3FAPA

Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
molecule keywords FK506-BINDING PROTEIN
molecule tags Cell cycle
source organism Homo sapiens
total genus 24
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3fapA00
4ODMA 3TCZA 4QIBA 4JFKA 1FKTA 1T11A 1EQ3A 2RUCA 4R0XA 2PPPA 1NMWA 2KGJA 4TW8A 3JYMA 4C02B 1JNTA 1FKSA 2D9FA 1ROTA 3O5RA 3MDYB 2RUDA 2F21A 4FN2A 2DG4A 1L1PA 4DZ2A 3GPKA 1YW5A 2PV3A 3CGMA 4LAVA 2MLXA 1FJDA 1W26A 3TDBA 1QPLA 3KAIA 4ITZA 4W9PA 4LAXA 1A7XA 2XP4A 1Q6HA 1FKDA 4QT2A 1ROUA 4ODPA 5I98A 5HT1A 3O5OA 1Q6UA 3OOBA 4JFJA 5D75A 2PPNA 1J4HA 3O5JA 4TX0A 3I6CA 2ZR5A 1FKGA 4TYOA 4FAPA 1C9HA 3IKDA 3FAPA 4TW7A 3IKGA 2MNTA 4NNRA 2RSEA 4N19A 2RQSA 4O2TA 1PINA 1PBKA 3RGCA 4G2PA 5HW6A 2UZ5A 2XP7A 4JFIA 5B8IC 2XPBA 4MGVA 3IK8A 1Q6IA 4MSPA 2KFWA 1NSGA 3ODKA 1YATA 2L2SA 4ODRA 3O5GA 3O5MA 1BL4A 2KR7A 3KACA 3UQBA 4DRHA 2RURA 2ZQUA 4DRIA 1FKFA 3O5QA 4ODNA 5HKGA 1JNSA 2XP9A 3H9RB 4DRJA 2PPOA 1J6YA 1FAPA 4DRPA 2ITKA 3VAWA 4JYSA 4ODKA 5DIUA 2AWGA 2KI3A 1NMVA 2M1IA 1D7IA 2K8IA 3KCEA 4QT3A 3WH0A 2M2AA 1Y0OA 1F40A 2OFNA 1D7JA 2PBCA 2XP3A 3UI4A 2FAPA 2KO7A 1FKIA 3KABA 3NI6A 2LGOA 3TC5A 3PRBA 3JXVA 4G50A 4W9QA 1N1AA 1FKJA 2DG3A 2KE0A 2LPVA 4LAWA 1B6CA 3RFWA 4DRQA 4J4OA 4GIVA 1FKBA 2XP8A 5J6EA 2VCDA 3KAHA 3PA7A 1KT0A 3IHZA 4DRMA 2MLYA 4J4NA 2ZQTA 2XP6A 3KAGA 4LAYA 4TNSA 4ODLA 1ZCNA 3O5KA 4JFLA 5HTGA 3UI6A 5HWCA 3UQAA 1D6OA 4TW6A 2M08A 3O5LA 3LUOA 1R9HA 1ZK6A 2LKNA 4U86A 1FKLA 1M5YA 2Y78A 2DG9A 3B7XA 4U84A 3JYJA 2RUQA 5GPGA 2ZQSA 2IF4A 4DT4A 2PV2A 3O5EA 1U79A 3O5FA 4W9OA 4DROA 1J4RA 3O5PA 1FKHA 2VN1A 4IPXA 5HWBA 5HUAA 2F4EA 3KZ7A 4GGQA 5DIVA 5BXJA 1FD9A 2JZVA 1FKRA 2ZR6A 3KADA 1P5QA 4JFMA 1J4IA 4IQ2A 1QPFA 2XPAA 2ZQVA 1KT1A 1F8AB 2ZR4A 5HW7A 1QZ2A 4DRKA 2FKEA 1EYMA 2PV1A 2XP5A 3CGNA 3UQIA 2N87A 3O5IA 1HXVA 5HW8A 3EY6A 3NRKA 3UI5A 4DRNA 1BKFA 2F2DA 4U85A 4DIPA 4DZ3A 2MPHA 5DITA 4ODQA 1JVWA 3O5DA 2LJ4A 3PRDA 2MLZA 1D7HA 3KAFA 1FKKA 4ODOA 4BF8A 3UF8A 1Q1CA 2Q5AA 4IQCA 2MF9A 3NTPA 4DH0A 1TCOC
chains in the Genus database with same CATH superfamily
4ZPTR 1EQ3A 1E9LA 4C02B 1FKSA 2F21A 4ZPWR 1CTNA 3WD0A 2XP4A 1Q6HA 1UR9A 4ODPA 4Z2KA 2DSVA 4MNKA 1Q6UA 4HBEA 2IUZA 1C9HA 2RSEA 4N19A 2RQSA 4O2TA 3CHEA 1E6NA 3IK8A 1K9TA 3CZ8A 4R5EA 3BMBA 4MNJA 4ODRA 3ARXA 3O5MA 3UQBA 2RURA 2ZQUA 1FKFA 1ITXA 2B31A 1ZBWA 1NMVA 2K8IA 3BXWA 2M2AA 1LG2A 2PBCA 3UI4A 2LGOA 3PRBA 1JNDA 4ZS6A 1FKJA 4J4OA 3PA7A 2MLYA 4TNSA 4ODLA 1GRJA 3UI6A 2M08A 3O5LA 4MAVA 3AS3A 3RM4A 1E44A 3JYJA 3RMEA 2PV2A 3ARPA 5DIVA 5BXJA 2ZR6A 3GU0A 1ZU8A 4JFMA 1J4IA 1GUVA 4IQ2A 3WIJA 1F8AB 3PR9A 4Z2GA 1E6PA 2ZR4A 2FKEA 3CGNA 3O5IA 1HKMA 3CH9A 5HW8A 3PRAA 3UI5A 4U85A 2MPHA 4ODQA 1JVWA 3O5DA 4NSBA 1FKKA 3WL1A 2AOSA 4DH0A 2DT2A 1H0IA 1TCOC 3TCZA 4QIBA 4JFKA 1T11A 2RUCA 3AS1A 2PPPA 1NMWA 2EULA 2KGJA 1JNTA 1X6NA 4WJXA 2RUDA 3ARTA 4Z2IA 2DG4A 4MNMA 3GPKA 4DWSD 4Q7NA 1YW5A 1FJDA 4LAVA 1W26A 1OGBA 4LAXA 1E6RA 2P4VA 1NWSA 3AQUA 3OOBA 1LL7A 2DSUA 2ZR5A 3FAPA 2MNTA 4NNRA 4UDMA 1LJYA 1LQ0A 1PINA 3G6LA 4WKFA 3RGCA 2UZ5A 5DO2A 4P8XA 3CHCA 4MGVA 1NWUA 1Q6IA 1NSGA 1TFVA 4DWSB 4L72B 3B9EA 4HARA 1BL4A 3KACA 4DRIA 3O5QA 4ODNA 5HKGA 4Z2LA 1JNSA 3ARQA 2A3EA 4JYSA 1W9VA 2WM0A 3GTYX 5DIUA 2KI3A 1EIBA 3ALGA 2M1IA 1D7IA 1D2KA 3WH0A 3ARYA 1W1PA 1FKIA 3KABA 4ZPVR 4W5UA 4W9QA 4LAWA 4DRQA 3RFWA 1ZBKA 4GIVA 2XP8A 1NWRA 3RM9A 1HJWA 1KT0A 3IHZA 4DRMA 4URIA 1VF8A 3O5KA 4JFLA 5HTGA 5HWCA 2ETNA 1D6OA 1FFRA 4TW6A 4Z2HA 1GPFA 1JNEA 1ZK6A 2LKNA 4U86A 1M5YA 3B7XA 2RUQA 1W1VA 5GPGA 2FDMA 3O5EA 3FY1A 3UQAA 4IPXA 3KZ7A 4GGQA 1FKRA 2JZVA 1QPFA 1UR8A 3ALFA 2PV1A 3UQIA 3AROA 3EY6A 4DRNA 2WLYA 2A3BA 4DIPA 5DITA 3ARUA 1W9PA 2LJ4A 1D7HA 3KAFA 4BF8A 2Q5AA 4IQCA 1L1PA 1SR0A 4R0XA 4TW8A 3JYMA 3O5RA 4FN2A 1NWTA 4DZ2A 1H0GA 4KR0B 1KFWA 1FFQA 1QPLA 3KAIA 4W9PA 1FKDA 4QT2A 1WB0A 4XAKA 3CHFA 4S3JA 5HT1A 5D75A 2PPNA 1J4HA 3ARWA 3O5JA 3OA5A 3I6CA 4NZCA 4Q22A 4TX0A 5DF0A 4TW7A 1XHGA 2O92A 1HKKA 1ZBCA 4DWSA 4G2PA 5HW6A 1HJXA 5B8IC 2PI6A 2XP7A 1E15A 4MSPA 2KFWA 2DPEA 3ODKA 2KR7A 2O9OA 4DRHA 3B9AA 2YBTA 3H9RB 4DRJA 3EIPA 1FAPA 2ITKA 3VAWA 4ODKA 2AWGA 4WKHA 2WLZA 1Y0OA 1F40A 1LL6A 2YBUA 1HKIA 2DT3A 2XP3A 2B5UB 3AS2A 3WD4A 3JXVA 1N1AA 2KE0A 2LPVA 1HKJA 1EDQA 4MTVA 3B9DA 4LAYA 4ML4A 3ARZA 1W1YA 4S3KA 3WD2A 3ARSA 3LUOA 3FXYA 2Y78A 2DG9A 2ZQSA 4DT4A 1U79A 4MNLA 3O5PA 1SYTA 2VN1A 5HWBA 3WD1A 2F4EA 1FD9A 3KADA 4KQZA 4AY1A 3B8SA 1KT1A 5HW7A 1GOIA 1QZ2A 4DRKA 1ZL1A 2XP5A 4IT6A 3W4RA 2N87A 1HXVA 2DSWA 2G41A 4DZ3A 1BKFA 4P8UA 4Z2JA 4MPKA 1ZB5A 1ZBVA 2DSZA 3CHDA 3UF8A 2MF9A 3NTPA 4P8WA 4ODMA 1FKTA 4WIWA 2D9FA 1ROTA 2F23A 3MDYB 4LGXA 2PV3A 3CGMA 2MLXA 3TDBA 4ITZA 1OWQA 1O6IA 1A7XA 1ROUA 1XRVA 3G6MA 5I98A 3O5OA 1W1TA 4JFJA 3WQWA 4TYOA 1FKGA 4FAPA 3IKDA 3IKGA 4HBOA 4IT4A 1PBKA 3WQVA 1IX5A 4JFIA 1E6ZA 2XPBA 1EHNA 3QOKA 5JH8A 1YATA 2DT0A 2L2SA 3O5GA 2A3CA 1WNOA 3WKZA 2XP9A 2A3AA 3WL0A 2PPOA 1J6YA 4DRPA 2PN0A 4WK9A 1JCHB 1RD6A 5DEZA 3KCEA 4QT3A 2OFNA 1D7JA 2FAPA 2KO7A 3NI6A 1W9UA 3TC5A 4G50A 2DG3A 1B6CA 3RM8A 1FKBA 5J6EA 2VCDA 3KAHA 4J4NA 2ZQTA 2XP6A 1X6LA 3ARVA 3KAGA 4WKAA 1ZCNA 2ESCA 3AS0A 2DT1A 1R9HA 4PTMA 1FKLA 1LL4A 4U84A 1NH6A 2G8ZA 4L3NA 2IF4A 5HBFA 3O5FA 4W9OA 4DROA 4DWSC 1J4RA 1FKHA 5HUAA 2OLHA 1P5QA 5GPRA 4P8VA 3ARRA 2XPAA 2ZQVA 1LG1A 2WK2A 1WAWA 2QF8A 1EYMA 1OGGA 3WD3A 3NRKA 4QZVB 2F2DA 3PRDA 2MLZA 4ODOA 1HJVA 1Q1CA 5GQBA
chains in the Genus database with same CATH topology
4ZPTR 1EQ3A 1E9LA 4C02B 1FKSA 2F21A 4ZPWR 1CTNA 3WD0A 2XP4A 1Q6HA 1UR9A 4ODPA 4Z2KA 2DSVA 4MNKA 1Q6UA 4HBEA 2IUZA 1C9HA 2RSEA 4N19A 2RQSA 4O2TA 3CHEA 1E6NA 3IK8A 1K9TA 3CZ8A 4R5EA 4MNJA 4ODRA 3ARXA 3O5MA 3UQBA 2RURA 2ZQUA 1FKFA 1ITXA 2B31A 1ZBWA 1NMVA 2K8IA 3BXWA 2M2AA 1LG2A 2PBCA 3UI4A 2LGOA 3PRBA 1JNDA 4ZS6A 1FKJA 4J4OA 3PA7A 2MLYA 4TNSA 4ODLA 3UI6A 2M08A 3O5LA 4MAVA 3AS3A 3RM4A 3JYJA 3RMEA 2PV2A 3ARPA 5DIVA 5BXJA 2ZR6A 1ZU8A 4JFMA 1J4IA 1GUVA 4IQ2A 3WIJA 1F8AB 3PR9A 4Z2GA 1E6PA 2ZR4A 2FKEA 3CGNA 3O5IA 1HKMA 3CH9A 5HW8A 3PRAA 3UI5A 4U85A 2MPHA 4ODQA 1JVWA 3O5DA 4NSBA 1FKKA 3WL1A 2AOSA 4DH0A 2DT2A 1H0IA 1TCOC 3TCZA 4QIBA 4JFKA 1T11A 2RUCA 3AS1A 2PPPA 1NMWA 2KGJA 1JNTA 1X6NA 4WJXA 2RUDA 3ARTA 4Z2IA 2DG4A 4MNMA 3GPKA 4DWSD 4Q7NA 1YW5A 1FJDA 4LAVA 1W26A 1OGBA 4LAXA 1E6RA 1NWSA 3AQUA 3OOBA 1LL7A 2DSUA 2ZR5A 3FAPA 2MNTA 4NNRA 1LJYA 1LQ0A 1PINA 3G6LA 4WKFA 3RGCA 2UZ5A 5DO2A 4P8XA 3CHCA 4MGVA 1NWUA 1Q6IA 1NSGA 1TFVA 4DWSB 4L72B 3B9EA 4HARA 1BL4A 3KACA 4DRIA 3O5QA 4ODNA 5HKGA 4Z2LA 1JNSA 3ARQA 2A3EA 4JYSA 1W9VA 2WM0A 5DIUA 2KI3A 1EIBA 3ALGA 2M1IA 1D7IA 1D2KA 3WH0A 3ARYA 1W1PA 1FKIA 3KABA 4ZPVR 4W5UA 4W9QA 4LAWA 4DRQA 3RFWA 1ZBKA 4GIVA 2XP8A 1NWRA 3RM9A 1HJWA 1KT0A 3IHZA 4DRMA 4URIA 1VF8A 3O5KA 4JFLA 5HTGA 5HWCA 1D6OA 1FFRA 4TW6A 4Z2HA 1GPFA 1JNEA 1ZK6A 2LKNA 4U86A 1M5YA 3B7XA 2RUQA 1W1VA 5GPGA 2FDMA 3O5EA 3FY1A 3UQAA 4IPXA 3KZ7A 4GGQA 1FKRA 2JZVA 1QPFA 1UR8A 3ALFA 2PV1A 3UQIA 3AROA 3EY6A 4DRNA 2WLYA 2A3BA 4DIPA 5DITA 3ARUA 1W9PA 2LJ4A 1D7HA 3KAFA 4BF8A 2Q5AA 4IQCA 1L1PA 1SR0A 4R0XA 4TW8A 3JYMA 3O5RA 4FN2A 1NWTA 4DZ2A 1H0GA 4KR0B 1KFWA 1FFQA 1QPLA 3KAIA 4W9PA 1FKDA 4QT2A 1WB0A 4XAKA 3CHFA 4S3JA 5HT1A 5D75A 2PPNA 1J4HA 3ARWA 3O5JA 3OA5A 3I6CA 4NZCA 4Q22A 4TX0A 5DF0A 4TW7A 1XHGA 2O92A 1HKKA 1ZBCA 4DWSA 4G2PA 5HW6A 1HJXA 5B8IC 2PI6A 2XP7A 1E15A 4MSPA 2KFWA 2DPEA 3ODKA 2KR7A 2O9OA 4DRHA 3B9AA 2YBTA 3H9RB 4DRJA 1FAPA 2ITKA 3VAWA 4ODKA 2AWGA 4WKHA 2WLZA 1Y0OA 1F40A 1LL6A 2XP3A 1HKIA 2DT3A 2YBUA 3AS2A 3WD4A 3JXVA 1N1AA 2KE0A 2LPVA 1HKJA 1EDQA 4MTVA 3B9DA 4LAYA 4ML4A 3ARZA 1W1YA 4S3KA 3WD2A 3ARSA 3LUOA 3FXYA 2Y78A 2DG9A 2ZQSA 4DT4A 1U79A 4MNLA 3O5PA 1SYTA 2VN1A 5HWBA 3WD1A 2F4EA 1FD9A 3KADA 4KQZA 4AY1A 3B8SA 1KT1A 5HW7A 1GOIA 1QZ2A 4DRKA 1ZL1A 2XP5A 4IT6A 3W4RA 2N87A 1HXVA 2DSWA 2G41A 4DZ3A 1BKFA 4P8UA 4Z2JA 4MPKA 1ZB5A 1ZBVA 2DSZA 3CHDA 3UF8A 2MF9A 3NTPA 4P8WA 4ODMA 1FKTA 4WIWA 2D9FA 1ROTA 3MDYB 4LGXA 2PV3A 3CGMA 2MLXA 3TDBA 4ITZA 1OWQA 1O6IA 1A7XA 1ROUA 1XRVA 3G6MA 5I98A 3O5OA 1W1TA 4JFJA 3WQWA 4TYOA 1FKGA 4FAPA 3IKDA 3IKGA 4HBOA 4IT4A 1PBKA 3WQVA 1IX5A 4JFIA 1E6ZA 2XPBA 1EHNA 3QOKA 5JH8A 1YATA 2DT0A 2L2SA 3O5GA 2A3CA 1WNOA 3WKZA 2XP9A 2A3AA 3WL0A 2PPOA 1J6YA 4DRPA 4WK9A 1RD6A 5DEZA 3KCEA 4QT3A 2OFNA 1D7JA 2FAPA 2KO7A 3NI6A 1W9UA 3TC5A 4G50A 2DG3A 1B6CA 3RM8A 1FKBA 5J6EA 2VCDA 3KAHA 4J4NA 2ZQTA 2XP6A 1X6LA 3ARVA 3KAGA 4WKAA 1ZCNA 2ESCA 3AS0A 2DT1A 1R9HA 4PTMA 1FKLA 1LL4A 4U84A 1NH6A 2G8ZA 4L3NA 2IF4A 5HBFA 3O5FA 4W9OA 4DROA 4DWSC 1J4RA 1FKHA 5HUAA 2OLHA 1P5QA 5GPRA 4P8VA 3ARRA 2XPAA 2ZQVA 1LG1A 2WK2A 1WAWA 2QF8A 1EYMA 1OGGA 3WD3A 3NRKA 4QZVB 2F2DA 3PRDA 2MLZA 4ODOA 1HJVA 1Q1CA 5GQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODM A;  3TCZ A;  4QIB A;  4JFK A;  1FKT A;  1T11 A;  1EQ3 A;  2RUC A;  4R0X A;  2PPP A;  1NMW A;  2KGJ A;  4TW8 A;  3JYM A;  4C02 B;  1JNT A;  1FKS A;  2D9F A;  1ROT A;  3O5R A;  3MDY B;  2RUD A;  2F21 A;  4FN2 A;  2DG4 A;  1L1P A;  4DZ2 A;  3GPK A;  1YW5 A;  2PV3 A;  3CGM A;  4LAV A;  2MLX A;  1FJD A;  1W26 A;  3TDB A;  1QPL A;  3KAI A;  4ITZ A;  4W9P A;  4LAX A;  1A7X A;  2XP4 A;  1Q6H A;  1FKD A;  4QT2 A;  1ROU A;  4ODP A;  5I98 A;  5HT1 A;  3O5O A;  1Q6U A;  3OOB A;  4JFJ A;  5D75 A;  2PPN A;  1J4H A;  3O5J A;  4TX0 A;  3I6C A;  2ZR5 A;  1FKG A;  4TYO A;  4FAP A;  1C9H A;  3IKD A;  3FAP A;  4TW7 A;  3IKG A;  2MNT A;  4NNR A;  2RSE A;  4N19 A;  2RQS A;  4O2T A;  1PIN A;  1PBK A;  3RGC A;  4G2P A;  5HW6 A;  2UZ5 A;  2XP7 A;  4JFI A;  5B8I C;  2XPB A;  4MGV A;  3IK8 A;  1Q6I A;  4MSP A;  2KFW A;  1NSG A;  3ODK A;  1YAT A;  2L2S A;  4ODR A;  3O5G A;  3O5M A;  1BL4 A;  2KR7 A;  3KAC A;  3UQB A;  4DRH A;  2RUR A;  2ZQU A;  4DRI A;  1FKF A;  3O5Q A;  4ODN A;  5HKG A;  1JNS A;  2XP9 A;  3H9R B;  4DRJ A;  2PPO A;  1J6Y A;  1FAP A;  4DRP A;  2ITK A;  3VAW A;  4JYS A;  4ODK A;  5DIU A;  2AWG A;  2KI3 A;  1NMV A;  2M1I A;  1D7I A;  2K8I A;  3KCE A;  4QT3 A;  3WH0 A;  2M2A A;  1Y0O A;  1F40 A;  2OFN A;  1D7J A;  2PBC A;  2XP3 A;  3UI4 A;  2FAP A;  2KO7 A;  1FKI A;  3KAB A;  3NI6 A;  2LGO A;  3TC5 A;  3PRB A;  3JXV A;  4G50 A;  4W9Q A;  1N1A A;  1FKJ A;  2DG3 A;  2KE0 A;  2LPV A;  4LAW A;  1B6C A;  3RFW A;  4DRQ A;  4J4O A;  4GIV A;  1FKB A;  2XP8 A;  5J6E A;  2VCD A;  3KAH A;  3PA7 A;  1KT0 A;  3IHZ A;  4DRM A;  2MLY A;  4J4N A;  2ZQT A;  2XP6 A;  3KAG A;  4LAY A;  4TNS A;  4ODL A;  1ZCN A;  3O5K A;  4JFL A;  5HTG A;  3UI6 A;  5HWC A;  3UQA A;  1D6O A;  4TW6 A;  2M08 A;  3O5L A;  3LUO A;  1R9H A;  1ZK6 A;  2LKN A;  4U86 A;  1FKL A;  1M5Y A;  2Y78 A;  2DG9 A;  3B7X A;  4U84 A;  3JYJ A;  2RUQ A;  5GPG A;  2ZQS A;  2IF4 A;  4DT4 A;  2PV2 A;  3O5E A;  1U79 A;  3O5F A;  4W9O A;  4DRO A;  1J4R A;  3O5P A;  1FKH A;  2VN1 A;  4IPX A;  5HWB A;  5HUA A;  2F4E A;  3KZ7 A;  4GGQ A;  5DIV A;  5BXJ A;  1FD9 A;  2JZV A;  1FKR A;  2ZR6 A;  3KAD A;  1P5Q A;  4JFM A;  1J4I A;  4IQ2 A;  1QPF A;  2XPA A;  2ZQV A;  1KT1 A;  1F8A B;  2ZR4 A;  5HW7 A;  1QZ2 A;  4DRK A;  2FKE A;  1EYM A;  2PV1 A;  2XP5 A;  3CGN A;  3UQI A;  2N87 A;  3O5I A;  1HXV A;  5HW8 A;  3EY6 A;  3NRK A;  3UI5 A;  4DRN A;  1BKF A;  2F2D A;  4U85 A;  4DIP A;  4DZ3 A;  2MPH A;  5DIT A;  4ODQ A;  1JVW A;  3O5D A;  2LJ4 A;  3PRD A;  2MLZ A;  1D7H A;  3KAF A;  1FKK A;  4ODO A;  4BF8 A;  3UF8 A;  1Q1C A;  2Q5A A;  4IQC A;  2MF9 A;  3NTP A;  4DH0 A;  1TCO C; 
#chains in the Genus database with same CATH topology
 4ZPT R;  1EQ3 A;  1E9L A;  4C02 B;  1FKS A;  2F21 A;  4ZPW R;  1CTN A;  3WD0 A;  2XP4 A;  1Q6H A;  1UR9 A;  4ODP A;  4Z2K A;  2DSV A;  4MNK A;  1Q6U A;  4HBE A;  2IUZ A;  1C9H A;  2RSE A;  4N19 A;  2RQS A;  4O2T A;  3CHE A;  1E6N A;  3IK8 A;  1K9T A;  3CZ8 A;  4R5E A;  3BMB A;  4MNJ A;  4ODR A;  3ARX A;  3O5M A;  3UQB A;  2RUR A;  2ZQU A;  1FKF A;  1ITX A;  2B31 A;  1ZBW A;  1NMV A;  2K8I A;  3BXW A;  2M2A A;  1LG2 A;  2PBC A;  3UI4 A;  2LGO A;  3PRB A;  1JND A;  4ZS6 A;  1FKJ A;  4J4O A;  3PA7 A;  2MLY A;  4TNS A;  4ODL A;  1GRJ A;  3UI6 A;  2M08 A;  3O5L A;  4MAV A;  3AS3 A;  3RM4 A;  1E44 A;  3JYJ A;  3RME A;  2PV2 A;  3ARP A;  5DIV A;  5BXJ A;  2ZR6 A;  3GU0 A;  1ZU8 A;  4JFM A;  1J4I A;  1GUV A;  4IQ2 A;  3WIJ A;  1F8A B;  3PR9 A;  4Z2G A;  1E6P A;  2ZR4 A;  2FKE A;  3CGN A;  3O5I A;  1HKM A;  3CH9 A;  5HW8 A;  3PRA A;  3UI5 A;  4U85 A;  2MPH A;  4ODQ A;  1JVW A;  3O5D A;  4NSB A;  1FKK A;  3WL1 A;  2AOS A;  4DH0 A;  2DT2 A;  1H0I A;  1TCO C;  3TCZ A;  4QIB A;  4JFK A;  1T11 A;  2RUC A;  3AS1 A;  2PPP A;  1NMW A;  2EUL A;  2KGJ A;  1JNT A;  1X6N A;  4WJX A;  2RUD A;  3ART A;  4Z2I A;  2DG4 A;  4MNM A;  3GPK A;  4DWS D;  4Q7N A;  1YW5 A;  1FJD A;  4LAV A;  1W26 A;  1OGB A;  4LAX A;  1E6R A;  2P4V A;  1NWS A;  3AQU A;  3OOB A;  1LL7 A;  2DSU A;  2ZR5 A;  3FAP A;  2MNT A;  4NNR A;  4UDM A;  1LJY A;  1LQ0 A;  1PIN A;  3G6L A;  4WKF A;  3RGC A;  2UZ5 A;  5DO2 A;  4P8X A;  3CHC A;  4MGV A;  1NWU A;  1Q6I A;  1NSG A;  1TFV A;  4DWS B;  4L72 B;  3B9E A;  4HAR A;  1BL4 A;  3KAC A;  4DRI A;  3O5Q A;  4ODN A;  5HKG A;  4Z2L A;  1JNS A;  3ARQ A;  2A3E A;  4JYS A;  1W9V A;  2WM0 A;  3GTY X;  5DIU A;  2KI3 A;  1EIB A;  3ALG A;  2M1I A;  1D7I A;  1D2K A;  3WH0 A;  3ARY A;  1W1P A;  1FKI A;  3KAB A;  4ZPV R;  4W5U A;  4W9Q A;  4LAW A;  4DRQ A;  3RFW A;  1ZBK A;  4GIV A;  2XP8 A;  1NWR A;  3RM9 A;  1HJW A;  1KT0 A;  3IHZ A;  4DRM A;  4URI A;  1VF8 A;  3O5K A;  4JFL A;  5HTG A;  5HWC A;  2ETN A;  1D6O A;  1FFR A;  4TW6 A;  4Z2H A;  1GPF A;  1JNE A;  1ZK6 A;  2LKN A;  4U86 A;  1M5Y A;  3B7X A;  2RUQ A;  1W1V A;  5GPG A;  2FDM A;  3O5E A;  3FY1 A;  3UQA A;  4IPX A;  3KZ7 A;  4GGQ A;  1FKR A;  2JZV A;  1QPF A;  1UR8 A;  3ALF A;  2PV1 A;  3UQI A;  3ARO A;  3EY6 A;  4DRN A;  2WLY A;  2A3B A;  4DIP A;  5DIT A;  3ARU A;  1W9P A;  2LJ4 A;  1D7H A;  3KAF A;  4BF8 A;  2Q5A A;  4IQC A;  1L1P A;  1SR0 A;  4R0X A;  4TW8 A;  3JYM A;  3O5R A;  4FN2 A;  1NWT A;  4DZ2 A;  1H0G A;  4KR0 B;  1KFW A;  1FFQ A;  1QPL A;  3KAI A;  4W9P A;  1FKD A;  4QT2 A;  1WB0 A;  4XAK A;  3CHF A;  4S3J A;  5HT1 A;  5D75 A;  2PPN A;  1J4H A;  3ARW A;  3O5J A;  3OA5 A;  3I6C A;  4NZC A;  4Q22 A;  4TX0 A;  5DF0 A;  4TW7 A;  1XHG A;  2O92 A;  1HKK A;  1ZBC A;  4DWS A;  4G2P A;  5HW6 A;  1HJX A;  5B8I C;  2PI6 A;  2XP7 A;  1E15 A;  4MSP A;  2KFW A;  2DPE A;  3ODK A;  2KR7 A;  2O9O A;  4DRH A;  3B9A A;  2YBT A;  3H9R B;  4DRJ A;  3EIP A;  1FAP A;  2ITK A;  3VAW A;  4ODK A;  2AWG A;  4WKH A;  2WLZ A;  1Y0O A;  1F40 A;  1LL6 A;  2YBU A;  1HKI A;  2DT3 A;  2XP3 A;  2B5U B;  3AS2 A;  3WD4 A;  3JXV A;  1N1A A;  2KE0 A;  2LPV A;  1HKJ A;  1EDQ A;  4MTV A;  3B9D A;  4LAY A;  4ML4 A;  3ARZ A;  1W1Y A;  4S3K A;  3WD2 A;  3ARS A;  3LUO A;  3FXY A;  2Y78 A;  2DG9 A;  2ZQS A;  4DT4 A;  1U79 A;  4MNL A;  3O5P A;  1SYT A;  2VN1 A;  5HWB A;  3WD1 A;  2F4E A;  1FD9 A;  3KAD A;  4KQZ A;  4AY1 A;  3B8S A;  1KT1 A;  5HW7 A;  1GOI A;  1QZ2 A;  4DRK A;  1ZL1 A;  2XP5 A;  4IT6 A;  3W4R A;  2N87 A;  1HXV A;  2DSW A;  2G41 A;  4DZ3 A;  1BKF A;  4P8U A;  4Z2J A;  4MPK A;  1ZB5 A;  1ZBV A;  2DSZ A;  3CHD A;  3UF8 A;  2MF9 A;  3NTP A;  4P8W A;  4ODM A;  1FKT A;  4WIW A;  2D9F A;  1ROT A;  2F23 A;  3MDY B;  4LGX A;  2PV3 A;  3CGM A;  2MLX A;  3TDB A;  4ITZ A;  1OWQ A;  1O6I A;  1A7X A;  1ROU A;  1XRV A;  3G6M A;  5I98 A;  3O5O A;  1W1T A;  4JFJ A;  3WQW A;  4TYO A;  1FKG A;  4FAP A;  3IKD A;  3IKG A;  4HBO A;  4IT4 A;  1PBK A;  3WQV A;  1IX5 A;  4JFI A;  1E6Z A;  2XPB A;  1EHN A;  3QOK A;  5JH8 A;  1YAT A;  2DT0 A;  2L2S A;  3O5G A;  2A3C A;  1WNO A;  3WKZ A;  2XP9 A;  2A3A A;  3WL0 A;  2PPO A;  1J6Y A;  4DRP A;  2PN0 A;  4WK9 A;  1JCH B;  1RD6 A;  5DEZ A;  3KCE A;  4QT3 A;  2OFN A;  1D7J A;  2FAP A;  2KO7 A;  3NI6 A;  1W9U A;  3TC5 A;  4G50 A;  2DG3 A;  1B6C A;  3RM8 A;  1FKB A;  5J6E A;  2VCD A;  3KAH A;  4J4N A;  2ZQT A;  2XP6 A;  1X6L A;  3ARV A;  3KAG A;  4WKA A;  1ZCN A;  2ESC A;  3AS0 A;  2DT1 A;  1R9H A;  4PTM A;  1FKL A;  1LL4 A;  4U84 A;  1NH6 A;  2G8Z A;  4L3N A;  2IF4 A;  5HBF A;  3O5F A;  4W9O A;  4DRO A;  4DWS C;  1J4R A;  1FKH A;  5HUA A;  2OLH A;  1P5Q A;  5GPR A;  4P8V A;  3ARR A;  2XPA A;  2ZQV A;  1LG1 A;  2WK2 A;  1WAW A;  2QF8 A;  1EYM A;  1OGG A;  3WD3 A;  3NRK A;  4QZV B;  2F2D A;  3PRD A;  2MLZ A;  4ODO A;  1HJV A;  1Q1C A;  5GQB A; 
#chains in the Genus database with same CATH homology
 4ZPT R;  1EQ3 A;  1E9L A;  4C02 B;  1FKS A;  2F21 A;  4ZPW R;  1CTN A;  3WD0 A;  2XP4 A;  1Q6H A;  1UR9 A;  4ODP A;  4Z2K A;  2DSV A;  4MNK A;  1Q6U A;  4HBE A;  2IUZ A;  1C9H A;  2RSE A;  4N19 A;  2RQS A;  4O2T A;  3CHE A;  1E6N A;  3IK8 A;  1K9T A;  3CZ8 A;  4R5E A;  4MNJ A;  4ODR A;  3ARX A;  3O5M A;  3UQB A;  2RUR A;  2ZQU A;  1FKF A;  1ITX A;  2B31 A;  1ZBW A;  1NMV A;  2K8I A;  3BXW A;  2M2A A;  1LG2 A;  2PBC A;  3UI4 A;  2LGO A;  3PRB A;  1JND A;  4ZS6 A;  1FKJ A;  4J4O A;  3PA7 A;  2MLY A;  4TNS A;  4ODL A;  3UI6 A;  2M08 A;  3O5L A;  4MAV A;  3AS3 A;  3RM4 A;  3JYJ A;  3RME A;  2PV2 A;  3ARP A;  5DIV A;  5BXJ A;  2ZR6 A;  1ZU8 A;  4JFM A;  1J4I A;  1GUV A;  4IQ2 A;  3WIJ A;  1F8A B;  3PR9 A;  4Z2G A;  1E6P A;  2ZR4 A;  2FKE A;  3CGN A;  3O5I A;  1HKM A;  3CH9 A;  5HW8 A;  3PRA A;  3UI5 A;  4U85 A;  2MPH A;  4ODQ A;  1JVW A;  3O5D A;  4NSB A;  1FKK A;  3WL1 A;  2AOS A;  4DH0 A;  2DT2 A;  1H0I A;  1TCO C;  3TCZ A;  4QIB A;  4JFK A;  1T11 A;  2RUC A;  3AS1 A;  2PPP A;  1NMW A;  2KGJ A;  1JNT A;  1X6N A;  4WJX A;  2RUD A;  3ART A;  4Z2I A;  2DG4 A;  4MNM A;  3GPK A;  4DWS D;  4Q7N A;  1YW5 A;  1FJD A;  4LAV A;  1W26 A;  1OGB A;  4LAX A;  1E6R A;  1NWS A;  3AQU A;  3OOB A;  1LL7 A;  2DSU A;  2ZR5 A;  3FAP A;  2MNT A;  4NNR A;  1LJY A;  1LQ0 A;  1PIN A;  3G6L A;  4WKF A;  3RGC A;  2UZ5 A;  5DO2 A;  4P8X A;  3CHC A;  4MGV A;  1NWU A;  1Q6I A;  1NSG A;  1TFV A;  4DWS B;  4L72 B;  3B9E A;  4HAR A;  1BL4 A;  3KAC A;  4DRI A;  3O5Q A;  4ODN A;  5HKG A;  4Z2L A;  1JNS A;  3ARQ A;  2A3E A;  4JYS A;  1W9V A;  2WM0 A;  5DIU A;  2KI3 A;  1EIB A;  3ALG A;  2M1I A;  1D7I A;  1D2K A;  3WH0 A;  3ARY A;  1W1P A;  1FKI A;  3KAB A;  4ZPV R;  4W5U A;  4W9Q A;  4LAW A;  4DRQ A;  3RFW A;  1ZBK A;  4GIV A;  2XP8 A;  1NWR A;  3RM9 A;  1HJW A;  1KT0 A;  3IHZ A;  4DRM A;  4URI A;  1VF8 A;  3O5K A;  4JFL A;  5HTG A;  5HWC A;  1D6O A;  1FFR A;  4TW6 A;  4Z2H A;  1GPF A;  1JNE A;  1ZK6 A;  2LKN A;  4U86 A;  1M5Y A;  3B7X A;  2RUQ A;  1W1V A;  5GPG A;  2FDM A;  3O5E A;  3FY1 A;  3UQA A;  4IPX A;  3KZ7 A;  4GGQ A;  1FKR A;  2JZV A;  1QPF A;  1UR8 A;  3ALF A;  2PV1 A;  3UQI A;  3ARO A;  3EY6 A;  4DRN A;  2WLY A;  2A3B A;  4DIP A;  5DIT A;  3ARU A;  1W9P A;  2LJ4 A;  1D7H A;  3KAF A;  4BF8 A;  2Q5A A;  4IQC A;  1L1P A;  1SR0 A;  4R0X A;  4TW8 A;  3JYM A;  3O5R A;  4FN2 A;  1NWT A;  4DZ2 A;  1H0G A;  4KR0 B;  1KFW A;  1FFQ A;  1QPL A;  3KAI A;  4W9P A;  1FKD A;  4QT2 A;  1WB0 A;  4XAK A;  3CHF A;  4S3J A;  5HT1 A;  5D75 A;  2PPN A;  1J4H A;  3ARW A;  3O5J A;  3OA5 A;  3I6C A;  4NZC A;  4Q22 A;  4TX0 A;  5DF0 A;  4TW7 A;  1XHG A;  2O92 A;  1HKK A;  1ZBC A;  4DWS A;  4G2P A;  5HW6 A;  1HJX A;  5B8I C;  2PI6 A;  2XP7 A;  1E15 A;  4MSP A;  2KFW A;  2DPE A;  3ODK A;  2KR7 A;  2O9O A;  4DRH A;  3B9A A;  2YBT A;  3H9R B;  4DRJ A;  1FAP A;  2ITK A;  3VAW A;  4ODK A;  2AWG A;  4WKH A;  2WLZ A;  1Y0O A;  1F40 A;  1LL6 A;  2XP3 A;  1HKI A;  2DT3 A;  2YBU A;  3AS2 A;  3WD4 A;  3JXV A;  1N1A A;  2KE0 A;  2LPV A;  1HKJ A;  1EDQ A;  4MTV A;  3B9D A;  4LAY A;  4ML4 A;  3ARZ A;  1W1Y A;  4S3K A;  3WD2 A;  3ARS A;  3LUO A;  3FXY A;  2Y78 A;  2DG9 A;  2ZQS A;  4DT4 A;  1U79 A;  4MNL A;  3O5P A;  1SYT A;  2VN1 A;  5HWB A;  3WD1 A;  2F4E A;  1FD9 A;  3KAD A;  4KQZ A;  4AY1 A;  3B8S A;  1KT1 A;  5HW7 A;  1GOI A;  1QZ2 A;  4DRK A;  1ZL1 A;  2XP5 A;  4IT6 A;  3W4R A;  2N87 A;  1HXV A;  2DSW A;  2G41 A;  4DZ3 A;  1BKF A;  4P8U A;  4Z2J A;  4MPK A;  1ZB5 A;  1ZBV A;  2DSZ A;  3CHD A;  3UF8 A;  2MF9 A;  3NTP A;  4P8W A;  4ODM A;  1FKT A;  4WIW A;  2D9F A;  1ROT A;  3MDY B;  4LGX A;  2PV3 A;  3CGM A;  2MLX A;  3TDB A;  4ITZ A;  1OWQ A;  1O6I A;  1A7X A;  1ROU A;  1XRV A;  3G6M A;  5I98 A;  3O5O A;  1W1T A;  4JFJ A;  3WQW A;  4TYO A;  1FKG A;  4FAP A;  3IKD A;  3IKG A;  4HBO A;  4IT4 A;  1PBK A;  3WQV A;  1IX5 A;  4JFI A;  1E6Z A;  2XPB A;  1EHN A;  3QOK A;  5JH8 A;  1YAT A;  2DT0 A;  2L2S A;  3O5G A;  2A3C A;  1WNO A;  3WKZ A;  2XP9 A;  2A3A A;  3WL0 A;  2PPO A;  1J6Y A;  4DRP A;  4WK9 A;  1RD6 A;  5DEZ A;  3KCE A;  4QT3 A;  2OFN A;  1D7J A;  2FAP A;  2KO7 A;  3NI6 A;  1W9U A;  3TC5 A;  4G50 A;  2DG3 A;  1B6C A;  3RM8 A;  1FKB A;  5J6E A;  2VCD A;  3KAH A;  4J4N A;  2ZQT A;  2XP6 A;  1X6L A;  3ARV A;  3KAG A;  4WKA A;  1ZCN A;  2ESC A;  3AS0 A;  2DT1 A;  1R9H A;  4PTM A;  1FKL A;  1LL4 A;  4U84 A;  1NH6 A;  2G8Z A;  4L3N A;  2IF4 A;  5HBF A;  3O5F A;  4W9O A;  4DRO A;  4DWS C;  1J4R A;  1FKH A;  5HUA A;  2OLH A;  1P5Q A;  5GPR A;  4P8V A;  3ARR A;  2XPA A;  2ZQV A;  1LG1 A;  2WK2 A;  1WAW A;  2QF8 A;  1EYM A;  1OGG A;  3WD3 A;  3NRK A;  4QZV B;  2F2D A;  3PRD A;  2MLZ A;  4ODO A;  1HJV A;  1Q1C A;  5GQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...