 7PTDA 4H9MA 4S3AA 4NASA 3PANA 2AQWA 3OYXA 3RUBL 3ZO9A 4FZIA 4POCA 2QGHA 2WZEA 2PP1A 3ES8A 1LRNA 4IFKA 4MG4A 3MU7A 3BAKA 3QHOA 3FKRA 1WE5A 4MM1A 5EFFA 1LM1A 3ARTA 1GOIA 1T40A 3ZMRA 4H8NA 3M43A 3ZLFA 4JIEA 3VOHA 2VZVA 4XO6A 1MRQA 3M0VA 4MZ8A 4TMBA 3T0TA 3PULA 5TF0A 2XIMA 1K8XA 1GOKA 1SUXA 5C9RA 4GA8A 2Y89A 1DXFA 4MPKA 1WAUA 2CBJA 4F0RA 4ICMA 1WYIA 4UR8A 4IMEA 2OR2A 4N7QA 1GYMA 1FDZA 1IIHA 1ALDA 3PG9A 1PZ3A 4XZNX 1VS1A 1VP5A 2JIWA 1UWRA 2WV8A 1AW5A 3N9RA 1FDYA 3L4TA 4IIDA 2VEGA 4LV9A 4XUGA 2EPHA 1ZB5A 2P53A 3H2AA 3M47A 3NM3A 3P3BA 5T26A 1ZTVA 4CNPA 2Y5EA 2DORA 2QUUA 4ATLA 4WY0A 2WM1A 3PFMA 4IL0A 2PWEA 2DJXA 5CC7A 3S1WA 3LCWA 4HA4A 5FAGA 2NXHA 4U3AA 2QCEA 4PB5A 5HR6A 3HU7A 3MUZ1 4DJDA 4FP1A 3TA6A 4DB7A 1TPVA 1N8FA 2NUYA 3LTPA 1ISYA 3KOYA 4FXJA 4EIVA 3UG8A 1DJIA 2X2GA 5CPOA 2WPBA 4MB1A 2NWSA 4TX8A 1J2WA 4DUVA 1UKTA 2OB3A 1HJSA 5E09A 3AISA 4GXWA 3E5PA 4C6DA 2C1HA 1TV5A 4DWSD 1Q7ZA 3ARSA 4GQRA 4R88A 3I65A 1J0KA 1B1YA 4TTUA 3VILA 5HBFA 3MKCA 4IIFA 4IXHA 4LANA 4B92A 1DWIM 4HPXA 5C71A 3NDYA 2VFHA 2A21A 4F48A 4B4FA 1BVNP 3DCPA 4Z2GA 5CSUA 4Y90A 1FXQA 5KINA 2CCRA 4G7EA 3BAWA 3UNDA 3SCSA 5EL1A 4UOJA 3ARPA 1BYDA 3WLOA 2V5BA 3GO2A 3T4WA 4RV8A 4W93A 5HJYA 3FYPA 5I7GA 4AZHA 6TIMA 4J5NA 2FVLA 1GQNA 4HTBA 5A95A 1KRAC 1Z3NA 4CN1A 3UY8A 5CSRA 2R1KA 4JDYA 3E5BA 4QISA 3LMYA 3M5VA 3TLQA 1DJGA 2YDAA 1FX6A 4P7QA 4NZ4A 5A1AA 4LVGA 1R3VA 1UR3M 2CWNA 3N12A 4URIA 5FJPA 4BF5A 2BP1A 3N6JA 4H8VA 3BLPX 4C91A 3NPWA 1OX4B 3THDA 1W1IE 2HE5A 1MVYA 4UTHA 4HQVA 1ZS2A 4QE1A 5CSSA 5MKGA 3FNDA 4Z17A 2J25A 3N18A 4X9SA 1XYBA 3H2MA 1QWKA 4RNJA 4W7VA 3O7UA 4IWWA 1LROA 1OFBA 4IM4A 4S39A 3FAWA 2ZZ4A 3C61A 2FH6A 3M0XA 4UFMA 2OO0A 2EPKX 4W86A 1JNEA 1YMYA 4U10A 1CGWA 1WOAA 3B40A 1JPIA 4RW5A 5ECVA 1O66A 4HHLA 5LA1A 3T08A 4N9DA 3GIQA 2PS2A 1ZJBA 3N9KA 3U4FA 2O9RA 3WF4A 2R9RA 4O8RA 1P0NA 2ZDSA 3AMLA 4C65A 2X1TA 3K8LA 4ACYA 4K36A 2I56A 3LXBA 2Y2WA 3MT1A 1TE6A 3RRAA 4BQ5A 3EWCA 1OK6A 3AYSA 4HVXA 3TQVA 1VFHA 5G1YA 1Y65A 3SGUA 1ZJIA 5CG0A 3B9EA 1NEYA 5A6BA 5D2VA 3V1HA 4CCEA 3FDGA 5D9NA 3W1XA 3FSTA 2Y88A 2YFNA 4W89A 2QDHA 4Q4QA 4UMCA 2PWHA 3C8FA 1XDMA 3IJQA 1MRAA 2BOGX 3BW3A 4IPNB 1GOQA 3WNPA 2W79A 4IG2B 2V68A 4MJZA 4BWLC 3DOPA 3GC4A 1EDTA 3GQYA 1BYBA 1SSDA 3PBMA 4O18A 5BRBA 1OG0A 2DZAA 2VOMA 1OFOA 4Q6JA 4ERAA 4LCSA 4I9TA 3FJLA 4DXKA 3ZOAA 3MDUA 5KEZA 4LFYA 2VFIA 2OOGA 1JAKA 2PUZA 2G3IA 4PGLA 3IUHA 3MV01 2C79A 2ZVIA 5FJRA 4J3ZA 3ZJ8A 3RCNA 1UWUA 2J7FA 1KXTA 1RJPA 3BLDA 4ZTXA 3V3WA 3GZAA 3IJLA 4XZBA 3MSYA 2WNZA 3DC0A 4QLKA 2NZLA 3UWYA 2D2GA 4JTDA 1VIZA 2E6DA 5I02A 3VA8A 4RV3A 4TX9A 1H3GA 3CNYA 5LXEA 1TPWA 2ZUMA 3RO8A 4E4FA 4EXBA 1YTKA 3NOEA 1F7BA 1FWHC 4CU6A 1VCGA 3G1VA 5FL0A 3LZ5A 2VT0A 3VNYA 4YVXA 2Z00A 4XD5A 5CJMA 4HMCA 4I90A 2HROA 1PIIA 3IJ8A 4DLMA 4Q4SA 5I3HA 3LA4A 1OEPA 1JYXA 3WBAA 3CMGA 4A2SA 2EKGA 1NELA 2Z1XA 2ZZ3A 1UWAA 3AZRA 5EPDA 1PBGA 2GJXA 3W75A 3S8HA 2HBXA 3WLIA 3PG8A 4LBRA 1VFUA 2BTMA 3G3DA 2V63A 2PRLA 1K6WA 2VP8A 3ARYA 4PMVA 4QHRA 1KGUA 1U1UA 5A2BA 4YL2A 3TYDA 4ZE4A 4I9JA 4HHMA 3MKVA 1PO9A 4MNKA 4LTSA 2J6VA 2QLYA 4LB3A 5C54A 2WSPA 2VENA 1H5VA 1W54A 3A22A 4NIRA 1W9VA 4DZAA 1QNOA 4JTGA 5M1TA 1HGWA 3RCMA 1R85A 4L1GA 4N02A 5AHFA 1HJUA 1RA0A 2QJHA 3LN3A 5DXYA 1Q6EA 4JNMA 3PPCA 3VNDA 3W7GA 3F4CA 1E1CB 1O94A 2E28A 4CUCA 3GTNA 1F76A 1XUUA 5EMYA 4QCFA 4NYYA 3G8EA 1XLHA 2NT0A 4DJDD 5D33A 2DVTA 4HSHA 1UR9A 4M6VA 5BOFA 1A5UA 4Y96A 3E2SA 4CKQA 2WVVB 3KL5A 3QV9A 3C2YA 3RJXA 1GVSA 3JVAA 1EQPA 3UD6A 4JFTA 1BLIA 2PU0A 1PKYA 1WO2A 1NAL1 5DRCA 3M6YA 3VIHA 2XVKA 3PF3A 2WZTA 1U5VA 3W74A 1ONRA 4AHQA 1G5AA 1W37A 2FLIA 4PMYA 2NLYA 4HJWA 3W3OA 1XLKA 5DMYA 4IGSA 4ADUA 3W7NA 3BGJA 5MHBA 1W3HA 5FACA 4NAFA 3I4KA 4UTUA 1QDSA 3L5MA 4ORIA 2HVNA 1XX1A 2ABAA 2FIQA 1TV3A 3JZUA 3C52A 4HNVA 4H9TA 1FHDA 4LB4A 3QSRA 3QGKC 5I2UA 3MS8A 2NQZA 5ABFB 2D3LA 1M9HA 2QCNA 3OZMA 2RDUA 5BROA 5DRIA 1RZMA 1IE7C 3PAJA 4WZHA 4LCQA 4A22A 2IPFA 4HPJA 5H6HA 3U5UA 2V8ZA 4QXIA 4B5TA 1E55A 4JX5A 1JCTA 1WAWA 3WLLA 1Z48A 3ATYA 3L12A 5G2IA 4XD3A 1W1A1 2ALRA 4XVEA 2ZX6A 4A8RA 3MO4A 5CGTA 2YPIA 3RMJA 4GVHA 3UFYA 2DH3A 3RX3A 3WY1A 1TPDA 1XRSA 1J0YA 3LCHA 3FHQA 3QC0A 2VFEA 2FKPA 4PRWA 2G3JA 4YIWA 2B7NA 1UC5A 3IRSA 1A47A 3RXZA 4AISA 3IEBA 4HYWA 5G2HA 3PJWA 3L4VA 3GXIA 4K68A 4FR6A 3ID7A 2W91A 2XFRA 3LX9A 3BQ5A 3W1QA 4LUJA 4J2PA 4N42A 2IPWA 5I5RA 4A05A 1M04A 2QR6A 1E0TA 1VQTA 3R13A 1R2RA 2ZTKA 2GDVA 1KTBA 4PUKA 1LORA 4D8LA 3CZKA 2FTWA 1XKJA 3AFBA 3TN6A 1IWAA 1DORA 3LHZA 4GMEA 4WCJA 3VKAA 1D7KA 4M24A 3FDKA 2RHGA 4XD4A 2YDQA 4K6AA 2DT2A 2GYIA 4PL1A 2QJGA 5AHLA 3L4XA 5JQ9A 3NR0A 5I6SA 3VFLA 1GUVA 4R9XA 4FF7A 1VLWA 4AIOA 2A3EA 1F9CA 1S2CA 1XLDA 3KEHA 5HPCA 1FWIC 3B0YA 1HNYA 2C18A 4RNIA 1DQXA 3DKJA 5A6BD 5D4YA 3FEQA 2BX7A 2PTDA 2XSXA 3SQLA 3U0HA 1W9BM 4RJEA 3B8DA 1XC4A 3EWUA 3AS0A 3QOMA 1QTWA 3W83A 4FXRA 1EL3A 1GW9A 4GZJA 2VC6A 1E9LA 3TJLA 3HV8A 3UWQA 4QTGA 2VDIA 4P8WA 4HMEA 1I2OA 2YXOA 3ITOA 4LOCA 4QE5A 2YX0A 4JIIX 7REQB 5LZLA 2HISA 4NZ3A 1A3XA 3BO9A 3K5XA 3AHTA 3BGAA 4F0KA 2V3EA 1XYZA 2WCGA 1KXVA 2HWGA 3G1AA 3OB8A 5AC8A 3LPFA 1UOKA 3WJSA 3R94A 4FS9A 1E1EA 2P8CA 2ZXDA 2VX5A 5EMJA 2DGAA 3PBWA 1RCOB 4GXPA 4JX4A 4UTLA 2VZOA 4AX7A 4HNUA 1MXGA 1XH1A 1DYSA 3VZYA 1W8SA 2Y61A 1MUCA 3NQ6A 3AYVA 2A3BA 3NSXA 4H3DA 4Q8TA 1D3GA 3UZYA 1R6WA 1QOQA 1I6NA 3HURA 3TCSA 3CIXA 3F5JA 3LBOA 1H7OA 1LUCA 4UTJA 3SQMA 3S83A 3VX1A 3TTSA 2IXVA 1TO3A 2PDCA 1FWEC 3SECA 4TMCA 3KBMA 4H6QA 3VZZA 1Q7MA 3LSCA 5DXXA 5FJJA 1M65A 3OBAA 2H6RA 1UD8A 3FCPA 1WP6A 3RN6A 3ZQ9A 2GVLA 4Q4RA 4W5ZA 3PFRA 3EX2A 2TSYA 3FJNA 4GWEA 3LQLA 1JI2A 5H2ZA 1GKRA 1PV8A 4AD1A 2WJEA 1S1RA 1ZFJA 3GG0A 1P48A 5A8GA 2VYOA 2EG7A 2C6QA 2UY2A 5JVLA 2RDTA 4I7UA 3G22A 1DIEA 2PTYA 3AS2A 4ZTYA 1BVWA 3SCQA 2EEXA 5C2GA 2QPSA 1ME7A 3OHMB 3N29A 3LTSA 4XIAA 1HIZA 4KESA 2Z7KA 1ME8A 1TX2A 3KZSA 2XIJA 2VTFA 4N4PA 5I23A 1XUZA 3BOXA 3RYSA 4KW2A 4GYPC 3E96A 2J79A 2C91A 3MP4A 1FCVA 3SCRA 3ABOA 4UIOA 2P0OA 5HNTA 2BHYA 4U31A 4DWSB 2FDMA 4M1BA 3NGJA 4C1LA 1E40A 5JBFA 3G6MA 3V1PA 2PDPA 3NQ8A 3QKEA 1T8XA 3IAQA 4G2DA 1BWLA 3SY5A 1T8QA 3GTIA 4XAPA 1QT1A 3NEHA 4O11A 3AZSA 3DGBA 4H7VA 1FFQA 1XM3A 2VEKA 1B2YA 4MLJA 3CV2A 1ZCCA 3DFQA 1KW1A 1VGAA 1TV8A 1A3HA 2EPMX 4DBSA 3FJ4A 1YE6A 4GXMA 3WD0A 3BARA 5EY5A 4GUHA 1UA3A 1EO7A 1AW2A 2QUTA 4IGNA 1DIOA 3FXYA 6TAAA 3VCRA 1GNXA 1QNPA 4Q8UA 1WPCA 1G4PA 3O9NA 4PBEA 2CKRA 3WQ5A 3OVQA 4IJBA 4U4MA 1OF8A 2EPNA 4H83A 4GUIA 1THFD 4X9YA 4ECLA 1PX8A 1HKIA 3EX1A 1SZRA 4JTRA 3CWNA 3NIYA 1G0CA 4HCLA 1KFWA 2NX9A 3I4EA 1AQHA 2CZVA 4XAGA 1X6NA 4C1NB 3QM3A 3VPLA 1RH9A 2VC7A 3NO3A 3B03A 3TW6A 2HMCA 2UY4A 3EA1A 3ZT7A 3BSHA 4JIQA 2YW4A 3GU9A 3LYEA 1C7SA 1TV7A 1UKOA 2E6YA 5DQPA 2PCEA 2WSYA 1S2UA 1HZYA 3DX5A 1XIMA 2YCLB 5FCZA 1E56A 4WXZA 3QMTA 3DESA 3L0NA 1ODUA 1R9YA 4HU4A 3DFSA 4A6GA 5M2FX 5EB8A 4B2DA 1W0MA 1RPKA 2CEQA 4JTEA 2CBIA 1RK5A 3KM8A 1Q6DA 3KL0A 3N2CA 1Q6GA 4TTGA 3BDKA 3UA3A 4LUIA 2E09A 4UTFA 2F84A 3QSTA 1KFBA 1OFEA 2A3CA 3BCDA 3GKFA 2CLLA 2ZRUA 2VEMA 3NDOA 1C29A 1BG4A 5C9WA 2DDXA 4WRHA 4WDXA 1ZP4A 4O52A 3ZSTA 6ENLA 1NP2A 4PSPA 3KOXA 1V0LA 4LWWA 1XIFA 4G5DA 3S5NA 4HBKA 1S46A 3TQ0A 3PP7A 3LV6A 4JKKA 4WVXA 2PA6A 3CU2A 4NI8A 4Q32A 3FYYA 1B3ZA 1OX6A 5LKYA 3W76A 2PDNA 5K7JA 4N6EA 2ZZ5A 1JUKA 1WXJA 4AB4A 1JRCA 1W1B1 1UB3A 2BFGA 3MBDA 5A8PA 1VHCA 4NG3A 3PBGA 4BI7A 4PBFA 4BQ4A 1I0BA 9XIMA 1PB0A 2CBVA 3N2OA 3OBKA 3SRKA 8CGTA 4AAJA 1V77A 4MFDA 1I0DA 4JY8A 1IT8A 1J9YA 2F9RA 4E2BA 3RPMA 2QDGA 1UWSA 3VMPA 3VE7A 4J2MA 1Q6RA 1W2VA 3QEZA 2PDYA 5CG7A 4ZSUA 3MQTA 3C2FA 1GCYA 5AYZA 1IF2A 4ZO6A 2ZRZA 4NHVA 1CXIA 2X1IA 1YHTA 4HK5A 4CVUA 3U7BA 1TG7A 2I14A 2IKIA 1MNZA 2OKTA 4UNKA 4DF0A 2R1PA 1MW2A 3HQOA 1X38A 5G2WA 3BAXA 4ZB0A 4IFKB 3UZWA 1CYGA 2D20A 1IR2A 3W38A 4AXNA 2QMKA 1OF6A 3MMWA 4I7VA 1IT0A 5E0CA 1OSEA 1P0EA 1MMFA 1TUFA 1EH9A 4C6NA 3CASA 1UH4A 2VO5A 3H6OA 5I3IA 4LBSA 3W1MA 3D5HA 4HYVA 3RIKA 1H09A 3UR2A 3S9IA 1T99A 4MNJA 2OYLA 2QJMA 1KWGA 4M29A 1SQ7A 2VC5A 3ITCA 4AWUA 1TWDA 3DHFA 3LK6A 4M80A 4KS0A 4PRRA 4AD4A 4XX6A 3OVGA 3WUEA 2EXOA 1WKDA 1OHLA 1YNPA 2XIOA 1RP8A 2DZVA 1NDWA 1ADDA 4I3GA 1S2TA 5EBAA 4U2ZA 2BS9A 1HTIA 2DSUA 1MZHA 1GONA 1LOLA 1WZLA 7ENLA 3UJFA 3TAOA 3HPSA 1JVNA 3WDJA 1EDGA 3ZJKA 2QJNA 1AL8A 1EJRC 3QBUA 1P0BA 4GCXA 2VURA 4GBDA 3U4AA 1IZCA 1TZ7A 2VHLA 4D6HA 3F4DA 1JQXA 1KCLA 3INPA 3EDKA 1KFLA 1JCYA 4ERIA 3N13A 3EOUA 3V0SA 5LXXA 4D6IA 1UD4A 3U6WA 3BG5A 1T96A 4KFOA 5AB3A 5D2WA 1W32A 1RY0A 4ZENA 2ZZ2A 1MEIA 1XQLA 4UB9A 1MZRA 2OX1A 1ITUA 3JW7A 4MTVA 5HMFA 2YCEA 2WXDM 3AI0A 1Q2SA 2ISDA 3DUGA 5E9AA 3MUXA 4TOQA 3QPZA 1UPMB 2X7WA 1CGTA 3R4IA 1SM9A 3E2VA 3CQ0A 1GQJA 3B8IA 4PMDA 3FX4A 2Z6IA 1NU5A 2RGLA 5JMUA 5MF5A 4RL3A 2J74A 3DXIA 1HF6A 2H9AA 3WH5A 1JUBA 2I9EA 3APTA 5KMYA 3J7HA 2V9DA 4HMDA 1BTMA 4W84A 4ZFMA 4G7EB 4NJJA 2BWGA 1JULA 3O6DA 3T42A 5I78A 1XXXA 1DOSA 1W1ZA 4FLSA 3VKCA 3DFPA 1TR9A 2Z27A 1T7LA 2YZRA 3RX4A 1JZ8A 4MHBA 1NARA 2BBFA 3AWOA 1R87A 2RH9A 3BW2A 1GQIA 3BE7A 3CBWA 3KP1A 1W1YA 4UFLA 1YDNA 1GT8A 3GC5A 1XL9A 4UCGA 4GZIA 3CIWA 5AY7A 2VR2A 5A3HA 3NUKA 2QIIA 2VX6A 5HULA 4F3HA 1S2AA 1DPMA 3T07A 3QR3A 3EXTA 5IRPA 1TTQA 3H8AA 1Z32X 5MKGB 3WQEA 2PDMA 2YXGA 3W25A 3GNNA 4YHEA 3VOCA 2F6KA 1P6CA 5AC7A 3POHA 2PF0A 4K8EA 2OT0A 4WDUA 5AC6A 5C9XA 4TIMA 3A4WA 3IIPA 4P2VA 3GXMA 3T6CA 4HP5A 3TFXA 3ICJA 1XLMA 3HB9A 1CXHA 4B2DD 1XINA 2IMRA 4NX0A 1YYAA 4O8AA 9XIAA 3BWWA 1K7FA 2OT1A 4M7TA 5H1WA 5DFAA 3SCNA 1AQFA 4QSFA 4JIHA 4DBEA 3BLIA 4GUGA 1PKNA 4H1ZA 4UQAA 4NP7A 1ZRQA 5D37A 3B8WA 1LT7A 1YXCA 2OODA 1KM1A 3AMCA 2BGNE 3ZWSA 2AMGA 5A6LA 4NAEA 1W17A 1J4EA 1OGBA 1UD5A 4ZB2A 3FVMA 5I77A 3LV5A 4QJ5B 5IFPA 4GOAA 4RKAA 2WHJA 2I5QA 4XKMA 1M5WA 4HTYA 4OHQA 4O14A 3SIZA 3W6MA 2XWDA 1XRFA 3DI1A 4JOMA 1V6UA 2FFCA 4KPLA 3VGEA 5IXEA 3CAVA 1KBIA 1W9XA 1KRCC 3GNRA 3VI2A 1IZKA 1RR2A 3CV1A 3W53A 5F1UA 1VFSA 1NIUA 2PP0A 1TA3A 2Q8ZA 4WK9A 3OU8A 3RU8X 3IIXA 4WOZA 1I60A 2EJAA 1Q4WA 3EOOA 4HD5A 1XLLA 1QHPA 1LBLA 3A24A 2WSRA 2X41A 4B9YA 4RXGA 5FJOA 1RVGA 1Z44A 2Z1VA 3VFCA 3AXHA 1ZZMA 2XGIA 3RILA 4GJ1A 3NNTA 2NLIA 1FVPA 3WLPA 1ICSA 4M56A 3HTWA 1EXPA 2VCCA 1KA9F 4D2JA 4YS1A 4O17A 1VEPA 3NQEA 1AODA 3ABSA 2HPIA 3G6LA 4YCOA 1W31A 1FWWA 3O15A 1XJBA 1CT5A 1HN1A 2Y0FA 2NSOA 3BUVA 5DX7A 2VELA 2R1LA 5D05A 3E6EA 1FWDC 2E6AA 2R82A 5DBTA 1SJCA 1ADOA 1R3QA 2FHCA 1JDEA 5CBBA 1SJDA 4Q4KA 5BZAA 4BEQA 4GO8A 4ZODA 3KHJA 1POJA 5HA7A 3R7MA 5PTDA 1LF1A 4IICA 3VDCA 4FF5A 1JYNA 2V5LA 2E8YA 2A6NA 2QUVA 4XB3A 1SO5A 2GJLA 2V2DA 3PTMA 3ORWA 4IIBA 1W1VA 2PGWA 3XINA 4FNSA 3PPHA 1TELA 3E9AA 3SB0A 1RSCA 1ZL1A 2OKOA 2GJXB 3GIYA 2XUCA 4JTKA 3EDDA 3I7RA 4IHCA 4WUIA 1C90A 1ELSA 1DWJM 3MMTA 1YBQA 3EKLA 1NWTA 3EBVA 3V16A 4FO4A 2D0HA 3K8MA 4EAMA 1B57A 1GOWA 1E0XA 1W9PA 3KCLA 3WQ6A 2HNHA 1B54A 1XV8A 4L1XA 2NQHA 1A5AA 4AZBA 1OABA 4GIRA 3GVVA 3NQ7A 5JXQA 3KRSA 3TDFA 2OJPA 1RK6A 3DG7A 3WBXA 3VDHA 4TUFA 4UQBA 2XN1A 3WBWA 4X2PA 4DN1A 1H7WA 3UG5A 3WQPA 3LTYA 1VFOA 3QR0A 4NNCA 4ZO7A 3OEXA 3VMNA 3T0CA 1OQFA 4JQAA 4Q8OA 1VJZA 3CK5A 6ALDA 1T5AA 1N55A 4L4PA 4OJYA 1F5ZA 1QRQA 4TVUA 2C3ZA 1UPPA 4BY3A 3H55A 3SDOA 4L9ZA 1U5HA 4QCEA 2DFAA 4GQ0A 4MYXA 3S2LA 1K03A 4MNLA 3AIVA 5DEZA 2D22A 4B3LA 3OA5A 3CUGA 5A5WA 1VPYA 3WFLA 3VXGA 2RAGA 1ZY9A 1N82A 3IUIA 1RUSA 3L0GA 1BHGA 4HZ7A 1P5BA 1R3TA 1ZENA 2J8FA 1X1NA 3HG5A 3K46A 4HU8A 1IWPA 4C60A 3V36A 3TZNA 2PTWA 3TW9A 1AG1O 3N17A 1MQRA 4NAFB 4PUJA 3LLXA 2PGEA 5HJXA 4FHAA 5E93A 4ZSTA 5AECA 5LNRA 4QNEA 1OT2A 3HF3A 3GB6A 4HKPA 1AZ1A 3AICA 2Z2UA 1NWRA 4QG6A 3WMCA 2PDKA 3GLCA 3EPMA 2EG8A 3C8NA 2X30A 2BLEA 2C71A 2G0WA 4JCMA 3ITTA 5A8NA 4XSMA 1BG9A 1QW9A 1ZGDA 4B5NA 3QPEA 3TSDA 3U7VA 2INEA 3T4CA 2CC0A 5C2XA 5CLTA 4I7WA 2VRQA 1GOMA 2PDWA 1P6BA 1EC8A 3S46A 3TR2A 2P76A 7TIMA 4LBUA 2A3LA 3IPWA 5FOOA 3UQNA 5FESA 4JY9A 3TCEA 4HN4A 4KCUA 4DO7A 4KRUA 1KM2A 2B7PA 2QQ6A 4YWSA 3UY7A 5EU9A 1PXGA 4JX6A 3EPOA 3H4WA 1OCJA 1FWGC 3BLOA 3ERPA 3MI6A 1GVFA 2XFYA 1WV2A 3I7SA 1JCMP 4XWUA 5HR7A 3LPOA 3WK2A 2E8ZA 2R24A 2JALA 4GC3A 4Q8QA 4ASTA 3CMFA 1F3WA 3L4ZA 4IP5A 4RNFA 3UXDA 4OQVA 3VNIA 3M0KA 4N9EA 3WQWA 3HFTA 1Q6QA 1YW1A 3APYA 4DYKA 4C7DA 1UZDA 3K2GA 4QX4A 1KFJA 3ABZA 1VBUA 3PVFA 3W7OA 4YN5A 3PZGA 1NF7A 4JEQA 3WNKA 3WJYA 3B4UA 2JE8A 4DHGA 3R11A 3TTYA 5H8PA 1NM9A 3DG6A 5FSEC 3EOLA 4DJEA 2OLAA 5FKYA 3H7RA 1VYRA 5LNVA 1TCDA 3STCA 3N73A 3NZPA 1R3SA 1BSIA 5CZKA 4DWDA 1BPLB 1L6WA 2PDIA 1TPUA 5TBOA 1VEOA 2GQ8A 3BPWA 3CIVA 3AUOA 1R2TA 3EA3A 3BW4A 1MFUA 4L56A 4Y9PA 2A4AA 1E9ZB 1KRBC 4YU1A 3SFKA 2DZTA 2ZXAA 3WQOA 2HVOA 3OLEA 3DEQA 1QU4A 4CQ8A 2CLIA 1AMKA 4Z1BA 2G8ZA 1YDYA 2AL2A 4C6FA 1PJ9A 1B4KA 1BXBA 3AHXA 4KRTA 3R0UA 4RDYA 4B90A 3FV9A 3DFHA 4GUFA 4WKAA 5GJMA 1HKVA 1TJ1A 3TC3A 4PTWA 3W7PA 3VNJA 4EVZA 2FQIA 1Y5WA 4JL2A 1VD6A 2NV2A 5HQLA 1JI1A 1UP0A 3LHVA 3EKZA 1BWKA 1AL7A 1HKMA 6XIAA 3AIBA 1AUSL 3A5FA 4K7YA 1W3JA 2PDGA 2Z6JA 2VFDA 2VGFA 2PD9A 3MHGA 4Y9MA 2PF8A 2PPGA 5B80A 2ACRA 2WWDA 3MUY1 1LUCB 2ZZ1A 3OQ8A 5FF2A 1F4AA 2AL1A 3SADA 3KAOA 4HYRA 2C0AA 4DZIA 3NL5A 1FTXA 3F2CA 4JN8A 2DQWA 3RCYA 4NL1A 1RJQA 3KXQA 5CEWA 4BKNA 1SFLA 3C2EA 1FH7A 2ZFAA 5CZ0A 4DUOA 1V3KA 2CERA 3R1ZA 2G37A 3MJYA 7ODCA 2R91A 1I45A 2E9LA 3GYEA 3T81A 1AQ0A 3RGTA 1JFHA 3VD3A 3CLMA 2HZGA 4G8TA 3PWGA 4LUSA 2G3FA 5DCEA 4JKLA 1OCNA 4ZOAA 1FWRA 3QGAC 1C8YA 1B3XA 5T9CE 2SFPA 1DIDA 3GTHA 2NQ9A 1OD8A 4Z2KA 3QW3A 3W88A 3XISA 1Q2RA 4XKYA 5J8LA 3TX9A 3S5SA 3MANA 1OB0A 4M82A 3QH2A 1EZWA 3UBPC 1XIIA 3OLIA 3H54A 3O6CA 1KLYA 2OGYA 4LF2A 3TOYA 2G50A 3WNLA 1H7XA 4GABA 2P88A 3GS6A 1FDJA 1LTDA 3CUHA 3QXBA 2C14A 4WD0A 3M4HA 2F2HA 3BH4A 1TWZA 1EHNA 1TYGA 2WHKA 4IIHA 1XHGA 2QGYA 2VDGA 3LRKA 1AZ2A 2Y8KA 4W7UA 4DYEA 4D6EA 2ON3A 1ZJAA 4Y6GA 2WCSA 2DH2A 1R30A 3ECQA 1J11A 1MEHA 1XLBA 1Q13A 1O5KA 3TZFA 3GH5A 3HN3A 4LYQA 1GWJA 2DU2A 1YIXA 1A5CA 3IS4A 3LLDA 5JUVA 1QJWA 5D2XA 1O7AA 3W27A 2PAJA 1I2QA 2BMBA 4AMCA 4LVBA 4FAMA 1Q85A 1JZ3A 3WFAA 4GFSA 4AFYA 1UKQA 2GUUA 5H91A 3MP3A 2JGQA 1EUNA 3CUIA 1OCBA 4JYDA 3BL3A 5F2MA 4CD7A 1K1DA 1JR1A 1AFSA 4PZVA 3SEPA 3TYAA 1J18A 4F9JA 1ITQA 3SUVA 1V5XA 5AYBA 5CAKA 4IP4A 1ZHAA 3Q37A 2CZEA 2VUYA 3WLNA 2J7GA 1EB3A 4W8AA 5FD0A 4HOWA 1KGWA 3AU6A 1JDDA 2YLLA 4WJ8A 4P7RA 2RJHA 4D6DA 1M53A 4K8HA 2VGIA 2D1ZA 1XFCA 1E6ZA 4PMRA 3FA4A 2E67A 3N3MA 2EPLX 1OD0A 3W2LA 2I7GA 3ZVHA 2J7CA 1REQA 2WZIA 3CUZA 4KWVA 1ICPA 1E9YB 2VL4A 3CAWA 1XIBA 2J47A 4CEUC 1Z42A 4H6EA 3MA8A 3N1AA 3M64A 1EZ2A 4E2VA 2HXUA 1HGYA 3G0XA 2X7VA 3P80A 4ATDA 4LT9A 3W87A 5D8ZA 1HL8A 1VFMA 3LHUA 3QY7A 4LVDA 3KS6A 1PYFA 5BWAA 2J9XA 4QJ3B 4HA3A 1OFDA 2ZRXA 1VFFA 4RNHA 3SUUA 1CNVA 2WVSA 1GZ1A 4PMJA 3WLHA 4DELA 2WW5A 3BAYA 2P1FA 4Z2HA 1I2PA 1HKKA 3N2TA 5IHSA 2ODOA 4P61A 3EEZA 1HFBA 1NOUA 4RDWA 2V69A 2X1RA 4JYEA 4NNBA 1JNDA 4EPKA 4NZJA 2E7FA 3T09A 5DMMA 4DJED 1KM6A 4C6BA 3IACA 3OG2A 2OQHA 3CYJA 2VQUA 2PDBA 2ZX5A 1GTHA 3VX0A 2WZMA 4FALA 3NA8A 3G18A 2W9MA 3TYEA 2PWDA 4BQ2A 5CPLA 3GSMA 5E6YA 4PODA 2Q09A 4B5VA 1VBJA 1HUVA 1WDWA 3VDBA 4NY2A 4NRSA 3NWRA 3KOFA 1TWWA 4ICNA 3TSBA 1OCQA 5HWNA 4FLQA 3SSJA 1MO0A 4D1JA 3URNA 3VO0A 4UTIA 2ISWA 4ORMA 2VMFA 3R43A 1N7KA 5E5CA 3NZQA 4KGLA 1F07A 4FOKA 4LS2A 4AWTA 2GPTA 5HXMA 3VIGA 4LX4A 3O06A 1JXKA 4MJMA 2Y8VA 1XDLA 2QCLA 1QO5A 1H63A 4K8GA 5FEPA 4IISA 3GXFA 2CETA 3OGSA 3ZVIA 5JBDA 3CUXA 2EHHA 1CXKA 3R8RA 1FWSA 3IIOA 1BSLA 3M0IA 4XBJA 2J78A 1HT6A 1HJQA 4J3XA 5CGQA 2A7PA 3GG1A 1Y0EA 1Z6KA 5HNNA 1UR1A 1P7TA 3MP5A 2A0NA 3LGEA 3I68A 4OFCA 3G5EA 5BYWA 3QHNA 4OUEA 4AF0A 3KVMA 1GG1A 2HK0A 3OZOA 3QN3A 4JN6A 1WCGA 2FZDA 2PDXA 4O15A 3G1XA 1CLKA 1VRXA 3PBYA 3W85A 1UWQA 3W73A 1EO5A 1XSIA 5LSMA 4AWEA 3O07A 2PRMA 4P7OA 3HMJG 2GJNA 1Q6LA 1H41A 3DHPA 3VYLA 1BRLA 2NQLA 1RBLA 2C13A 3AYTA 1UW9A 2WMGA 1H50A 1XQKA 3RNDA 4PMQA 4DNMA 3RO6A 2C1GA 2DIJA 3O05A 5EMUA 4JCLA 3L2IA 1JQVA 1OX5A 4DPQA 1TZZA 1K8YA 1E6PA 4MJ4A 2WC4A 1WDDA 1ITXA 3XIMA 2P5NA 1LCOA 3W07A 3O6YX 4AMAA 3ANUA 3GK0A 1D3HA 2IW0A 2J77A 4UQCA 3C0LA 1DWGM 3L5AA 3PS7A 2J24A 4DZHA 1UOZA 1LRQA 1O4UA 1WB0A 2XDFA 4JTIA 2E9BA 4BFAA 3B8UA 4OBRA 4PMNA 3ALGA 3EA2A 1TVLA 1XCFA 2F7FA 4FX7A 3EX4A 1V7YA 2HBVA 1HX0A 3PJTA 5ECUA 4HB7A 5I06A 4KWUA 3TC7A 3MUCA 1CLXA 1L2QA 3A3HA 4H01A 4XAZA 4AD0A 4GQQA 4ZZ9A 3PZOA 2Z24A 4S3EA 1DL3A 1G69A 3ARUA 3BURA 3W2JA 2L5HA 3THUA 1EEXA 3BG3A 1V3IA 3F1QA 3NM1A 1W9DM 4HZ6A 3HPXA 4IUGA 4FIRA 3SCWA 3H2CA 3S5OA 4JHMA 2QJIA 6A3HA 3M0JA 2ZWZA 2XIIA 2BVTA 3DHUA 3H2NA 3P5ZA 1OZMA 1L8NA 3MYOA 5FEXA 4AY1A 3LCIA 1CECA 3W1LA 5HOSA 4IQEA 2H9AB 2WMHA 1YE4A 2V38A 4CD8A 3L4YA 2QHAA 2XTKA 3W7CA 1JZ6A 3R89A 3M0YA 2EJ1A 2IS7A 4ZOBA 1TRIA 2RDWA 3G1YA 3IJ7A 4S2CA 1DHKA 1QVBA 4RPQA 3GTXA 2VD9A 3S6DA 4NKCA 5HMEA 3N3TA 1UR0A 3OGVA 3IARA 4Z1AA 3AAMA 4F40A 3B9DA 8RUCA 2X0YA 1PAMA 4LCRA 8XIMA 4IH3A 3OVPA 3ISIX 3HMCA 3VD9A 1A5KC 4A3UA 3T44A 3PPFA 2R1MA 1E3XA 4UTWA 2GQAA 1IQ8A 2BOEX 3RK8A 4PSRA 3GKAA 5EMKA 4WX2A 4ONVA 1DTUA 3MC5A 4HZ8A 2VCBA 2XGZA 4L4MA 4MAZA 3M7WA 4GISA 3T7VA 4FSAA 3RR1A 3DENA 4X0NA 2PDUA 2GVGA 1OFPA 5I07A 4GINA 4AIUA 3TW7A 4W9TA 3H7UA 3H23A 3E0FA 1E4IA 4MWAE 4PMUA 1QPKA 4FR1A 1UROA 3PTKA 1CGYA 4IX2A 4K38A 1J01A 1BWVA 5CPTA 4Z1YA 4C6JA 4LY8A 3S9ZA 3ZR5A 4NI3A 1QBBA 2PGRA 4H8UA 1E0UA 2E68A 1EP3A 3PWAA 1L6SA 1VEMA 3LSBA 1PWMA 2YW3A 1FFRA 3PWIA 4PRTA 1W3NA 1DKWA 2OYMA 3I6RA 3NVTA 3H70A 3D3FA 4NILA 4S3KA 1WKYA 5BXSA 2QCDA 1MW0A 5TAOA 1DV7A 3LENA 2XVGA 3A3WA 4AZ7A 4M6PA 5CPQA 3NSMA 4JTLA 5J5RA 2YCIX 3K1GA 1O60A 1GPWA 4PMOA 4FLRA 3SIMA 1PTDA 3TWAA 5CLWA 4M51A 4UTTA 1TA3B 4S3JA 1QI2A 3KL3A 4ES4A 2H3DA 4N9BA 4N4QA 3VGGA 2ZA3A 3WBEA 4XZWA 1OVDA 1FA2A 2KZHA 3K4AA 4E8GA 4HHPA 3PN8A 3W1NA 3P82A 5HWJA 3WMBA 1S5VA 2UZ9A 4WY0F 3WYZA 3TK7A 2JF6A 1AK5A 3E12A 1DJQA 4B3ZA 3NQBA 2XHYA 3N11A 1WQ5A 1OIFA 4KCVA 2NWRA 4LVAA 3WELA 2CLPA 4M5PA 1Q7QA 2PU1A 4GVFA 2NV1A 1EP2A 1AH3A 1XLAA 1V03A 3SQSA 1M7XA 4UOZA 2VJXA 4C1KA 3SJNA 4DX3A 5CCZA 2DUXA 1W5MA 3SCUA 1X6LA 3CZEA 1F3XA 1U5JA 4NXKA 2W66A 4UFJA 4RK8A 1PEZA 4AVNA 2H8XA 2GK1A 2RUSA 2WLYA 4MZ1A 1L9WA 1AQMA 2P3EA 4LW7A 1P1XA 1B31A 4LC6A 3A9IA 3ITGA 4WJXA 5D2YA 1XSJA 1WXYA 4HCDA 4REQA 2WJDA 2FYMA 4FX6M 4C90A 5DY3A 5JBEA 1PZ2A 4PH6A 1EP1A 3M7SA 2YR1A 3OVRA 2ZUWA 3JZEA 4RE2A 3TTQA 1GHRA 1POKA 2PRHA 3AMDA 3KBNA 4WDWA 4HCHA 1W1PA 3R8GA 3WF1A 1GKPA 4GIYA 3DHDA 1YBQB 3PSVA 1W3LA 3PZMA 4M3PA 1JGIA 3W2KA 4F0LA 1GOXA 4DY1A 4ZA0A 4XBSA 2EBNA 3SSZA 3LBCA 4MPQA 3CT7A 4DJFA 1OINA 4NXSA 1LG1A 3W2MA 1A50A 3RMEA 3CWOX 4OBTA 4I8YA 4UTKA 2ZTJA 3WF0A 2W0UA 4FX8A 3V7PA 2B7QA 1ZQ5A 4OU1A 4UBPC 1TPEA 3AS1A 1JDAA 5GVJA 4Q3MA 3VIOA 3M0ZA 2FTYA 3V4BA 2PDQA 3CO8A 2PTXA 4PL2A 4DAIA 4LH8A 4GNVA 1M7JA 3ANYA 1HW6A 1W8GA 2FHBA 3VKBA 1H2JA 1YDOA 2TRSA 4L1WA 2XVPA 1M6JA 1WUFA 2XFWA 4A3QA 3OODA 4PUEA 3KRBA 1FY6A 2Y5JA 1K9TA 1JUEA 3BMVA 2Z25A 5REQA 4ZR8A 5CKSA 1QI4A 4Q22A 2ZXBA 3THCA 1C8VA 1XCWA 2E5DA 1TCMA 1O5RA 1T6MA 3KOWA 2NQJA 2DPEA 3A23A 4C6QA 2ZC8A 2V82A 3LCXA 5BOOA 4JICA 1P0DA 3IAPA 3M1ZA 5FF4A 1TJPA 3UWZA 1S3TC 3UETA 4B5UA 5AYXA 1VJIA 3THAA 3TOPA 2O4MA 3LGGA 4CQBA 1Z69A 3EX3A 3WJWA 5EYWA 3TQPA 5LGZA 3YPIA 1EWEA 2ZWYA 1OGGA 3CYVA 2D69A 2XINA 3R12A 3ZIZA 5K9XA 1MNSA 1EOMA 4GPNA 2WJFA 1TTPA 2PCQA 1QW7A 3R79A 3USBA 1JCLA 2YZ5A 1AMYA 1H62A 4GH3A 1DQUA 4IIEA 4V27A 4AG0A 4DBWA 4PULA 3WD2A 2OQLA 1L6YA 3AALA 3S2NA 4JTCA 4DUWA 4UMAA 3KRZA 3WL0A 4ICCX 1F8IA 1DJNA 3JUGA 3WH8A 1EF3A 3TXZA 2OEKA 4OOUA 1Q45A 4WHBA 2OCZA 2BXVA 3Q2DA 5E0KA 1K02A 4O4WA 1PZ1A 4AC1X 2XH2A 1E3ZA 1S5TA 4FMVA 5HNRA 4KGJA 1V6VA 3C3NA 2NVAA 2WB5A 2B81A 1J0HA 2XJ7A 1TB3A 2I17A 3IK2A 3CTTA 2QF8A 5C0QA 4Q4PA 4E3TA 4IQJA 1BXCA 1TX0A 3RM8A 3P74A