3FATA

X-ray structure of iglur4 flip ligand-binding core (s1s2) in complex with (s)-ampa at 1.90a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
259
structure length
259
Chain Sequence
GRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 4
publication title Molecular mechanism of agonist recognition by the ligand-binding core of the ionotropic glutamate receptor 4
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 88
structure length 259
sequence length 259
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fatA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fatA02
2XX9A 1R1NA 5ITPA 3L6GA 2RC9A 4RK2A 1N3XA 1UIUA 3ZKKA 2XXRA 5B70A 1M5DA 2DVZA 2OBGA 1J1NA 2GH9A 4NTLA 4DCYA 5L9MA 1GTKA 1B3GA 2W7YA 3DM0A 3LSXA 3MVYA 4GQOA 3HHGA 3LSLA 4MLVA 4XKQA 3QUFA 5I58B 2XD3A 3RGYA 5ISUA 1MDP1 4UACA 2V25A 3IB2A 2AL4A 3UGWA 2AYSA 3KGCA 4FECA 2UYFA 1HSLA 1SDXA 2D5WA 2ANJA 3OO6A 4LVQA 1ANFA 3KZGA 5F1QA 3GZGA 2QJEA 1DPPA 3OMBA 4IY6A 4G8HA 1GVCA 3A3UA 1CB6A 1MQJA 3ZS6A 2Q9TA 2GRVA 3IOWA 3CVGA 1LCFA 4LA9A 1MXYA 1ZMGA 3LBSA 1JETA 5ICTA 3S9MC 2V84A 3N5LA 5KZTA 2HFBA 5AA2A 3TZAA 1Q35A 3IK6B 4F39A 2ONSA 3LUYA 5AE4A 3OD7A 1O7TA 2B65A 1T0KA 4NF5A 1SW2A 3KN8A 3RT6B 4LP2B 1XS5A 3PPOA 3EPEA 5HBCA 2Z8FA 3ONMA 1URDA 4F3PA 1EZ9A 3M8UA 4H8IA 1B3LA 4GXSB 5KDTB 1AH5A 2ZYKA 3GXAA 2D21A 3C33A 4G8MA 1A8EA 1MQIA 3C32A 4O3BA 2O51A 1FQBA 5TP9A 3EN3A 2Q2CA 1MXXA 4LZ5A 1DTGA 2UXAA 5F7VA 2Y7KA 5ITOA 1LLSA 3DP6A 4P11A 2GHBA 1IITA 5IKBA 2DWHA 5I2KA 4OEVA 4EQ7A 2HZKA 1OVBA 4U2RA 1B0HA 1LB9A 3R6UA 4WXJA 4HCWA 3N94A 3I5OA 3M3LA 4GXAA 2QRYA 1B6HA 4IO3A 4R72A 1B51A 4U1ZA 1OMPA 1Y4TA 3C31A 1LAXA 2X26A 3TODA 1WVJA 1MH4A 4U4SA 1QW0A 3IORA 4KCDA 1URGA 4EDPA 3O29A 4R74A 1Y3NA 4EF2A 1R9LA 4WKMA 5EYFA 2Y7PA 3K00A 3G3JA 2FA7A 3C4MA 4JWOA 3RTFB 4AB5A 3CIJA 1XHYA 1DSNA 2ABHA 2F7AA 1M5EA 2XXXA 5AA2B 4F22A 3ZKLA 3PUVE 3RT8A 1S9TA 2Q88A 4NF4A 3EHSA 4OFLA 3MZBA 3N6UA 1VR5A 3V83A 3OEKA 1SI1A 5CMMA 4NF5B 3TDJA 3E13X 1MQHA 5FHNA 3IO6A 2IA4A 3CG3A 5H8FB 4H1XA 3T9VA 1ELJA 3SEWA 4F18A 5HM4B 1ATGA 1LFGA 3G3GA 2NOOA 1SW4A 2F6GA 2I4BA 1M5CA 4ELQA 4Q0CA 1FW0A 5K2YA 5DVFA 2THIA 3GBAA 1B58A 3QYTA 3DP4A 2P1SA 1GV8A 3UK4A 1FQAA 4YAHX 3IJOB 4Q8RA 5EHMA 1UTHB 4I8CA 1YPNA 1AL3A 4ELOA 1MY4A 1OVTA 3TCFA 2ZNTA 4MH5A 1RYXA 3TQLA 1P1NA 4ZE9A 1GR2A 4H0WA 5I2NA 1LB8A 3G3FA 1VFEA 1IZ1A 5CC2A 4C1UA 3ODBA 3MP1A 1AMFA 1SVXB 3KJ7A 4QSCA 3U1OA 1FTMA 3K4UA 2GHAA 2ZNSA 3KBRA 2DS9A 3ECRA 3KN3A 3FJGA 5H8HA 1N84A 1YTVA 3S2VA 2I6EA 4TQUQ 1A7LA 1NL5A 1PDAA 4E0XA 1OLAA 4GVOA 4OFJA 3V5AA 4QSEA 2F6PA 3T22A 4DXBA 4MFIA 3DP8A 3HHFA 2YJPA 1DTZA 3IR1A 3IOTA 3IOVA 3R26A 5I57A 2OWSA 5BUUA 3R7XA 1LAGE 3JYRA 5CRYA 3RNNA 4LZ7A 3VDFA 4ONYA 4G77A 4X1BA 4KD5A 1F9BA 3O28A 4F1UA 3C9HA 4PP0A 5JK4A 1JVXA 2R6GE 3KG2A 2QMWA 3VLUA 2UYEA 1ZU0A 4F1VA 3T96B 3K6XA 3OEMA 4QHQA 3H6VA 2QL3A 3KSXA 3FASA 2XXPA 1B05A 1TFDA 2YLNA 3K1NA 1B7ZA 3TTLA 4QRZA 2DXRA 3FVGA 1FQFA 4C0RA 4EXLA 3K02A 2V3UA 3CSBA 2F97A 1HSEA 1QUKA 4GL0A 4G68A 4ZS9A 1N7WA 2V3TA 3FIRA 1N7XA 2DQVA 4NF6A 2XHDA 3C36A 3SEXA 4FORA 2RC7A 4UA8A 4YICA 3KOSA 4U4XA 3O97A 3T66A 4IO6A 2QPQA 3UIFA 4F1YA 3EF7A 1P1WA 3BFUA 3H7MA 3PMWA 5I2NB 1I69A 1LAFE 3PV0E 1Y1MA 2Y84A 3JV9A 5AA4A 4BDNA 1CE2A 2XXUA 4P0GA 4G68C 4WEDA 4EXKA 4N07A 1UQWA 1B1XA 4R2BA 4ZEDA 4JXIA 5JEIA 1Y20A 2LAOA 1B2HA 1VSOA 4ESWA 2OJTA 3TKDA 5TPAA 3FVNA 2NWJA 4GL8A 5EHSA 3MVXA 2AIXA 2XXYA 4H5FA 1SI0A 4RK9A 2CMOA 4XXUA 2DP8A 2I3VA 5FTHA 1Y3QA 3T9XB 3U8QA 4JSOA 3Q28A 1SW5A 5H8SA 3G3IA 4EUOA 5L8DA 4OHNA 1WODA 2NUVA 3MP8A 1I6QA 2F34A 4ZZAA 3FGSA 3GBBA 2RINA 4I9DA 1B4ZA 1D3KA 1MY2A 1H76A 3MJNA 1YAEA 4RNSA 2HAVA 2HXWA 4BDRA 1RKMA 3ILTB 3PUZE 5CMKA 3D4CA 1SYIA 4GRKA 4F2QA 3OSRA 4FEDA 1D4NA 3SEYA 1DOTA 1IIWA 3VLWA 4ELPA 5I59A 2H5YA 4OENA 1LFIA 3TTRA 3RQTA 4XTCQ 3OELA 4U23A 4JWYA 4YKJA 4MBPA 1NFTA 1B3FA 4R73A 4G68B 3FJMA 2H4IA 2RF1A 4OERA 4Q30B 3N6TA 1NKXA 4NF6B 4IB2A 4OESA 2XXIA 1B9JA 4NMYA 1RYOA 4KI0E 3IO4A 3TUSA 1B52A 3QUJA 4KFQA 4ESXA 3MPKA 2BJJX 4FJPA 5HPQA 4IO2A 4ISUA 2UVGA 2ZYMA 1ZBMA 4JSDA 3UP9A 2UVHA 1P1UA 5AA4B 2I0CA 3P7IA 2DWJA 3W9WA 4DCXA 3H06B 4FATA 4XKNA 1MXWA 1AOVA 4BDOA 2Z8DA 1B5HA 3VXBA 4ZDMA 4M1VA 1B5IA 3EHTA 1JEVA 1EU8A 5TPAB 1MXVA 3A3CA 1MY3A 1S50A 2Z22A 1QVSA 3RTWB 2WKYA 4N6PA 1IUDA 4YB6A 2Y7RA 4F31B 2D3IA 2I0BA 1Y9UA 3TCGA 1QKBA 1R6ZA 4U1OA 4YKPA 3VVDA 4RPOA 3PUXE 4DIGA 2PVUA 3G3KA 5JTYA 3UN6A 3SESA 1LGBC 4KCCA 5L9SA 1Y3PA 2A5TA 1H45A 4R6YA 4BLAA 1EH3A 3MQ9A 1OQHA 3FV2A 1PB7A 2O69A 1SYHA 2FYIA 4YU0A 4YKKA 4F19A 2DOJA 3K1PA 2B3BA 1B3EA 4NWDA 3I6VA 1USYH 4LATA 3CSGA 3G3HA 3B6WA 4Q5TA 3Q26A 3U92A 5M2VA 1PEBA 4FE8A 1H43A 1TT1A 4G8NA 4LQ2A 5A5XA 5KCJA 3AXFA 2Q2AA 2QS2A 5I84A 3SEUA 1EZOA 2OK2A 1GGGA 2NXOA 2UVJA 1B5JA 2O7IA 3TCHA 3PPNA 2X7PA 4AB6A 4QFKA 5TU0A 4H67A 1DMBA 2ZMBA 3RN8A 2DYXA 2F7BA 1ZJLA 5AA1A 3SDFA 1NH7A 1YCJA 1KWHA 4IO4A 1A40A 2AL5A 4FAJA 2QS3A 1WDNA 1VE4A 1LCTA 1MH3A 4QFNA 5TP9B 5FHOA 3EQ1A 3G7WA 1MG1A 1Z7NE 2ALUA 1N04A 4XKPA 4ZEIA 2CZLA 2R71A 1PB9A 3CRBA 2HZLA 3HN0A 1FCKA 3Q29A 4H8JA 2F7CA 5H8NA 2OZZA 3RUMA 1JNFA 5I2KB 4YMBA 2H9BA 1TWYA 3FJ7A 3MVZA 2H25A 3PPPA 3HSTA 1B7HA 2ZYNA 1LAHE 2XX7A 2RCAA 1USYE 2VD3A 5DVIA 3M3FA 3M3KA 4IGTA 3B6QA 4R9GA 3PMXA 1N3WA 5DVJA 4ZEBA 5DYHA 1S7YA 1OIBA 3LR1A 1ZLQA 3MP6A 4M4GA 3OOAA 3PMVA 3PUWE 1MPBA 2VD2A 3D4GA 4F3SA 3TTMA 5LOMA 1LBCA 5JTYB 5CMCA 3IL1B 4F2OA 1SW1A 1B46A 3KOTA 4U22A 2O68A 2A5TB 1H44A 1P99A 4GF8A 2YPNA 5J1DA 1SBPA 1FTOA 4GFRA 4HTGA 1R9QA 2V3QA 3OXNA 2XXTA 3GLBA 3TFLA 3TAJA 3KSJA 1JVYA 4NF4B 1N76A 4ZECA 3C35A 3ZSFA 2IEEA 2Y7WA 2Q89A 2PX1A 1P1OA 3TTNA 3KFMA 3MUQA 1QUJA 5KCJB 1LFHA 3VVFA 3CR9A 4H6DA 3K01A 1BIYA 4JBZA 1BP5A 2ESNA 3O9PA 1UTBA 2DWIA 4I62A 4KYSA 5CM6A 4EF1A 3U72A 3T93B 1BTJA 4RXLA 2M8CA 2DWAA 2O6AA 4POWA 3VV5A 3I3VA 1Y4CA 3H6WA 4OVJA 4X9TA 4YMAA 2F78A 2Y7IA 4JB7A 4K3FA 4R9FA 4NF8A 3K6UA 3MBPA 1O64A 4NWCA 3IB0A 4QFOA 4R6HA 1M5BA 4PFUA 1FTKA 1Y1ZA 2XX8A 4WEPA 4FEBA 4QSDA 3RLFE 2GFEA 3B6TA 5H8NB 4HCYA 1PBQA 4C1TA 3E3KA 5KDTA 4MF3A 3VE1B 4Z0IA 1BKAA 4N13A 1PC3A 1D9VA 4RPNA 3K1MA 4I1DA 2ZYOA 3PPQA 1MM7A 4RJZA 2G29A 4GIZA 3PUYE 3BKIB 2REGA 5IAIA 3DLNA 3MPLA 3VVEA 5H8HB 4JDFA 5CI5A 1POY1 4PQJA 4YZZA 3WAFA 1M5FA 4ZE8A 1PB8A 5AA2D 4GWOA 4OTEA 4KQPA 4QF9A 3K0VA 2F5XA 4KYDA 2RKMA 2PT1A 4OYVA 3QK6A 4R6KA 5I57B 3FXUA 5BWJA 3F11A 3QSLA 4ELRA 1MPCA 4KHZE 3OO9A 1PBPA 4NE4A 2NVUB 3THIA 4DZ1A 4OFOA 3FUZA 1NNFA 1XVXA 4OXVA 3B7DA 3LSWA 3FXRA 5CBSA 1FQEA 3KN7A 3RPWA 1MS7A 4LONB 1UTBB 1QJMA 4P0IA 2PMSA 2I49A 4JWXA 2XXQA 2I3WA 4Z7EA 3BFTA 1B7UA 3MZ1A 3T9HB 4GD5A 1JEUA 4DXCA 3WAEA 2OLBA 4G4PA 2HEUA 3FXQA 1XC1A 4U21A 2P2AA 4F3GA 4NF8B 2XXVA 4MLQA 1NNKA 4DXUA 5H8FA 1JW1A 3TEPA 4H5GA 1US4A 2REJA 2DE3A 2R9JA 1A99A 2OWTA 3KEIA 1MXUA 4QFLA 4KPTA 2DVCA 3V8XB 2QMXA 3O66A 4HS7A 5CMBA 3MWBA 1JQFA 3KJTA 1MY0A 3S9LC 3FVOA 3CG1A 5ELVA 4IY5A 4FIMA 1NNTA 2X7QA 1OLCA 2QS4A 1UTHA 1ZIUA 4X1DA 3A09A 3H4ZA 4G2ZA 4TLLB 2XXWA 3OO8A 1B40A 1II5A 1QULA 2DE4A 2DSFA 1Q1KA 2RCBA 1IXIA 1FQCA 1SD3A 1A55A 4IO7A 2PYYA 3SEVA 4BDQA 4QFPA 1QUIA 1MPDA 3TYHA 3QAXA 3IOUA 2KLFA 4ZZEA 4THIA 5I56A 4ZEKA 1MQGA 2UVIA 4XIGQ 4PE5B 2XXHA 1XVYA 3VLVA 2ONRA 1MRPA 2VOZA 3TTKA 3SKPA 1BLFA 3O6HA 3CI8A 1XT8A 4X48A 3CFZA 4LUBA 3U94A 3IX1A 2O1MA 1OQGA 4YB7A 4GOTA 3VXCA 1URSA 2HQ0A 2I4CA 3HO7A 5CBRA 1JW4A 4R2FA 3FD3A 3E9XA 5ICQA 1H3DA 5I59B 1POTA 4AQ4A 1IXCA 2RC8A 4OMBA 1UIVA 3S9NC 1MDQA 3W9VA 3FZVA 2HCAA 3PGFA 1LBBA 3LSFB 1FQDA 2G93A 1A8FA 4PFWA 5DEXA 5DT6A 1LSTA 4RY1A 4R75A 3DELB 2ZXTA 3N26A 4DDDA 2DE2A 2H99A 1ZTYA 4RYAA 3S9EA 4GLIA 3PD8A 4DE8A 1EZPA 3IJXB 3L6HA 3JZJA 1HSJA 3K2DA 3BBRA 1IEJA 3IAZA 3H03A 2OCUA 1NH8A 5H8QA 2FNCA 5K2XA 1B32A 2V93A 4YKIA 2HAUA 3UORA 3OSQA 4OWDA 3MW0A 4KYEA 5B7DA 2H98A 5AA3A 2B3FA 4POXA 3PPRA 4PETA 4H65A 3QXMA 3VFJA 3HCQA 1B1HA 3IB1A 3PD9A 4EQ9A 1MQDA 3V89B 1XOCA 3FATA 4BDLA 4ECFA 5FHMA 1QKAA 1TFAA 1FTLA 4TOZA 3TPAA 1IXHA 1IQ7A 3W15C 1US5A 2O7UA 3S4UA 4OQOA 1L5TA 4IGRA 2VP1A 1A54A 2VHAA 5I58A 2I48A 5DTBA 2O1LA 4IO5A 3TMGA 1MXZA 3E4RA 2E0SA 4DLDA 2PT2A 3FV1A 1IXGA 3LC8A 4E0WA 1D9YA 1NNPA 4RA1A 5I56B 2QS1A 1TXFA 1MY1A 4OZ9A 1B3HA 4F29A 1I6AA 4F3BA 3Q27A 2ZNUA 4NEDA 3C34A 2Z8EA 3O6GA 3OO7A 1O63A 4O3CA 4LQ5A 5L9OA 3O2AA 4KR5A 3U93A 3PU5A 4TLMB 1DPEA 3T9UA 2A5SA 3CFLA 3K6WA 4YB5A 5A5XB 1NMUA 3SERA 3HV1A 3RY3A 1Z7ME 1JW5A 3SETA 2PBWA 1P1QA 1FTJA 3O6IA 3MVWA 2I58A 3OENA 1I6BA 3H3GA 2VGQA 3MAMA 1SQYA 1MM6A 4LZ8A 1B4HA 2E1SA 4ZEFA 1B0LA 2F8DA 5DEXB 3MC2A 4PFTA 3HPIA 4PFYA 3H6UA 3MZ9A 5FTIA 3K6VA 4HW8A 3UA8A 4EQBA 2ONKE 2Z23A 2F35A 3CFXA 3QIMA 2QSXA 2XD2A 2F36A 4BDMA 3ILUB 3Q25A 3FVKA 4OEUA 2DXYA 2Q8JA 4O3AA 4OETA 4L17A 4ND9A 2O84X 1VFDA 1AIVA 3USDA 3EHUA 3H6TA 5H8QB 3TELA 3TQWA 1ZKBA 1N0TA 2P0SA 4XKRA
chains in the Genus database with same CATH superfamily
2XX9A 1R1NA 5ITPA 3L6GA 2RC9A 4RK2A 1N3XA 4PBHA 1UIUA 3ZKKA 2XXRA 5B70A 1M5DA 2DVZA 2OBGA 1J1NA 2GH9A 4NTLA 1FBPA 4DCYA 5L9MA 1GTKA 1B3GA 2W7YA 3DM0A 3LSXA 3MVYA 4JVDA 4OVRA 1NUWA 4GQOA 3HHGA 3LSLA 4MLVA 4XKQA 4O94A 3QUFA 5I58B 2XD3A 3RGYA 4I3YA 5ISUA 1MDP1 4UACA 2V25A 3IB2A 2AL4A 3UGWA 2AYSA 3KGCA 4FECA 2UYFA 1HSLA 1SDXA 2D5WA 2ANJA 3OO6A 4OVSA 3KC1A 4LVQA 1ANFA 3KZGA 5F1QA 4O8MA 3GZGA 4PDHA 2QJEA 4O7MA 1DPPA 3OMBA 4IY6A 4G8HA 1GVCA 3A3UA 1CB6A 1MQJA 1D9QA 3ZS6A 1RDYA 2Q9TA 2GRVA 3IOWA 3CVGA 1LCFA 4LA9A 1MXYA 1ZMGA 3LBSA 1JETA 5ICTA 3S9MC 1INPA 2V84A 3N5LA 5KZTA 2HFBA 3EKIA 5AA2A 3TZAA 1Q35A 3IK6B 4F39A 2ONSA 3LUYA 1FPFA 5AE4A 3OD7A 1O7TA 2B65A 1T0KA 1FPJA 4DI3D 1FJ9A 4NF5A 1SW2A 4PFBA 3KN8A 3RT6B 1K9YA 2MKZA 4LP2B 1XS5A 3PPOA 3EPEA 5HBCA 5IZ3B 2Z8FA 3ONMA 1URDA 4GBWA 5EYGA 4F3PA 1EZ9A 3M8UA 4X04A 4H8IA 5EQ7A 5IM2A 1B3LA 4GXSB 5KDTB 1AH5A 2ZYKA 3GXAA 2D21A 3C33A 1FPGA 4G8MA 1A8EA 1MQIA 3C32A 4O3BA 4N15A 2O51A 1FQBA 2CZHA 5TP9A 3EN3A 2Q2CA 4PF8A 1MXXA 4LZ5A 1DTGA 2FIEA 2UXAA 5F7VA 2Y7KA 5ITOA 1LLSA 3DP6A 2OWZA 4P11A 2GHBA 1IITA 5IKBA 2DWHA 2KQZA 5I2KA 4OEVA 4EQ7A 4MX6A 2HZKA 1OVBA 4U2RA 1B0HA 1LB9A 2PFYA 3R6UA 4WXJA 4HCWA 5IZZA 3N94A 3I5OA 3M3LA 4GXAA 2QRYA 1B6HA 4IO3A 4R72A 5ET8A 5ESYA 1B51A 5DW8A 4HXVA 4U1ZA 1OMPA 1Y4TA 3C31A 1LAXA 2X26A 3TODA 1WVJA 1RDXA 1MH4A 4U4SA 1QW0A 3IORA 3B8BA 1URGA 4KCDA 4EDPA 3O29A 4R74A 1Y3NA 2KR0A 2P3NA 4EF2A 1R9LA 4WKMA 5EYFA 2Y7PA 3K00A 1IMDA 4PFIA 3G3JA 2FA7A 3C4MA 4JWOA 3RTFB 4AB5A 3CIJA 1XHYA 1DSNA 1CNQA 2VT5A 2ABHA 2F7AA 4I40A 1M5EA 2XXXA 4F22A 5AA2B 3PUVE 3RT8A 3ZKLA 1S9TA 2Q88A 4NF4A 1Q9DA 3RPLB 1NV5A 3EHSA 4OFLA 3MZBA 3N6UA 1VR5A 3V83A 3OEKA 1SI1A 4PAIA 4PAKA 5CMMA 1LBWA 4NF5B 3TDJA 3E13X 1MQHA 5FHNA 1FPDA 3IO6A 2IA4A 3CG3A 4AS5A 5H8FB 4H1XA 3T9VA 1ELJA 3SEWA 4GWWA 4OVQA 4F18A 5HM4B 1ATGA 1LFGA 3G3GA 2NOOA 4MIJA 1SW4A 1FPKA 2F6GA 5ET5A 2I4BA 1M5CA 3ISPA 4ELQA 4Q0CA 1FW0A 3FBPA 5K2YA 5DVFA 2THIA 3GBAA 2XXKA 1B58A 3QYTA 3DP4A 2P1SA 1GV8A 3UK4A 1FQAA 4YAHX 3IJOB 4Q8RA 5EHMA 1FPBA 4N81A 1UTHB 2BJIA 4I8CA 1YPNA 1AL3A 4ELOA 1MY4A 1OVTA 3TCFA 2ZNTA 4MH5A 1RYXA 3TQLA 1P1NA 4ZE9A 1GR2A 4H0WA 5I2NA 1LB8A 3G3FA 1VFEA 1IZ1A 1LEVA 5CC2A 4C1UA 3ODBA 3MP1A 1LBVA 1AMFA 4QSCA 1SVXB 3KJ7A 4N6KA 1FTMA 3U1OA 3K4UA 2GHAA 2ZNSA 3KBRA 4DI4B 2DS9A 3ECRA 3KN3A 3FJGA 5H8HA 1LBYA 1N84A 1YTVA 3S2VA 2I6EA 2HHMA 4TQUQ 1A7LA 1NL5A 1FBCA 1PDAA 4E0XA 1OLAA 4GVOA 4OFJA 3V5AA 4QSEA 2F6PA 3T22A 4DXBA 4MFIA 3DP8A 3HHFA 4MNPA 2YJPA 1DTZA 4X8RA 3IR1A 3IOTA 3IOVA 3R26A 5I57A 2OWSA 5BUUA 3R7XA 1LAGE 3JYRA 5CRYA 2HXRA 2L5VA 3RNNA 4MAGA 4LZ7A 4PCDA 3VDFA 4ONYA 4G77A 4X1BA 4KD5A 1F9BA 3O28A 2ZZVA 4F1UA 3C9HA 4PP0A 5JK4A 1JVXA 2R6GE 3KG2A 2QMWA 3VLUA 2UYEA 1IMCA 1ZU0A 4F1VA 3T96B 3K6XA 1FBHA 3OEMA 4PAFA 5LDZA 4QHQA 3H6VA 2QL3A 3KSXA 3ROJA 3FASA 2XXPA 1B05A 1TFDA 2YLNA 4HE2A 3K1NA 1B7ZA 3TTLA 4QRZA 2DXRA 5EQ8A 3FVGA 1FQFA 4C0RA 4EXLA 4GBVA 3K02A 2V3UA 3CSBA 2F97A 1HSEA 1QUKA 4GL0A 4G68A 4ZS9A 1N7WA 1LBZA 2V3TA 3FIRA 1N7XA 2DQVA 4NF6A 2XHDA 3C36A 3SEXA 4FORA 2RC7A 4UA8A 4YICA 3KOSA 4U4XA 3GYYA 3O97A 3T66A 1NUYA 4IO6A 2QPQA 3UIFA 4F1YA 3EF7A 1P1WA 3BFUA 3H7MA 3PMWA 5I2NB 1I69A 1LAFE 3PV0E 1Y1MA 2Y84A 3JV9A 2CEXA 5AA4A 4BDNA 1CE2A 2XXUA 2Y5LA 4PDDA 3SZPA 4P0GA 4G68C 4WEDA 4EXKA 4N07A 1UQWA 1B1XA 4R2BA 4ZEDA 4NX1A 1BK4A 2QVRA 4JXIA 5JEIA 1Y20A 2LAOA 1B2HA 1VSOA 4ESWA 2OJTA 3TKDA 5TPAA 3FVNA 2NWJA 4GL8A 5EHSA 1IMAA 3MVXA 2AIXA 4QXDA 2FVZA 2XXYA 4H5FA 4GWUA 1SI0A 4NHBA 4RK9A 2CMOA 4XXUA 2DP8A 2I3VA 5FTHA 1Y3QA 3T9XB 3U8QA 4JSOA 3Q28A 1SW5A 2ZZWA 2VPNA 5H8SA 3G3IA 4EUOA 5L8DA 4OHNA 1WODA 1NV3A 2NUVA 3MP8A 1I6QA 2F34A 4ZZAA 3FGSA 3GBBA 2RINA 4I9DA 4LN5A 1B4ZA 5ET7A 1D3KA 1MY2A 1H76A 3MJNA 1YAEA 5A5LA 4RNSA 2HAVA 2HXWA 4BDRA 1RKMA 3ILTB 3PUZE 4HE1A 5CMKA 3D4CA 1SYIA 4GRKA 4F2QA 3OSRA 4FEDA 1D4NA 3SEYA 1DOTA 1IIWA 4GX4A 3VLWA 4ELPA 5I59A 2H5YA 4OENA 1LFIA 3TTRA 3RQTA 4XTCQ 3OELA 4U23A 4JWYA 3HFUA 4YKJA 4MBPA 1NFTA 4R73A 1B3FA 4G68B 3FJMA 2H4IA 2RF1A 4OERA 4Q30B 3N6TA 1NKXA 4NF6B 4IB2A 4OESA 2XXIA 1B9JA 4NMYA 1RYOA 4KI0E 3IO4A 3TUSA 1B52A 3QUJA 4KFQA 4ESXA 3MPKA 4MHFA 2BJJX 4FJPA 5HPQA 4IO2A 4ISUA 2UVGA 2ZYMA 1NV6A 1ZBMA 4JSDA 3UP9A 2UVHA 1P1UA 5AA4B 2I0CA 4NQ8A 3P7IA 1YZ0A 2DWJA 3W9WA 4DCXA 1LBXA 3H06B 4FATA 4XKNA 5I7IA 1MXWA 1AOVA 4BDOA 2Z8DA 1B5HA 2Q8MA 3VXBA 5LTCA 4ZDMA 4M1VA 4N4UA 4QBAA 1B5IA 3EHTA 1JEVA 1EU8A 3FXBA 1FPIA 5ET6A 2QVUA 5TPAB 1MXVA 3A3CA 1MY3A 1S50A 2Z22A 1QVSA 4P8BA 3RTWB 2WKYA 4N6PA 4H46A 1IUDA 4YB6A 2Y7RA 3D1RA 2HPGA 4F31B 2D3IA 2I0BA 1Y9UA 3TCGA 1QKBA 1R6ZA 4U1OA 4YKPA 3VVDA 4NN3A 4RPOA 3NOHA 3PUXE 4DIGA 2PVUA 3G3KA 5JTYA 3UN6A 3SESA 1LGBC 4KCCA 5L9SA 1Y3PA 2A5TA 1H45A 4R6YA 4BLAA 1EH3A 2P3VA 3MQ9A 1OQHA 3FV2A 1PB7A 2O69A 1SYHA 2FYIA 4YU0A 4YKKA 4F19A 2DOJA 3K1PA 2B3BA 2FIXA 1KA0A 1B3EA 4NWDA 3I6VA 1USYH 4LATA 3CSGA 3G3HA 3B6WA 4Q5TA 4GX6A 5IZ1A 1NV7A 3Q26A 4P3LA 3U92A 5M2VA 1PEBA 4FE8A 3T1BA 1IMBA 1H43A 1TT1A 4G8NA 4LQ2A 5A5XA 5KCJA 3AXFA 2Q2AA 2QS2A 5I84A 3SEUA 1EZOA 2OK2A 3BIGA 1GGGA 5IGAA 2CZIA 2NXOA 2UVJA 1B5JA 2O7IA 3TCHA 1QGXA 4P1EA 3PPNA 2X7PA 4AB6A 4QFKA 5TU0A 4H67A 1DMBA 2ZMBA 3RN8A 2DYXA 2F7BA 1ZJLA 5AA1A 3SDFA 1NH7A 1YCJA 1KWHA 4IO4A 3B50A 1A40A 2AL5A 4FAJA 2QS3A 1WDNA 1VE4A 1FPEA 1G0HA 1LCTA 4OVTA 1MH3A 4QFNA 5TP9B 5FHOA 3EQ1A 3G7WA 3IFCA 4GWYA 1MG1A 1Z7NE 2Q74A 2ALUA 1N04A 2B4MA 4XKPA 4ZEIA 2CZLA 2R71A 4XFEA 1PB9A 3CRBA 2HZLA 3HN0A 1FCKA 3Q29A 2WEFA 4H8JA 3LUZA 2F7CA 5H8NA 2OZZA 3RUMA 1JNFA 5I2KB 4YMBA 2H9BA 1KZ8A 1TWYA 1DCUA 3FJ7A 3MVZA 2H25A 3PPPA 3HSTA 1B7HA 2ZYNA 1LAHE 2XX7A 5I5PA 2RCAA 1USYE 2VD3A 5DVIA 4PGPA 3M3FA 3M3KA 4IGTA 3B6QA 4R9GA 3PTYA 3PMXA 4OANA 1N3WA 5DVJA 4ZEBA 5DYHA 1S7YA 1OIBA 4GWZA 3LR1A 1ZLQA 3MP6A 4M4GA 3OOAA 3PMVA 2WBDA 3PUWE 1MPBA 4JVCA 1KA1A 2VD2A 3D4GA 4F3SA 3TTMA 5LOMA 1LBCA 5JTYB 4GX3A 5CMCA 3IL1B 4F2OA 1SW1A 1B46A 3KOTA 4U22A 2O68A 2A5TB 1H44A 1P99A 4GF8A 2YPNA 5J1DA 1SBPA 1FTOA 4GFRA 4HTGA 1R9QA 2V3QA 3QMFA 3OXNA 1IMEA 4JVIA 3LV0A 2XXTA 3GLBA 2DDKA 3TFLA 4HE0A 3TAJA 3KSJA 1JVYA 4NF4B 1N76A 4ZECA 3C35A 3ZSFA 2IEEA 2Y7WA 2Q89A 2PX1A 1P1OA 3TTNA 3KFMA 3MUQA 3CHGA 1QUJA 4XF5A 5KCJB 1LFHA 2CZKA 2FHYA 3VVFA 3CR9A 4H6DA 3K01A 1BIYA 4JBZA 1BP5A 2ESNA 3O9PA 1UTBA 4H45A 2DWIA 4I62A 4KYSA 5CM6A 4EF1A 3U72A 3T93B 1BTJA 4RXLA 2M8CA 2DWAA 2O6AA 1NV4A 4POWA 2WBBA 3VV5A 3I3VA 1Y4CA 3H6WA 4OVJA 4X9TA 4YMAA 2F78A 2Y7IA 4JB7A 4K3FA 4PFRA 4R9FA 4NF8A 1AWBA 3K6UA 3MBPA 1O64A 4NWCA 3IB0A 4QFOA 2B4LA 4MJOA 4R6HA 1M5BA 1EYJA 4PFUA 1FTKA 1Y1ZA 2XX8A 4WEPA 4FEBA 4QSDA 3RLFE 2GFEA 3B6TA 5H8NB 4HCYA 1PBQA 4C1TA 3E3KA 5KDTA 4MF3A 2GQ1A 1FRPA 3VE1B 4Z0IA 1BKAA 4N13A 1PC3A 1D9VA 1YYZA 4RPNA 2PCRA 3K1MA 4I1DA 2ZYOA 3PPQA 1MM7A 4RJZA 2G29A 4GIZA 3PUYE 4MNIA 3BKIB 2REGA 5IAIA 1NV0A 3DLNA 3MPLA 2PFZA 3VVEA 5H8HB 4JDFA 5CI5A 1NI9A 1POY1 4PQJA 4YZZA 3WAFA 1M5FA 4ZE8A 1PB8A 5AA2D 4GWOA 4OTEA 4KQPA 4QF9A 4IR8A 3K0VA 2F5XA 4KYDA 2RKMA 2PT1A 4OYVA 4G61A 3QK6A 4R6KA 5I57B 3FXUA 5BWJA 4FBPA 3F11A 1FBDA 3QSLA 4ELRA 1MPCA 2ZZXA 4KHZE 1FJ6A 3OO9A 1FSAA 1PBPA 2V4CA 2FBPA 4NE4A 2NVUB 3THIA 4DZ1A 1FPLA 4N6DA 4OFOA 2XWVA 3FUZA 1NNFA 1XVXA 4PF6A 4OXVA 3B7DA 3LSWA 1FTAA 3FXRA 5CBSA 1FQEA 3KN7A 3RPWA 1MS7A 1NV2A 4LONB 1UTBB 1QJMA 5EQAA 3A29A 3U65A 4P0IA 2PMSA 2I49A 5J16A 4JWXA 2XXQA 2I3WA 4Z7EA 3BFTA 1B7UA 4OA4A 3RPLA 3MZ1A 3T9HB 4GD5A 1JEUA 4DXCA 3WAEA 2OLBA 4G4PA 2HEUA 3FXQA 1XC1A 4U21A 4PE3A 2P2AA 4F3GA 4NF8B 2XXVA 4MLQA 1NNKA 4DXUA 5H8FA 1JW1A 3TEPA 1EYIA 4H5GA 1US4A 2R8TA 2REJA 2DE3A 2R9JA 1A99A 2OWTA 3KEIA 1MXUA 4GWXA 4QFLA 4KPTA 2DVCA 4P56A 3V8XB 3T0JA 2QVVA 2QMXA 3O66A 4HS7A 5CMBA 3MWBA 1JQFA 3KJTA 2VPOA 1EYKA 1MY0A 4P9KA 3S9LC 3E78A 4KXPA 3FVOA 3CG1A 1JP4A 5ELVA 4P47A 2F3BA 4IY5A 4FIMA 1NNTA 2X7QA 1OLCA 2QS4A 1UTHA 4N8GA 1ZIUA 4X1DA 3A09A 2WX9A 3H4ZA 4G2ZA 4TLLB 2XXWA 3KBZA 4PBQA 3OO8A 1B40A 1II5A 2CEYA 1QULA 2DE4A 5T3JA 2DSFA 4P1LA 1Q1KA 2RCBA 1IXIA 1FQCA 5FBPA 4MCOA 1SD3A 1A55A 4IO7A 2PYYA 3SEVA 4BDQA 4QFPA 1QUIA 1FBGA 1MPDA 3TYHA 3QAXA 3IOUA 2KLFA 4ZZEA 4THIA 5I56A 4ZEKA 1MQGA 2UVIA 4XIGQ 2XWIA 3RYDA 4XEQA 3IFAA 2XXHA 4PE5B 1XVYA 3VLVA 2ONRA 1MRPA 2VOZA 3TTKA 4MEVA 3SKPA 4PTKA 1BLFA 4MNCA 2QFLA 3O6HA 1K9ZA 3CI8A 3E79A 1XT8A 4X48A 3MYUA 3CFZA 4LUBA 3U94A 3IX1A 2O1MA 1OQGA 4YB7A 4GOTA 3VXCA 1URSA 2HQ0A 4GWSA 2I4CA 2WYPA 3HO7A 5CBRA 1JW4A 4R2FA 3FD3A 3E9XA 5ICQA 1H3DA 5I59B 1SPIA 1POTA 4AQ4A 1IXCA 2RC8A 4OMBA 1UIVA 3S9NC 4NG7A 1MDQA 3W9VA 3FZVA 2HCAA 1FBFA 3PGFA 1LBBA 3LSFB 1FQDA 2G93A 2XA5A 1A8FA 4PFWA 4OVPA 2WYKA 5DEXA 5DT6A 1LSTA 4RY1A 4R75A 5EQ9A 3DELB 2ZXTA 1XI6A 3N26A 4DDDA 2DE2A 4PGNA 2H99A 4AS4A 5I3SA 1ZTYA 4RYAA 3S9EA 4GLIA 3PD8A 4DE8A 2JJKA 1EZPA 1VDWA 3IJXB 3L6HA 3JZJA 1HSJA 3K2DA 3BBRA 1IEJA 3IAZA 3H03A 2OCUA 1NH8A 5H8QA 2FNCA 5K2XA 1B32A 2V93A 4YKIA 2HAUA 3UORA 3OSQA 4OWDA 1G0IA 3MW0A 4KYEA 5B7DA 2H98A 5AA3A 2B3FA 4POXA 3PPRA 4PETA 4H65A 3QXMA 3VFJA 3HCQA 1B1HA 1NUZA 3IB1A 3PD9A 4NGUA 2F3DA 4EQ9A 1MQDA 4N8YA 3V89B 1XOCA 3FATA 4BDLA 4ECFA 5FHMA 1FBEA 1QKAA 1TFAA 1FTLA 2XWKA 4TOZA 3TPAA 1IXHA 4NF0A 1IQ7A 1US5A 3W15C 2O7UA 3S4UA 4OQOA 3MSTA 2OX3A 1L5TA 4IGRA 2VP1A 1A54A 2VHAA 5I58A 2I48A 5DTBA 3BIHA 4PC9A 2O1LA 2Y5KA 4IO5A 3TMGA 1MXZA 5EYHA 3E4RA 2E0SA 2XWOA 4DLDA 2PT2A 3FV1A 1IXGA 3LC8A 4E0WA 1D9YA 1NNPA 4RA1A 5I56B 1IMFA 2QS1A 1TXFA 1MY1A 4OZ9A 1B3HA 4F29A 1I6AA 4I3EA 4F3BA 3Q27A 2ZNUA 4NEDA 3C34A 2Z8EA 3O6GA 3OO7A 1O63A 4O3CA 4LQ5A 5L9OA 3O2AA 4KR5A 3U93A 3PU5A 4TLMB 1DPEA 4UABA 4N91A 3T9UA 4MMPA 2A5SA 3CFLA 3K6WA 4YB5A 5A5XB 1NMUA 3SERA 3HV1A 3RY3A 3KC0A 1DK4A 1Z7ME 1JW5A 3SETA 1YXIA 1NUXA 1DBZA 2PBWA 1P1QA 1FTJA 3O6IA 3MVWA 2I58A 3OENA 1I6BA 3H3GA 1RDZA 2VGQA 3MAMA 1SQYA 1MM6A 4LZ8A 1B4HA 2E1SA 4ZEFA 1B0LA 2F8DA 5DEXB 3MC2A 4PFTA 3HPIA 4PFYA 3H6UA 3MZ9A 5FTIA 3K6VA 4HW8A 3UA8A 4EQBA 5F24A 2ONKE 2Z23A 2F35A 3CFXA 4O7IA 3QIMA 2QSXA 4NAPA 2XD2A 2F36A 4BDMA 5IZ3A 3ILUB 3Q25A 4N17A 3FVKA 4OEUA 2DXYA 2Q8JA 4O3AA 4OETA 4L17A 4ND9A 2O84X 1VFDA 1AIVA 1NV1A 3USDA 3EHUA 3H6TA 5H8QB 3TELA 3TQWA 1ZKBA 1N0TA 2P0SA 4XKRA
chains in the Genus database with same CATH topology
2XX9A 1R1NA 5ITPA 3L6GA 2RC9A 4RK2A 1N3XA 1UIUA 3ZKKA 2XXRA 5B70A 1M5DA 2DVZA 2OBGA 1J1NA 2GH9A 4NTLA 4DCYA 5L9MA 1GTKA 1B3GA 2W7YA 3DM0A 3LSXA 3MVYA 4GQOA 3HHGA 3LSLA 4MLVA 4XKQA 3QUFA 5I58B 2XD3A 3RGYA 5ISUA 1MDP1 4UACA 2V25A 3IB2A 2AL4A 3UGWA 2AYSA 3KGCA 4FECA 2UYFA 1HSLA 1SDXA 2D5WA 2ANJA 3OO6A 4LVQA 1ANFA 3KZGA 5F1QA 3GZGA 2QJEA 1DPPA 3OMBA 4IY6A 4G8HA 1GVCA 3A3UA 1CB6A 1MQJA 3ZS6A 2Q9TA 2GRVA 3IOWA 3CVGA 1LCFA 4LA9A 1MXYA 1ZMGA 3LBSA 1JETA 5ICTA 3S9MC 2V84A 3N5LA 5KZTA 2HFBA 5AA2A 3TZAA 1Q35A 3IK6B 4F39A 2ONSA 3LUYA 5AE4A 3OD7A 1O7TA 2B65A 1T0KA 4NF5A 1SW2A 3KN8A 3RT6B 4LP2B 1XS5A 3PPOA 3EPEA 5HBCA 2Z8FA 3ONMA 1URDA 4F3PA 1EZ9A 3M8UA 4H8IA 1B3LA 4GXSB 5KDTB 1AH5A 2ZYKA 3GXAA 2D21A 3C33A 4G8MA 1A8EA 1MQIA 3C32A 4O3BA 2O51A 1FQBA 5TP9A 3EN3A 2Q2CA 1MXXA 4LZ5A 1DTGA 2UXAA 5F7VA 2Y7KA 5ITOA 1LLSA 3DP6A 4P11A 2GHBA 1IITA 5IKBA 2DWHA 5I2KA 4OEVA 4EQ7A 2HZKA 1OVBA 4U2RA 1B0HA 1LB9A 3R6UA 4WXJA 4HCWA 3N94A 3I5OA 3M3LA 4GXAA 2QRYA 1B6HA 4IO3A 4R72A 1B51A 4U1ZA 1OMPA 1Y4TA 3C31A 1LAXA 2X26A 3TODA 1WVJA 1MH4A 4U4SA 1QW0A 3IORA 4KCDA 1URGA 4EDPA 3O29A 4R74A 1Y3NA 4EF2A 1R9LA 4WKMA 5EYFA 2Y7PA 3K00A 3G3JA 2FA7A 3C4MA 4JWOA 3RTFB 4AB5A 3CIJA 1XHYA 1DSNA 2ABHA 2F7AA 1M5EA 2XXXA 5AA2B 4F22A 3ZKLA 3PUVE 3RT8A 1S9TA 2Q88A 4NF4A 3EHSA 4OFLA 3MZBA 3N6UA 1VR5A 3V83A 3OEKA 1SI1A 5CMMA 4NF5B 3TDJA 3E13X 1MQHA 5FHNA 3IO6A 2IA4A 3CG3A 5H8FB 4H1XA 3T9VA 1ELJA 3SEWA 4F18A 5HM4B 1ATGA 1LFGA 3G3GA 2NOOA 1SW4A 2F6GA 2I4BA 1M5CA 4ELQA 4Q0CA 1FW0A 5K2YA 5DVFA 2THIA 3GBAA 1B58A 3QYTA 3DP4A 2P1SA 1GV8A 3UK4A 1FQAA 4YAHX 3IJOB 4Q8RA 5EHMA 1UTHB 4I8CA 1YPNA 1AL3A 4ELOA 1MY4A 1OVTA 3TCFA 2ZNTA 4MH5A 1RYXA 3TQLA 1P1NA 4ZE9A 1GR2A 4H0WA 5I2NA 1LB8A 3G3FA 1VFEA 1IZ1A 5CC2A 4C1UA 3ODBA 3MP1A 1AMFA 1SVXB 3KJ7A 4QSCA 3U1OA 1FTMA 3K4UA 2GHAA 2ZNSA 3KBRA 2DS9A 3ECRA 3KN3A 3FJGA 5H8HA 1N84A 1YTVA 3S2VA 2I6EA 4TQUQ 1A7LA 1NL5A 1PDAA 4E0XA 1OLAA 4GVOA 4OFJA 3V5AA 4QSEA 2F6PA 3T22A 4DXBA 4MFIA 3DP8A 3HHFA 2YJPA 1DTZA 3IR1A 3IOTA 3IOVA 3R26A 5I57A 2OWSA 5BUUA 3R7XA 1LAGE 3JYRA 5CRYA 3RNNA 4LZ7A 3VDFA 4ONYA 4G77A 4X1BA 4KD5A 1F9BA 3O28A 4F1UA 3C9HA 4PP0A 5JK4A 1JVXA 2R6GE 3KG2A 2QMWA 3VLUA 2UYEA 1ZU0A 4F1VA 3T96B 3K6XA 3OEMA 4QHQA 3H6VA 2QL3A 3KSXA 3FASA 2XXPA 1B05A 1TFDA 2YLNA 3K1NA 1B7ZA 3TTLA 4QRZA 2DXRA 3FVGA 1FQFA 4C0RA 4EXLA 3K02A 2V3UA 3CSBA 2F97A 1HSEA 1QUKA 4GL0A 4G68A 4ZS9A 1N7WA 2V3TA 3FIRA 1N7XA 2DQVA 4NF6A 2XHDA 3C36A 3SEXA 4FORA 2RC7A 4UA8A 4YICA 3KOSA 4U4XA 3O97A 3T66A 4IO6A 2QPQA 3UIFA 4F1YA 3EF7A 1P1WA 3BFUA 3H7MA 3PMWA 5I2NB 1I69A 1LAFE 3PV0E 1Y1MA 2Y84A 3JV9A 5AA4A 4BDNA 1CE2A 2XXUA 4P0GA 4G68C 4WEDA 4EXKA 4N07A 1UQWA 1B1XA 4R2BA 4ZEDA 4JXIA 5JEIA 1Y20A 2LAOA 1B2HA 1VSOA 4ESWA 2OJTA 3TKDA 5TPAA 3FVNA 2NWJA 4GL8A 5EHSA 3MVXA 2AIXA 2XXYA 4H5FA 1SI0A 4RK9A 2CMOA 4XXUA 2DP8A 2I3VA 5FTHA 1Y3QA 3T9XB 3U8QA 4JSOA 3Q28A 1SW5A 5H8SA 3G3IA 4EUOA 5L8DA 4OHNA 1WODA 2NUVA 3MP8A 1I6QA 2F34A 4ZZAA 3FGSA 3GBBA 2RINA 4I9DA 1B4ZA 1D3KA 1MY2A 1H76A 3MJNA 1YAEA 4RNSA 2HAVA 2HXWA 4BDRA 1RKMA 3ILTB 3PUZE 5CMKA 3D4CA 1SYIA 4GRKA 4F2QA 3OSRA 4FEDA 1D4NA 3SEYA 1DOTA 1IIWA 3VLWA 4ELPA 5I59A 2H5YA 4OENA 1LFIA 3TTRA 3RQTA 4XTCQ 3OELA 4U23A 4JWYA 4YKJA 4MBPA 1NFTA 1B3FA 4R73A 4G68B 3FJMA 2H4IA 2RF1A 4OERA 4Q30B 3N6TA 1NKXA 4NF6B 4IB2A 4OESA 2XXIA 1B9JA 4NMYA 1RYOA 4KI0E 3IO4A 3TUSA 1B52A 3QUJA 4KFQA 4ESXA 3MPKA 2BJJX 4FJPA 5HPQA 4IO2A 4ISUA 2UVGA 2ZYMA 1ZBMA 4JSDA 3UP9A 2UVHA 1P1UA 5AA4B 2I0CA 3P7IA 2DWJA 3W9WA 4DCXA 3H06B 4FATA 4XKNA 1MXWA 1AOVA 4BDOA 2Z8DA 1B5HA 3VXBA 4ZDMA 4M1VA 1B5IA 3EHTA 1JEVA 1EU8A 5TPAB 1MXVA 3A3CA 1MY3A 1S50A 2Z22A 1QVSA 3RTWB 2WKYA 4N6PA 1IUDA 4YB6A 2Y7RA 4F31B 2D3IA 2I0BA 1Y9UA 3TCGA 1QKBA 1R6ZA 4U1OA 4YKPA 3VVDA 4RPOA 3PUXE 4DIGA 2PVUA 3G3KA 5JTYA 3UN6A 3SESA 1LGBC 4KCCA 5L9SA 1Y3PA 2A5TA 1H45A 4R6YA 4BLAA 1EH3A 3MQ9A 1OQHA 3FV2A 1PB7A 2O69A 1SYHA 2FYIA 4YU0A 4YKKA 4F19A 2DOJA 3K1PA 2B3BA 1B3EA 4NWDA 3I6VA 1USYH 4LATA 3CSGA 3G3HA 3B6WA 4Q5TA 3Q26A 3U92A 5M2VA 1PEBA 4FE8A 1H43A 1TT1A 4G8NA 4LQ2A 5A5XA 5KCJA 3AXFA 2Q2AA 2QS2A 5I84A 3SEUA 1EZOA 2OK2A 1GGGA 2NXOA 2UVJA 1B5JA 2O7IA 3TCHA 3PPNA 2X7PA 4AB6A 4QFKA 5TU0A 4H67A 1DMBA 2ZMBA 3RN8A 2DYXA 2F7BA 1ZJLA 5AA1A 3SDFA 1NH7A 1YCJA 1KWHA 4IO4A 1A40A 2AL5A 4FAJA 2QS3A 1WDNA 1VE4A 1LCTA 1MH3A 4QFNA 5TP9B 5FHOA 3EQ1A 3G7WA 1MG1A 1Z7NE 2ALUA 1N04A 4XKPA 4ZEIA 2CZLA 2R71A 1PB9A 3CRBA 2HZLA 3HN0A 1FCKA 3Q29A 4H8JA 2F7CA 5H8NA 2OZZA 3RUMA 1JNFA 5I2KB 4YMBA 2H9BA 1TWYA 3FJ7A 3MVZA 2H25A 3PPPA 3HSTA 1B7HA 2ZYNA 1LAHE 2XX7A 2RCAA 1USYE 2VD3A 5DVIA 3M3FA 3M3KA 4IGTA 3B6QA 4R9GA 3PMXA 1N3WA 5DVJA 4ZEBA 5DYHA 1S7YA 1OIBA 3LR1A 1ZLQA 3MP6A 4M4GA 3OOAA 3PMVA 3PUWE 1MPBA 2VD2A 3D4GA 4F3SA 3TTMA 5LOMA 1LBCA 5JTYB 5CMCA 3IL1B 4F2OA 1SW1A 1B46A 3KOTA 4U22A 2O68A 2A5TB 1H44A 1P99A 4GF8A 2YPNA 5J1DA 1SBPA 1FTOA 4GFRA 4HTGA 1R9QA 2V3QA 3OXNA 2XXTA 3GLBA 3TFLA 3TAJA 3KSJA 1JVYA 4NF4B 1N76A 4ZECA 3C35A 3ZSFA 2IEEA 2Y7WA 2Q89A 2PX1A 1P1OA 3TTNA 3KFMA 3MUQA 1QUJA 5KCJB 1LFHA 3VVFA 3CR9A 4H6DA 3K01A 1BIYA 4JBZA 1BP5A 2ESNA 3O9PA 1UTBA 2DWIA 4I62A 4KYSA 5CM6A 4EF1A 3U72A 3T93B 1BTJA 4RXLA 2M8CA 2DWAA 2O6AA 4POWA 3VV5A 3I3VA 1Y4CA 3H6WA 4OVJA 4X9TA 4YMAA 2F78A 2Y7IA 4JB7A 4K3FA 4R9FA 4NF8A 3K6UA 3MBPA 1O64A 4NWCA 3IB0A 4QFOA 4R6HA 1M5BA 4PFUA 1FTKA 1Y1ZA 2XX8A 4WEPA 4FEBA 4QSDA 3RLFE 2GFEA 3B6TA 5H8NB 4HCYA 1PBQA 4C1TA 3E3KA 5KDTA 4MF3A 3VE1B 4Z0IA 1BKAA 4N13A 1PC3A 1D9VA 4RPNA 3K1MA 4I1DA 2ZYOA 3PPQA 1MM7A 4RJZA 2G29A 4GIZA 3PUYE 3BKIB 2REGA 5IAIA 3DLNA 3MPLA 3VVEA 5H8HB 4JDFA 5CI5A 1POY1 4PQJA 4YZZA 3WAFA 1M5FA 4ZE8A 1PB8A 5AA2D 4GWOA 4OTEA 4KQPA 4QF9A 3K0VA 2F5XA 4KYDA 2RKMA 2PT1A 4OYVA 3QK6A 4R6KA 5I57B 3FXUA 5BWJA 3F11A 3QSLA 4ELRA 1MPCA 4KHZE 3OO9A 1PBPA 4NE4A 2NVUB 3THIA 4DZ1A 4OFOA 3FUZA 1NNFA 1XVXA 4OXVA 3B7DA 3LSWA 3FXRA 5CBSA 1FQEA 3KN7A 3RPWA 1MS7A 4LONB 1UTBB 1QJMA 4P0IA 2PMSA 2I49A 4JWXA 2XXQA 2I3WA 4Z7EA 3BFTA 1B7UA 3MZ1A 3T9HB 4GD5A 1JEUA 4DXCA 3WAEA 2OLBA 4G4PA 2HEUA 3FXQA 1XC1A 4U21A 2P2AA 4F3GA 4NF8B 2XXVA 4MLQA 1NNKA 4DXUA 5H8FA 1JW1A 3TEPA 4H5GA 1US4A 2REJA 2DE3A 2R9JA 1A99A 2OWTA 3KEIA 1MXUA 4QFLA 4KPTA 2DVCA 3V8XB 2QMXA 3O66A 4HS7A 5CMBA 3MWBA 1JQFA 3KJTA 1MY0A 3S9LC 3FVOA 3CG1A 5ELVA 4IY5A 4FIMA 1NNTA 2X7QA 1OLCA 2QS4A 1UTHA 1ZIUA 4X1DA 3A09A 3H4ZA 4G2ZA 4TLLB 2XXWA 3OO8A 1B40A 1II5A 1QULA 2DE4A 2DSFA 1Q1KA 2RCBA 1IXIA 1FQCA 1SD3A 1A55A 4IO7A 2PYYA 3SEVA 4BDQA 4QFPA 1QUIA 1MPDA 3TYHA 3QAXA 3IOUA 2KLFA 4ZZEA 4THIA 5I56A 4ZEKA 1MQGA 2UVIA 4XIGQ 4PE5B 2XXHA 1XVYA 3VLVA 2ONRA 1MRPA 2VOZA 3TTKA 3SKPA 1BLFA 3O6HA 3CI8A 1XT8A 4X48A 3CFZA 4LUBA 3U94A 3IX1A 2O1MA 1OQGA 4YB7A 4GOTA 3VXCA 1URSA 2HQ0A 2I4CA 3HO7A 5CBRA 1JW4A 4R2FA 3FD3A 3E9XA 5ICQA 1H3DA 5I59B 1POTA 4AQ4A 1IXCA 2RC8A 4OMBA 1UIVA 3S9NC 1MDQA 3W9VA 3FZVA 2HCAA 3PGFA 1LBBA 3LSFB 1FQDA 2G93A 1A8FA 4PFWA 5DEXA 5DT6A 1LSTA 4RY1A 4R75A 3DELB 2ZXTA 3N26A 4DDDA 2DE2A 2H99A 1ZTYA 4RYAA 3S9EA 4GLIA 3PD8A 4DE8A 1EZPA 3IJXB 3L6HA 3JZJA 1HSJA 3K2DA 3BBRA 1IEJA 3IAZA 3H03A 2OCUA 1NH8A 5H8QA 2FNCA 5K2XA 1B32A 2V93A 4YKIA 2HAUA 3UORA 3OSQA 4OWDA 3MW0A 4KYEA 5B7DA 2H98A 5AA3A 2B3FA 4POXA 3PPRA 4PETA 4H65A 3QXMA 3VFJA 3HCQA 1B1HA 3IB1A 3PD9A 4EQ9A 1MQDA 3V89B 1XOCA 3FATA 4BDLA 4ECFA 5FHMA 1QKAA 1TFAA 1FTLA 4TOZA 3TPAA 1IXHA 1IQ7A 3W15C 1US5A 2O7UA 3S4UA 4OQOA 1L5TA 4IGRA 2VP1A 1A54A 2VHAA 5I58A 2I48A 5DTBA 2O1LA 4IO5A 3TMGA 1MXZA 3E4RA 2E0SA 4DLDA 2PT2A 3FV1A 1IXGA 3LC8A 4E0WA 1D9YA 1NNPA 4RA1A 5I56B 2QS1A 1TXFA 1MY1A 4OZ9A 1B3HA 4F29A 1I6AA 4F3BA 3Q27A 2ZNUA 4NEDA 3C34A 2Z8EA 3O6GA 3OO7A 1O63A 4O3CA 4LQ5A 5L9OA 3O2AA 4KR5A 3U93A 3PU5A 4TLMB 1DPEA 3T9UA 2A5SA 3CFLA 3K6WA 4YB5A 5A5XB 1NMUA 3SERA 3HV1A 3RY3A 1Z7ME 1JW5A 3SETA 2PBWA 1P1QA 1FTJA 3O6IA 3MVWA 2I58A 3OENA 1I6BA 3H3GA 2VGQA 3MAMA 1SQYA 1MM6A 4LZ8A 1B4HA 2E1SA 4ZEFA 1B0LA 2F8DA 5DEXB 3MC2A 4PFTA 3HPIA 4PFYA 3H6UA 3MZ9A 5FTIA 3K6VA 4HW8A 3UA8A 4EQBA 2ONKE 2Z23A 2F35A 3CFXA 3QIMA 2QSXA 2XD2A 2F36A 4BDMA 3ILUB 3Q25A 3FVKA 4OEUA 2DXYA 2Q8JA 4O3AA 4OETA 4L17A 4ND9A 2O84X 1VFDA 1AIVA 3USDA 3EHUA 3H6TA 5H8QB 3TELA 3TQWA 1ZKBA 1N0TA 2P0SA 4XKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XX9 A;  1R1N A;  5ITP A;  3L6G A;  2RC9 A;  4RK2 A;  1N3X A;  1UIU A;  3ZKK A;  2XXR A;  5B70 A;  1M5D A;  2DVZ A;  2OBG A;  1J1N A;  2GH9 A;  4NTL A;  4DCY A;  5L9M A;  1GTK A;  1B3G A;  2W7Y A;  3DM0 A;  3LSX A;  3MVY A;  4GQO A;  3HHG A;  3LSL A;  4MLV A;  4XKQ A;  3QUF A;  5I58 B;  2XD3 A;  3RGY A;  5ISU A;  1MDP 1;  4UAC A;  2V25 A;  3IB2 A;  2AL4 A;  3UGW A;  2AYS A;  3KGC A;  4FEC A;  2UYF A;  1HSL A;  1SDX A;  2D5W A;  2ANJ A;  3OO6 A;  4LVQ A;  1ANF A;  3KZG A;  5F1Q A;  3GZG A;  2QJE A;  1DPP A;  3OMB A;  4IY6 A;  4G8H A;  1GVC A;  3A3U A;  1CB6 A;  1MQJ A;  3ZS6 A;  2Q9T A;  2GRV A;  3IOW A;  3CVG A;  1LCF A;  4LA9 A;  1MXY A;  1ZMG A;  3LBS A;  1JET A;  5ICT A;  3S9M C;  2V84 A;  3N5L A;  5KZT A;  2HFB A;  5AA2 A;  3TZA A;  1Q35 A;  3IK6 B;  4F39 A;  2ONS A;  3LUY A;  5AE4 A;  3OD7 A;  1O7T A;  2B65 A;  1T0K A;  4NF5 A;  1SW2 A;  3KN8 A;  3RT6 B;  4LP2 B;  1XS5 A;  3PPO A;  3EPE A;  5HBC A;  2Z8F A;  3ONM A;  1URD A;  4F3P A;  1EZ9 A;  3M8U A;  4H8I A;  1B3L A;  4GXS B;  5KDT B;  1AH5 A;  2ZYK A;  3GXA A;  2D21 A;  3C33 A;  4G8M A;  1A8E A;  1MQI A;  3C32 A;  4O3B A;  2O51 A;  1FQB A;  5TP9 A;  3EN3 A;  2Q2C A;  1MXX A;  4LZ5 A;  1DTG A;  2UXA A;  5F7V A;  2Y7K A;  5ITO A;  1LLS A;  3DP6 A;  4P11 A;  2GHB A;  1IIT A;  5IKB A;  2DWH A;  5I2K A;  4OEV A;  4EQ7 A;  2HZK A;  1OVB A;  4U2R A;  1B0H A;  1LB9 A;  3R6U A;  4WXJ A;  4HCW A;  3N94 A;  3I5O A;  3M3L A;  4GXA A;  2QRY A;  1B6H A;  4IO3 A;  4R72 A;  1B51 A;  4U1Z A;  1OMP A;  1Y4T A;  3C31 A;  1LAX A;  2X26 A;  3TOD A;  1WVJ A;  1MH4 A;  4U4S A;  1QW0 A;  3IOR A;  4KCD A;  1URG A;  4EDP A;  3O29 A;  4R74 A;  1Y3N A;  4EF2 A;  1R9L A;  4WKM A;  5EYF A;  2Y7P A;  3K00 A;  3G3J A;  2FA7 A;  3C4M A;  4JWO A;  3RTF B;  4AB5 A;  3CIJ A;  1XHY A;  1DSN A;  2ABH A;  2F7A A;  1M5E A;  2XXX A;  5AA2 B;  4F22 A;  3ZKL A;  3PUV E;  3RT8 A;  1S9T A;  2Q88 A;  4NF4 A;  3EHS A;  4OFL A;  3MZB A;  3N6U A;  1VR5 A;  3V83 A;  3OEK A;  1SI1 A;  5CMM A;  4NF5 B;  3TDJ A;  3E13 X;  1MQH A;  5FHN A;  3IO6 A;  2IA4 A;  3CG3 A;  5H8F B;  4H1X A;  3T9V A;  1ELJ A;  3SEW A;  4F18 A;  5HM4 B;  1ATG A;  1LFG A;  3G3G A;  2NOO A;  1SW4 A;  2F6G A;  2I4B A;  1M5C A;  4ELQ A;  4Q0C A;  1FW0 A;  5K2Y A;  5DVF A;  2THI A;  3GBA A;  1B58 A;  3QYT A;  3DP4 A;  2P1S A;  1GV8 A;  3UK4 A;  1FQA A;  4YAH X;  3IJO B;  4Q8R A;  5EHM A;  1UTH B;  4I8C A;  1YPN A;  1AL3 A;  4ELO A;  1MY4 A;  1OVT A;  3TCF A;  2ZNT A;  4MH5 A;  1RYX A;  3TQL A;  1P1N A;  4ZE9 A;  1GR2 A;  4H0W A;  5I2N A;  1LB8 A;  3G3F A;  1VFE A;  1IZ1 A;  5CC2 A;  4C1U A;  3ODB A;  3MP1 A;  1AMF A;  1SVX B;  3KJ7 A;  4QSC A;  3U1O A;  1FTM A;  3K4U A;  2GHA A;  2ZNS A;  3KBR A;  2DS9 A;  3ECR A;  3KN3 A;  3FJG A;  5H8H A;  1N84 A;  1YTV A;  3S2V A;  2I6E A;  4TQU Q;  1A7L A;  1NL5 A;  1PDA A;  4E0X A;  1OLA A;  4GVO A;  4OFJ A;  3V5A A;  4QSE A;  2F6P A;  3T22 A;  4DXB A;  4MFI A;  3DP8 A;  3HHF A;  2YJP A;  1DTZ A;  3IR1 A;  3IOT A;  3IOV A;  3R26 A;  5I57 A;  2OWS A;  5BUU A;  3R7X A;  1LAG E;  3JYR A;  5CRY A;  3RNN A;  4LZ7 A;  3VDF A;  4ONY A;  4G77 A;  4X1B A;  4KD5 A;  1F9B A;  3O28 A;  4F1U A;  3C9H A;  4PP0 A;  5JK4 A;  1JVX A;  2R6G E;  3KG2 A;  2QMW A;  3VLU A;  2UYE A;  1ZU0 A;  4F1V A;  3T96 B;  3K6X A;  3OEM A;  4QHQ A;  3H6V A;  2QL3 A;  3KSX A;  3FAS A;  2XXP A;  1B05 A;  1TFD A;  2YLN A;  3K1N A;  1B7Z A;  3TTL A;  4QRZ A;  2DXR A;  3FVG A;  1FQF A;  4C0R A;  4EXL A;  3K02 A;  2V3U A;  3CSB A;  2F97 A;  1HSE A;  1QUK A;  4GL0 A;  4G68 A;  4ZS9 A;  1N7W A;  2V3T A;  3FIR A;  1N7X A;  2DQV A;  4NF6 A;  2XHD A;  3C36 A;  3SEX A;  4FOR A;  2RC7 A;  4UA8 A;  4YIC A;  3KOS A;  4U4X A;  3O97 A;  3T66 A;  4IO6 A;  2QPQ A;  3UIF A;  4F1Y A;  3EF7 A;  1P1W A;  3BFU A;  3H7M A;  3PMW A;  5I2N B;  1I69 A;  1LAF E;  3PV0 E;  1Y1M A;  2Y84 A;  3JV9 A;  5AA4 A;  4BDN A;  1CE2 A;  2XXU A;  4P0G A;  4G68 C;  4WED A;  4EXK A;  4N07 A;  1UQW A;  1B1X A;  4R2B A;  4ZED A;  4JXI A;  5JEI A;  1Y20 A;  2LAO A;  1B2H A;  1VSO A;  4ESW A;  2OJT A;  3TKD A;  5TPA A;  3FVN A;  2NWJ A;  4GL8 A;  5EHS A;  3MVX A;  2AIX A;  2XXY A;  4H5F A;  1SI0 A;  4RK9 A;  2CMO A;  4XXU A;  2DP8 A;  2I3V A;  5FTH A;  1Y3Q A;  3T9X B;  3U8Q A;  4JSO A;  3Q28 A;  1SW5 A;  5H8S A;  3G3I A;  4EUO A;  5L8D A;  4OHN A;  1WOD A;  2NUV A;  3MP8 A;  1I6Q A;  2F34 A;  4ZZA A;  3FGS A;  3GBB A;  2RIN A;  4I9D A;  1B4Z A;  1D3K A;  1MY2 A;  1H76 A;  3MJN A;  1YAE A;  4RNS A;  2HAV A;  2HXW A;  4BDR A;  1RKM A;  3ILT B;  3PUZ E;  5CMK A;  3D4C A;  1SYI A;  4GRK A;  4F2Q A;  3OSR A;  4FED A;  1D4N A;  3SEY A;  1DOT A;  1IIW A;  3VLW A;  4ELP A;  5I59 A;  2H5Y A;  4OEN A;  1LFI A;  3TTR A;  3RQT A;  4XTC Q;  3OEL A;  4U23 A;  4JWY A;  4YKJ A;  4MBP A;  1NFT A;  1B3F A;  4R73 A;  4G68 B;  3FJM A;  2H4I A;  2RF1 A;  4OER A;  4Q30 B;  3N6T A;  1NKX A;  4NF6 B;  4IB2 A;  4OES A;  2XXI A;  1B9J A;  4NMY A;  1RYO A;  4KI0 E;  3IO4 A;  3TUS A;  1B52 A;  3QUJ A;  4KFQ A;  4ESX A;  3MPK A;  2BJJ X;  4FJP A;  5HPQ A;  4IO2 A;  4ISU A;  2UVG A;  2ZYM A;  1ZBM A;  4JSD A;  3UP9 A;  2UVH A;  1P1U A;  5AA4 B;  2I0C A;  3P7I A;  2DWJ A;  3W9W A;  4DCX A;  3H06 B;  4FAT A;  4XKN A;  1MXW A;  1AOV A;  4BDO A;  2Z8D A;  1B5H A;  3VXB A;  4ZDM A;  4M1V A;  1B5I A;  3EHT A;  1JEV A;  1EU8 A;  5TPA B;  1MXV A;  3A3C A;  1MY3 A;  1S50 A;  2Z22 A;  1QVS A;  3RTW B;  2WKY A;  4N6P A;  1IUD A;  4YB6 A;  2Y7R A;  4F31 B;  2D3I A;  2I0B A;  1Y9U A;  3TCG A;  1QKB A;  1R6Z A;  4U1O A;  4YKP A;  3VVD A;  4RPO A;  3PUX E;  4DIG A;  2PVU A;  3G3K A;  5JTY A;  3UN6 A;  3SES A;  1LGB C;  4KCC A;  5L9S A;  1Y3P A;  2A5T A;  1H45 A;  4R6Y A;  4BLA A;  1EH3 A;  3MQ9 A;  1OQH A;  3FV2 A;  1PB7 A;  2O69 A;  1SYH A;  2FYI A;  4YU0 A;  4YKK A;  4F19 A;  2DOJ A;  3K1P A;  2B3B A;  1B3E A;  4NWD A;  3I6V A;  1USY H;  4LAT A;  3CSG A;  3G3H A;  3B6W A;  4Q5T A;  3Q26 A;  3U92 A;  5M2V A;  1PEB A;  4FE8 A;  1H43 A;  1TT1 A;  4G8N A;  4LQ2 A;  5A5X A;  5KCJ A;  3AXF A;  2Q2A A;  2QS2 A;  5I84 A;  3SEU A;  1EZO A;  2OK2 A;  1GGG A;  2NXO A;  2UVJ A;  1B5J A;  2O7I A;  3TCH A;  3PPN A;  2X7P A;  4AB6 A;  4QFK A;  5TU0 A;  4H67 A;  1DMB A;  2ZMB A;  3RN8 A;  2DYX A;  2F7B A;  1ZJL A;  5AA1 A;  3SDF A;  1NH7 A;  1YCJ A;  1KWH A;  4IO4 A;  1A40 A;  2AL5 A;  4FAJ A;  2QS3 A;  1WDN A;  1VE4 A;  1LCT A;  1MH3 A;  4QFN A;  5TP9 B;  5FHO A;  3EQ1 A;  3G7W A;  1MG1 A;  1Z7N E;  2ALU A;  1N04 A;  4XKP A;  4ZEI A;  2CZL A;  2R71 A;  1PB9 A;  3CRB A;  2HZL A;  3HN0 A;  1FCK A;  3Q29 A;  4H8J A;  2F7C A;  5H8N A;  2OZZ A;  3RUM A;  1JNF A;  5I2K B;  4YMB A;  2H9B A;  1TWY A;  3FJ7 A;  3MVZ A;  2H25 A;  3PPP A;  3HST A;  1B7H A;  2ZYN A;  1LAH E;  2XX7 A;  2RCA A;  1USY E;  2VD3 A;  5DVI A;  3M3F A;  3M3K A;  4IGT A;  3B6Q A;  4R9G A;  3PMX A;  1N3W A;  5DVJ A;  4ZEB A;  5DYH A;  1S7Y A;  1OIB A;  3LR1 A;  1ZLQ A;  3MP6 A;  4M4G A;  3OOA A;  3PMV A;  3PUW E;  1MPB A;  2VD2 A;  3D4G A;  4F3S A;  3TTM A;  5LOM A;  1LBC A;  5JTY B;  5CMC A;  3IL1 B;  4F2O A;  1SW1 A;  1B46 A;  3KOT A;  4U22 A;  2O68 A;  2A5T B;  1H44 A;  1P99 A;  4GF8 A;  2YPN A;  5J1D A;  1SBP A;  1FTO A;  4GFR A;  4HTG A;  1R9Q A;  2V3Q A;  3OXN A;  2XXT A;  3GLB A;  3TFL A;  3TAJ A;  3KSJ A;  1JVY A;  4NF4 B;  1N76 A;  4ZEC A;  3C35 A;  3ZSF A;  2IEE A;  2Y7W A;  2Q89 A;  2PX1 A;  1P1O A;  3TTN A;  3KFM A;  3MUQ A;  1QUJ A;  5KCJ B;  1LFH A;  3VVF A;  3CR9 A;  4H6D A;  3K01 A;  1BIY A;  4JBZ A;  1BP5 A;  2ESN A;  3O9P A;  1UTB A;  2DWI A;  4I62 A;  4KYS A;  5CM6 A;  4EF1 A;  3U72 A;  3T93 B;  1BTJ A;  4RXL A;  2M8C A;  2DWA A;  2O6A A;  4POW A;  3VV5 A;  3I3V A;  1Y4C A;  3H6W A;  4OVJ A;  4X9T A;  4YMA A;  2F78 A;  2Y7I A;  4JB7 A;  4K3F A;  4R9F A;  4NF8 A;  3K6U A;  3MBP A;  1O64 A;  4NWC A;  3IB0 A;  4QFO A;  4R6H A;  1M5B A;  4PFU A;  1FTK A;  1Y1Z A;  2XX8 A;  4WEP A;  4FEB A;  4QSD A;  3RLF E;  2GFE A;  3B6T A;  5H8N B;  4HCY A;  1PBQ A;  4C1T A;  3E3K A;  5KDT A;  4MF3 A;  3VE1 B;  4Z0I A;  1BKA A;  4N13 A;  1PC3 A;  1D9V A;  4RPN A;  3K1M A;  4I1D A;  2ZYO A;  3PPQ A;  1MM7 A;  4RJZ A;  2G29 A;  4GIZ A;  3PUY E;  3BKI B;  2REG A;  5IAI A;  3DLN A;  3MPL A;  3VVE A;  5H8H B;  4JDF A;  5CI5 A;  1POY 1;  4PQJ A;  4YZZ A;  3WAF A;  1M5F A;  4ZE8 A;  1PB8 A;  5AA2 D;  4GWO A;  4OTE A;  4KQP A;  4QF9 A;  3K0V A;  2F5X A;  4KYD A;  2RKM A;  2PT1 A;  4OYV A;  3QK6 A;  4R6K A;  5I57 B;  3FXU A;  5BWJ A;  3F11 A;  3QSL A;  4ELR A;  1MPC A;  4KHZ E;  3OO9 A;  1PBP A;  4NE4 A;  2NVU B;  3THI A;  4DZ1 A;  4OFO A;  3FUZ A;  1NNF A;  1XVX A;  4OXV A;  3B7D A;  3LSW A;  3FXR A;  5CBS A;  1FQE A;  3KN7 A;  3RPW A;  1MS7 A;  4LON B;  1UTB B;  1QJM A;  4P0I A;  2PMS A;  2I49 A;  4JWX A;  2XXQ A;  2I3W A;  4Z7E A;  3BFT A;  1B7U A;  3MZ1 A;  3T9H B;  4GD5 A;  1JEU A;  4DXC A;  3WAE A;  2OLB A;  4G4P A;  2HEU A;  3FXQ A;  1XC1 A;  4U21 A;  2P2A A;  4F3G A;  4NF8 B;  2XXV A;  4MLQ A;  1NNK A;  4DXU A;  5H8F A;  1JW1 A;  3TEP A;  4H5G A;  1US4 A;  2REJ A;  2DE3 A;  2R9J A;  1A99 A;  2OWT A;  3KEI A;  1MXU A;  4QFL A;  4KPT A;  2DVC A;  3V8X B;  2QMX A;  3O66 A;  4HS7 A;  5CMB A;  3MWB A;  1JQF A;  3KJT A;  1MY0 A;  3S9L C;  3FVO A;  3CG1 A;  5ELV A;  4IY5 A;  4FIM A;  1NNT A;  2X7Q A;  1OLC A;  2QS4 A;  1UTH A;  1ZIU A;  4X1D A;  3A09 A;  3H4Z A;  4G2Z A;  4TLL B;  2XXW A;  3OO8 A;  1B40 A;  1II5 A;  1QUL A;  2DE4 A;  2DSF A;  1Q1K A;  2RCB A;  1IXI A;  1FQC A;  1SD3 A;  1A55 A;  4IO7 A;  2PYY A;  3SEV A;  4BDQ A;  4QFP A;  1QUI A;  1MPD A;  3TYH A;  3QAX A;  3IOU A;  2KLF A;  4ZZE A;  4THI A;  5I56 A;  4ZEK A;  1MQG A;  2UVI A;  4XIG Q;  4PE5 B;  2XXH A;  1XVY A;  3VLV A;  2ONR A;  1MRP A;  2VOZ A;  3TTK A;  3SKP A;  1BLF A;  3O6H A;  3CI8 A;  1XT8 A;  4X48 A;  3CFZ A;  4LUB A;  3U94 A;  3IX1 A;  2O1M A;  1OQG A;  4YB7 A;  4GOT A;  3VXC A;  1URS A;  2HQ0 A;  2I4C A;  3HO7 A;  5CBR A;  1JW4 A;  4R2F A;  3FD3 A;  3E9X A;  5ICQ A;  1H3D A;  5I59 B;  1POT A;  4AQ4 A;  1IXC A;  2RC8 A;  4OMB A;  1UIV A;  3S9N C;  1MDQ A;  3W9V A;  3FZV A;  2HCA A;  3PGF A;  1LBB A;  3LSF B;  1FQD A;  2G93 A;  1A8F A;  4PFW A;  5DEX A;  5DT6 A;  1LST A;  4RY1 A;  4R75 A;  3DEL B;  2ZXT A;  3N26 A;  4DDD A;  2DE2 A;  2H99 A;  1ZTY A;  4RYA A;  3S9E A;  4GLI A;  3PD8 A;  4DE8 A;  1EZP A;  3IJX B;  3L6H A;  3JZJ A;  1HSJ A;  3K2D A;  3BBR A;  1IEJ A;  3IAZ A;  3H03 A;  2OCU A;  1NH8 A;  5H8Q A;  2FNC A;  5K2X A;  1B32 A;  2V93 A;  4YKI A;  2HAU A;  3UOR A;  3OSQ A;  4OWD A;  3MW0 A;  4KYE A;  5B7D A;  2H98 A;  5AA3 A;  2B3F A;  4POX A;  3PPR A;  4PET A;  4H65 A;  3QXM A;  3VFJ A;  3HCQ A;  1B1H A;  3IB1 A;  3PD9 A;  4EQ9 A;  1MQD A;  3V89 B;  1XOC A;  3FAT A;  4BDL A;  4ECF A;  5FHM A;  1QKA A;  1TFA A;  1FTL A;  4TOZ A;  3TPA A;  1IXH A;  1IQ7 A;  3W15 C;  1US5 A;  2O7U A;  3S4U A;  4OQO A;  1L5T A;  4IGR A;  2VP1 A;  1A54 A;  2VHA A;  5I58 A;  2I48 A;  5DTB A;  2O1L A;  4IO5 A;  3TMG A;  1MXZ A;  3E4R A;  2E0S A;  4DLD A;  2PT2 A;  3FV1 A;  1IXG A;  3LC8 A;  4E0W A;  1D9Y A;  1NNP A;  4RA1 A;  5I56 B;  2QS1 A;  1TXF A;  1MY1 A;  4OZ9 A;  1B3H A;  4F29 A;  1I6A A;  4F3B A;  3Q27 A;  2ZNU A;  4NED A;  3C34 A;  2Z8E A;  3O6G A;  3OO7 A;  1O63 A;  4O3C A;  4LQ5 A;  5L9O A;  3O2A A;  4KR5 A;  3U93 A;  3PU5 A;  4TLM B;  1DPE A;  3T9U A;  2A5S A;  3CFL A;  3K6W A;  4YB5 A;  5A5X B;  1NMU A;  3SER A;  3HV1 A;  3RY3 A;  1Z7M E;  1JW5 A;  3SET A;  2PBW A;  1P1Q A;  1FTJ A;  3O6I A;  3MVW A;  2I58 A;  3OEN A;  1I6B A;  3H3G A;  2VGQ A;  3MAM A;  1SQY A;  1MM6 A;  4LZ8 A;  1B4H A;  2E1S A;  4ZEF A;  1B0L A;  2F8D A;  5DEX B;  3MC2 A;  4PFT A;  3HPI A;  4PFY A;  3H6U A;  3MZ9 A;  5FTI A;  3K6V A;  4HW8 A;  3UA8 A;  4EQB A;  2ONK E;  2Z23 A;  2F35 A;  3CFX A;  3QIM A;  2QSX A;  2XD2 A;  2F36 A;  4BDM A;  3ILU B;  3Q25 A;  3FVK A;  4OEU A;  2DXY A;  2Q8J A;  4O3A A;  4OET A;  4L17 A;  4ND9 A;  2O84 X;  1VFD A;  1AIV A;  3USD A;  3EHU A;  3H6T A;  5H8Q B;  3TEL A;  3TQW A;  1ZKB A;  1N0T A;  2P0S A;  4XKR A; 
#chains in the Genus database with same CATH topology
 2XX9 A;  1R1N A;  5ITP A;  3L6G A;  2RC9 A;  4RK2 A;  1N3X A;  4PBH A;  1UIU A;  3ZKK A;  2XXR A;  5B70 A;  1M5D A;  2DVZ A;  2OBG A;  1J1N A;  2GH9 A;  4NTL A;  1FBP A;  4DCY A;  5L9M A;  1GTK A;  1B3G A;  2W7Y A;  3DM0 A;  3LSX A;  3MVY A;  4JVD A;  4OVR A;  1NUW A;  4GQO A;  3HHG A;  3LSL A;  4MLV A;  4XKQ A;  4O94 A;  3QUF A;  5I58 B;  2XD3 A;  3RGY A;  4I3Y A;  5ISU A;  1MDP 1;  4UAC A;  2V25 A;  3IB2 A;  2AL4 A;  3UGW A;  2AYS A;  3KGC A;  4FEC A;  2UYF A;  1HSL A;  1SDX A;  2D5W A;  2ANJ A;  3OO6 A;  4OVS A;  3KC1 A;  4LVQ A;  1ANF A;  3KZG A;  5F1Q A;  4O8M A;  3GZG A;  4PDH A;  2QJE A;  4O7M A;  1DPP A;  3OMB A;  4IY6 A;  4G8H A;  1GVC A;  3A3U A;  1CB6 A;  1MQJ A;  1D9Q A;  3ZS6 A;  1RDY A;  2Q9T A;  2GRV A;  3IOW A;  3CVG A;  1LCF A;  4LA9 A;  1MXY A;  1ZMG A;  3LBS A;  1JET A;  5ICT A;  3S9M C;  1INP A;  2V84 A;  3N5L A;  5KZT A;  2HFB A;  3EKI A;  5AA2 A;  3TZA A;  1Q35 A;  3IK6 B;  4F39 A;  2ONS A;  3LUY A;  1FPF A;  5AE4 A;  3OD7 A;  1O7T A;  2B65 A;  1T0K A;  1FPJ A;  4DI3 D;  1FJ9 A;  4NF5 A;  1SW2 A;  4PFB A;  3KN8 A;  3RT6 B;  1K9Y A;  2MKZ A;  4LP2 B;  1XS5 A;  3PPO A;  3EPE A;  5HBC A;  5IZ3 B;  2Z8F A;  3ONM A;  1URD A;  4GBW A;  5EYG A;  4F3P A;  1EZ9 A;  3M8U A;  4X04 A;  4H8I A;  5EQ7 A;  5IM2 A;  1B3L A;  4GXS B;  5KDT B;  1AH5 A;  2ZYK A;  3GXA A;  2D21 A;  3C33 A;  1FPG A;  4G8M A;  1A8E A;  1MQI A;  3C32 A;  4O3B A;  4N15 A;  2O51 A;  1FQB A;  2CZH A;  5TP9 A;  3EN3 A;  2Q2C A;  4PF8 A;  1MXX A;  4LZ5 A;  1DTG A;  2FIE A;  2UXA A;  5F7V A;  2Y7K A;  5ITO A;  1LLS A;  3DP6 A;  2OWZ A;  4P11 A;  2GHB A;  1IIT A;  5IKB A;  2DWH A;  2KQZ A;  5I2K A;  4OEV A;  4EQ7 A;  4MX6 A;  2HZK A;  1OVB A;  4U2R A;  1B0H A;  1LB9 A;  2PFY A;  3R6U A;  4WXJ A;  4HCW A;  5IZZ A;  3N94 A;  3I5O A;  3M3L A;  4GXA A;  2QRY A;  1B6H A;  4IO3 A;  4R72 A;  5ET8 A;  5ESY A;  1B51 A;  5DW8 A;  4HXV A;  4U1Z A;  1OMP A;  1Y4T A;  3C31 A;  1LAX A;  2X26 A;  3TOD A;  1WVJ A;  1RDX A;  1MH4 A;  4U4S A;  1QW0 A;  3IOR A;  3B8B A;  1URG A;  4KCD A;  4EDP A;  3O29 A;  4R74 A;  1Y3N A;  2KR0 A;  2P3N A;  4EF2 A;  1R9L A;  4WKM A;  5EYF A;  2Y7P A;  3K00 A;  1IMD A;  4PFI A;  3G3J A;  2FA7 A;  3C4M A;  4JWO A;  3RTF B;  4AB5 A;  3CIJ A;  1XHY A;  1DSN A;  1CNQ A;  2VT5 A;  2ABH A;  2F7A A;  4I40 A;  1M5E A;  2XXX A;  4F22 A;  5AA2 B;  3PUV E;  3RT8 A;  3ZKL A;  1S9T A;  2Q88 A;  4NF4 A;  1Q9D A;  3RPL B;  1NV5 A;  3EHS A;  4OFL A;  3MZB A;  3N6U A;  1VR5 A;  3V83 A;  3OEK A;  1SI1 A;  4PAI A;  4PAK A;  5CMM A;  1LBW A;  4NF5 B;  3TDJ A;  3E13 X;  1MQH A;  5FHN A;  1FPD A;  3IO6 A;  2IA4 A;  3CG3 A;  4AS5 A;  5H8F B;  4H1X A;  3T9V A;  1ELJ A;  3SEW A;  4GWW A;  4OVQ A;  4F18 A;  5HM4 B;  1ATG A;  1LFG A;  3G3G A;  2NOO A;  4MIJ A;  1SW4 A;  1FPK A;  2F6G A;  5ET5 A;  2I4B A;  1M5C A;  3ISP A;  4ELQ A;  4Q0C A;  1FW0 A;  3FBP A;  5K2Y A;  5DVF A;  2THI A;  3GBA A;  2XXK A;  1B58 A;  3QYT A;  3DP4 A;  2P1S A;  1GV8 A;  3UK4 A;  1FQA A;  4YAH X;  3IJO B;  4Q8R A;  5EHM A;  1FPB A;  4N81 A;  1UTH B;  2BJI A;  4I8C A;  1YPN A;  1AL3 A;  4ELO A;  1MY4 A;  1OVT A;  3TCF A;  2ZNT A;  4MH5 A;  1RYX A;  3TQL A;  1P1N A;  4ZE9 A;  1GR2 A;  4H0W A;  5I2N A;  1LB8 A;  3G3F A;  1VFE A;  1IZ1 A;  1LEV A;  5CC2 A;  4C1U A;  3ODB A;  3MP1 A;  1LBV A;  1AMF A;  4QSC A;  1SVX B;  3KJ7 A;  4N6K A;  1FTM A;  3U1O A;  3K4U A;  2GHA A;  2ZNS A;  3KBR A;  4DI4 B;  2DS9 A;  3ECR A;  3KN3 A;  3FJG A;  5H8H A;  1LBY A;  1N84 A;  1YTV A;  3S2V A;  2I6E A;  2HHM A;  4TQU Q;  1A7L A;  1NL5 A;  1FBC A;  1PDA A;  4E0X A;  1OLA A;  4GVO A;  4OFJ A;  3V5A A;  4QSE A;  2F6P A;  3T22 A;  4DXB A;  4MFI A;  3DP8 A;  3HHF A;  4MNP A;  2YJP A;  1DTZ A;  4X8R A;  3IR1 A;  3IOT A;  3IOV A;  3R26 A;  5I57 A;  2OWS A;  5BUU A;  3R7X A;  1LAG E;  3JYR A;  5CRY A;  2HXR A;  2L5V A;  3RNN A;  4MAG A;  4LZ7 A;  4PCD A;  3VDF A;  4ONY A;  4G77 A;  4X1B A;  4KD5 A;  1F9B A;  3O28 A;  2ZZV A;  4F1U A;  3C9H A;  4PP0 A;  5JK4 A;  1JVX A;  2R6G E;  3KG2 A;  2QMW A;  3VLU A;  2UYE A;  1IMC A;  1ZU0 A;  4F1V A;  3T96 B;  3K6X A;  1FBH A;  3OEM A;  4PAF A;  5LDZ A;  4QHQ A;  3H6V A;  2QL3 A;  3KSX A;  3ROJ A;  3FAS A;  2XXP A;  1B05 A;  1TFD A;  2YLN A;  4HE2 A;  3K1N A;  1B7Z A;  3TTL A;  4QRZ A;  2DXR A;  5EQ8 A;  3FVG A;  1FQF A;  4C0R A;  4EXL A;  4GBV A;  3K02 A;  2V3U A;  3CSB A;  2F97 A;  1HSE A;  1QUK A;  4GL0 A;  4G68 A;  4ZS9 A;  1N7W A;  1LBZ A;  2V3T A;  3FIR A;  1N7X A;  2DQV A;  4NF6 A;  2XHD A;  3C36 A;  3SEX A;  4FOR A;  2RC7 A;  4UA8 A;  4YIC A;  3KOS A;  4U4X A;  3GYY A;  3O97 A;  3T66 A;  1NUY A;  4IO6 A;  2QPQ A;  3UIF A;  4F1Y A;  3EF7 A;  1P1W A;  3BFU A;  3H7M A;  3PMW A;  5I2N B;  1I69 A;  1LAF E;  3PV0 E;  1Y1M A;  2Y84 A;  3JV9 A;  2CEX A;  5AA4 A;  4BDN A;  1CE2 A;  2XXU A;  2Y5L A;  4PDD A;  3SZP A;  4P0G A;  4G68 C;  4WED A;  4EXK A;  4N07 A;  1UQW A;  1B1X A;  4R2B A;  4ZED A;  4NX1 A;  1BK4 A;  2QVR A;  4JXI A;  5JEI A;  1Y20 A;  2LAO A;  1B2H A;  1VSO A;  4ESW A;  2OJT A;  3TKD A;  5TPA A;  3FVN A;  2NWJ A;  4GL8 A;  5EHS A;  1IMA A;  3MVX A;  2AIX A;  4QXD A;  2FVZ A;  2XXY A;  4H5F A;  4GWU A;  1SI0 A;  4NHB A;  4RK9 A;  2CMO A;  4XXU A;  2DP8 A;  2I3V A;  5FTH A;  1Y3Q A;  3T9X B;  3U8Q A;  4JSO A;  3Q28 A;  1SW5 A;  2ZZW A;  2VPN A;  5H8S A;  3G3I A;  4EUO A;  5L8D A;  4OHN A;  1WOD A;  1NV3 A;  2NUV A;  3MP8 A;  1I6Q A;  2F34 A;  4ZZA A;  3FGS A;  3GBB A;  2RIN A;  4I9D A;  4LN5 A;  1B4Z A;  5ET7 A;  1D3K A;  1MY2 A;  1H76 A;  3MJN A;  1YAE A;  5A5L A;  4RNS A;  2HAV A;  2HXW A;  4BDR A;  1RKM A;  3ILT B;  3PUZ E;  4HE1 A;  5CMK A;  3D4C A;  1SYI A;  4GRK A;  4F2Q A;  3OSR A;  4FED A;  1D4N A;  3SEY A;  1DOT A;  1IIW A;  4GX4 A;  3VLW A;  4ELP A;  5I59 A;  2H5Y A;  4OEN A;  1LFI A;  3TTR A;  3RQT A;  4XTC Q;  3OEL A;  4U23 A;  4JWY A;  3HFU A;  4YKJ A;  4MBP A;  1NFT A;  4R73 A;  1B3F A;  4G68 B;  3FJM A;  2H4I A;  2RF1 A;  4OER A;  4Q30 B;  3N6T A;  1NKX A;  4NF6 B;  4IB2 A;  4OES A;  2XXI A;  1B9J A;  4NMY A;  1RYO A;  4KI0 E;  3IO4 A;  3TUS A;  1B52 A;  3QUJ A;  4KFQ A;  4ESX A;  3MPK A;  4MHF A;  2BJJ X;  4FJP A;  5HPQ A;  4IO2 A;  4ISU A;  2UVG A;  2ZYM A;  1NV6 A;  1ZBM A;  4JSD A;  3UP9 A;  2UVH A;  1P1U A;  5AA4 B;  2I0C A;  4NQ8 A;  3P7I A;  1YZ0 A;  2DWJ A;  3W9W A;  4DCX A;  1LBX A;  3H06 B;  4FAT A;  4XKN A;  5I7I A;  1MXW A;  1AOV A;  4BDO A;  2Z8D A;  1B5H A;  2Q8M A;  3VXB A;  5LTC A;  4ZDM A;  4M1V A;  4N4U A;  4QBA A;  1B5I A;  3EHT A;  1JEV A;  1EU8 A;  3FXB A;  1FPI A;  5ET6 A;  2QVU A;  5TPA B;  1MXV A;  3A3C A;  1MY3 A;  1S50 A;  2Z22 A;  1QVS A;  4P8B A;  3RTW B;  2WKY A;  4N6P A;  4H46 A;  1IUD A;  4YB6 A;  2Y7R A;  3D1R A;  2HPG A;  4F31 B;  2D3I A;  2I0B A;  1Y9U A;  3TCG A;  1QKB A;  1R6Z A;  4U1O A;  4YKP A;  3VVD A;  4NN3 A;  4RPO A;  3NOH A;  3PUX E;  4DIG A;  2PVU A;  3G3K A;  5JTY A;  3UN6 A;  3SES A;  1LGB C;  4KCC A;  5L9S A;  1Y3P A;  2A5T A;  1H45 A;  4R6Y A;  4BLA A;  1EH3 A;  2P3V A;  3MQ9 A;  1OQH A;  3FV2 A;  1PB7 A;  2O69 A;  1SYH A;  2FYI A;  4YU0 A;  4YKK A;  4F19 A;  2DOJ A;  3K1P A;  2B3B A;  2FIX A;  1KA0 A;  1B3E A;  4NWD A;  3I6V A;  1USY H;  4LAT A;  3CSG A;  3G3H A;  3B6W A;  4Q5T A;  4GX6 A;  5IZ1 A;  1NV7 A;  3Q26 A;  4P3L A;  3U92 A;  5M2V A;  1PEB A;  4FE8 A;  3T1B A;  1IMB A;  1H43 A;  1TT1 A;  4G8N A;  4LQ2 A;  5A5X A;  5KCJ A;  3AXF A;  2Q2A A;  2QS2 A;  5I84 A;  3SEU A;  1EZO A;  2OK2 A;  3BIG A;  1GGG A;  5IGA A;  2CZI A;  2NXO A;  2UVJ A;  1B5J A;  2O7I A;  3TCH A;  1QGX A;  4P1E A;  3PPN A;  2X7P A;  4AB6 A;  4QFK A;  5TU0 A;  4H67 A;  1DMB A;  2ZMB A;  3RN8 A;  2DYX A;  2F7B A;  1ZJL A;  5AA1 A;  3SDF A;  1NH7 A;  1YCJ A;  1KWH A;  4IO4 A;  3B50 A;  1A40 A;  2AL5 A;  4FAJ A;  2QS3 A;  1WDN A;  1VE4 A;  1FPE A;  1G0H A;  1LCT A;  4OVT A;  1MH3 A;  4QFN A;  5TP9 B;  5FHO A;  3EQ1 A;  3G7W A;  3IFC A;  4GWY A;  1MG1 A;  1Z7N E;  2Q74 A;  2ALU A;  1N04 A;  2B4M A;  4XKP A;  4ZEI A;  2CZL A;  2R71 A;  4XFE A;  1PB9 A;  3CRB A;  2HZL A;  3HN0 A;  1FCK A;  3Q29 A;  2WEF A;  4H8J A;  3LUZ A;  2F7C A;  5H8N A;  2OZZ A;  3RUM A;  1JNF A;  5I2K B;  4YMB A;  2H9B A;  1KZ8 A;  1TWY A;  1DCU A;  3FJ7 A;  3MVZ A;  2H25 A;  3PPP A;  3HST A;  1B7H A;  2ZYN A;  1LAH E;  2XX7 A;  5I5P A;  2RCA A;  1USY E;  2VD3 A;  5DVI A;  4PGP A;  3M3F A;  3M3K A;  4IGT A;  3B6Q A;  4R9G A;  3PTY A;  3PMX A;  4OAN A;  1N3W A;  5DVJ A;  4ZEB A;  5DYH A;  1S7Y A;  1OIB A;  4GWZ A;  3LR1 A;  1ZLQ A;  3MP6 A;  4M4G A;  3OOA A;  3PMV A;  2WBD A;  3PUW E;  1MPB A;  4JVC A;  1KA1 A;  2VD2 A;  3D4G A;  4F3S A;  3TTM A;  5LOM A;  1LBC A;  5JTY B;  4GX3 A;  5CMC A;  3IL1 B;  4F2O A;  1SW1 A;  1B46 A;  3KOT A;  4U22 A;  2O68 A;  2A5T B;  1H44 A;  1P99 A;  4GF8 A;  2YPN A;  5J1D A;  1SBP A;  1FTO A;  4GFR A;  4HTG A;  1R9Q A;  2V3Q A;  3QMF A;  3OXN A;  1IME A;  4JVI A;  3LV0 A;  2XXT A;  3GLB A;  2DDK A;  3TFL A;  4HE0 A;  3TAJ A;  3KSJ A;  1JVY A;  4NF4 B;  1N76 A;  4ZEC A;  3C35 A;  3ZSF A;  2IEE A;  2Y7W A;  2Q89 A;  2PX1 A;  1P1O A;  3TTN A;  3KFM A;  3MUQ A;  3CHG A;  1QUJ A;  4XF5 A;  5KCJ B;  1LFH A;  2CZK A;  2FHY A;  3VVF A;  3CR9 A;  4H6D A;  3K01 A;  1BIY A;  4JBZ A;  1BP5 A;  2ESN A;  3O9P A;  1UTB A;  4H45 A;  2DWI A;  4I62 A;  4KYS A;  5CM6 A;  4EF1 A;  3U72 A;  3T93 B;  1BTJ A;  4RXL A;  2M8C A;  2DWA A;  2O6A A;  1NV4 A;  4POW A;  2WBB A;  3VV5 A;  3I3V A;  1Y4C A;  3H6W A;  4OVJ A;  4X9T A;  4YMA A;  2F78 A;  2Y7I A;  4JB7 A;  4K3F A;  4PFR A;  4R9F A;  4NF8 A;  1AWB A;  3K6U A;  3MBP A;  1O64 A;  4NWC A;  3IB0 A;  4QFO A;  2B4L A;  4MJO A;  4R6H A;  1M5B A;  1EYJ A;  4PFU A;  1FTK A;  1Y1Z A;  2XX8 A;  4WEP A;  4FEB A;  4QSD A;  3RLF E;  2GFE A;  3B6T A;  5H8N B;  4HCY A;  1PBQ A;  4C1T A;  3E3K A;  5KDT A;  4MF3 A;  2GQ1 A;  1FRP A;  3VE1 B;  4Z0I A;  1BKA A;  4N13 A;  1PC3 A;  1D9V A;  1YYZ A;  4RPN A;  2PCR A;  3K1M A;  4I1D A;  2ZYO A;  3PPQ A;  1MM7 A;  4RJZ A;  2G29 A;  4GIZ A;  3PUY E;  4MNI A;  3BKI B;  2REG A;  5IAI A;  1NV0 A;  3DLN A;  3MPL A;  2PFZ A;  3VVE A;  5H8H B;  4JDF A;  5CI5 A;  1NI9 A;  1POY 1;  4PQJ A;  4YZZ A;  3WAF A;  1M5F A;  4ZE8 A;  1PB8 A;  5AA2 D;  4GWO A;  4OTE A;  4KQP A;  4QF9 A;  4IR8 A;  3K0V A;  2F5X A;  4KYD A;  2RKM A;  2PT1 A;  4OYV A;  4G61 A;  3QK6 A;  4R6K A;  5I57 B;  3FXU A;  5BWJ A;  4FBP A;  3F11 A;  1FBD A;  3QSL A;  4ELR A;  1MPC A;  2ZZX A;  4KHZ E;  1FJ6 A;  3OO9 A;  1FSA A;  1PBP A;  2V4C A;  2FBP A;  4NE4 A;  2NVU B;  3THI A;  4DZ1 A;  1FPL A;  4N6D A;  4OFO A;  2XWV A;  3FUZ A;  1NNF A;  1XVX A;  4PF6 A;  4OXV A;  3B7D A;  3LSW A;  1FTA A;  3FXR A;  5CBS A;  1FQE A;  3KN7 A;  3RPW A;  1MS7 A;  1NV2 A;  4LON B;  1UTB B;  1QJM A;  5EQA A;  3A29 A;  3U65 A;  4P0I A;  2PMS A;  2I49 A;  5J16 A;  4JWX A;  2XXQ A;  2I3W A;  4Z7E A;  3BFT A;  1B7U A;  4OA4 A;  3RPL A;  3MZ1 A;  3T9H B;  4GD5 A;  1JEU A;  4DXC A;  3WAE A;  2OLB A;  4G4P A;  2HEU A;  3FXQ A;  1XC1 A;  4U21 A;  4PE3 A;  2P2A A;  4F3G A;  4NF8 B;  2XXV A;  4MLQ A;  1NNK A;  4DXU A;  5H8F A;  1JW1 A;  3TEP A;  1EYI A;  4H5G A;  1US4 A;  2R8T A;  2REJ A;  2DE3 A;  2R9J A;  1A99 A;  2OWT A;  3KEI A;  1MXU A;  4GWX A;  4QFL A;  4KPT A;  2DVC A;  4P56 A;  3V8X B;  3T0J A;  2QVV A;  2QMX A;  3O66 A;  4HS7 A;  5CMB A;  3MWB A;  1JQF A;  3KJT A;  2VPO A;  1EYK A;  1MY0 A;  4P9K A;  3S9L C;  3E78 A;  4KXP A;  3FVO A;  3CG1 A;  1JP4 A;  5ELV A;  4P47 A;  2F3B A;  4IY5 A;  4FIM A;  1NNT A;  2X7Q A;  1OLC A;  2QS4 A;  1UTH A;  4N8G A;  1ZIU A;  4X1D A;  3A09 A;  2WX9 A;  3H4Z A;  4G2Z A;  4TLL B;  2XXW A;  3KBZ A;  4PBQ A;  3OO8 A;  1B40 A;  1II5 A;  2CEY A;  1QUL A;  2DE4 A;  5T3J A;  2DSF A;  4P1L A;  1Q1K A;  2RCB A;  1IXI A;  1FQC A;  5FBP A;  4MCO A;  1SD3 A;  1A55 A;  4IO7 A;  2PYY A;  3SEV A;  4BDQ A;  4QFP A;  1QUI A;  1FBG A;  1MPD A;  3TYH A;  3QAX A;  3IOU A;  2KLF A;  4ZZE A;  4THI A;  5I56 A;  4ZEK A;  1MQG A;  2UVI A;  4XIG Q;  2XWI A;  3RYD A;  4XEQ A;  3IFA A;  2XXH A;  4PE5 B;  1XVY A;  3VLV A;  2ONR A;  1MRP A;  2VOZ A;  3TTK A;  4MEV A;  3SKP A;  4PTK A;  1BLF A;  4MNC A;  2QFL A;  3O6H A;  1K9Z A;  3CI8 A;  3E79 A;  1XT8 A;  4X48 A;  3MYU A;  3CFZ A;  4LUB A;  3U94 A;  3IX1 A;  2O1M A;  1OQG A;  4YB7 A;  4GOT A;  3VXC A;  1URS A;  2HQ0 A;  4GWS A;  2I4C A;  2WYP A;  3HO7 A;  5CBR A;  1JW4 A;  4R2F A;  3FD3 A;  3E9X A;  5ICQ A;  1H3D A;  5I59 B;  1SPI A;  1POT A;  4AQ4 A;  1IXC A;  2RC8 A;  4OMB A;  1UIV A;  3S9N C;  4NG7 A;  1MDQ A;  3W9V A;  3FZV A;  2HCA A;  1FBF A;  3PGF A;  1LBB A;  3LSF B;  1FQD A;  2G93 A;  2XA5 A;  1A8F A;  4PFW A;  4OVP A;  2WYK A;  5DEX A;  5DT6 A;  1LST A;  4RY1 A;  4R75 A;  5EQ9 A;  3DEL B;  2ZXT A;  1XI6 A;  3N26 A;  4DDD A;  2DE2 A;  4PGN A;  2H99 A;  4AS4 A;  5I3S A;  1ZTY A;  4RYA A;  3S9E A;  4GLI A;  3PD8 A;  4DE8 A;  2JJK A;  1EZP A;  1VDW A;  3IJX B;  3L6H A;  3JZJ A;  1HSJ A;  3K2D A;  3BBR A;  1IEJ A;  3IAZ A;  3H03 A;  2OCU A;  1NH8 A;  5H8Q A;  2FNC A;  5K2X A;  1B32 A;  2V93 A;  4YKI A;  2HAU A;  3UOR A;  3OSQ A;  4OWD A;  1G0I A;  3MW0 A;  4KYE A;  5B7D A;  2H98 A;  5AA3 A;  2B3F A;  4POX A;  3PPR A;  4PET A;  4H65 A;  3QXM A;  3VFJ A;  3HCQ A;  1B1H A;  1NUZ A;  3IB1 A;  3PD9 A;  4NGU A;  2F3D A;  4EQ9 A;  1MQD A;  4N8Y A;  3V89 B;  1XOC A;  3FAT A;  4BDL A;  4ECF A;  5FHM A;  1FBE A;  1QKA A;  1TFA A;  1FTL A;  2XWK A;  4TOZ A;  3TPA A;  1IXH A;  4NF0 A;  1IQ7 A;  1US5 A;  3W15 C;  2O7U A;  3S4U A;  4OQO A;  3MST A;  2OX3 A;  1L5T A;  4IGR A;  2VP1 A;  1A54 A;  2VHA A;  5I58 A;  2I48 A;  5DTB A;  3BIH A;  4PC9 A;  2O1L A;  2Y5K A;  4IO5 A;  3TMG A;  1MXZ A;  5EYH A;  3E4R A;  2E0S A;  2XWO A;  4DLD A;  2PT2 A;  3FV1 A;  1IXG A;  3LC8 A;  4E0W A;  1D9Y A;  1NNP A;  4RA1 A;  5I56 B;  1IMF A;  2QS1 A;  1TXF A;  1MY1 A;  4OZ9 A;  1B3H A;  4F29 A;  1I6A A;  4I3E A;  4F3B A;  3Q27 A;  2ZNU A;  4NED A;  3C34 A;  2Z8E A;  3O6G A;  3OO7 A;  1O63 A;  4O3C A;  4LQ5 A;  5L9O A;  3O2A A;  4KR5 A;  3U93 A;  3PU5 A;  4TLM B;  1DPE A;  4UAB A;  4N91 A;  3T9U A;  4MMP A;  2A5S A;  3CFL A;  3K6W A;  4YB5 A;  5A5X B;  1NMU A;  3SER A;  3HV1 A;  3RY3 A;  3KC0 A;  1DK4 A;  1Z7M E;  1JW5 A;  3SET A;  1YXI A;  1NUX A;  1DBZ A;  2PBW A;  1P1Q A;  1FTJ A;  3O6I A;  3MVW A;  2I58 A;  3OEN A;  1I6B A;  3H3G A;  1RDZ A;  2VGQ A;  3MAM A;  1SQY A;  1MM6 A;  4LZ8 A;  1B4H A;  2E1S A;  4ZEF A;  1B0L A;  2F8D A;  5DEX B;  3MC2 A;  4PFT A;  3HPI A;  4PFY A;  3H6U A;  3MZ9 A;  5FTI A;  3K6V A;  4HW8 A;  3UA8 A;  4EQB A;  5F24 A;  2ONK E;  2Z23 A;  2F35 A;  3CFX A;  4O7I A;  3QIM A;  2QSX A;  4NAP A;  2XD2 A;  2F36 A;  4BDM A;  5IZ3 A;  3ILU B;  3Q25 A;  4N17 A;  3FVK A;  4OEU A;  2DXY A;  2Q8J A;  4O3A A;  4OET A;  4L17 A;  4ND9 A;  2O84 X;  1VFD A;  1AIV A;  1NV1 A;  3USD A;  3EHU A;  3H6T A;  5H8Q B;  3TEL A;  3TQW A;  1ZKB A;  1N0T A;  2P0S A;  4XKR A; 
#chains in the Genus database with same CATH homology
 2XX9 A;  1R1N A;  5ITP A;  3L6G A;  2RC9 A;  4RK2 A;  1N3X A;  1UIU A;  3ZKK A;  2XXR A;  5B70 A;  1M5D A;  2DVZ A;  2OBG A;  1J1N A;  2GH9 A;  4NTL A;  4DCY A;  5L9M A;  1GTK A;  1B3G A;  2W7Y A;  3DM0 A;  3LSX A;  3MVY A;  4GQO A;  3HHG A;  3LSL A;  4MLV A;  4XKQ A;  3QUF A;  5I58 B;  2XD3 A;  3RGY A;  5ISU A;  1MDP 1;  4UAC A;  2V25 A;  3IB2 A;  2AL4 A;  3UGW A;  2AYS A;  3KGC A;  4FEC A;  2UYF A;  1HSL A;  1SDX A;  2D5W A;  2ANJ A;  3OO6 A;  4LVQ A;  1ANF A;  3KZG A;  5F1Q A;  3GZG A;  2QJE A;  1DPP A;  3OMB A;  4IY6 A;  4G8H A;  1GVC A;  3A3U A;  1CB6 A;  1MQJ A;  3ZS6 A;  2Q9T A;  2GRV A;  3IOW A;  3CVG A;  1LCF A;  4LA9 A;  1MXY A;  1ZMG A;  3LBS A;  1JET A;  5ICT A;  3S9M C;  2V84 A;  3N5L A;  5KZT A;  2HFB A;  5AA2 A;  3TZA A;  1Q35 A;  3IK6 B;  4F39 A;  2ONS A;  3LUY A;  5AE4 A;  3OD7 A;  1O7T A;  2B65 A;  1T0K A;  4NF5 A;  1SW2 A;  3KN8 A;  3RT6 B;  4LP2 B;  1XS5 A;  3PPO A;  3EPE A;  5HBC A;  2Z8F A;  3ONM A;  1URD A;  4F3P A;  1EZ9 A;  3M8U A;  4H8I A;  1B3L A;  4GXS B;  5KDT B;  1AH5 A;  2ZYK A;  3GXA A;  2D21 A;  3C33 A;  4G8M A;  1A8E A;  1MQI A;  3C32 A;  4O3B A;  2O51 A;  1FQB A;  5TP9 A;  3EN3 A;  2Q2C A;  1MXX A;  4LZ5 A;  1DTG A;  2UXA A;  5F7V A;  2Y7K A;  5ITO A;  1LLS A;  3DP6 A;  4P11 A;  2GHB A;  1IIT A;  5IKB A;  2DWH A;  5I2K A;  4OEV A;  4EQ7 A;  2HZK A;  1OVB A;  4U2R A;  1B0H A;  1LB9 A;  3R6U A;  4WXJ A;  4HCW A;  3N94 A;  3I5O A;  3M3L A;  4GXA A;  2QRY A;  1B6H A;  4IO3 A;  4R72 A;  1B51 A;  4U1Z A;  1OMP A;  1Y4T A;  3C31 A;  1LAX A;  2X26 A;  3TOD A;  1WVJ A;  1MH4 A;  4U4S A;  1QW0 A;  3IOR A;  4KCD A;  1URG A;  4EDP A;  3O29 A;  4R74 A;  1Y3N A;  4EF2 A;  1R9L A;  4WKM A;  5EYF A;  2Y7P A;  3K00 A;  3G3J A;  2FA7 A;  3C4M A;  4JWO A;  3RTF B;  4AB5 A;  3CIJ A;  1XHY A;  1DSN A;  2ABH A;  2F7A A;  1M5E A;  2XXX A;  5AA2 B;  4F22 A;  3ZKL A;  3PUV E;  3RT8 A;  1S9T A;  2Q88 A;  4NF4 A;  3EHS A;  4OFL A;  3MZB A;  3N6U A;  1VR5 A;  3V83 A;  3OEK A;  1SI1 A;  5CMM A;  4NF5 B;  3TDJ A;  3E13 X;  1MQH A;  5FHN A;  3IO6 A;  2IA4 A;  3CG3 A;  5H8F B;  4H1X A;  3T9V A;  1ELJ A;  3SEW A;  4F18 A;  5HM4 B;  1ATG A;  1LFG A;  3G3G A;  2NOO A;  1SW4 A;  2F6G A;  2I4B A;  1M5C A;  4ELQ A;  4Q0C A;  1FW0 A;  5K2Y A;  5DVF A;  2THI A;  3GBA A;  1B58 A;  3QYT A;  3DP4 A;  2P1S A;  1GV8 A;  3UK4 A;  1FQA A;  4YAH X;  3IJO B;  4Q8R A;  5EHM A;  1UTH B;  4I8C A;  1YPN A;  1AL3 A;  4ELO A;  1MY4 A;  1OVT A;  3TCF A;  2ZNT A;  4MH5 A;  1RYX A;  3TQL A;  1P1N A;  4ZE9 A;  1GR2 A;  4H0W A;  5I2N A;  1LB8 A;  3G3F A;  1VFE A;  1IZ1 A;  5CC2 A;  4C1U A;  3ODB A;  3MP1 A;  1AMF A;  1SVX B;  3KJ7 A;  4QSC A;  3U1O A;  1FTM A;  3K4U A;  2GHA A;  2ZNS A;  3KBR A;  2DS9 A;  3ECR A;  3KN3 A;  3FJG A;  5H8H A;  1N84 A;  1YTV A;  3S2V A;  2I6E A;  4TQU Q;  1A7L A;  1NL5 A;  1PDA A;  4E0X A;  1OLA A;  4GVO A;  4OFJ A;  3V5A A;  4QSE A;  2F6P A;  3T22 A;  4DXB A;  4MFI A;  3DP8 A;  3HHF A;  2YJP A;  1DTZ A;  3IR1 A;  3IOT A;  3IOV A;  3R26 A;  5I57 A;  2OWS A;  5BUU A;  3R7X A;  1LAG E;  3JYR A;  5CRY A;  3RNN A;  4LZ7 A;  3VDF A;  4ONY A;  4G77 A;  4X1B A;  4KD5 A;  1F9B A;  3O28 A;  4F1U A;  3C9H A;  4PP0 A;  5JK4 A;  1JVX A;  2R6G E;  3KG2 A;  2QMW A;  3VLU A;  2UYE A;  1ZU0 A;  4F1V A;  3T96 B;  3K6X A;  3OEM A;  4QHQ A;  3H6V A;  2QL3 A;  3KSX A;  3FAS A;  2XXP A;  1B05 A;  1TFD A;  2YLN A;  3K1N A;  1B7Z A;  3TTL A;  4QRZ A;  2DXR A;  3FVG A;  1FQF A;  4C0R A;  4EXL A;  3K02 A;  2V3U A;  3CSB A;  2F97 A;  1HSE A;  1QUK A;  4GL0 A;  4G68 A;  4ZS9 A;  1N7W A;  2V3T A;  3FIR A;  1N7X A;  2DQV A;  4NF6 A;  2XHD A;  3C36 A;  3SEX A;  4FOR A;  2RC7 A;  4UA8 A;  4YIC A;  3KOS A;  4U4X A;  3O97 A;  3T66 A;  4IO6 A;  2QPQ A;  3UIF A;  4F1Y A;  3EF7 A;  1P1W A;  3BFU A;  3H7M A;  3PMW A;  5I2N B;  1I69 A;  1LAF E;  3PV0 E;  1Y1M A;  2Y84 A;  3JV9 A;  5AA4 A;  4BDN A;  1CE2 A;  2XXU A;  4P0G A;  4G68 C;  4WED A;  4EXK A;  4N07 A;  1UQW A;  1B1X A;  4R2B A;  4ZED A;  4JXI A;  5JEI A;  1Y20 A;  2LAO A;  1B2H A;  1VSO A;  4ESW A;  2OJT A;  3TKD A;  5TPA A;  3FVN A;  2NWJ A;  4GL8 A;  5EHS A;  3MVX A;  2AIX A;  2XXY A;  4H5F A;  1SI0 A;  4RK9 A;  2CMO A;  4XXU A;  2DP8 A;  2I3V A;  5FTH A;  1Y3Q A;  3T9X B;  3U8Q A;  4JSO A;  3Q28 A;  1SW5 A;  5H8S A;  3G3I A;  4EUO A;  5L8D A;  4OHN A;  1WOD A;  2NUV A;  3MP8 A;  1I6Q A;  2F34 A;  4ZZA A;  3FGS A;  3GBB A;  2RIN A;  4I9D A;  1B4Z A;  1D3K A;  1MY2 A;  1H76 A;  3MJN A;  1YAE A;  4RNS A;  2HAV A;  2HXW A;  4BDR A;  1RKM A;  3ILT B;  3PUZ E;  5CMK A;  3D4C A;  1SYI A;  4GRK A;  4F2Q A;  3OSR A;  4FED A;  1D4N A;  3SEY A;  1DOT A;  1IIW A;  3VLW A;  4ELP A;  5I59 A;  2H5Y A;  4OEN A;  1LFI A;  3TTR A;  3RQT A;  4XTC Q;  3OEL A;  4U23 A;  4JWY A;  4YKJ A;  4MBP A;  1NFT A;  1B3F A;  4R73 A;  4G68 B;  3FJM A;  2H4I A;  2RF1 A;  4OER A;  4Q30 B;  3N6T A;  1NKX A;  4NF6 B;  4IB2 A;  4OES A;  2XXI A;  1B9J A;  4NMY A;  1RYO A;  4KI0 E;  3IO4 A;  3TUS A;  1B52 A;  3QUJ A;  4KFQ A;  4ESX A;  3MPK A;  2BJJ X;  4FJP A;  5HPQ A;  4IO2 A;  4ISU A;  2UVG A;  2ZYM A;  1ZBM A;  4JSD A;  3UP9 A;  2UVH A;  1P1U A;  5AA4 B;  2I0C A;  3P7I A;  2DWJ A;  3W9W A;  4DCX A;  3H06 B;  4FAT A;  4XKN A;  1MXW A;  1AOV A;  4BDO A;  2Z8D A;  1B5H A;  3VXB A;  4ZDM A;  4M1V A;  1B5I A;  3EHT A;  1JEV A;  1EU8 A;  5TPA B;  1MXV A;  3A3C A;  1MY3 A;  1S50 A;  2Z22 A;  1QVS A;  3RTW B;  2WKY A;  4N6P A;  1IUD A;  4YB6 A;  2Y7R A;  4F31 B;  2D3I A;  2I0B A;  1Y9U A;  3TCG A;  1QKB A;  1R6Z A;  4U1O A;  4YKP A;  3VVD A;  4RPO A;  3PUX E;  4DIG A;  2PVU A;  3G3K A;  5JTY A;  3UN6 A;  3SES A;  1LGB C;  4KCC A;  5L9S A;  1Y3P A;  2A5T A;  1H45 A;  4R6Y A;  4BLA A;  1EH3 A;  3MQ9 A;  1OQH A;  3FV2 A;  1PB7 A;  2O69 A;  1SYH A;  2FYI A;  4YU0 A;  4YKK A;  4F19 A;  2DOJ A;  3K1P A;  2B3B A;  1B3E A;  4NWD A;  3I6V A;  1USY H;  4LAT A;  3CSG A;  3G3H A;  3B6W A;  4Q5T A;  3Q26 A;  3U92 A;  5M2V A;  1PEB A;  4FE8 A;  1H43 A;  1TT1 A;  4G8N A;  4LQ2 A;  5A5X A;  5KCJ A;  3AXF A;  2Q2A A;  2QS2 A;  5I84 A;  3SEU A;  1EZO A;  2OK2 A;  1GGG A;  2NXO A;  2UVJ A;  1B5J A;  2O7I A;  3TCH A;  3PPN A;  2X7P A;  4AB6 A;  4QFK A;  5TU0 A;  4H67 A;  1DMB A;  2ZMB A;  3RN8 A;  2DYX A;  2F7B A;  1ZJL A;  5AA1 A;  3SDF A;  1NH7 A;  1YCJ A;  1KWH A;  4IO4 A;  1A40 A;  2AL5 A;  4FAJ A;  2QS3 A;  1WDN A;  1VE4 A;  1LCT A;  1MH3 A;  4QFN A;  5TP9 B;  5FHO A;  3EQ1 A;  3G7W A;  1MG1 A;  1Z7N E;  2ALU A;  1N04 A;  4XKP A;  4ZEI A;  2CZL A;  2R71 A;  1PB9 A;  3CRB A;  2HZL A;  3HN0 A;  1FCK A;  3Q29 A;  4H8J A;  2F7C A;  5H8N A;  2OZZ A;  3RUM A;  1JNF A;  5I2K B;  4YMB A;  2H9B A;  1TWY A;  3FJ7 A;  3MVZ A;  2H25 A;  3PPP A;  3HST A;  1B7H A;  2ZYN A;  1LAH E;  2XX7 A;  2RCA A;  1USY E;  2VD3 A;  5DVI A;  3M3F A;  3M3K A;  4IGT A;  3B6Q A;  4R9G A;  3PMX A;  1N3W A;  5DVJ A;  4ZEB A;  5DYH A;  1S7Y A;  1OIB A;  3LR1 A;  1ZLQ A;  3MP6 A;  4M4G A;  3OOA A;  3PMV A;  3PUW E;  1MPB A;  2VD2 A;  3D4G A;  4F3S A;  3TTM A;  5LOM A;  1LBC A;  5JTY B;  5CMC A;  3IL1 B;  4F2O A;  1SW1 A;  1B46 A;  3KOT A;  4U22 A;  2O68 A;  2A5T B;  1H44 A;  1P99 A;  4GF8 A;  2YPN A;  5J1D A;  1SBP A;  1FTO A;  4GFR A;  4HTG A;  1R9Q A;  2V3Q A;  3OXN A;  2XXT A;  3GLB A;  3TFL A;  3TAJ A;  3KSJ A;  1JVY A;  4NF4 B;  1N76 A;  4ZEC A;  3C35 A;  3ZSF A;  2IEE A;  2Y7W A;  2Q89 A;  2PX1 A;  1P1O A;  3TTN A;  3KFM A;  3MUQ A;  1QUJ A;  5KCJ B;  1LFH A;  3VVF A;  3CR9 A;  4H6D A;  3K01 A;  1BIY A;  4JBZ A;  1BP5 A;  2ESN A;  3O9P A;  1UTB A;  2DWI A;  4I62 A;  4KYS A;  5CM6 A;  4EF1 A;  3U72 A;  3T93 B;  1BTJ A;  4RXL A;  2M8C A;  2DWA A;  2O6A A;  4POW A;  3VV5 A;  3I3V A;  1Y4C A;  3H6W A;  4OVJ A;  4X9T A;  4YMA A;  2F78 A;  2Y7I A;  4JB7 A;  4K3F A;  4R9F A;  4NF8 A;  3K6U A;  3MBP A;  1O64 A;  4NWC A;  3IB0 A;  4QFO A;  4R6H A;  1M5B A;  4PFU A;  1FTK A;  1Y1Z A;  2XX8 A;  4WEP A;  4FEB A;  4QSD A;  3RLF E;  2GFE A;  3B6T A;  5H8N B;  4HCY A;  1PBQ A;  4C1T A;  3E3K A;  5KDT A;  4MF3 A;  3VE1 B;  4Z0I A;  1BKA A;  4N13 A;  1PC3 A;  1D9V A;  4RPN A;  3K1M A;  4I1D A;  2ZYO A;  3PPQ A;  1MM7 A;  4RJZ A;  2G29 A;  4GIZ A;  3PUY E;  3BKI B;  2REG A;  5IAI A;  3DLN A;  3MPL A;  3VVE A;  5H8H B;  4JDF A;  5CI5 A;  1POY 1;  4PQJ A;  4YZZ A;  3WAF A;  1M5F A;  4ZE8 A;  1PB8 A;  5AA2 D;  4GWO A;  4OTE A;  4KQP A;  4QF9 A;  3K0V A;  2F5X A;  4KYD A;  2RKM A;  2PT1 A;  4OYV A;  3QK6 A;  4R6K A;  5I57 B;  3FXU A;  5BWJ A;  3F11 A;  3QSL A;  4ELR A;  1MPC A;  4KHZ E;  3OO9 A;  1PBP A;  4NE4 A;  2NVU B;  3THI A;  4DZ1 A;  4OFO A;  3FUZ A;  1NNF A;  1XVX A;  4OXV A;  3B7D A;  3LSW A;  3FXR A;  5CBS A;  1FQE A;  3KN7 A;  3RPW A;  1MS7 A;  4LON B;  1UTB B;  1QJM A;  4P0I A;  2PMS A;  2I49 A;  4JWX A;  2XXQ A;  2I3W A;  4Z7E A;  3BFT A;  1B7U A;  3MZ1 A;  3T9H B;  4GD5 A;  1JEU A;  4DXC A;  3WAE A;  2OLB A;  4G4P A;  2HEU A;  3FXQ A;  1XC1 A;  4U21 A;  2P2A A;  4F3G A;  4NF8 B;  2XXV A;  4MLQ A;  1NNK A;  4DXU A;  5H8F A;  1JW1 A;  3TEP A;  4H5G A;  1US4 A;  2REJ A;  2DE3 A;  2R9J A;  1A99 A;  2OWT A;  3KEI A;  1MXU A;  4QFL A;  4KPT A;  2DVC A;  3V8X B;  2QMX A;  3O66 A;  4HS7 A;  5CMB A;  3MWB A;  1JQF A;  3KJT A;  1MY0 A;  3S9L C;  3FVO A;  3CG1 A;  5ELV A;  4IY5 A;  4FIM A;  1NNT A;  2X7Q A;  1OLC A;  2QS4 A;  1UTH A;  1ZIU A;  4X1D A;  3A09 A;  3H4Z A;  4G2Z A;  4TLL B;  2XXW A;  3OO8 A;  1B40 A;  1II5 A;  1QUL A;  2DE4 A;  2DSF A;  1Q1K A;  2RCB A;  1IXI A;  1FQC A;  1SD3 A;  1A55 A;  4IO7 A;  2PYY A;  3SEV A;  4BDQ A;  4QFP A;  1QUI A;  1MPD A;  3TYH A;  3QAX A;  3IOU A;  2KLF A;  4ZZE A;  4THI A;  5I56 A;  4ZEK A;  1MQG A;  2UVI A;  4XIG Q;  4PE5 B;  2XXH A;  1XVY A;  3VLV A;  2ONR A;  1MRP A;  2VOZ A;  3TTK A;  3SKP A;  1BLF A;  3O6H A;  3CI8 A;  1XT8 A;  4X48 A;  3CFZ A;  4LUB A;  3U94 A;  3IX1 A;  2O1M A;  1OQG A;  4YB7 A;  4GOT A;  3VXC A;  1URS A;  2HQ0 A;  2I4C A;  3HO7 A;  5CBR A;  1JW4 A;  4R2F A;  3FD3 A;  3E9X A;  5ICQ A;  1H3D A;  5I59 B;  1POT A;  4AQ4 A;  1IXC A;  2RC8 A;  4OMB A;  1UIV A;  3S9N C;  1MDQ A;  3W9V A;  3FZV A;  2HCA A;  3PGF A;  1LBB A;  3LSF B;  1FQD A;  2G93 A;  1A8F A;  4PFW A;  5DEX A;  5DT6 A;  1LST A;  4RY1 A;  4R75 A;  3DEL B;  2ZXT A;  3N26 A;  4DDD A;  2DE2 A;  2H99 A;  1ZTY A;  4RYA A;  3S9E A;  4GLI A;  3PD8 A;  4DE8 A;  1EZP A;  3IJX B;  3L6H A;  3JZJ A;  1HSJ A;  3K2D A;  3BBR A;  1IEJ A;  3IAZ A;  3H03 A;  2OCU A;  1NH8 A;  5H8Q A;  2FNC A;  5K2X A;  1B32 A;  2V93 A;  4YKI A;  2HAU A;  3UOR A;  3OSQ A;  4OWD A;  3MW0 A;  4KYE A;  5B7D A;  2H98 A;  5AA3 A;  2B3F A;  4POX A;  3PPR A;  4PET A;  4H65 A;  3QXM A;  3VFJ A;  3HCQ A;  1B1H A;  3IB1 A;  3PD9 A;  4EQ9 A;  1MQD A;  3V89 B;  1XOC A;  3FAT A;  4BDL A;  4ECF A;  5FHM A;  1QKA A;  1TFA A;  1FTL A;  4TOZ A;  3TPA A;  1IXH A;  1IQ7 A;  3W15 C;  1US5 A;  2O7U A;  3S4U A;  4OQO A;  1L5T A;  4IGR A;  2VP1 A;  1A54 A;  2VHA A;  5I58 A;  2I48 A;  5DTB A;  2O1L A;  4IO5 A;  3TMG A;  1MXZ A;  3E4R A;  2E0S A;  4DLD A;  2PT2 A;  3FV1 A;  1IXG A;  3LC8 A;  4E0W A;  1D9Y A;  1NNP A;  4RA1 A;  5I56 B;  2QS1 A;  1TXF A;  1MY1 A;  4OZ9 A;  1B3H A;  4F29 A;  1I6A A;  4F3B A;  3Q27 A;  2ZNU A;  4NED A;  3C34 A;  2Z8E A;  3O6G A;  3OO7 A;  1O63 A;  4O3C A;  4LQ5 A;  5L9O A;  3O2A A;  4KR5 A;  3U93 A;  3PU5 A;  4TLM B;  1DPE A;  3T9U A;  2A5S A;  3CFL A;  3K6W A;  4YB5 A;  5A5X B;  1NMU A;  3SER A;  3HV1 A;  3RY3 A;  1Z7M E;  1JW5 A;  3SET A;  2PBW A;  1P1Q A;  1FTJ A;  3O6I A;  3MVW A;  2I58 A;  3OEN A;  1I6B A;  3H3G A;  2VGQ A;  3MAM A;  1SQY A;  1MM6 A;  4LZ8 A;  1B4H A;  2E1S A;  4ZEF A;  1B0L A;  2F8D A;  5DEX B;  3MC2 A;  4PFT A;  3HPI A;  4PFY A;  3H6U A;  3MZ9 A;  5FTI A;  3K6V A;  4HW8 A;  3UA8 A;  4EQB A;  2ONK E;  2Z23 A;  2F35 A;  3CFX A;  3QIM A;  2QSX A;  2XD2 A;  2F36 A;  4BDM A;  3ILU B;  3Q25 A;  3FVK A;  4OEU A;  2DXY A;  2Q8J A;  4O3A A;  4OET A;  4L17 A;  4ND9 A;  2O84 X;  1VFD A;  1AIV A;  3USD A;  3EHU A;  3H6T A;  5H8Q B;  3TEL A;  3TQW A;  1ZKB A;  1N0T A;  2P0S A;  4XKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...