3FA3A

Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, trigonal crystal form
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
301
structure length
301
Chain Sequence
PMVTAATSLRRALENPDSFIVAPGVYDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRCGHLAGKILVDTDTYVTRIRAAVQARQRIGSDIVVIARTDSLQTHGYEESVARLRAARDAGADVGFLEGITSREMARQVIQDLAGWPLLLNMVEHGATPSISAAEAKEMGFRIIIFPFAALGPAVAAMREAMEKLKRDGIPGLDKEMTPQMLFRVCGLDESMKVDAQAGGAAFDGGVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of 2,3-dimethylmalate lyase, a PEP mutase/isocitrate lyase superfamily member.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Lyase
molecule keywords 2,3-dimethylmalate lyase
total genus 111
structure length 301
sequence length 301
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 4.1.3.32: 2,3-dimethylmalate lyase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3fa3A00
2OLSA 1DQUA 1JDEA 4L9YA 4B5TA 3BJFA 1O66A 4RPPA 2V5JA 3I4EA 1E0TA 1VBGA 3HQPA 1IGWA 1F8IA 4LSBA 4L9ZA 1PKLA 2KX9A 3GG8A 3ME3A 4QGCA 1XG3A 1UJQA 2ZE3A 1U5HA 3PUGA 3EOLA 4TV6A 1KC7A 4KCTA 3EZ4A 1T5AA 1M3UA 3QLLA 4HYWA 5TAOA 1SGJA 3LG3A 1KBLA 2HROA 1AQFA 2WQDA 1F3XA 4L7ZA 4QG9A 4WJ8A 1O68A 2XZ9A 4TV5A 4MG4A 1DIKA 3E5BA 3BJTA 4B5SA 3VAVA 2X0SA 3OYXA 3M0JA 3QTGA 4KS0A 1S2WA 4G1NA 3OYZA 3IS4A 1OQFA 3U2ZA 3EOEA 3KTXA 1DXEA 2G50A 2VGBA 1A49A 3T05A 3SRDA 1F3WA 2VGGA 1A5UA 1DXFA 3B8IA 3R4IA 2E28A 3FA4A 1O5QA 2XZ7A 3SRHA 1A3XA 3QV6A 3HQNA 1Z6KA 4QG6A 4B5XA 3QV7A 4YNGA 2QIWA 4IQDA 4B5VA 1VBHA 3PP7A 4B2DD 2VWSA 4KCWA 2DIKA 3H6OA 4HYVA 3N25A 2R82A 4FXFA 1M1BA 3KHDA 4B5WA 4ROQA 1S2TA 3FA3A 4L80A 2XDFA 1ZJHA 4KCVA 3QV9A 4B2DA 3GQYA 3E0VA 2VGFA 3SRKA 1XG4A 2BG5A 1PKMA 1F8MA 3QV8A 1S2UA 4FXJA 2V5KA 3QQWA 4IP7A 1OY0A 4KCUA 4B5UA 1GGOA 3M0KA 3G2GA 1E0UA 2HWGA 3MA8A 3SRFA 4IQEA 1PKNA 2DUAA 4YJ5A 1PYMA 1IZCA 2HJPA 3T07A 1S2VA 3EOOA 3HQOA 2VGIA 1A3WA 4QG8A 3GR4A 5JVLA 1F61A 1ZLPA 4DRSA 3QZ6A 4MF4A 3P0XA 3E0WA 3T0TA 4IMAA 3LYEA 4KRZA 1PKYA 2HRWA 1U5VA 2VWTA 1MUMA 3OQ8A 4JPGA 2L5HA
chains in the Genus database with same CATH superfamily
3FHAA 3FJLA 1JCMP 2VFEA 2E09A 3ITVA 1DJHA 2VEFA 4J5NA 5M5DA 3N15A 1TJ0A 1KR0A 1LJYA 5LA0A 1X97A 1EJXC 1UD5A 1O1ZA 4S3GA 3L2MA 4ZOEA 4N2YA 3R79A 1JXJA 3QHMA 5B7ZA 3KCOA 1BHGA 4IQLA 3WFLA 3CQ0A 1CLKA 4O54A 1ZSXA 2F2KA 1TZ9A 5U4NA 2WQDA 1K9EA 4HNUA 4D6CA 5KMYA 4H3DA 4BWLC 4K38A 2FGZA 2DPEA 5CCZA 3N12A 2ZRXA 1X6UA 4Z0SA 3V7PA 1UD8A 1FXQA 4B3LA 1B57A 2PBGA 3R12A 4W7VA 1F3WA 2DSUA 3O2LA 1MUCA 1WXYA 4HMNA 2GPTA 3ARZA 2J4GA 1JZ7A 4LBUA 4ROQA 4MMWA 4AZCA 1DHPA 2Z7GA 4ZOAA 3TJXA 4LW7A 2QDHA 3SY8A 3HN3A 2ZX8A 4HNNA 6REQB 3F03K 3I7QA 2DQXA 1UA3A 3NOEA 2C13A 3MKCA 3MUIA 3TYAA 2VCAA 1KRMA 2GYIA 3KVLA 1W1TA 5E9XA 1K03A 3IIXA 1DEDA 4Q7BA 5I03A 4ZO9A 4FXSA 4IM4A 4IMAA 4EPKA 5A6MA 4DJFC 1YYAA 4Z2HA 2IQ0A 1TRIA 3W0KA 1XXXA 3WLOA 4OV4A 3SCSA 3FA5A 1M04A 4LX4A 3F4DA 2PLMA 2BXVA 1R9YA 2X41A 4GX9A 1G67A 3A3XA 4IG2B 3T6CA 2EO7A 3CEUA 2QJHA 4DO7A 4AZ6A 1Z9AA 5D03A 4DO6A 4DEFA 2V8ZA 3SCNA 3M9YA 4QIUA 3M1ZA 4NL1A 4DWSC 4ACYA 3B0YA 3G77A 1UKTA 4H9YA 1LOSA 3HM7A 3S83A 1XC4A 3L4ZA 5T9BG 4MLJA 4NYUA 1A0EA 4Z08A 4AD2A 4UMBA 3JS3A 4FF5A 4B2DD 4XAFA 5LIUX 2BVDA 2OLAA 4B5WA 1TPDA 5D09A 1UHVA 1W37A 4M81A 1H0IA 1YXYA 3VD9A 4PMVA 2Y8UA 1T6MA 1XIJA 2CBJA 3QV8A 4INFA 3FLUA 4O1FA 5K9CA 3W71A 1XCFA 4UCGA 5E6ZA 1ZAJA 3HJZA 2J7FA 3FNDA 1PX4A 3GH5A 1T0OA 4NRRA 2VDGA 2GJLA 4JTDA 4Z2KA 3VKJA 2Y7DA 1EGZA 4D6EA 2J62A 4O4WA 2ZVRA 4YTRA 2DZXA 1CBGA 2RAGA 3HURA 3KBNA 5EMMA 4Z1DA 3ZZ1A 2KX9A 1K8YA 2PBOA 4PR4A 1N8IA 1TA3A 2QCLA 4JTTA 1DWAM 2PDQA 2FQIA 1PDYA 4FNRA 3NO5A 5CLWA 1EO5A 3LHUA 3P0WA 6A3HA 5L9FA 1A3HA 2D0FA 4GUHA 1GEHA 2X1IA 1UCWA 3E0FA 5AVHA 3GXIA 5I5RA 3WLQA 1DIEA 1X1NA 4FPSA 1D7FA 4KGLA 2ZE0A 4AW7A 3WENA 5C8BB 4BZYA 2V5DA 1XYAA 3UWVA 1BGAA 1DJNA 3AXHA 3SFWA 3VNYA 4QDWA 2FH6A 3WUBA 2JK2A 4U5KA 3SCTA 1XLGA 2I5QA 3OZOA 4H8HA 8CGTA 4L61A 4MWAC 1NFBA 4D8ZA 2V81A 4AEOA 1LQ0A 1QVBA 3GXNA 3THAA 3FKKA 3W74A 1OB0A 3MJMA 3TTOA 3V1HA 1W5NA 3IRDA 3MU7A 3FXYA 3RIKA 4V2XA 3F7JA 3BK0A 4KRTA 2CCRA 2PDJA 4LF1A 2CLPA 4UTKA 3THCA 2CLOA 2VFFA 5D9MA 4NT0A 3B0UX 1Z32X 1GYNA 3B0XA 3MB9A 1RD5A 3ARUA 4H2HA 2A6NA 4OGZA 4R7OA 2WJZA 1QNSA 4CNSA 2Y62A 2F7FA 3U6WA 4HPNA 1F73A 1OF8A 5MKGB 3V0TA 2GUUA 4D6JA 3VKAA 8XIAA 4UQEA 4IF2A 4W9TA 4I9MA 1AW1A 4OKDA 4C65A 3UPWA 1MDRA 4MG4A 2X1UA 5F2LA 2EG8A 3QC0A 3WKZA 2CWXA 1EYWA 3QJAA 5XIMA 2VXNA 1AQ0A 3WLLA 5D37A 1YNQA 3HGSA 5J5DA 1A3XA 4MAVA 2R14A 3RM8A 1H63A 3D47A 4IFRA 3W6YA 4I7UA 3ARWA 3O1NA 4Q7IA 1PZ0A 1W9BM 4KW2A 4CEXC 4FNUA 3RX2A 4XBKA 2FTPA 4DYEA 2CLKA 3SRKA 5ABFA 1ESWA 4AZHA 1NJJA 3CQIA 4C60A 1GTEA 1E51A 3KL0A 2HWGA 3H7UA 2YFNA 3T07A 3T8QA 4JTCA 3W7NA 2EGZA 1F07A 3FSTA 2MUCA 1SZRA 4KEMA 3MSGA 1I2OA 5LKYA 4CNOA 4XVDA 1OM0A 1AJ0A 4GQGA 1PKLA 1CLVA 1GQKA 4E2BA 5J8LA 1HTIA 1U33A 3ARTA 2YW3A 3GVRA 2OOFA 3TFXA 1SGJA 3AXXA 3WNKA 2TAAA 1K3UA 3ZLGA 4DWSD 3AU2A 1J93A 4MJ2A 1VQTA 2GFTA 2VKZG 4JHZA 3WQ4A 4GIEA 3ZJKA 2XIQA 1I6NA 3N04A 3RK8A 3T05A 1N8WA 2OWXA 2GZXA 3TC3A 3LNMA 3BV4A 4IIBA 3O0KA 4UOJA 1UB3A 1LDCA 3B0VC 4EE9A 4CNUA 4WKFA 1EJ7L 3UD6A 3WLIA 1TVPA 3I7RA 3QR1A 3O3RA 3AHYA 4RE2A 4MFEA 5A8QA 5I3IA 3AXIA 4EIVA 1DVJA 4G5DA 3WDIA 1PYMA 2CLEA 2PRLA 1UR3M 3O6CA 4D6HA 1EEXA 4WJXA 2AL1A 2QJNA 4A2RA 2RDXA 1RJQA 3BC9A 1XH2A 2VC7A 1Q13A 3VOFA 1XYLA 1QTWA 1VBJA 4W88A 3GNPA 2EPHA 4GZIA 5LGZA 1QNPA 2ACSA 2CLIA 4JFUA 5CH9A 4ENLA 1QMLA 2V2DA 1Q3NA 2PU1A 2ESCA 5A6LA 2GUYA 2WW5A 1LL6A 3LZ5A 3QLDA 1GPFA 4R27A 4WHBA 2QQ6A 1TR9A 1XIMA 3MO7A 4UNLA 5C71A 2NX1A 2J13A 1OWQA 2V68A 1ENUA 1TQJA 6REQA 1IF2A 3MZNA 3MWAA 2TSYA 4D2JA 4Q6XA 1BFNA 4N9CA 4E3TA 4JNYA 3PSWA 1ZY9A 4UC5A 4GVFA 2C91A 2W3ZA 2OZTA 4JTSA 3CZKA 2XWEA 4HU8A 2A7NA 1HF6A 2XVPA 2GQAA 3O63A 2PPGA 3BSMA 4FLOA 3TA9A 4XVEA 3TSDA 2P76A 2DIEA 3V3WA 1G4PA 3E0VA 2BG5A 1O1HA 3A22A 4RDVA 4ZZ9A 3ATYA 4MTVA 5CKSA 3P84A 3VKCA 3LTYA 4JIRA 3ZR4A 5EKYA 3BCDA 5I3KA 3TW6A 1QT1A 2ATMA 3B4UA 3H26A 4IQEA 5GJPA 5CAHA 2VELA 1W1YA 4LCQA 1EBGA 1BXNA 4LY4A 3H4WA 3B8SA 2WPBA 3QSRA 5FJPA 3W1LA 3KLLA 1XLAA 2PGRA 5HUOA 4L9YA 3UG3A 3QQ0A 4XB3A 2YOCA 4XD3A 1X96A 3NQ8A 1HNYA 3W1AA 3Q58A 2IXUA 4U10A 1V6UA 2A3AA 2Z0IA 2YYUA 3K8MA 2DUZA 1HO4A 1O68A 4J2MA 4X22A 1XV8A 1N8FA 5FSDC 1U2YA 1BG9A 4MWAA 2P50A 3CWNA 3VZXA 1FCQA 3HMJG 2Q71A 5AYXA 4FK9A 2A7PA 1FA2A 4O18A 1UWQA 1XRFA 3CIWA 1JL8A 4NAFB 1CDGA 1HN1A 2RFGA 1CXFA 1ITXA 3W2MA 1W9UA 3ZSTA 4YN5A 4IMEA 4PH6A 2WVTA 1JAEA 3BCJA 4G9PA 4Y9MA 2WC3A 1VFMA 3C0JA 1R7OA 2ZZ5A 3OLIA 4OU1A 1JUKA 4M82A 1IXNA 2V2CA 2DQWA 5I00A 2P0IA 3TQ0A 1HP5A 1P43A 4I9TA 4AWUA 2VM8A 3CH9A 2DZUA 4OECA 3VC6A 2PTZA 4QBXA 4FAMA 1KRAC 1OFEA 3MP4A 1VHCA 3G24A 1OABA 2PTXA 1TR1A 3LCHA 4LSBA 2VC6A 3WJSA 3AIBA 1WYIA 4AB4A 4QLLA 4FZIA 3S47A 4QJ4B 7TAAA 2X30A 5CG7A 4NKCA 4I5XA 5AC6A 4NIRA 4DWSB 3UETA 6XIAA 1HJQA 1XISA 4JOMA 2XIJA 1IEIA 2HPMA 1Z44A 2G97A 2Y63A 5BXTA 1CLXA 1CGYA 3SIZA 3WD4A 2ZX6A 3UA4A 4BQ2A 3L7RA 2GGGA 1MNSA 3H55A 4X63A 4WCJA 4GQ0A 2V3FA 2RJGA 1RVKA 2ZUWA 1UUOA 1ISYA 4M24A 1JPMA 3UERA 1UKQA 1UOKA 3BQ6A 3KHDA 4TXEA 3AZRA 4WDXA 2XDFA 3N34A 2HZGA 4O28A 2DZTA 4XO7A 3PPGA 4NXSA 4S3FA 1DWGM 3W27A 1MWOA 3LTPA 1EWDA 5K3VA 1CENA 2NLYA 1HT6A 3CTTA 3DENA 5BROA 3R6IA 2NQ9A 1EX5A 5F2IA 1R85A 1FWBC 4J35A 1A0CA 3U3HA 1QI4A 2E5CA 1R2RA 4L4MA 4FNSA 4IWWA 4JTQA 4EXQA 4RE3A 2R6OA 4N6FA 4RZ4A 4NG3A 2KZHA 3T8LA 4IISA 2POTA 4UFLA 1EWEA 1AW5A 1EJWC 3CU2A 5G1MA 2J6VA 3GO2A 8TIMA 2V38A 1PHWA 1SO4A 4AWTA 3W87A 2OSXA 4JKMA 3G1FA 1OFAA 1V6TA 1WZLA 3I65A 2JEQA 3T44A 4LVFA 4WF7A 3TMLA 3I6EA 4OE7A 4CLMA 4JICA 5AN7A 1KTBA 1A5LC 4BI6A 2VHLA 1FHUA 2RDWA 3VIMA 1PX8A 5LNWA 3CGTA 3GNRA 4PCSA 3OZYA 3KOYA 1FWDC 2WMHA 5I3HA 2H6RA 1R47A 1ICPA 3XINA 2FZMA 2VFHA 1E6ZA 4YTUA 2QXWA 4GYFA 4TOQA 3SUVA 3PZIA 1JZ5A 2RH9A 3DFTA 2JBMA 3CL8A 1UBSA 3CHFA 4NZ5A 3IPWA 1NH6A 4DZ5A 1H7XA 2BXYA 1ZENA 4JTAA 4XUYA 1DTNA 3I68A 3N6QA 2Q02A 6TAAA 5CAKA 3BG9A 1DJZA 2PDMA 4M6PA 5A8GA 1R0MA 4LB3A 1KLZA 4O57A 4GLEA 3WF0A 2A21A 3KUMA 4XZWA 3Q67A 5A8PA 2OJPA 2ZX5A 1D3HA 1J0ZA 5DRIA 3RU6A 1F2JA 4QAWA 3EB4A 4ML9A 1TV3A 2CBUA 2DEPA 2NXGA 3WBWA 3HZ3A 5C7VA 4XAZA 1U1JA 3SRHA 1UBPC 1TMLA 1XWYA 1Z6KA 3VM5A 1NF0A 1ZUAX 3UZXA 4PE8A 3LCFA 3VUSA 4D6IA 4P61A 3T0AA 3SY1A 4H00A 5EFFA 3EMZA 4MKNA 1E70M 3NQ2A 2W67A 4N42A 4GXMA 5FL1A 3BOXA 1H5VA 3GIYA 3LLDA 4YMZA 1N7KA 2R1MA 2G3MA 4K7YA 1ZL1A 4M56A 4NF7A 3DAQA 5HNUA 1GKRA 4IGNA 1A3WA 3BW4A 1A5AA 1XINA 5I2UA 3EPNA 1S5TA 4IPIA 1VFUA 1XIBA 3G1DA 4ZB5A 3QPEA 3DYMA 3ISIX 3W7OA 1PZ3A 1MEHA 4FLSA 4CEUC 3CUFA 5JIWA 4NNAA 2PCQA 2YZRA 3C2RA 1O5RA 1VJZA 4CN6A 4NI8A 3LQLA 3WJWA 7A3HA 5KETA 3VVGA 2Q8LA 2D22A 3ABZA 4QG9A 4FS9A 2ABBA 3BW2A 5DMNA 2X42A 1TJ1A 4P8XA 4LCRA 4LJ3A 4Z2JA 3STCA 1JZ2A 4YS1A 1TELA 1W0MA 1ISWA 1H1NA 5BWFA 2HS6A 5DO8A 3B05A 3QFWA 4RX0A 1JPHA 1XJBA 4X0NA 4UFMA 5EB8A 1H3GA 4M0XA 4DX3A 2NV2A 1A50A 4LWWA 2JKPA 4PODA 1GG1A 4ZL1A 4FXRA 1IWAA 2CKSA 3ZT7A 1MW3A 1F8MA 4ZFMA 2PB1A 3C0LA 4LVBA 1D2KA 2GGEA 1PUDA 5JH2A 4U28A 1Z41A 4C1NB 2DT0A 1RK6A 3P81A 5G1YA 1XR2A 3B9OA 2C16A 3EX3A 1GZJA 4O15A 2HBXA 2PTDA 4LUYA 1PSCA 3MVIA 4AHQA 5AFDA 4N4QA 1OC6A 3CUGA 1SMDA 1RV8A 5CPTA 1JDEA 2QJGA 4O0KA 5BMWA 1M01A 4JIEA 1ZP3A 1RAKA 2XTKA 3BLFA 5JXQA 3PB2A 4RE4A 3UNTA 2O56A 4RDYA 3GDKA 5DY3A 3FVMA 3S9IA 4JDYA 3QGAC 1G1YA 1A5OC 4H41A 3S2JA 1KTCA 5CPNA 3E5BA 4QXIA 2E0PA 3VOGA 1XKJA 1OF6A 2ZRVA 4JTKA 4KH2A 3ZJ6A 3USBA 5J04A 3AS1A 2HXTA 4M6QA 3M6DA 4LVDA 3R0KA 3KTCA 3MTWA 4LAZA 3M5ZA 4RK8A 2VCCA 4D9PA 3FKRA 3DBPA 1NVMA 4F0MA 4CD5A 2FGBA 2DIKA 4XUGA 3S5ZA 2ISFA 1G4TA 1H1ZA 1GONA 1C7SA 1KO0A 2PD5A 2QF7A 2XJ7A 2Z6JA 1L2UA 1W2VA 3MKKA 4YHGA 1O6IA 1D9EA 1O12A 1HUVA 1Q8AA 3NL2A 4PCTA 1ZBVA 1VYSX 2PGWA 2VFGA 3SRFA 4ACZA 4I6VA 3C0SA 2Y61A 3L65A 3C0QA 3SO7A 1FWGC 2BGSA 1TWSA 4ADSA 2PE4A 3NQMA 2NSXA 3ES8A 1Y8BA 3R0DA 5DX7A 2QUUA 4S3AA 1CX9A 1OC7A 4YYFA 4C7GA 4GJIA 1SJDA 2F6KA 3TXVA 4QTGA 5E0KA 1UWAA 4F0RA 2NWSA 4MGGA 3WMCA 2QUTA 1KC7A 4LYQA 4TUFA 1YDVA 3W1UA 3P5YA 3WLNA 4RLIA 1E9LA 2GLKA 1T40A 2WMKA 4Q8TA 2YXGA 2PDIA 4TR9A 4EACA 1DKWA 4GO8A 3W81A 1DJGA 4DJDC 3DN5A 5LXEA 4DXVA 2HV5A 3B3DA 2C6QA 2JKAA 1JUBA 1SYTA 4N7QA 3R4IA 2YDQA 4PUMA 4XZBA 4HOWA 3W75A 2O4QA 2UWFA 1NWSA 3UESA 1Z89A 4E3VA 1WO2A 3W7GA 3S0CA 3BLIA 1SJBA 5LNVA 2D0GA 1SUXA 1UR9A 1V3MA 1XDLA 2VGFA 2YL5A 3S2LA 3IAQA 5FEXA 3TIMA 3UCQA 1VJSA 2J79A 4WJEA 4OHQA 1UD6A 5DELA 5REQA 2E5DA 4KEUA 1WDPA 1YTDA 4GJJA 2Y1HA 1V08A 3MC5A 1ZU8A 2WXDM 4UFJA 5AC7A 1LG1A 4DM1A 4JYDA 4YU1A 2YL6A 3AHVA 1EJVC 2NV1A 4O14A 1KRBC 3KL5A 4DBSA 4CD6A 1BRLB 3U2CA 3P8JA 3UYIA 1I2RA 5TIMA 3VCNA 3ARYA 8RUCA 3OPSA 3CWOX 5I3JA 3BTNA 3R94A 2BSLA 1LT8A 4DO4A 3SUUA 4Y90A 3KZSA 3GXTA 3L4TA 1RCXB 4WJ8A 4Z1CA 2OX1A 3F2DA 1XLIA 3N17A 5I77A 3VABA 4GFIA 1TWZA 1E3ZA 3PY2A 4YHEA 3BO9A 3FYPA 3NYZA 1VFSA 1PIIA 4A3UA 4AY8A 2GWNA 5LIWX 1C7TA 3BAWA 3FA4A 1W3HA 3D6NA 5AYYA 3VA8A 5EFDA 4LYPA 3GTHA 1FBAA 1L8PA 4WKHA 3SURA 4O17A 3WH5A 1H61A 3TTEA 1JFHA 3GQYA 2G4JA 3SSJA 3N13A 2QJMA 1UYQA 6PTDA 4HHMA 4GYJA 4KCUA 4QFUA 4GZ7A 1M68A 4PUUA 2AQOA 3KOFA 3NPXA 4JTHA 3VIOA 1TO3A 3EWYA 4CU8A 1H62A 4DM2A 4BHYA 4AF0A 5M2FX 3GU9A 1LWIA 5T8GA 1QOXA 3VNJA 4GY7A 3BL3A 2HS8A 3IEBA 5DBTA 1FVPA 2BS9A 5DY2A 2PF8A 2EPKX 4JX6A 4ADUA 1ZJAA 2Q01A 3DFHA 4RPPA 3V35A 2VVSA 4LPCA 4GFSA 1BVZA 1VD6A 3AZSA 1YXDA 4PTWA 3KBSA 3I3EA 4HK5A 4PMDA 1PBGA 2DSVA 3SR7A 5FCZA 1UZ1A 2YDSA 4HIBA 4O53A 3OZMA 3DI1A 4AZIA 1A5KC 4XK2A 5G4EA 5DBUA 3A21A 3W1TA 4S3BA 4V15A 3VIIA 4PC8A 2WSKA 1OCJA 4RV8A 2XZ7A 2QPSA 1MMFA 5CSSA 4O1AA 5A8MA 3HGJA 4L1GA 3VGHA 1KBKA 4HZ6A 5FKYA 2PRHA 3H2OA 1MZRA 2W62A 4BF5A 1LL7A 2MANA 1I45A 1SW0A 5ABEA 3W02A 2J47A 3GKFA 1OBAA 3SCRA 3H12A 2GDQA 4X61A 3QHOA 1OIFA 3OEXA 3VM7A 3R1ZA 4BI7A 4WRHA 3E96A 3G2GA 2PC4A 3F5KA 2Z2UA 3G0UA 4QLJA 4AG0A 2J8GA 1M7PA 4CQCA 3OBEA 3S2CA 5B80A 3G1AA 3R89A 2FYMA 3CZEA 5A6TC 1W5MA 3S5NA 4AF0B 1Q5MA 2O9RA 1GVSA 1W3KA 4WD0A 2YDAA 1J8VA 4U3CA 5K9XA 4MPQA 1FWAC 4LEFA 3VMPA 2CW6A 3QGVA 4EXBA 1HP4A 1SJCA 1HJUA 1ZHAA 2OPJA 3V5FA 5TBOA 3CIVA 4J2PA 1RY8A 1Q6DA 7XIMA 2QDEA 3RFAA 2I16A 4DVOA 3FAXA 3WD2A 3GFXA 3ZJ7A 4GACA 5KINA 3RILA 3G1YA 5CGMA 1NDYA 4NHVA 4I5UA 5JU6A 3QTGA 4TO8A 4LUSA 4QNEA 5HJLA 3GX9A 3V36A 3R13A 4HN8A 2DGAA 1LRTA 4O16A 3VNZA 2BVTA 1IR2A 3H6OA 5IBXA 3M44A 5LNRA 2BNJA 1MZHA 3GNXA 2TPSA 4L4LA 2EF9A 1SW7A 1EL3A 2Y5SA 2EXOA 2WYSA 2ALDA 3W7MA 1JCXA 3UQNA 2V5LA 1EJTC 3VYLA 3LPOA 1VP5A 1U30A 3CH0A 1V6YA 2ANUA 3JU2A 4Q22A 3GXPA 3T0TA 2V0TA 1NARA 1JFXA 2CLFA 1X8CA 3HPZA 4FX7A 1KXTA 1IXQA 3K4AA 3PZGA 2VO5A 2Z2AA 1TPH1 5C0QA 1Q7MA 3M16A 5BRBA 5EA9A 3ME3A 4NJGA 5DFAA 4NAFA 4K2SA 2ACQA 5AC8A 1V3IA 1IXOA 4ROPA 2E6AA 4R9OA 3A3HA 4Q8WA 2QVNA 4MWAB 3ITOA 3LM7A 3LXAA 3G6MA 1FQ0A 1A5NC 1MO0A 3KBJA 3MT1A 3ZMRA 1R38A 3OYXA 4C5ZA 2FZBA 4UOQA 1TX2A 1V6VA 2AAMA 4ICCX 2NQZA 1S39A 3THQA 1A5UA 3E5PA 3T0BA 2I17A 5H8UA 2YPIA 4R3UA 3N18A 3SUSA 1PZ1A 4HBKA 3F1QA 1V8EA 3VNDA 5F1UA 1DJYA 1MW0A 2JGQA 2E6FA 4DJED 1C91A 3AXKA 2D3NA 1TV5A 3Q94A 3W88A 4ATDA 3QMRA 4TQTA 1H7RA 1DHKA 3AIQA 2PP3A 3PFMA 4W84A 2J88A 3KCLA 6CGTA 3OGVA 2B81A 1E4NA 3WYZA 3AHZA 2QGYA 4WXZA 1EXPA 5I0DA 5M1TA 4KRZA 1C8QA 3AI0A 5EU9A 3UZZA 4BWLA 1YBQA 3IJ8A 1RR2A 1ADSA 1H1YA 1QPNA 3B40A 2V67A 5HWMA 4KWUA 5CPSA 2V5JA 3LY0A 2D3LA 3LN3A 1VYPX 5FA5A 2TYSA 5EMUA 1P7TA 4Y8EA 2WK2A 4PTXA 1NWTA 4JN8A 3SJ3A 5HK4A 4K39A 1JNEA 1G6CA 1GOXA 2WKJA 4EF8A 2HMCA 1EF3A 3PB0A 1OT1A 4GI6A 4UTMA 3MMTA 3OTRA 4N9EA 4M7SA 4FP1A 5ABFB 4XKMA 3BGJA 2RGMA 2WZMA 4IIFA 3V5OA 2GSEA 1ECQA 3AJXA 1UROA 1WBHA 4GMEA 3M0ZA 3DXIA 1QNOA 2EJ1A 3WQ5A 1ISXA 1CNVA 3QY6A 3AMKA 4RNFA 1JF6A 1FCUA 5BXSA 1K8XA 1GW1A 3EPMA 4ADTA 1R3WA 2NLIA 4FXFA 1GEQA 4RW3A 1HKVA 5ECVA 4X2PA 1ZJHA 3W22A 1ADDA 3AIRA 3DUGA 3VNMA 4URIA 3S9YA 1ZB5A 2ISDA 1NU5A 1TTQA 4JQ1A 3TONA 3T78A 3KP1A 3RDKA 3WSUA 1ZPTA 4JTLA 4UXDA 3VI2A 4IP7A 1LQ2A 2DW7A 1XCWA 3QRHA 3W26A 1XPYA 2XFFA 4LUSB 4DY1A 5LIXX 2W9MA 1W31A 1UKOA 3H21A 4GINA 4AIUA 4UTUA 1TREA 3RMEA 4XO6A 2UZ9A 4FB7A 3E2QA 1X6NA 4ZO8A 3FYOA 3PTMA 4PTMA 3GIPA 3KRZA 3CO4A 1P1XA 1LLWA 1UUQA 3CLMA 4BA0A 1IIHA 2RKXA 2OSWA 1UD3A 1WV2A 3CUIA 2ZC1A 5CPQA 2VC5A 2Z1KA 4B5NA 2FIQA 3OU8A 2R1LA 2HSAA 1FWSA 3LBOA 4HB7A 2X09A 5JBEA 1E6RA 1XUUA 1BRLA 1PXGA 3MI6A 2Z7KA 2CIPA 4FI4A 1QPQA 1QI5A 3S1UA 3W86A 4PBEA 3G3MA 1FCVA 4UTFA 1UJPA 4R7JA 2OX4A 1IEQA 2XVGA 4ZQNA 2GVEA 2PC8A 3IIZA 3OYZA 1JYXA 2BMBA 3M64A 4AD3A 2FZNA 5REQB 1DORA 3LOTA 3BWWA 1FUYA 5LSMA 1YLVA 2VDIA 3AYVA 3N9KA 3B9EA 3NTYA 1BD0A 2PWGA 2HE5A 1TJ2A 3QZEA 2Y24A 1PCWA 4HU4A 1B3YA 4A8LA 4PRRA 5D05A 3BAIA 3WDJA 1VFFA 2IQTA 1EZWA 4KWOA 3H70A 4G56A 3DC0A 1FFQA 3U7BA 2V69A 2GWGA 3M43A 5A6SA 4QSHA 4TTGA 4RW5A 4GYPA 1US0A 2HBVA 3K8LA 5A8NA 1IZCA 1NM9A 1E9YB 4U5IA 2X40A 1IYXA 5IHRA 3L0KA 1BYBA 4H04A 4O0ZA 4Q33A 3N2BA 5HQEA 2UBPC 4GBDA 3W37A 1VFOA 2QV4A 1U5JA 3M0HA 4C5YA 3VD5A 4B15A 4K37A 1P1MA 4RL3A 3B9DA 1XPGA 1TPUA 2H9AA 1N55A 3MMUA 3IGUA 1PWLA 4JL2A 4AIEA 4D72A 1XIEA 2E4TA 4MSSA 4TV5A 3U48A 3IK4A 1KNWA 5HPOA 4LAUA 4B5SA 1WZAA 4JBRA 1WXJA 2WJDA 3M0JA 3W7HA 3UCCA 4REQB 4EAMA 3S42A 1TPFA 2PDUA 4MOZA 3QPZA 5HWJA 3RGTA 4IGHA 1E6PA 1M03A 3WMBA 3UVAA 3FJNA 3VMOA 1BWVA 3CB3A 2ZOXA 5CC6A 2F84A 4XV0A 4JD4A 1B9ZA 1C3FA 2FVLA 1XLKA 1CCWB 1GZGA 1BQGA 4JQ3A 4HNTA 1UIPA 1KXVA 3RR4A 1Y7VA 3EBVA 3HPAA 4JTUA 1ZALA 2EG6A 4L6DA 3TJ4A 4W5ZA 3HQOA 2XVKA 4A29A 4RNJA 1UH4A 4PSPA 3TYDA 3GU1A 1E43A 3QFEA 2F6UA 3LXBA 4L4PA 1M7OA 3VO0A 1I9CB 1UR8A 4PMUA 1XDMA 1J0IA 2DZWA 3EX6A 3WJYA 4UUIA 1V0MA 1B90A 1YPIA 4J4KA 4L9ZA 4PUWA 5XIAA 3PVFA 3TYBA 3RCMA 3S9ZA 3MANA 4AWEA 2FHFA 2CU0A 1RJPA 3G1VA 2G3JA 4DPPA 3TNOA 1IHIA 3OG3A 2I1OA 1OJXA 5I3FA 3Q2DA 2IQDA 1E0VA 1KKRA 3HV9A 3CL6A 3U4FA 4M19A 4GQRA 4S38A 3OVGA 3FW6A 3VE9A 3UR2A 4H01A 3AXMA 2ODOA 4C1NA 1O5KA 3P93A 2B7OA 3WQ6A 3Q4DA 2PWHA 3WUGA 1LRNA 2PDWA 4DNMA 3APYA 1I2QA 3IJDA 4KEZA 4A3QA 2EKCA 4CGTA 2WO5A 1N2VA 3CV7A 1NDWA 3BGGA 4R33A 3NZRA 4D8AA 2XIBA 4XZMX 5DRCA 1F3EA 1E0XA 4GUFA 4A6GA 2DT2A 2DUAA 2OQLA 4LU0A 4Q8MA 3EB3A 5C2GA 1BTMA 4G7EB 4FA3A 2HRWA 1KFCA 1VZWA 1LZOA 1X39A 1ONXA 3UXDA 2E67A 1TZ7A 3P82A 4NRSA 5C6MA 4IIHA 4KWVA 4IIDA 4JFTA 3WF3A 2FHBA 1YHTA 3GH7A 4BKNA 1LRQA 2QV5A 7REQB 3U0HA 3WF4A 3CNYA 3K4WA 3EA2A 3RJXA 3EOLA 3A6OA 4W7UA 4PFMA 4JXCA 3W72A 3AFBA 1FWCC 5F4XA 4O8AA 4LGXA 5D04C 1XBZA 3CZ8A 2E8ZA 4ILSA 3W7PA 4IICA 4X60A 1ZBKA 4QCFA 2VD9A 1BSIA 1D8WA 1Q6LA 2DVTA 1A47A 2R91A 3IAPA 3SGZA 4A8NA 1JD9A 3QV7A 2OCZA 4PMYA 3MCOA 2TMDA 1V3JA 3MUZ1 4MJMA 4AIBA 4UTIA 2Z00A 2ISWA 4AVFA 2QCDA 3DGRA 1CWYA 1W1VA 4B3KA 3A64A 2V3DA 4OIFA 1YBQB 3TN6A 2VEMA 4AVOA 1EZ2A 3LMYA 4JYEA 3W7QA 3QC3A 5J5RA 2FHCA 1XQLA 2O92A 4LYKA 4DHGA 3PS7A 4L5ZA 3BG3A 5CEWA 1DV7A 3L4XA 4ZQMA 1XRTA 3FCPA 3VIKA 3LMZA 3VD3A 3URBA 1J2BA 3CM4A 3VGEA 2BOGX 4JAWA 4UB9A 3VKKA 1EHAA 4ZR8A 3BE7A 4PBFA 3UXAA 3TWBA 1R3TA 1IGWA 4DBEA 3HB9A 3SM0A 3QHNA 1Q66A 3GDTA 4AXNA 3W1MA 1YKWA 4MUPA 2WCAA 2ZDSA 3T09A 1A80A 3BARA 4KFOA 3BH4A 4K8HA 2J66A 3WZ0E 1NFGA 4IFKA 3FAWA 3RU8X 3LEPA 3W7LA 2P8BA 2E1DA 3VKBA 2Z26A 1P0BA 1V93A 2XHYA 3JR2A 4P8UA 3OLDA 5LHEA 1RLDA 3BDKA 3NXLA 4IPNB 2NV9A 1J0JA 1OK4A 3RMJA 4C6LA 4B5XA 3NSXA 1JCNA 4ZMGA 4LQ1A 3IIPA 3O6YX 2D2JA 3EDKA 1KFEA 4HCDA 1LOQA 1RALA 5C9UA 1JPDX 1HJVA 3LCWA 3BMWA 3WNOA 2QKFA 1SR9A 1Z69A 2QCGA 4Z1AA 1Y65A 4ZTYA 1UH3A 3TMQA 1C90A 2NUWA 3ZLHA 3ZXWA 1CEOA 1B3WA 1EUNA 5EYWA 3HJEA 1QWGA 4Q32A 2VZOA 4ZODA 1BXCA 4OQVA 5EMJA 5D9NA 5D2VA 1YTKA 3VIFA 2X2GA 4QG8A 3KBVA 3M0MA 3NJ3A 2ZXBA 1CXLA 3P0XA 3EXTA 3PG8A 3UZYA 1KRCC 1AL8A 1U5VA 3QYQA 2OEJA 1UD4A 4K1WA 1S5VA 1XLBA 3C86A 2ZQ0A 2ZIDA 4AH7A 1M53A 3V0SA 3W7CA 1LF1A 4WOQA 1KQZA 3EMQA 3EWUA 2ZE3A 2VNCA 3PUGA 3OZPA 2XSXA 3CWHA 3EZ4A 3HA1A 4E2OA 2W4XA 2ZTKA 4L7ZA 1VBUA 2YA0A 4M7TA 1SO3A 2C0AA 2AMGA 5D32A 1UD2A 1VB9A 2QVHA 4KERA 5ABTA 1UR4A 4E6MA 2P53A 2UY4A 4WY0F 4AY7A 4H7CA 2PD9A 3NFUA 2ISVA 4XZIA 1NWUA 2O9TA 1L6FA 1TZZA 1WE5A 3KOWA 3BICA 1UQYA 1FY6A 2Q09A 3CLWA 4JTGA 2GL5A 3HFTA 2LLEA 3C2YA 3PBUA 1J0KA 4FEZA 1KLYA 1XD0A 2B4GA 1H5YA 4IIEA 4E2DA 2IKGA 5GPRA 3GBDA 2F6XA 3K30A 2O7QA 5MF5A 2BHZA 4Q3MA 5CGQA 2ZXAA 3IJLA 1XLCA 2GQ8A 3DGBA 3QOKA 4A21A 1TV4A 3GBEA 4W8LA 3SFKA 2XIIA 1AH3A 3FIGA 1AMKA 3QY8A 1Q65A 1RUSA 2VWTA 1YNYA 3N29A 2PI6A 4AZ7A 2QHAA 3R8GA 3H2FA 4K8EA 4PGLA 1QPRA 3BJFA 1TV8A 4ZQPA 4DNHA 5DT5A 1X98A 3URNA 4LS1A 5ABHA 4LBRA 5D8ZA 4NNBA 1J2WA 3WQCA 1YEYA 2A2IA 2VEIA 2WSYA 4JDBA 1R46A 5C2XA 4LC6A 1Q7QA 2CZ5A 1VYRA 3EMCA 4QLKA 5FJJA 3DYOA 1JNDA 2A5HA 3VDAA 4CNNA 4UQAA 3DIPA 3BAYA 5HOSA 1G94A 1JUEA 4I7VA 1FRBA 3FN9A 1BLIA 3LERA 1TPC1 2WJEA 2XVNA 4TX6A 2A85A 3KFTA 5A94A 5HULA 1PHQA 2JGYA 3QW3A 3BZGA 4QG6A 3R10A 4ML4A 1MEIA 3FFSA 4TVDA 4GIYA 3PPHA 4O1CA 5HBFA 1E55A 3RX4A 3H2CA 3G1RA 1R9XA 2J25A 5HJYA 4PZVA 1RBOB 1WKEA 3SJNA 4LVAA 1HG3A 5IFTA 1LOLA 4LOCA 1VLWA 4YL2A 1XC6A 2E40A 1ODUA 3FHQA 1WXZA 3A4WA 1HIZA 2REQA 4JGDA 4WUIA 2WC4A 4MIMA 5EMLA 2VQTA 4OUIA 4WSHA 3VOCA 4HYRA 4HMCA 1S3HA 3R5EA 1DTUA 2D20A 4OBSA 4AYGA 1IE7C 4GABA 4ZB0A 3UJSA 1RHCA 4FNTA 2VTFA 3QMTA 1P5BA 3C3NA 3NQGA 4G8TA 2BGNE 3KS5A 3LPFA 3P5ZA 2OVLA 1F3TA 2YSWA 3OQEA 4KBXA 3F4NA 3T1GA 5A6AA 1E40A 4QITA 3HBLA 2VEKA 4HU0A 3KVMA 1NELA 2DZVA 3Q37A 4LV4A 4D6DA 2OYKA 2CHNA 4IX0A 1RZMA 4CN4A 1AFSA 1DBTA 1TWDA 2XGZA 3NSNA 4MWAD 3GNOA 4NZ1A 3CTLA 1KGWA 3PTKA 3V1PA 3VDBA 1OC5A 2QAPA 4D8LA 5E09A 3ZWSA 3SSZA 4YCPA 3KDOA 4HPHA 4XBSA 3DHUA 1SPQA 3RLHA 3LU2A 2J9YA 1B1YA 1GG0A 1L6GA 2CZVA 1CZ1A 1Q6EA 4D1IA 1XICA 4F0SA 3MA8A 3GHTA 2WVVB 1HX0A 3PTDA 1E1EA 3L5LA 3TTYA 3CMFA 4RR4A 1F61A 3DHDA 3W7JA 4I9JA 4JTIA 3CUXA 1XRSA 1AA1B 2EHHA 3RX3A 1V6WA 1BWKA 2EPLX 3BSGA 1I8JA 4EOUA 4JKKA 1QJWA 4QJ3B 2GSJA 3DFSA 2PLKA 1V03A 3FK4A 4G2DA 4Y9NA 1OCBA 4AD0A 5I09A 2GSHA 4GIRA 1JDDA 4C6DA 1NQ6A 1V0KA 3CC1A 3PC0A 1W1B1 1KB3A 3EGJA 1JXKA 5BZAA 5E70A 3PZVA 3E2SA 1EDTA 3M5XA 4UWMA 3NCOA 3KEHA 4G1NA 1OQFA 3U2ZA 1X6LA 1TKKA 4QP0A 4KMQA 2WHLA 1VGAA 3GVGA 2B7QA 4XTIA 4O0QA 4NJHA 2QJJA 4RV3A 2XISA 4YNGA 1P6CA 3QQ1A 4HZ7A 3ZQ9A 1O60A 3MSRA 2WVUA 5D9PA 1WA3A 1EC8A 2E25A 2VRKA 3EX2A 4R5EA 3WG6A 2W5FA 4UMCA 1L2QA 1M5WA 3PBVA 3AC0A 4IJCA 5CSRA 3R11A 1XD1A 3LCLA 4QSFA 2DVUA 5G4HC 1K8ZA 4H7VA 4EWJA 1UP0A 2C7FA 4O10A 1DWHM 1Z48A 1PTAA 5F1VA 2VFIA 1YPFA 2XINA 3APGA 2PP0A 1FWRA 2A0NA 3GZ3A 2JKEA 4O1DA 4FNPA 3MSYA 2Y70A 4DJEA 1UJQA 2Y7EA 1RD6A 4V27A 3HF3A 4H9UA 1PTGA 1GVEA 1OX5A 1RH9A 3L66A 4LUIA 3WBEA 3G0SA 3SN0A 2G4FA 4ZGYA 3VCRA 5LNUA 2QLYA 2WWCA 3EWXA 1CYGA 2QMJA 1SZNA 2PSNA 2OWCA 4CVWA 4K36A 5AHNA 1AD4A 2OZ0A 1G4SA 1V3HA 2PZ0A 1RQHA 1FDZA 3S8HA 3AIVA 1LBMA 4Z1BA 3W2UA 4F8XA 4XSMA 3D46A 4O8RA 3HQNA 1G7VA 3T40A 2QIWA 4JCMA 3G1SA 2P88A 2WMIA 1FXPA 3GWQA 3BMXA 3E1F1 4WGHA 2FZ8A 1DWJM 1B3VA 4DELA 4C6JA 3ZYZA 2QCHA 5C2CA 4RNIA 4MADA 1UZ4A 2P10A 1SU5A 3KCJA 5JBDA 3ABOA 5HINA 2CLMA 3SW6A 1YNPA 3RPTA 3GKAA 2VL4A 5MHBA 5FJUA 2GJRA 1N82A 2HISA 3UA3A 1FKXA 2CEQA 1QK2A 4HHHA 3WJZA 4U33A 2PEVA 2C1IA 3SZ8A 3C2VA 4GVIA 4IOTA 1GQIA 3O15A 3OLEA 5I06A 2WV8A 4QCEA 4B5TA 2J7DA 1HQTA 3NAVA 3UPMA 5EL1A 3W2KA 3WQFA 5LXXA 2D2GA 3W73A 2Z2BA 3W6LA 1T5AA 3MUXA 4WOZA 1Q8JA 1TTPA 5H8PA 1B9BA 2DORA 3NL5A 1A4MA 1SO5A 3QR0A 4W5UA 4HZMA 3WMLA 4GHRA 3CMGA 3EAUA 3W1PA 3GE7A 3MP3A 4UTTA 1E15A 9CGTA 3KW3A 4GGBA 1WDDA 4F40A 3E02A 4UR9A 2F38A 4QROA 2G96A 4JFVA 2XSAA 2O0TA 4A35A 3LQGA 2NQ5A 1ISVA 5D4YA 3WLHA 4KF1A 3CAKA 4F2UA 3O0FA 2PDNA 1W3TA 5DLCA 3VNLA 8A3HA 4CCCA 3DH7A 4IGMA 3TN3A 1QNRA 2OGYA 5ABGA 1XGZA 4ZVJA 2FJUB 1W1A1 4Y8FA 2P1FA 4BF7A 2ONEA 5D8WA 3IJQA 2VQUA 1HVQA 2VR5A 3MV01 1EA0A 5FF7A 1UIOA 1T99A 3MUAA 2YLAA 4FHAA 1EPXA 3USZA 3VDCA 1YE4A 4PUNA 5HNRA 4R7WA 1TSIA 3SIMA 2DFAA 1QXLA 3LI0A 1C9WA 2QF8A 3PWGA 4HA3A 1AVAA 1HL8A 1QAPA 4J3VA 4PMZA 3MDWA 1REQB 2PRMA 3E2VA 1JR1A 2CETA 3N9SA 2NQHA 4KRUA 2VP8A 5C55A 3CV2A 4QEHA 2WZEA 1Q6FA 3GG7A 4LS2A 1XHGA 4C91A 2O4MA 3TOPA 1J5SA 1ISZA 2JIEA 1TJPA 1FWWA 1ZJIA 2F2HA 3G5EA 2E6YA 1TWIA 4IQDA 4C6PA 4W86A 3TWAA 2FTWA 2E77A 3C2EA 1TJRA 4IH3A 1E1CB 2XH0A 4CD8A 1FP9A 4CNPA 4AXKA 4GZEA 4M8UA 3K4DA 2QDGA 4E4FA 4JTRA 3U9IA 1QW9A 1B0IA 3AU6A 3UR5A 1ELSA 1FWJC 2PDLA 4A8RA 1F9CA 3B8WA 1M41A 2GOUA 1W8GA 3L4YA 3GR4A 4NUWA 7CGTA 3NUKA 4PCNA 3AUOA 1GPWA 3H22A 4W87A 3MMDA 3WD1A 1UPMB 2PWEA 3GAKA 3SCVA 4XG1A 2WSQA 2BV9A 3UVIA 1ZP4A 5HXMA 1XLFA 3W24A 4YYCA 4JY8A 4S3CA 1W32A 3IK2A 3CIXA 4WY0B 4ORMA 1XFCA 1XFBA 2AGKA 4JQ4A 1KBLA 3W53A 2EG7A 1QI3A 4FF7A 3CUZA 1R3YA 1AG1O 2E8YA 4X0VA 1TIMA 3IWPA 4AIOA 1M7JA 4X9SA 1SZGA 4FOKA 4F0HA 3PFRA 4YPJA 5CJMA 3IRSA 3RXZA 3AMCA 2PMQA 3HG4A 4C6MA 4WSKA 2YBTA 3SCUA 4B5VA 4KCWA 3PTQA 1XLJA 1VKFA 3KX6A 3Q65A 1A5CA 2DIJA 3ID7A 4TX8A 2OKTA 4KFPA 3TKFA 4YWIA 3BG5A 2ZVIA 2PFHA 1CB2A 2OO6A 2GUBA 4LV9A 1GNXA 4UR7A 4AC1X 1YE6A 2BB0A 1EDQA 1XRVA 3VOHA 1OINA 3T4CA 3RO6A 1F6YA 3C61A 4BEQA 3LHZA 2UY3A 3EEZA 5JQ9A 1X1OA 4LY8A 1XYZA 4JQ2A 3SGUA 1I4NA 4PN2A 4EP8C 2WBKA 4MJZA 3JZEA 1TMQA 2ZUVA 2YW4A 3II1A 4NJIA 4MZ1A 3I4EA 2G3NA 4BF9A 1GVYA 1HJXA 1L9WA 4ATLA 4RCXA 4Y2WA 1GHRA 3DG3A 2GK1A 2DSWA 1W17A 4FOUA 4WDUA 4RJEA 4I7WA 2WKLA 4JKLA 3CHDA 3S2MA 1DPMA 3GS6A 3H4XA 3NZGA 4DZIA 2VOTA 3UBPC 1S5NA 2WVVA 2GGJA 3TX9A 4H4IA 3SCOA 4A2SA 1KCZA 4GCAA 1XIDA 1LL4A 3NDZA 3CPGA 3UJRA 1GYLA 4ORIA 4Q4QA 3S5SA 2ACRA 1GKQA 4FIQA 4DJFD 3W1XA 4MWAE 2XGBA 4N9DA 2WWDA 1QR7A 4U2ZA 4PCFA 2AAAA 3TK7A 4B2DA 3IUIA 4DBWA 3B9NA 4N02A 1PKMA 4R53A 5DN1A 1TQXA 1S38A 2B7NA 4ZE4A 3KBWA 5ECUA 3WIJA 3MCNA 1G7UA 2EPNA 2VGIA 3UXLA 1KTNA 1OX6A 3L4WA 1P0EA 4Q4OA 4JNZA 1TRDA 1RQEA 2AL2B 3UYCA 3BLKA 3K8KA 1ONWA 2YIHA 3NWRA 3INPA 1TVNA 4HCHA 3S6DA 3ALFA 3F4WA 3GH4A 3AWNA 3HQPA 3G22A 4GO9A 1FFRA 4XD4A 5C9XA 1LLZA 5L6UA 5G4WA 3WX7A 3EWWA 5AHFA 2G3IA 2OSYA 5CZSA 1WUEA 3NQFA 1MRAA 4C6IA 1REQA 4P8VA 4HTYA 2Y85A 1R8LA 4LVGA 3VUPA 1CXKA 2FFIA 2OFJA 5AECA 3NYDA 3EDDA 3W76A 1CGTA 1UR0A 4QEEA 1DWIM 2WCSA 4NILA 4J7RA 2OQHA 4M51A 4PRTA 4XD5A 4XSLA 5A6JA 1UH2A 3MYOA 2C15A 1KFLA 1R7AA 4OUEA 3M0IA 2PLCA 4K6AA 3WQEA 1IEVA 1C8VA 1CGVA 3FGCB 5A5WA 2NT0A 3EOUA 3TSMA 1I2NA 3WH8A 2QCMA 2Y89A 1B2YA 1TX0A 4PSRA 4I8YA 3LTSA 2YKKA 4GE8A 4PRWA 4GXWA 4RZ6A 4Q4PA 4ZSUA 4DBUA 1DYSA 4GNVA 4I6KA 1XSJA 3N11A 1BYCA 2BDQA 1TTIA 1NP2A 2FZ9A 2P0OA 1R6WA 4HCLA 3W1QA 3TN5A 4W7WA 2ZDRA 3APTA 4GOAA 3KXQA 2BBFA 3EWDA 2KAUC 3FSUA 4PL2A 1PZ2A 4FSAA 2YZ5A 2AKZA 1JRBA 2AQWA 4AEEA 5CC7A 3W2NA 1AH4A 1RBLA 3C2FA 3WELA 3DI0A 2X1RA 3LRKA 4Z2GA 1ME7A 5A2CA 1CT5A 3OIHA 5I7GA 3ARSA 1K02A 1R2SA 4OWGA 2YYTA 1HL2A 2GGHA 3QKZA 3STPA 1CXEA 4FMVA 1EEPA 4MNMA 3U2OA 1E9ZB 1F76A 4LT9A 1F3XA 3STEA 1UC4A 3ATZA 4AFYA 4J3XA 2OYLA 2HK1A 4Q8OA 3TW9A 1XX1A 1Z3NA 1HL9A 1F4AA 3S3GA 1R2TA 3KTXA 3CV1A 1XH1A 3VX0A 3NIYA 3B8IA 3DBNA 3CJPA 4Z1YA 3S6TA 1EJSC 4LH8A 1TUXA 7PTDA 4H8NA 1CXIA 2ZBTA 3L2IA 2HTMA 4RUBA 3ANVA 4LC8A 2NXHA 1QPKA 2YCIX 5AYZA 1XDJA 2CXGA 1V0LA 3V0UA 2BLEA 5LGXA 3SADA 2W91A 5AZ1A 1MQQA 4DI9A 3EX4A 5A69A 3L12A 1YMYA 1AODA 4PB4A 4DQWA 5DQPA 3VC5A 2NVCA 3U7VA 3EDJA 4E5TA 4L6HA 4NAEB 4NVTA 3AMDA 3TR2A 4KWSA 3EA1A 4HD5A 4HTBA 3KWXA 1TCDA 2G5WA 3A4XA 3W70A 3MI2A 3PR2A 4G6CA 3NO1A 1YXCA 1US2A 3CZGA 4MB5A 2OLSA 4GVGA 3ZM8A 1LCOA 1VPXA 1ICSA 1XGEA 4QX4A 5E0FA 1H11A 4Q4SA 3BUVA 4JS3A 2FPTA 5AHIA 3LLFA 1EDGA 2PLJA 5AHLA 4XIMA 2HXUA 2XIOA 2YB1A 4G7FA 2FMNA 1P4CA 3GFZA 3QLLA 1JZ3A 4GG9A 3KVJA 3OJGA 3GUGA 4M29A 1LORA 4BS0A 4OBRA 2J9XA 2JF6A 2PUZA 2B7PA 1R30A 1VH7A 2NUXA 3U57A 4DYKA 4ZTXA 3PBWA 2NX3A 2A7RA 2OT1A 2QMKA 1ZBWA 1MFUA 2A1YA 3QZAA 3M0XA 3KTSA 2E28A 4DAFA 5HMFA 4MKSA 1UZHA 4NZCA 1J4EA 3O6AA 5F2GA 3CT2A 2REQB 5AC5A 3GZAA 2DUXA 3U8GA 5IXEA 2IKJA 1DJIA 3TTSA 3E38A 2FH8A 3ONCA 4UQDA 4MVAA 4F79A 4BCEA 4UNIA 4EWND 2VZTA 3VNKA 4BFAA 3TQVA 2FVMA 3UP8A 4HGXA 2QJIA 2YA2A 2DW6A 1PV8A 1OX4B 2YX0A 3NVDA 2QUVA 3W85A 1GQJA 1CPUA 3A9BA 5CBBA 2VRJA 3WLKX 1WB0A 2XWDA 1EIBA 3LX9A 3C4UA 3SAZA 1V02A 3RO8A 5A2AA 3QVQA 3RJYA 1H7NA 4DJFA 3GHSA 1SW3A 2BASA 4B9ZA 2CWNA 3TQKA 1A5MC 4MY8A 3H7VA 4L6OA 3ARPA 4GQQA 5FESA 3GDBA 3MYPA 1O7AA 2VRQA 2BWGA 4H1ZA 3GHUA 1EJRC 5CPMA 4H9ZA 3NL3A 2JFEX 3PNUA 5M17A 1JZ8A 4W89A 1GTHA 1T8XA 2XH4A 1NF7A 3UG4A 1IT0A 4EF9A 3DFQA 3L67A 3DFOA 5D33A 4D6GA 1Q2RA 4Y96A 4OV9A 4CNTA 3LHYA 4MB3A 3NEHA 3UEQA 1O94A 2YBVA 2CERA 2HVOA 3E2RA 3LB0A 3TJIA 2VWSA 1F74A 1E0WA 2ZUMA 3AUJA 9XIAA 5CLTA 1A53A 2NQLA 1CGXA 1BWLA 4DLMA 5HAOA 2WHJA 2V5BA 3LV6A 5E9AA 3WK2A 1MSSA 1KM1A 2WNQA 3RLUA 4K3ZA 5AHEA 2JE8A 4JN7A 2WHMA 3L23A 3MKVA 1TB3A 4OFCA 5BMXA 4RNHA 4ZB2A 1LQAA 3AS0A 2HQAA 1OVDA 4JTJA 4H9MA 2I9EA 3GAYA 5LIKX 1KBIA 2PZNA 2YCEA 1EQCA 4GGHA 1W9VA 2ADAA 3AJ7A 2Y4SA 3TJLA 1EP1A 3DFYA 1WKFA 2PDCA 3UWQA 5HR7A 1EA9C 3RLGA 3OB8A 2F8QA 1Y5VA 4MLRA 1JCYA 3QYSA 1UWIA 2Z4GA 1M3UA 4Z2LA 4BI5A 1AQMA 4HPGA 4AEFA 2IXVA 1WZMA 4CQ8A 1FH7A 3JUGA 3STFA 4CCEA 3IS4A 1EIXA 1OSEA 3FDKA 3EA3A 3STGA 1B5TA 2WJFA 1S1RA 1QBAA 2Y0FA 1PDZA 3VGBA 3ES7A 4LANA 3KBMA 2ON3A 4XKYB 2QT3A 1SSGA 4HYVA 1K6AA 5IFPA 1KWKA 5DXXA 1EC9A 4QJ1A 4O19A 4S3DA 1VAHA 3CS2A 3DFNA 4LALA 3NQEA 4REQA 2EQDA 1R3VA 5GVJA 4ZO7A 2DP3A 3ITYA 1K4GA 1GW9A 2E1WA 2XFRA 1W5OA 4DF2A 3PUOA 1WX0A 3P74A 1RP8A 4ERIA 3TC6A 2W92A 5TQLA 5IM51 2IMRA 4O13A 1SO6A 1UP3A 2YR1A 4DRSA 3MV11 4F66A 1DJQA 2RUSA 1CB7B 4Y9OA 5AHMA 1VC4A 4LNYA 3NA8A 4H6KA 1Q85A 4QISA 3OODA 3MBFA 2GK1B 4XZNX 7ENLA 2C14A 4JCLA 2J6XA 3UY7A 5HR6A 2A4AA 3PZTA 3R7MA 3K5XA 4UOZA 2ZA1A 4K1GA 1Z8AA 4DBDA 3I10A 3FYYA 2RJHA 1J6OA 1KV8A 3SCQA 3MP5A 2NSOA 4CVUA 3KHJA 4AZBA 3HOJA 4V28A 4PYSA 3NZQA 2CZDA 3NPWA 5B7YA 3L0NA 3P3BA 1XI3A 2IS7A 1VRXA 2FKPA 5HQLA 2I9UA 2WM1A 4IPLA 1K6WA 1OK6A 4QM1A 5EGRA 8XIMA 3BLDA 3GYCA 1YADA 1W1ZA 2GQ9A 4N0RA 1ECEA 1QRQA 1GCYA 3ELFA 1PX3A 3PJTA 2WOQA 3EB2A 2BZNA 1NQKA 3BAXA 3L2LA 3MO4A 3EEGA 3VDHA 5CPOA 3KAOA 3NDYA 4A4AA 1RK5A 2VEPA 2C8NA 3NL6A 3L21A 4DYJA 4LUTB 3M46A 4MZYA 4J3UA 3LSBA 3A24A 3F4CA 3M47A 4TMCA 1SFSA 3OA3A 2BHYA 3UPBA 1V7YA 1OGGA 3GNDA 4DXXA 4A3YA 4IL0A 1BYAA 1PKYA 4AX6A 3AIEA 3OQ8A 2WMJA 2OU4A 1AJZA 1P48A 1XLMA 4I90A 3H2MA 1DE5A 3NQAA 2BVYA 2I14A 2D2OA 3IGXA 4NJKA 4S3KA 2HCVA 2VX7A 5JIPA 2C1HA 3TCEA 3ZO9A 3FOKA 3GYEA 4HA4A 4JTFA 3RN6A 1H7WA 2DH2A 1KA9F 1ZTVA 1E6QM 4IJBA 2EEXA 3WLPA 2ZZ6A 1H2JA 1F7BA 2PWFA 4JEJA 3PAOA 2HNHA 1KCLA 4PULA 5BXPA 4O1BA 4WX2A 1GT8A 3E0IA 1A0DA 1BAGA 2ZUNA 1ZZMA 3HV8A 1QO5A 4XAGA 3AHTA 2NQJA 4I5RA 4DAIA 1E56A 3B06A 4CU6A 3W00A 3PZNA 1T41A 3W25A 2QAFA 4XX6A 4H6EA 4RXGA 3MUY1 2GVJA 4I9AA 5E0CA 3VCCA 1IT8A 4KEVA 1Q6CA 1WOBA 4F48A 3IUDA 1K7XA 5I6SA 3ARQA 4XAPA 2VOMA 2EPMX 3PBGA 3VU2A 1C9DA 3EKGA 4XTDA 4DN1A 1V3KA 3OLGA 4PEKA 3ORWA 5KSWA 4HA1A 2EBNA 5BW6A 1GJUA 2E9BA 3M0KA 3MI3A 3NEVA 5GQBA 1GORA 2VI0A 5AY7A 1GQNA 2BOFX 1AH0A 5HNNA 5AZ0A 1YDYA 1TE1A 4P7NA 1KKOA 1JCLA 3MPGA 1RBAA 1ML1A 3CYVA 2GJNA 4MY1A 1RCQA 3IJIA 2XIMA 4JPGA 3PZOA 4WDTA 3VGGA 4PUDA 4YVXA 1MQPA 2WPGA 1OFDA 4UZUA 5FIPA 2I56A 2W61A 5H8MA 1AD1A 3IJ9A 3ICJA 4GC3A 4TX9A 1Q6OA 2V3GA 2G3FA 3C52A 3FVDA 1DQWA 1GZ1A 1SFTA 3M0LA 2XN1A 2J7CA 3RNDA 1R3RA 3L5MA 3TAOA 3ZVHB 4E2VA 4F4RA 5AC4A 1S2WA 4QNWA 4C6KA 3ABXA 1WDRA 1H4PA 1F05A 3LBCA 2PTWA 2Y7GA 1FWFC 5KZ6A 4HOXA 5EBAA 2PURA 4S2CA 3RF9A 4ZQCA 1HXJA 2ZRYA 2DT1A 4B16A 3AROA 3QXBA 3T0CA 3SI9A 1KCKA 4C6FA 3W23A 1H09A 3TLLA 3A4JA 4TVCA 1MW1A 3E12A 4BEUA 1ME9A 2ZC8A 5IOBA 1XG4A 2NZLA 3OBKA 5C70A 3QH2A 5CZKA 5BWAA 2ZUTA 1ZNNA 4LTSA 4MAZA 1KM3A 5FJIA 2HJPA 1FH9A 4GD0A 2H3DA 5HMDA 2J24A 4WY0A 1GOOA 4WKAA 4ZFCA 1L6YA 1DOSA 4L65A 1TPEA 1QW8A 1TYGA 2ISSA 2L5HA 2YL9A 2J27A 1HKKA 2WHKA 1KFWA 1E4IA 1J10A 1SR0A 4HNCA 4A05A 4GUIA 5F4WA 2ZZ2A 5I24A 4OOUA 3GVVA 2V3EA 2OEMA 1CI1A 3UWWA 3CK5A 5TAOA 3QBUA 4MYAA 4YWSA 3QTPA 1JZ6A 4RDWA 3HMCA 2Z29A 1E5JA 2DDXA 2PDGA 3LCXA 3WQOA 5AYIA 2ZXDA 4GC4A 2VEGA 5F2MA 4PUKA 1D3GA 1UWTA 2VR2A 1IEWA 5HA7A 4MKVA 1FWTA 1DIDA 1GVRA 2IKHA 1KFBA 5HNTA 2WMIB 3PJWA 3TDFA 3MJYA 4DJEC 1C93A 4YCOA 3EDFA 4PMXA 3WNNA 1PEZA 1FX6A 3A9IA 3AHXA 1PPIA 6ENLA 1S1PA 5ENLA 2WB5A 3P8IA 1E0UA 4DF1A 3G3DA 2XH2A 4GNJA 4PTNA 4QS5A 4XZHA 5JVLA 3H54A 4P2VA 1G9HA 1XLDA 3PAJA 5FEPA 5HATA 1RA5A 1XIFA 1DL3A 4L56A 2R1KA 1MUMA 3P67A 3UY8A 3M5VA 5FOOA 4O52A 3BZJA 1I75A 1XIIA 2FZDA 4RZ5A 2O55A 3UZWA 1LM1A 2H9AB 1UKPA 9RUBA 1LBLA 3U5UA 4TTUA 4LBSA 3RM9A 3B9AA 3V5CA 2R9RA 4PMNA 1UUMA 1JGMA 1BYDA 1UC5A 4JHOA 3D0CA 4U2YA 5HPCA 1BF2A 2VC9A 3VZZA 4C6BA 1PO9A 1GOKA 1UA7A 2YB4A 1KFJA 1LLOA 2X0SA 3F4VA 3SUTA 3EOEA 3B8UA 2EAWA 3DU0A 1NEYA 1KM2A 4C7FA 3H2EA 1MW2A 1YQ2A 3GG0A 4Y9AA 2YXXA 3A23A 3Q45A 1I2PA 3SY5A 1EP2A 3DDMA 3VZYA 2PP1A 5FJOA 1NSJA 3WD0A 3RCYA 5BNKA 4LUJA 2V30A 5F7UA 2ZA3A 3GR7A 3MSDA 5C5YA 2QIIA 4B90A 2OO0A 2DZPA 4IMFA 4PTDA 1CECA 1XGDA 3NQCA 3TFCA 1J6PA 3CAWA 4UZSA 4Q4MA 3K13A 2WNWA 1H0GA 1YW1A 1E3XA 3EOOA 3OHIA 2HVNA 4AISA 1WPCA 1ZLPA 1EHNA 1OD0A 4RDZA 1A5SA 2ALRA 5AVNA 3SBFA 1MRQA 5DANA 3LS9A 4M6VA 3N19B 3PWIA 3TV8A 4Q6JA 4QS6A 2X0HA 3TNBA 1W3NA 1K4HA 3PSVA 4F9DA 4MDPA 2YDRA 1NY1A 4R88A 2J74A 1S2AA 3TU9A 1LUCA 2X0YA 5BYWA 2ATSA 3UT0A 5DXYA 2D1ZA 2CESA 3F5JA 5D2WA 4HPJA 4GY0A 5HMSA 3N2OA 4J3SA 5M3WA 2BP1A 4EAYA 1TG7A 1XS2A 2DV0A 3BLOA 1SVDA 2G37A 1GVQA 1BQCA 1PWMA 5RUBA 1XYMA 2FTYA 3AZTA 4CD7A 4CUCA 1DXFA 1WZKA 1X38A 2QCEA 1KXHA 2XFWA 4W8BA 3ECQA 1JDAA 2BTMA 4PBGA 1WAUA 3MHGA 1WCGA 2ASHA 1Z7AA 1JDFA 1XBXA 4N6EA 5A3HA 3L9CA 1SSDA 2DY3A 2C0HA 4UTLA 5I79A 1E9IA 1NOWA 1E73M 4Y9PA 5E1QA 2IPWA 2J7EA 4M80A 1MXSA 4POCA 5IBXC 5HUPA 3WF1A 3EDEA 1EJUC 2FVKA 1YIXA 3P61A 3QN3A 1FP8A 3NQDA 3OOQA 3WLTA 2ZRZA 1KXQA 1QHOA 1ADOA 1M7XA 2FPVA 4DUWA 2B31A 2GJXB 1JI1A 5JUVA 1VPYA 2G95A 4TU1A 2Y7FA 3UW6A 3S4TA 3VK5A 2OQYA 4MYXA 4X2RA 1GOWA 2QS8A 4OBTA 3B8VA 2WLYA 4ZEPA 4M5PA 1UG6A 1EP3A 3VE7A 1S5MA 1OZQA 5CSUA 4MJ4A 5BOFA 2RGLA 1LBFA 4S1FA 5I3GA 4HHLA 3M7WA 1DJWA 3T81A 3TLQA 3EPOA 2OXNA 2X7VA 3H2AA 5JBFA 3AMGA 2Z28A 3AWOA 3QV6A 3GDRA 2NWRA 1XF0A 4GYKA 3W3OA 5AKQA 2OTDA 3DHFA 2H3BA 1NTHA 3LD5A 4YTSA 3PULA 2VZVA 3TE9A 4S39A 2TODA 4Q8QA 3VOJA 5A6BD 4FX6M 3C5QA 1EYEA 3CZJA 3P62A 1QCWA 4XD6A 5DMMA 4M1RA 4NY2A 4U4MA 3GM8A 2UV8G 3I6RA 3WQ8A 1W6TA 3O9NA 1JQXA 1W9XA 1CXHA 5BU9A 1T7LA 1V3LA 1W54A 2W0UA 3TYEA 2CBIA 3WUEA 1HGWA 1XLLA 4E0CA 3B03A 4QGCA 3GVWA 3DCPA 3P14A 1SJAA 2WQPA 4NX0A 1P0DA 4MM1A 3UU0A 5MKGA 2Z27A 3I3DA 1W3LA 1QUMA 3OP2A 4AY1A 1QHZA 2VX5A 2W63A 2J8FA 1UP2A 5KTLA 2QUNA 2OELA 3ZLFA 4MNLA 5C9RA 3B0PA 2QULA 1OADA 4GZJA 3NXFA 3CB8A 3T2QA 5LNSA 3UCDA 4MB4A 3TXZA 1LUCB 3RLVA 2ABAA 1EBHA 2YCKX 2Z1BA 3B8TA 3ARVA 3UGVA 1L0PA 1JDCA 1VJIA 2CLHA 3R0UA 2CKRA 4DZHA 3NQ7A 3QV9A 3DG6A 4GY1A 4L9XA 2XH7A 3W7IA 5DF0A 3LRMA 1P6WA 5FD0A 5DT7A 3BGAA 3URAA 1VS1A 4CU7A 1X7IA 5CJ5A 7ODCA 4E8GA 1QW7A 1NOUA 4HMEA 1CIUA 4M1BA 3S1XA 3LGGA 4YXGA 2BXZA 2PDKA 1KGXA 3CQHA 2Q8XA 4JX4A 2PAJA 2FB2A 4GKTA 2V2HA 3PHAA 1G69A 3N14A 5F4SA 5M03A 1TFVA 3XIMA 1X7FA 1O66A 4UBPC 3MMWA 1POKA 5FF2A 3BPWA 1RA0A 3A5FA 4AHOA 4ZBCA 4QQUA 5H2ZA 2WAGA 3MUCA 1S3TC 3CL7A 1G5AA 4B92A 4NX5A 4ZXOA 1TPB1 4H7ZA 4PMQA 1UKSA 2JEPA 2GDVA 2YBUA 4WXYA 3F5LA 3HU7A 3T7VA 1C29A 3PPFA 4GI9A 3EYPA 4CKQA 1HO1A 4DUOA 1ME8A 4L4OA 4ASTA 2G50A 4MPKA 2A3EA 2A3CA 3K1GA 4AZ5A 2HNEA 2YCLA 4LAMA 3S46A 2RHGA 4HP5A 1M6JA 4KT2A 1WNOA 3OVQA 1JZ4A 4EVZA 4JX5A 4UNKA 1R3SA 2Y5EA 3KRSA 1DIOA 4UTWC 1KQYA 5FEWA 3PUDA 1TV7A 2CZFA 4LS0A 1GQLA 4F3HA 5A6KA 3E49A 2IW0A 1JYNA 4FO4A 1K9TA 3KS6A 3ZFHA 3C56A 1TTJA 3L4UA 4AWSA 5KEZA 4DZAA 1H7PA 1US3A 3ABSA 1ALDA 1DQXA 1QO2A 4E4UA 2ZKMX 1GGOA 2PDHA 2CZEA 3ARXA 3O7UA 4GPNA 3IVSA 3BXWA 3DESA 3OIXA 1GOIA 4NQ1A 1V5XA 1HKIA 4NYYA 4GRSA 3QY7A 4QHRA 3WO8A 2H8XA 1B3XA 3HGRA 2XM2A 2OGJA 4B4HA 1BGGA 2EJAA 3IJ6A 4RPQA 3SN1A 2C3ZA 3RAOA 4UFIA 4W8AA 3IARA 3SCWA 3N6JA 2HDJA 2X16A 4YIWA 2QNEA 4AMCA 3WLRA 1KBBA 4ZOCA 3GW0A 3CQKA 3BMVA 4O1EA 2VVNA 1JJKA 4X9YA 3WK0A 2VYOA 1W9DM 3BAJA 2E5BA 3W29A 4HK6A 4C6EA 4IP4A 3T2PA 2EKGA 2J75A 3BOFA 3WH6A 1XQKA 1B3ZA 1ITUA 1FDYA 2WSRA 2NW0A 2C1GA 3B97A 3OVRA 3DEQA 2BOEX 1JD7A 2DVXA 1JCJA 1VR6A 4IFOA 2ZZ1A 3H7RA 4FX8A 4H2CA 2PDBA 3LENA 1VIWA 2AOSA 4F0LA 1E6SM 4LYRA 5C7HA 1R9ZA 4UQCA 2ZADA 1B54A 1V7AA 2PWVA 3H2NA 2OZ8A 5A95A 2F61A 2V5KA 4H9VA 1FWIC 3VINA 3V18A 4YLWA 2CYGA 4M3PA 3B04A 4RE0A 5HQMA 3CEPA 4WK9A 4UFKA 3LSCA 3W4RA 5C9ZA 3PZUA 3OBAA 3UG8A 1U1UA 1MXDA 4HPXA 1W5PA 3N4EA 2QCFA 1K9FA 4ZCWA 2ICSA 1JVNA 3G6LA 4MDOA 3BLEA 1W3JA 1FTXA 2POZA 1HVXA 4H9XA 4O11A 3IACA 2QW5A 3WF2A 4YTTA 3VIJA 2DJLA 1UQZA 3LUTA 1XG3A 3QOMA 1RSCA 4M6UA 3RUBL 2OLHA 1W5QA 3R58A 3QGKC 4WSJA 3WLMA 3LM3A 3U4AA 1AL7A 4HYWA 3LDVA 3VPLA 5BXRA 1WOAA 1UPPA 3WQVA 3L68A 3VTRA 4DI8A 3GK0A 5TD4A 4KS0A 3P2VA 1W1PA 5AYBA 1LP6A 3PUEA 3S1GA 1DXEA 1LYXA 3WLJA 3ZSSA 2NUYA 1SM9A 3HQ1A 2DU2A 5FAJA 1J18A 2Z1WA 2XUCA 1VRDA 3N25A 1WDWA 4DLFA 1K77A 3O06A 1NFPA 3HTWA 1VIZA 3PN8A 4GXPA 3WFZA 3PG9A 1W8SA 5LIYX 3T42A 3MZ2A 2BVWA 1LWJA 1SZEA 3UWEA 3PZ9A 4F0KA 1GVOA 3EXRA 2WVSA 3LNPA 1XW8A 3VIGA 4J9JA 4GA8A 3HIJA 4GI8A 5IRPA 4XZLX 4Z0JA 2CITA 3CUJA 3RG6A 3QPYA 3VDGA 4QDPA 3O07A 3E0WA 3P6LA 4XWUA 2X05A 1AK5A 9XIMA 3KLKA 1T8QA 3N2TA 4UTTC 3IVTA 1TPWA 4Y7EA 1HKMA 1RPXA 1PS9A 2J7GA 3TSBA 4A3RA 4HOZA 2BY0A 3LBMA 3KOZA 4KGJA 2A3HA 1D7KA 2GDUA 4P8WA 2INFA 4ICNA 1NDVA 2A6LA 1EX1A 4LF2A 1UR2A 1QASA 4GK8A 5CZ0A 4N9BA 1V02E 3FS2A 2CPUA 1EF2A 4U31A 1QWKA 3CQJA 3CT7A 3WD3A 5EBUA 3MS8A 3TP4A 1IT7A 1XM3A 1KW1A 1V51A 3URQA 1IZJA 2J7BA 3HPXA 3THDA 2XSBA 1VBHA 4MB1A 2VCBA 3AO0A 3PNZA 3SQLA 4HU3A 5GJMA 1EKOA 4RKAA 1MI3A 3GXMA 2WMFA 3RCNA 4BJHA 4S23A 3DYPA 4XZ9A 4UTJA 1PAMA 4NASA 3GVQA 1JQVA 3VGDA 4H83A 4MNJA 4J3WA 4A8IA 4US5D 4EPDC 1TUFA 3V75A 1WDQA 2XN2A 5CG0A 1H51A 4AD4A 1S2VA 1QPOA 2OZ3A 1B3OA 3CHEA 2V63A 3DX5A 1Q7ZA 2BY1A 1VEMA 4MF4A 2A3LA 1GVIA 2GJPA 3M6YA 1R3QA 3UZ5A 5I07A 1XUZA 3CV6A 1JEZA 4Y6GA 3SDOA 1OGBA 3G1HA 3WQGA 5T91A 1V0NA 3PM6A 2NVAA 5G2IA 1I0BA 4JIQA 1G01A 4NJJA 3A13A 4G7EA 3BLPX 3M41A 2Z1XA 3CPRA 5G5IA 1R87A 2DSZA 1J79A 3TR9A 3KL3A 3IV3A 1AQFA 3A3WA 1NAL1 2YFOA 2ACUA 4ZXLA 3BVJA 3CBWA 1DWFM 4G1KA 3PZMA 2XVLA 2OEKA 1OX4A 4C6NA 1I1XA 5TNVA 3WNMA 2WC7A 3AYTA 1UWRA 3TYCA 1JGIA 3PBYA 1UMYA 1E6NA 3S1WA 3PP7A 2V9DA 1ITQA 3S1VA 4PEEA 1J5TA 2PDYA 4OVXA 4PTVA 4GKLA 3LXCA 4L80A 1VENA 4P7RA 4IP5A 3SQMA 1WKDA 3AQUA 4CCZA 2BY3A 1UASA 3WH7A 3MY9A 4K68A 3HO8A 3N9RA 3EWCA 4IQJA 3CO8A 1OY0A 4IXXA 3ABQA 4V1XA 3T9PA 1FHVA 3P7YA 3TYUA 1JYWA 5FF3A 3GC2A 4K7VA 1KM0A 2OG9A 4GQBA 3CUHA 3UJFA 3EKZA 2Z6IA 4EXAA 1HJWA 1KR1A 3UXIA 3PZQA 3TA6A 1JULA 1CGWA 1V4YA 4QE4A 3M7SA 1IV8A 3TH6A 2E3ZA 1OT2A 4IZGA 2PODA 4L1WA 1EOKA 1UMLA 2XPKA 4HNLA 4K8GA 3IJ7A 3AS3A 4TV6A 1Y5WA 4D71A 2C18A 1OCNA 4GWEA 2QZRA 3F2CA 1ICQA 2R1PA 1P0KA 2PS2A 4NZ3A 3KOXA 1S5WA 2PDFA 4WR3A 3SGGA 2ZXQA 1ZGDA 3T4WA 3AYSA 5LYRA 3WY1A 2YJQA 3WH9A 2D73A 3B8DA 3NO3A 2WZHA 3GG1A 5HJXA 4UQBA 4C6OA 4UTHA 1G0CA 4S2BA 3UF9A 4Q8VA 3LGEA 4HA0A 3VD7A 5DMYA 3NGFA 4LNCA 3BLLA 3MBDA 3POCA 3KWSA 5D2XA 2O9PA 2DZSA 3DFPA 3GFYA 3RPMA 4L1XA 4QJ5B 4LUTA 3DHPA 1MFVA 4B5UA 2E9MA 4OOZA 4JN6A 2VT0A 2PGEA 1PKNA 3EXSA 4AUBA 1DE6A 4HJFA 2Y5JA 1B4KA 2ZCGA 1ZAHA 3RPDA 3LRLA 3WL0A 1OYCA 3OGSA 1FDJA 5AB3A 2G0WA 3R43A 7TIMA 3CZLA 5HDRA 1KGUA 3DKLA 1DQUA 1L8NA 3TAKA 2UY5A 4KESA 5BU6A 3TZNA 3N2MA 3AAMA 3CMJA 1RLCL 3GG8A 2WMGA 4HSOA 5K4ZA 5GNYA 3QM3A 4CD4A 2YGYA 4PFHA 1A5BA 1K1DA 4UMAA 4JY9A 5CSYA 3FY1A 3GHRA 3OGRA 3LV5A 3DECA 1W1IE 3UJ2A 3R8RA 1OG6A 2H90A 1G4EA 2OMAA 1ZBCA 1TMHA 3K46A 3GIQA 1H7OA 3UNDA 2ZTJA 3UWZA 1M9HA 4P7QA 4J28A 2ZUUA 1MVYA 2PCEA 3SQSA 4Z17A 4XQ6A 5DMLA 4FXJA 3CHCA 2BX7A 1AJ2A 1TE6A 4GH1A 3WBYA 3W7EA 3J7HA 2PWUA 4ES4A 3UWUA 4LFYA 3VNIA 2QCNA 4QRNA 1DP0A 3TVAA 1XSKA 1SQ7A 5FACA 3CHVA 1W9PA 3BSHA 1DXIA 4BQ5A 3WEMA 2C19A 3LHWA 4FIRA 3MHUA 2NT1A 4YVVA 3REQA 5A1AA 4BQ3A 3N73A 1D3CA 5LHFA 4AD1A 2WKGA 3EWZA 3FEQA 4PUJA 4IFKB 2CLLA 2Q8ZA 3GDLA 4PL1A 1OFPA 3RYSA 4JL1A 5KITA 1TV2A 1ZCOA 1EPVA 2ZA2A 4KWWA 2BHUA 4JIPA 4DWSA 3JZUA 3W28A 2OODA 3WMSA 1P0NA 3HG3A 3M4HA 3N4AA 1HKJA 1OZMA 2VENA 5I02A 1LT7A 4MNKA 1AMYA 4FNQA 3GC4A 4HK7A 3RITA 4ONVA 3LLXA 2Y6ZA 1EOMA 1JG9A 1QOPA 1J0YA 4PB3A 2A3BA 3TUUA 1E6XM 3R8HA 3LPGA 1W2PA 3TZFA 1HKWA 2HPIA 1WBJA 1D8CA 3NDOA 2WLZA 3W1NA 2QEZA 3WBAA 2X1SA 3TEVA 1Q2SA 1E4LA 1T96A 4WGXA 5GJNA 3VILA 2INZA 1ONRA 4O4VA 1S46A 3VIPA 5H6HA 4QE1A 3DOPA 1BG4A 2ZRWA 4KKXA 2YXOA 5CQ1A 2A79A 4ALDA 1P7TB 5A8OA 2X7WA 1XP3A 1XIGA 3AIWA 4IHCA 3GSMA 1MUWA 1OYAA 3QW4B 1UOZA 3WK3A 2VD8A 3G8EA 3ZVIA 1HW6A 2PGFA 2O9OA 1UW9A 1BXBA 2OOGA 1RP9A 4ZQOA 3GTXA 3ONBA 1XCXA 2Y2WA 1E5NA 3ITXA 4LCSA 4ZENA 2F9RA 3BJSA 1HGYA 2OB3A 3O05A 3WK1A 1HJSA 4B3ZA 2W6RA 1WKYA 4GYPC 1NDZA 3NPUA 4HNOA 4H8VA 3AMLA 7REQA 3QMSA 3PBMA 1JI2A 1JCTA 2ZZ4A 3XISA 3SCPA 3DZ1A 1NP0A 6ALDA 1QFEA 2CFFA 5A6BA 1O5QA 3PPCA 3WLSA 4A3HA 2Z1VA 1FCBA 4EANA 2Z25A 5T9CE 4DUXA 3W6MA 3VXGA 4P7LA 3FGCA 2W27A 5K7JA 2X1TA 1EUAA 3HGOA 3I3BA 5CC5A 1YPXA 4NZJA 3N3TA 2GVLA 5H91A 2J78A 1EB3A 4QE5A 4LEQA 3TN4A 2INEA 4BR1A 4C6CA 4OZOA 1GHSA 1UWSA 4ATWA 1IWBA 3WQDA 1TA3B 1V77A 5CC3A 4E8DA 4HSNA 3K2GA 3QSTA 1ODZA 3NZPA 5G1TA 1THFD 2P5NA 2WNNA 2C79A 4AZGA 2ZWZA 2GJXA 4E4PA 5IDZA 4GUGA 4LAOA 1Y0EA 5BOOA 1J12A 4HVXA 3WEZA 4ZO6A 2DH3A 3D5HA 1VFTA 3OG2A 5IHSA 3H24A 2FGLA 1ZAIA 1U5HA 2BGQA 1ZFJA 3W7RA 5D30A 2XU2A 3AYRA 1Q6QA 1VEOA 1K8CA 3T08A 4XAYA 4ZA0A 3CXOA 1RVGA 4WQ6A 3JRKA 3C3UA 3FDGA 4X3ZA 3VAVA 3CAVA 3RM4A 4PUEA 3W7KA 4US5A 1H50A 4IL2A 1OIMA 4JYFA 3ZJ8A 1AW2A 2WANA 1YDOA 1WP6A 2BY2A 3A4AA 3P80A 4UTWA 2JALA 1LTDA 3BAKA 3NQVA 3N4FA 3GXDA 4C7DA 2FB3A 5HANA 2CXEA 5LA2A 1KCXA 2XG9A 4NZ4A 4FR1A 5U7SA 1L6SA 4P5UA 5D38A 3MWCA 1BTCA 2HE8A 1RY0A 2WNZA 4AMAA 2E7FA 4A22A 3HFYA 4DWDA 1MXGA 4Q8UA 3KDNA 3NVTA 3WNLA 4JNMA 2XN0A 3SECA 3QZ6A 1XH0A 1FKWA 2AQVA 1J11A 1MNZA 1OEPA 1VFLA 1XLEA 3ALGA 4Q4KA 4YTQA 3L0GA 1ITCA 4S3EA 1RXOB 4ZQRA 3LGDA 2Z24A 4V1YA 1OFRA 1B31A 3VFCA 1OFOA 2P3EA 2D23A 1LROA 5D9OA 1AZ2A 2YLLA 2OR2A 3U5YA 5K4XA 1FHDA 3W2JA 1KM6A 3ANYA 5D2TA 1J96A 3IANA 3POHA 2WBGA 1E1FA 1ZCCA 1E1CA 4JFSA 3C8NA 1QI2A 5D02A 1F6KA 4O50A 4CQDA 3ZR6A 3KRUA 1CTNA 1R86A 3HG5A 4GJ1A 2GVYA 4EKJA 5C9WA 1TVLA 3ZVHA 1YTEA 3M5YA 5EY5A 5BOEA 4QQ3A 1X8FA 4NZFA 3NQBA 4S3JA 2IUZA 3BOLA 3LZ3A 2QGHA 5T26A 1VCGA 4H19A 5BCAA 2J7HA 3IIOA 1MDLA 1LG2A 1KBJA 2D2HA 4WIWA 4NNCA 3QR3A 1HZYA 5HWNA 4RXFA 3QKEA 1XLHA 2ZZ3A 2G8ZA 5CBJA 4JQAA 3ARRA 5TF0A 4WEVX 2JQXA 4PA8A 1Q6GA 3IVUA 3M0YA 2AGTA 2VX6A 3DKJA 3B4YA 4GNKB 4MHBA 1PL9A 4I8DA 4IG2A 4DB7A 3FX4A 1E72M 1BKSA 2CNCA 1GJPA 5FI8A 3MCMA 2PA6A 2ZFAA 1Q63A 3LPPA 2HVMA 3A47A 2P8CA 1TPVA 3V4BA 4BK9A 4WVXA 2OKOA 5KZEA 2V82A 5KZMA 4ACZB 2GOKA 2VZUA 2Y88A 1OFBA 3G0XA 1W91A 5DCDA 3S5OA 2QCCA 4F2TA 3TW7A 4IUGA 3U2EA 4HZ8A 3GC5A 2WZIA 5K2ZA 1BEUA 1W56A 1EXBA 5E93A 3AICA 1F6PA 2B0MA 2Y8KA 3N1AA 1WUFA 4CN1A 4WLCA 5CJNA 3TOYA 1QOQA 1SMAA 3C6CA 4GI4A 1KM5A 3QQWA 1JRCA 4O12A 1PIGA 2FDSA 2R8WA 4ZSTA 5I3DA 3WCZA 4Z42C 1YX1A 4MUZA 4KIRA 4ERGA 3H8AA 5H1WA 2J77A 3NM1A 1QNQA 3O6DA 2GGIA 2W79A 1IWPA 2QR6A 4IMDA 4Q8PA 2GVGA 5HMEA 4NP7A 1QBBA 2FFCA 2RDTA 3D3AA 2VX4A 4EX4A 4MFDA 3WDHA 3TYZA 1KFKA 1E4MM 1TWWA 5JMUA 4HMDA 4XIAA 4LB4A 2J8TA 2JIWA 2ZZ7A 4AZCB 2V5CA 2R1NA 4AD5A 1O5XA 2FJKA 1JYVA 3CPUA 3BQ5A 3UR7A 3PK7A 1QI0A 3VKDA 3W83A 3AIUA 2XFYA 4F9JA 2W66A 3KRBA 5G2WA 4UIOA 3E3HA 3GB6A 5GNXA 3DG7A 2ZWYA 4PB5A 1OFQA 3LHTA 2WM0A 1EQPA 2UY2A 4E8CA 3GLCA 3KE0A 1FHLA 1ZJBA 2VZSA 3ZOAA 1IQ8A 2GQ3A 2HEJA 3IIVA 3T0DA 1VCVA 2VFDA 2XM1A 3UXKA 1EFZA 2QPXA 2R94A 4QR6A 3GW3A 3MHFA 4AU0A 1NOFA 3BANA 1VPQA 3BCFA 3RRXA 3FJ6A