3FB6A

Kcsa potassium channel in the partially open state with 16 a opening at t112
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
molecule tags Membrane protein/metal transport
source organism Streptomyces lividans
publication title KcsA Potassium channel in the partially open state with 16 A opening at T112
rcsb
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6A02
4XP9L 2Y7QB 4NO0B 3U0TB 4EI5C 2CDEA 5E2UL 2G5BB 4Q9RL 1FN4A 3CX2A 2CK0H 3GRWH 5CP7B 2DQDH 2CK2A 4G6FD 4ZOEA 3SOBH 3N0PB 2PYFA 1HN1A 1I7ZA 4IOFD 2Y4SA 3ULUC 3LN4A 5F9DC 1NLBL 4P5KB 1QSFE 1JYXA 2IANB 1CG9B 2DQUH 5D2LB 1JCKA 3MLWH 2IALB 2OJEB 5DQDL 2ADIB 4X5XA 3QXDB 1C5CH 3Q0HA 2EYRB 2IH3B 1YNLH 5C07A 3UO1L 1KJMB 2GT9B 4NKMB 4NQSA 5F71A 3KPMA 1A7NH 3GBML 1MIMH 1CI5A 2LTQB 4M5YH 4X6CB 2VAAB 2DM4A 1CDBA 5DURB 3RGHA 3PV7A 4U1LB 2UZIH 1UQSB 3V4PH 1TETH 3OZ9H 4I48A 5DFTA 2V7HA 5CSZB 5D7LD 5FGBC 3ARDD 4PRNA 3QXVA 4HS8H 3P9WB 3TBWB 2P5WB 1U8IA 1K4CA 5EZJA 1JF6A 3CK0L 4QXUH 1T5XA 4K94C 4OZFH 5GJSH 5F1KC 2VDOL 3G6JB 4XPHL 1F02I 3H6JA 2PW2B 4JFHE 1CVSC 2ZSWB 3IAQA 4LHUG 5DQJA 1ZVSB 1J0IA 1VCAA 5D1ZB 4D0BA 4LCWD 3KPNB 1N6QL 4RGND 3FZUC 5FM5M 1UYWH 4Y19A 2FYYB 4EI6B 4OTXL 1WT5A 4MJID 4L3EA 5CMAB 4N9OB 5CJQH 4B7IA 2DIJA 4YE4L 5FUOL 3ZKMD 4DCQA 5IW3A 1X5AA 4OV6F 1LE5B 1RIUH 2C3VA 3LS5L 5KSUB 4YHOL 4JN1H 3MQIA 1RHFA 4WEUD 1M7IA 4RFOH 3RP1A 4NQXB 4K8RC 4R7NB 4DZBB 3P4MB 1RPQA 3IDJB 1UGNA 1D5XA 1HHHA 3QCVL 5DMGD 5EZIH 3G6JF 4HXBL 2IAMB 2W59A 1CDGA 2E5EA 3QIBB 3EJYD 4ZYKA 4Y4KA 4PJIF 2FGZA 3DHJA 1MJ8L 3GB7B 1A3RH 5EU6E 1SYVB 2MQ3A 5HHNB 3VA2C 3QFJE 1BQLH 5GGQH 1NLBH 5I1IL 1EHXA 3H3BC 1I9JH 2WM0A 1CE1L 2F53A 1HIMH 5DD6B 3MODL 4PP1D 3STLA 3U9PL 1IAII 2FHFA 3OXSB 3MLUH 1MEXL 5EA0L 1S5HB 1T7WA 1CXLA 1JF1A 2QR0A 1BFSA 1Q9KA 1S5IL 3NABL 4MVBC 3QDGD 4Y1AB 3V6ZA 1NFDF 4XNZC 2PTUA 3IAPA 1P2CA 3SN6N 4PLOB 4UQ2A 2CUMA 1FZJB 5TPWL 2FECL 4G3YL 5D1QB 5I8OL 3OKYA 3EDFA 1RZFH 3QP3A 5JPNB 1WWCA 2HN7B 2VISB 3VDBA 4XCNA 3HLAA 2GUOA 5IR1B 4LCWB 4YIQB 2C5DC 3SDAA 4KAQH 4OLYH 4HWEL 4PJHB 3BP6B 5DHYB 2CGRL 2DQJL 4GRLD 4MD0A 5T3ZD 4X4ZA 3SPVB 2DI7A 2ZUQC 3HC0B 4OM0L 3S4SA 1K4DB 4ZPTB 4LPVA 4QOKD 4KJYB 1XF5A 3MCKB 4FQJL 4GO6B 4TTDC 4W4OC 4FFZH 4G6JL 5FCUH 3WKML 4YE4H 4RNRB 3EO0A 1P7KA 3MRKA 4XNZB 1A6AA 1CU4L 3BIAX 3HE7D 5E8OA 4S2SA 4WU7A 3WFBL 3RDTB 1MUJA 2DWDA 2EO1A 2YD8A 4M6OL 3MBEC 3PP4H 1DBAH 3CUPB 3NZ8A 3V6FB 1AHWA 2FHCA 3B6SA 2ZG3A 4TNWK 4NHCL 2JCCE 3PXHA 4XB8A 2ZCLH 4MLIA 3AVEA 1J0HA 1U92A 2W9DH 3VWKD 4OIBA 4U1NA 1UCBH 3MCLH 2ZNXA 4UQ3B 4EVNA 1MAML 4X6CE 4YGVA 2DS4A 3UTSE 3LEYH 2PN5A 2HVJB 3RVUC 4OIIL 4P9ML 4GLRH 1BP3B 1S9YA 1OTSC 2IQAB 2NCMA 4KV5E 3AXLB 3Q48A 4L9LA 1E4XI 3ARYA 2JTDA 5E9DE 5J89A 1WAAF 7CGTA 1EEYB 4F7PB 3MV8D 3OGCA 1RFDH 4NPYA 3JUYA 4TSCL 3NPZB 2UWEB 5IWLA 5B22A 2DTMH 2CPCA 5DJ0A 5GS0C 3AREC 3AB0C 3WHE1 1FNLA 3VD9A 4JCMA 3LPFA 4QHNB 3HI1B 4I4WB 3WLWC 2FLRT 3HI6H 3HTLX 1QO3B 3BISA 5JXAH 4R4BA 1OAZH 2YPKB 3EHBD 2A38A 3S37L 4DEPC 4RX4A 1FFRA 5GGTL 5TE7L 1AP2B 3UYOD 4G8IA 1Q0YL 5DSCA 3T0AA 1IAIM 4P46D 3D85B 4IRJD 5LGJA 1ZEAH 4JY5H 1NCAL 3QJFB 4LCWE 3O2DA 5ITBH 1VFOA 4ZS6C 4Y19D 3FONB 2P47B 4FXKB 3HNTL 3ULUH 1HHHB 3FL7A 3IDUA 2FBOJ 4WU5A 1N5AA 3LEVL 3IDXH 2EEAA 4NFBA 2R0ZL 4PJIB 3AREB 2NTFB 4LCUA 5EH1A 1NUDA 4GBXC 1JFQH 2WBJC 4KTDH 2ATKB 3ULSA 4FFYH 1Q0XH 1L7IH 1OGAE 3MR9A 4LFHG 4X8JA 5FHAH 3QH3A 2OP4H 1ZS8B 3FTGB 5A3ID 1DJSA 3INUH 3NCBB 1OGTB 3VI4F 4AMKH 1Q9LA 5T3XL 4W4OA 4LLYB 5H37H 4TN9A 2XA8H 3I85A 1YA5A 3T1FA 4UBDD 3U2SB 3QFJB 5EBMA 4WEBL 2XN9A 4MAYB 3QQ4A 1BBJA 3MX0A 5JHLH 4R8WL 3D3VA 2HMIC 2K9UA 4UQ2B 1W8OA 1IBGH 1AKJB 1FORL 7FABH 2AV7B 4HIEA 4U1GB 3NA9H 4ETQB 2B0SL 2ZP0T 3ROLB 1RZKC 2VLRD 1JRHL 2CKBL 3L95A 3MLSH 4HK3J 4PFEA 4DOHB 2GSGA 5I9QB 5DJ8A 5FYLH 4Y5VA 4BSWB 2HJFA 2EDJA 3MNZB 35C8H 1CFNA 1SHMA 3C5SB 5FECA 5FA3B 3O2VH 2EIZB 3IXTB 1TQCC 1MCQA 4MSWA 3HI6L 1OPGH 3H2WA 1XR9B 4KJYA 4HGWA 3QDME 3OR6A 4GQ9L 4H1LH 1JWMB 5D93B 2JIXA 1FGVH 3DTXA 3A0OA 4NHUA 3LQAH 1EO5A 4UILH 3O4LE 4JO1L 3VFTA 3VCLB 3QJHA 3UJIH 1AC0A 2N4IA 1N5YL 5H2BB 5E8OB 4H26B 3MRIB 4DGYH 3CFKA 4PJCE 4FN0A 12E8L 2K7QA 5GRJL 2HFFB 2Y5TB 3ZLQC 2BVOB 4RMRA 4P23D 1FIEA 1R3HA 1NANI 1T1ZB 1J05A 1BZ9A 4MA3A 1FAIH 2DQIL 4HKJB 1WK0A 2EZ0C 1XIWD 4MB3A 5F7WC 3KR3L 1KCLA 1OW0A 1SYSB 3H42L 1PAMA 4AYFA 4K23L 3C09C 2XOTA 2F19H 4PRPD 4C56E 1KJVA 1VADA 2E7CA 4WUUE 4Z18A 1DN0A 1JGVL 2XIDA 2NX5D 4Y5XC 1NKOA 2RFXA 3EYUL 1B2WL 3WUZA 1JNHA 3KPTA 2X10A 4K7FB 1Y6KR 4CUCA 1P69B 1XGPA 4RAHA 3D39B 1FVDA 2GKIA 4BQ9A 3STZB 5D7LE 1DZBA 5FO7A 5KW9H 2C26A 3VD4A 1CZ8L 2BDNL 4M8QA 3L3OB 3FQWA 5J1TC 3DMMD 1T4KB 4WI4A 1KOAA 4JPIB 3CLEL 3SJVA 3OPZH 3FN9A 1B0GA 5J13C 1OSZA 3SCMA 3ROOA 4U1JA 1CD9B 1JGEA 3LKQB 3MV8A 4NNXA 4RDQF 4PV9A 4Q9QL 4L29B 4DKFH 4UTBH 5L2JA 3BPNC 4ZO7A 3VXQA 1T21B 1KPUA 1MRCL 3SDXB 3EJZD 4Z7UE 4U49A 3QCTL 3O3DB 5DHVH 5MENA 3EDDA 1PG7L 3VI4E 4MJ2A 3PHOA 4KDWA 2AK1L 3CC5B 1B3JA 4D8PA 1WTLA 5MEOA 1QEWB 3H9SA 3VA6A 3SE9H 5AG9A 1J8KA 5C0BD 3ARPA 5IOPB 1KIRA 3BDXA 5GJSL 1TNNA 2DWEB 3DGGA 1AC6A 4KUZL 1OAYL 4K3HA 3RWJB 1XR8A 4F57L 5C9JA 4ZTPL 1P5VA 1KPVA 5C0RL 5AWNL 4TVPH 3BEVA 3NCYP 2JB5L 3AMKA 3SDXF 1N4XH 2VLKB 4NZUL 1N0LA 5T1LA 4Y4FB 4QRTB 4RMVA 5CCKL 4OJFH 4OQ1A 1QBLL 4OQTL 4WI8A 2A73A 5L6YL 1IC4L 3MGTA 4MHHG 1QFOA 3PQYB 1WV7T 3FJTA 2R2EB 3UYRL 4HIXL 4QLRA 3OXRB 5GHWH 3TCLB 2HTLC 5B39B 1T0NB 5F7LB 5BV7H 1JUFB 3NCYS 3WIIH 5HYJB 4XPAH 4JO2H 5KTEL 2FX9L 2BSTB 3DX6A 1TETL 3OZ9L 5A40E 3C6SB 4QT5A 4PTUA 3SJVD 4FQHB 2D7MA 1OAXH 1KUMA 1JZ5A 4GRMB 1VDGA 5D5MB 5HHQB 1LO4L 4PJBE 2VDML 3K8KA 5CINH 1V8HA 1CZ8H 3SDXE 1V7ML 3O6FC 3NTCL 3WHXA 5CKAA 4LLQB 1JJUA 1LO3L 1N64H 1ZHKA 3Q1SH 3S98A 5EU7C 1AGDA 5MHSD 1SM3H 2BC4B 2BHYA 4L8DA 1MRDH 4PJHE 5JUEL 4M1CD 4GUPA 2ZOKB 4M00A 3N50A 3DO7A 5H2BA 2YRPA 3BIBX 5EA0H 1REIA 1AGFA 1XT5A 4KROD 2LABA 2OLDA 4QRRE 5IFHH 3CX5J 2VC2L 4MNGB 1NANH 4GOSA 5CEYB 3KXFD 2XWJB 4O00A 1T7YA 2R69L 2Y5EA 5C0BA 1H5BA 1TQBC 3KLHD 4Y88A 3AS1A 2HT4D 5F89B 3D2UD 4JN1L 4QRPD 4Y4HD 2Z91A 1QR1A 5SV3A 1U9KA 5AZEH 5KOMC 1IEBA 2NY1D 1JL8A 4OCSH 3SE9L 1J1XL 1ETZB 4HXBH 5BW7C 2E9WA 4X6BA 1J8HB 4M7KL 3TIEB 1KJVB 2GJZA 3Q2CA 1NLDH 4OLYL 1OSPL 4S1RL 4ALAL 1MELA 5I15H 3RWEB 4NM4L 4WI6A 2EKSA 3E2HC 3K1KC 4Z77A 1I9JL 4LLWB 2QV2A 4O2FB 3UTSB 4R90H 1GGCH 3VI3E 3D3VD 3ES6B 2AV7A 5IIEB 4L8CA 4HS3B 3L3OA 4LCCC 5ESAB 1D6EA 3OJDB 3DARA 3HE7B 4KMQA 4OCYH 1NMCC 2WUCH 4U7SA 2NXZB 2NY6D 3D0LA 4Y5VB 1BLNA 1I9EA 5ADOL 5D96B 3RVXC 2DICA 3W5MA 1ZHBB 1KBGL 2J8HA 3KJ4C 4DN4L 1Z2KA 5IROC 2EIZA 2FJGB 3KNBB 5BS0D 4P9HL 4LCIH 1F6AB 3CFIC 1NCCL 2AJYL 1OAXL 4KK5C 4ELMA 2H3NB 3MJ8A 2YN3A 3GJFK 1YDPB 1IT9H 2QQKH 1KTRL 2GY5A 2V9RA 3QJHB 4P59L 5LCVL 2XT1B 2UWEF 3AUVA 5BRZE 1KTDA 1CG9A 1BAFH 4AENB 4LHUB 2VLJB 5EO0A 1S7TA 1B0RB 1MY7A 5FCSH 5E95B 3TESA 4HQQH 4GW5B 2EYRA 1U3ZA 5KANI 3S5LB 3D2UA 3X3FL 1HYSD 5DDHA 3L7FA 2OTUA 5CBEB 4TSCH 3DRTB 5ACMA 1NAMB 2DLFH 3WS6A 4DN3H 1N0XL 3SKJH 3U4BL 1UQSA 4EDWL 3BH9A 5IEHB 1BF8A 2R69H 2Y9RT 5CIPH 3L1OH 4FABL 5A16B 2CR6A 1T03H 3T0EA 3BGFC 2P5WA 1ND0A 2R1YA 3VFWA 1FO0H 2BVQA 3VRJA 3GJFB 1VFBB 1BBDL 3V52L 4UT6L 1T1XB 4JHBA 5ICZA 3RPIA 4A2MA 3NZHL 3MGTB 1WCBB 5I1GH 2GITB 4EIZC 4JRXB 4WUUB 4JLRA 3MRQA 3I6KA 2Q8BL 1HH6A 5GRWA 3O2WL 1INQB 2MNUA 4XMKL 3WFCH 3QNXA 3T4AB 4M8QB 4S10A 3FB7B 1HQRB 3EOTL 4Z0XB 2WANA 2WINA 4X0KB 2QSQA 2D4FA 1G9EA 4YNYB 4QTIL 3CLFL 5KN5B 1DBMH 1A2YA 3O3UN 4NNXB 2J5LC 3LEVH 4YDLB 4OGYL 2X4SA 1QSEB 3RIFF 4S0SD 1A4KB 1MRFL 4N5EC 5IB1A 4KWUA 4NKIL 1N2RB 2DTML 2Q8AL 3HS0B 2NZ9D 4X7SL 1OAUH 3DNKA 3OKKB 4DW2H 1MJ7H 1RZKH 1C12B 3LN4B 3ULVD 3RWIB 3Q6FA 2HFGH 3QUZD 4UINH 3D48R 3ZZ1A 4Z95L 1T89C 3ULVH 5CSZA 4AMKL 4PJXF 4GRLA 5KS9F 2HAZA 1T20B 5FDYA 1OM3H 3ESUF 3DVIA 4XHJC 5D2LA 1HSAA 3QDJB 1A22B 2QQQA 1H15B 2Z93B 4C55A 4MQXC 1IT9L 4JY5L 4XVJH 3QO1B 3U7YL 3DYOA 1BZQK 3LEXA 2E8ZA 1MVUA 1IEAA 1ED3A 1OD7A 3ILQC 2C3XA 2Q7NA 1ETZA 2H32B 4DVBB 4XAKE 5JW3L 3AAZB 1E6OL 1MCPH 3BUTA 5JDJA 1CGSH 3I50L 2E9JA 4G9FE 5L8LB 5KVEH 1RZJH 1U8QB 4OV5A 3I75A 4WO4B 3W2DL 5C2BL 4NBYB 5DQ9B 3DXAB 2X05A 1OHQA 2XWBA 1SJEB 4LNRB 4NJAL 3G08B 4KRNA 3MLXH 4H20L 4KRPC 2R2EA 1GGIL 5CP3H 5DQJB 43C9A 5D1ZA 3D69B 5F7EL 3E6FA 2D7TH 4GFTB 1F58H 2X5PA 1NGZB 1CGWA 4FQHA 5HHMD 1S9VB 4XRCA 1LD9A 3N1QC 3IJSA 1I85C 2DQTL 2Z31D 3G5YA 1IGYB 4U6VH 1FVEA 4X6DE 5DLML 5DD1H 5DRNB 2V5MA 1RAMA 3PNWA 5KSAB 5FIEA 4XMKH 2G75B 2CO6B 2NY2C 4HBCH 5JOEA 4J4PA 4L4TA 1XH3B 4TTGA 3MUJA 3DYMA 2EIDA 5DGQA 4LMQE 3NA9L 1H3VA 3I6GA 3A6OA 1YDPA 5F7KC 2R23A 3EO0B 4PJDA 4TNVK 4MAUH 1WIUA 3VWJC 1CXKA 1NUGA 2P8PB 3RVVC 1UADC 2P5ED 4KKLD 2WV3A 1OP3K 2XN9E 5EORH 2LFGA 3VXMD 2NX5B 2VZTA 3CX5K 4XP5L 3B6SB 5EBLB 4N0CD 3PJSB 1KTLB 4XBEH 5TQ0H 4U3HA 2W0PA 5A1AA 4YBQC 1IGIH 4BUGA 2NX5E 2ATPB 3PV6B 1YQ2A 5FOBB 3NOIA 3WNLA 1HINL 5JW4R 3EOBB 2W07A 5HI5D 1MWAL 1QBML 2OJZH 3PHQA 5IBUB 3WSQL 5F21B 1OM3L 4XXDA 3G5ZB 1CD1B 4AG4L 3BSZH 3RNQA 1S5HA 3W0WA 1I3UA 3F65A 2IQAA 6CGTA 2PCPB 1UB5B 2NR6C 4AIXA 3IETA 4CRPA 1QTYT 4Y4FD 1R3JA 4YBLB 3QRFM 3RWEA 5JW4Q 1ZVHA 4U6YB 1J88A 1HHGB 4BQCA 1ORSB 1AGBB 3AC0A 4RFNB 3KPRE 1FBIL 3MLVL 4FG6C 2MPAL 3ULUD 2D7NA 4PRIE 1F6FB 4RAVA 4BQBA 3DUSA 3QHZH 4FFWC 5C2BH 5JPNA 2FIKA 2FH6A 4XTRC 1WBXA 1FNAA 5K9OB 2YD9A 5I1KL 2CLZA 2HLAA 4OUUA 1JGVH 4PJGE 1RQ5A 2Y1VA 1LDPL 1I1RA 2H1PH 5A2FA 3RUGE 2X4OA 5F7YC 1VGKA 3UAJD 3V0WL 4JE4B 4P23C 5AD0B 2D7TL 4JFDB 3ABZA 4U6XB 2W9EH 3P4LA 4MXWL 1HXMB 1INDL 4ODVL 3TJEL 4OCWH 1FV1A 3L3IA 1FJ1B 3V79C 1I3RA 4J23A 4KPHH 3EYQD 4R4FH 3VWKC 1UWEL 3Q6FB 5A2KH 4GS7C 4NDMA 4NZJA 4POUB 3FQXB 3RWFA 5GXBB 1A6WL 3F12A 1F11B 2VLRE 3X17A 2ZSVB 3I84A 1IAOB 3HPLA 5E8NB 3CDGB 3ARDB 5EIQA 2DQCH 3SDCC 2CLVB 2XA3A 3AXLA 1JZ6A 1OT1A 3MFGB 4PJFE 3QG6A 2VXSL 3LRSA 4FZEL 5CJOL 1MVUB 5L6YH 1VFAA 1ZLUH 3J7HA 5D5MF 3DRTA 1M1SA 3DGCR 4HIXH 1R3IH 2GQHA 3S88H 4U1NB 1HI6A 4LCYA 1FL5A 5ID1B 4P5TB 2JCCF 3CVHA 4JHAH 4V1DD 4KVNL 5HHPB 1BF2A 5T5FL 1S9WB 2VWEC 2V6HA 5GRZA 2Z92B 1ADQL 4PG2C 4D3CL 4YHKL 4PP2A 3MLZL 5CEXA 3QQ3A 3IT8D 4D9QD 4I3SL 1RY7B 3CXDH 1P7QD 1I8KA 3C2SA 3NTCH 1FC2D 2VZ1A 1HCVA 1OAYH 5J4MA 1J8HE 3HC3H 5CEZD 2MMXA 4R0LA 1SJXA 1I7TA 2P49B 3VWKA 1NCDH 4GXVL 2IC2A 3E6FB 4LSTH 4ZQKB 2F53E 3QNXB 3T4AA 4NNPL 3SDYL 1QQDA 4WY7L 5TGBA 3GMOB 3FB6A 2CSPA 1X7QA 4NZUH 4YNYA 1AQKH 2D9QB 2PXYC 1BPVA 3KPSE 1G9MC 1L6ZA 1LNUB 3MLVH 2FR4B 4OZHF 2M26A 2BY1A 3RL2B 1WSST 3C8KA 2XICA 3O4OB 4NZRH 4MQSB 5D1QC 2ADJA 2EYTB 4ZMAT 5B38B 1MCOH 1MHCB 3UYRH 1BVLA 2C4FT 3TWCL 1TZIA 5CD3A 2JIXB 3ARFC 2VSCA 32C2A 1J1PH 2ATKA 1DQLH 5DUPL 5IBLD 3C6LC 1NEZA 4L3AA 4F37K 4NUGL 1C5BH 5FO8A 1J0KA 1J8HD 5A2LH 3TVMA 3UC0H 3L3GA 4HV8A 1CWVA 4RMSA 1PVHA 1WVZA 1CK0H 2VZSA 3TFKD 2CUHA 5BJTA 1RZIA 3ARBB 1S7WB 3ZTJH 1N26A 5SWSE 1L6XA 3WO3B 5D72H 3HZVB 4L3EE 1BZ9B 3Q1SL 4PTTA 5F9JB 2ADFH 1FO0B 3D3VB 15C8H 2BNQD 4MA1C 4NKDA 2GY7B 4N1EA 2Q3AA 2RGSA 3CH1A 4HH9A 1CD1A 5IQ7H 3V95A 2A77L 4FP8H 3ETBF 4B41A 3Q5YA 4N0UB 1C5CL 1OF2B 3KLHC 1OGTA 2VC2H 3WLWD 3OHXA 3TBSB 5IFHL 2EE9A 1X5ZA 3SGKA 5J7CC 5IJKC 3TFKC 3ARWA 2EXWD 3G6JE 4U0QB 4U1SB 1DUYA 4X7CC 1U8KB 3M8OL 3S88L 3LV3A 1OB1A 3G04A 3RWGB 1ORSA 4AL8H 3QXAA 3VD7A 4NQCA 1KB9J 3X11A 2I9LA 3PQYD 5IMLB 5JW5A 4OFYD 3NCJH 4BYHA 4P9HH 1X3DA 1P7QB 4CVXA 3PWPD 2VR4A 3L7EB 3GO1L 4S1SH 4TNWF 3O6FD 1U8PB 5DC0A 3S6CA 1ZA3B 5C70A 5D2NA 5I1AB 4JG1L 4N68A 1PYWA 1LO2L 2AQ3A 5B4MD 4BJLA 2MFNA 5EFIB 3IJSB 1FVCA 2NY7L 1RUQH 3CFKB 4WV1B 4C4KO 1X5KA 1MFEH 2BVOA 4UMGA 1Q1JH 3BPNB 3MBED 2EDXA 1EFQA 4DEPB 4ZUUB 1ERNA 2I07A 2R23B 1OTUD 1MREL 3BYTA 4ODWB 5HYSA 1EZVY 2YXMA 4KFZC 1NBYB 2HG5B 5DVOA 1I8IA 4G43B 2CLVA 2BNRB 4K3DH 1BWMA 4R9HA 3V5DA 1VESA 2NZIA 3TNMB 3VFMA 4JKPL 5C08E 1U8MA 3PJSA 3LRSB 3EYOA 4NKMA 3ULVC 3FQTA 5HHOE 1HHKA 4ZUWA 2VAAA 1E4WL 4HUXA 4KMTH 1MFNA 5LBSH 4JREC 3BDYL 4L8SB 2XXCB 2J8OA 3EFDL 1SYSA 6FABH 4JFZL 2B4CH 5GGQL 5I1IH 4I5BB 4YUEL 1BAFL 1J1OH 2Y7QA 2AJUH 4JFQA 5GGSB 1KELL 2ZUWA 5BZDB 2L7UA 1EVTC 4HUKB 1ZTXH 4XWOC 3HCVB 4AEFA 3RVWD 1U91A 4QHKI 1KLUA 1PBYA 4CN6A 1EFXD 5FYLD 3O8XA 3VJ6A 4NN7B 4HIJA 1XGTA 2A9NH 1C5DB 2AEWA 1E4KA 4PJEE 2R2HB 3UTSD 4RAVB 4MVBD 4N1HB 4YZFE 1B4RA 4NZTL 4Y5YB 4HG4J 2KPNA 3L1OL 4FABH 4H8WL 2VQ1B 3F5WB 4OM1H 5B3JF 1ZLSH 4H1LA 4UDUB 3TV3L 4HXAH 5C08D 2A9ML 2EYTA 1PLGH 4WNQB 5GISH 2Y36L 1TPXC 1W72A 4H5SB 4XCYA 4YXLH 4MB4A 1X5LA 1ONQB 5I71C 4WHDA 4QOKB 4NWUH 3I9GH 3NFPA 5LXGH 2ZOKA 3VFSB 3P0YL 4OM0H 3NGBC 4IRSA 1NGWA 4I0PA 3JXAA 2XQYK 3I50H 1JPSH 2A2QT 4A6YH 4CW1A 4MJ5A 4XPTH 2CDFB 4YHNB 4HC1A 2NR6D 3GHBL 1UXWA 2AGJH 4I9WE 3RDTD 3HNSH 4G6JH 2JELL 5FCUL 2FJHB 4Z7UA 4YFLF 1HILB 1U6AL 3OJVC 3QHFH 2PO6B 4BFIA 1A14L 4X7SH 4M02A 2Y07L 1HWHB 3EYVA 3MRHB 2BOBA 5EBWA 5HI5C 5C0FA 4F33A 2ZSWA 2FB4L 4LASH 3MACH 3EO1A 1H5BC 1VACA 5IVXE 5HYJA 2J5LB 3VXNB 1ROWA 1YNKL 4E5XB 1S7XB 3V6OA 3ULVL 4O5LH 3MRPA 3S3SA 4PRBB 4P3CH 3TLRA 4YR6A 3RJQB 5IHZB 1Y0LB 4PJCF 5HGDA 3RWGA 1GGUA 2EDBA 2VABA 4GG8B 4LLWA 4O2FA 5F9WC 1JGDA 2X41A 5JW5B 1IC5L 3LEYL 3U7YH 1DDHA 1QRKA 2A74B 4X7TB 5DC4B 3ES6A 1BZ7A 1UZ6E 4WCYL 1MHPH 1JHKL 1JYNA 5SWZA 3PGCA 5HJ3A 2NYYC 3IDJA 4YXHH 1OWRM 1TZGL 2XZCL 1CLYH 2OSLB 4F80A 4RMUA 4LSUH 4M6NH 3WKMH 1G7LA 4Y8DC 3RL2A 4NO2A 5D7JA 4JQVA 4EUPG 1H5BB 5DRWB 4ELMB 5JPMB 2Z91B 1ZLWK 3VWJA 5FYJH 4U7MA 1A3LL 4WO4C 1AD0B 2NY0D 3RZCB 1VGEH 4YDKL 5HYSB 5CLTA 3RBSA 1Q9KB 1RJCA 1T0MA 3NA4A 4KKCC 1U8LA 4OD3L 4QRPE 4BELD 2F9BT 1RULL 3SKNA 2OXHA 4PJDE 2RB8A 3K2UL 1R5VA 4M8VA 1QLFB 4PLJC 1GAFL 3C5JA 3VGBA 1TJHL 5C0AE 4OZIF 5IQ9B 4MJIE 4OAWA 2B1AH 4BH7A 3R06B 2IG2L 3KLAA 2FO4A 5FKAA 5IVXB 4YC2B 4OI8A 1JNNH 2DM3A 4ZUSB 1F4XH 3KYNB 4L9DA 4HJ0C 3S3PA 1RIVL 4XCNB 5C09B 4MJ6A 2HT3C 3QFDA 4XHJD 4L9LB 3QWRD 2YD4A 1K2DB 1TVBA 2CXGA 3G6AB 3MRCA 2UUDK 4JM2A 2I27N 1FZMA 4Z77B 4LEOA 1EO8H 4PBWD 3I6KB 4Q7DA 2VZVA 1MOEA 1FFPB 1C5DA 1NKRA 5F7HA 4DFIA 4LF3B 2DTSA 4FQXA 4Y4HA 2HTLD 1QBMH 1KIQB 3CFEB 2WIMA 3AS3A 5F1IA 2B2XH 4N5UA 5DJYA 1EZVX 1P7KB 1AP2A 4H1LB 1A2YB 4TYUA 3QNYA 1FYTE 3HNTH 3KWWA 3M17B 1N59B 4R6UA 1A1NA 4LHQB 1Q94B 2AK4D 4V2BA 3TYGL 5AUMB 4F7EB 3GSXA 3QEQE 5CJOH 5HGBB 1E28B 2O5XH 4TOYH 2R0ZH 3OKDA 2EXYC 1CFVH 2UZYB 3MJ8B 2E9BA 3TT3H 1G7JA 3CFBA 5DURD 1FP5A 4ODWA 3HRZA 1HZHL 2X4RA 4G7VL 5DUBB 4C83B 4NN6C 3RL1A 3JUZA 5FK9A 5TDOB 5LWYH 2C3WA 3EUUA 3O81A 4JO1H 4UOJA 1LP9F 3WXWL 5HPMA 5DO2C 3ZL4L 3D2UB 3TJEH 5IB4A 3L7FB 2FX8L 1IEAB 1J5OL 3PWNA 4PJ8A 1HHKB 2VLRA 4ZUWB 4WWKD 4XNQB 3GSWA 4QWWC 5EBGA 3VXSA 4HUUA 1S7XA 4U0RB 1J0JA 1EXUB 4WY7H 3ARRA 4DTGL 4JFOA 3W39A 1X9QA 5BO1L 1Y0LA 3BX7C 5HGDB 2P7TB 1U91B 1JV5B 3BZ4B 2CKBH 5E2TH 4G9DA 1PX3A 4XTRD 1IAIL 2NY5C 4OQTA 1WBZB 5GGVH 3LY6A 4M7ZB 1A7NL 1K6QL 1GC1L 4LU5H 3HS0A 1HH6B 4M5YL 4NQVA 1DQLL 1I8MB 5EZOH 3FONA 3QUXA 1JPTL 2DQFA 1X5HA 4RMQA 4DGIL 1C5BL 1VEPA 4MS8D 1WGOA 4OFKA 5TF1H 3DVNA 3DVGA 3P9LB 1LD9B 5I66B 4FOMA 3ME0A 2OSLA 5DXWA 4JG0H 2B20A 1T83A 5KANG 4BSVA 4IOIA 4IJ3C 4XCEA 4CMHB 4TQEL 1F3DJ 4YHZL 2Z35B 3PWJB 3FB5A 4ZOBA 4OLWL 1G7MB 4JRYA 4KHTH 4D0DB 2I9TA 4Z78B 1HXYA 2EZ0D 4K71C 3BP5A 4NHUB 5CHNB 2NY1B 2AK4B 4XHQA 4JDTL 1MCKA 1IRAY 5GRJH 4LFHD 3UJTL 3RWIA 4C4KT 1OLZA 4KHXH 4QWWD 3FTGA 3QRGL 4BQ8A 1C7SA 5DMKA 4I0PD 1NCBL 1U8LB 4UU9A 1NFDE 4MJ5B 3AGVA 3UZEA 4XPFH 3LMJH 4XPBL 2ESVE 1I7RB 4X9BA 4RISL 3T0DA 3TWCH 1J1PL 4XAWL 1FHGA 4JDVB 3ILQD 4HKJA 2B8OT 5JNYA 3KYMB 3DRQA 1YJDL 1BGXL 3CGTA 3JWDH 3N1PC 1A6ZA 5IVXF 3EYUH 3W9DB 1UACH 1MCJA 1EUTA 4YFDB 3VXNA 2HVKB 5E1HB 1P84J 3T3PE 2ZZUT 1KLGA 1YNTA 2X7LB 4HD9A 4X4YB 3BJ91 3JTSA 4PRBA 3QDMD 4WHYG 5HVGB 4F57H 2EIEA 1FZMB 2CXKA 4K7FA 2J6EH 5KAQG 2R2BB 3OAZK 5DMGC 4HWZA 4PJ7B 5EU3B 3F7VB 1KIUA 2W65A 5FGBA 4WW2B 4O2EA 1DLFH 3RWHB 3C60B 3BWAA 3VFVA 4EKXA 4WJ5A 5LGHL 4QHMA 2X4NB 4Q9QH 3I6GB 4Z0BH 5CCKH 1FNEA 4RAUB 1OSZB 2O5ZL 5HHOB 1D9KA 2BMKA 3SQOL 1AJ7H 3BQUD 2EDOA 3B4NA 2A6IA 4MDIA 4ZUVA 3G5YB 3OKEA 3SDAC 3CFDB 3VXRE 5EZOL 4AL8L 4IMKC 3NCEB 2APFA 1AFVL 2XZQL 3N85H 2VDLL 5AUMA 4F7EA 4WUKH 4MNQA 1EGJA 5AZ2L 1FV1B 3PWUA 3L3IB 1NGQH 2H26A 5FYKU 3MV9A 4GAFB 5TDNB 4G3YH 4WTXA 4GKNA 4MHHI 3QUKB 2VDMH 3RZCA 5EOTA 1G9NL 1JNJA 3DSNA 5T1KD 4XWGH 1T0MB 4RDQG 4WW2F 1UB5A 3RUGF 3VXME 4Q2ZA 4M1DH 2P5EE 5IK3A 2UY7A 1ZHLB 4ODXA 4JKMA 1YMME 4YHML 1FDLL 2DWEA 1VFAB 5JORB 3CMOL 1L0YA 1MWAA 4WFFE 3P0GB 2FO4B 4NWTL 4KK8C 4U1MB 5FKAB 5IVXA 1NCWL 1XZ0A 4S1DD 4P9HC 4NRXA 3VXOA 2QHRH 1P7HL 2VLLA 3D25A 3P11H 3SJVB 1WZKA 1BVKB 3A6CL 3SKOA 3SO3B 3TM6A 3IETB 4Q0XH 3ZKXB 3UPAA 5HGAB 4EJ1C 4G7YL 5HYFA 1C7TA 3VFPB 3HHRB 5K33A 2A73B 3QWRA 1DSFH 1VGKB 5D71L 4H88L 5IHLB 1T21A 2Y23A 3SDXA 4RBPH 1T0NA 3EGSA 1DLHB 2BFVH 1EDQA 3O3DA 1U3HD 2Q86B 4BZ1L 3KPLB 1KIQA 1ZLUK 5I15L 1UM4H 4ZAKC 5CEZH 2VQUA 5F88B 5I1DA 1KFAL 5IW6A 2J6EL 1X7QB 5J06A 2C4FU 2W1NA 1AI1L 3RAJL 2VERN 5HHQA 4OSUH 1CT8A 2P24A 4KKNA 3MJ9A 5FKPB 4GAYB 4DQOH 5KVGH 4KU1A 3OKLB 5JQHC 3RVTC 4DUWA 2DM7A 1JHLH 1M7IB 2XY1A 2P5WE 2A9NL 1FSKC 5KSVB 2AP2A 1E28A 1NEZB 2H2SC 3IU4L 3S96A 4MCYB 2CR3A 1ZWIA 1BOYA 4HIHA 3TVMB 2IAMA 4DUXA 5DMKB 1F13A 3ARFA 1YNKH 4WO4D 3VGAB 1TQCB 1ZLSL 5K9JH 4O5LL 4OLZH 4HXAL 5CILL 2FEEL 4QKXB 2HKHH 4LKCA 4N8CH 4HH8A 4ZS7H 3LKRB 5ITFB 5MENE 3OF6D 4PB0H 4TSAL 4HC1H 1G1YA 4XWGL 3FN0L 3P0VH 4JCLA 4U6HA 3W9DA 2A6DB 4LSVH 4IIQC 1AY1L 1FPTH 2QSVA 3BVNA 3I3DA 3PWLB 5FGSA 1TZGH 3TBVA 1P6AB 3IS0X 1QYGL 5E2VL 2XKNB 3IFLH 3OMZA 3V6OC 4PJGF 4MB5A 2NY6C 3VGHA 5CEXB 1UZ8B 4P4RB 4Z7WA 3D9AH 3GBNH 1P2CB 4J8RB 3G5VB 1JMXA 4PG9A 5DI8B 3F7VA 4XI5C 5B38A 2HLFC 1UM5L 3TPUB 1GL4B 1R0AL 1TCRA 3A6CH 5DHVA 4Y1AE 2X1OA 3KDMB 1D3CA 4JO3L 4QYOA 2WWKT 3BPLB 2W9LA 3DVGB 3P9LA 3ZDYE 1U8HB 4PJFB 3D39E 1BLNB 3GSUB 5L8JB 3LD8B 3MUGB 2ARJA 4MYWB 3IF1B 3REWA 4QEGA 5GS1C 4UNUA 1IQDA 1FORH 7FABL 2LAGB 4M7LT 4LLVB 3QQNA 4YXKL 3MBXH 1TJHH 3N1GC 3LPGA 3NIDE 3O11A 2JJSA 4GH7B 1IEBB 2ORBL 3MRKB 4ORZC 4GG6A 5KVFH 5J6HB 1U95B 5DD3L 1MUJB 2DWDB 5C0DA 4X6BB 3W81A 4YLQT 2XTJE 3HRPA 4ZAKA 2D7PA 1KJ2B 4I18B 2VE6B 1YEHH 4QHUA 5DWUH 1OPGL 1U92B 2X09A 2IGFL 4ODUA 1G7HB 3ZYOA 4WHTB 4EVNB 3T04D 4HKZB 4U1GC 4IRSD 4N8CL 4ZS7L 5BS0E 3VD3A 4YO0A 1YEIL 1T5WB 4CADB 5BZDA 3RGVD 3ZMRA 4OF5A 3VFWB 4I1NB 4RBPK 5FGCB 1OTTC 3GNML 1LP9A 3S4SB 3G04B 2GITA 4XXCA 4ODBD 3S97C 5J3HD 1UH4A 4HIJB 5DJDA 1GAFH 5IB5A 1JGUH 5FB8A 3ZTJG 3OKMA 1J18A 4LPXA 4QTIH 2Z8SA 2BNQA 2FHBA 2JJVA 3DPBA 3BWAB 4PJ9A 3VFVB 1QYGH 2IPKA 1MCBA 1E4XL 3IXAB 4IDJH 1F8TL 4UTAH 4OZGB 5IWLC 2ICWI 2C1PA 1IJ9A 1DE4B 2NW2B 1DBBL 2VDPL 1FVCB 1G6VK 4K94H 4ACPA 1JZ2A 1DL7H 1UZ6F 2VDQH 3CSGA 3D18A 4YDLC 5E4IA 4D0CA 2F54E 5FYJD 1XF3B 4JFFB 3EYOB 1IM9A 2CJUH 2NY0B 3B5HA 1TMCB 1X5XA 4JKLA 1ODAA 4AK1A 2X1PA 4I0PB 1U2CA 3JV4B 3DURB 4GRLB 4H0GA 4ZFZB 5GS2D 5D7JD 3HCVA 5I75B 3VXRB 4Z7UB 1RJYA 4PV8A 3FO0L 3FMGL 1WWBX 1RK0A 1MWAB 5EOQL 1LEGB 4F33B 2PO6C 2F5BL 1CYGA 3T2OA 4PJXE 4QGTA 1WISA 4U6HB 4DVBA 5IFAH 2ITCB 1PW3A 3I02B 4Q9BA 3VI3F 3UZQA 3H7BA 3HUJA 1F2QA 5I16A 1KJ3H 4OZFA 4JG0L 4JB9L 2IFFH 1Q9WA 1L9NA 1PKQA 4PJGB 4PJCB 3IDYC 2KZ1B 3V0VA 4M61A 2XPGB 4N0RA 5DI8A 4QHLA 2FX8H 5LAXB 4WNQA 5IVZB 5IEKB 3KHOA 1RHHA 4EDXA 2A6KA 5FM8A 2VOTA 1V3KA 1KF9B 4KGLA 3SDDA 3VXSE 1J5OH 43C9B 3ULVF 3IAGC 4PJ9D 2JJUA 1RU9L 1P4LB 3QPXH 3KPSB 5ICXA 3JBG7 2VDNH 4P2RE 3GNMH 4TVPL 1EEUA 3T0WA 1WLHA 5E9DA 3LAFA 2BY2A 5INCA 2VSDA 3GSUA 1BMGA 3DV4B 4TUKH 5CJXA 1CDUA 4JEGB 3KJ4B 5C0JA 5JXEC 3VFNA 2A1WH 4L4TB 2VZ3A 2FECI 3ALXA 1H15A 2Z93A 4Z9KB 4DGVH 1KT2B 1GGTA 2NY2B 4LU5L 4HAGA 1EEZB 4XAWH 4LLAA 5BV7L 1RVFH 4BM7A 1AH1A 3BD4A 5EUKB 4G6MH 2LTQC 4K94L 3EO1B 4JDZA 5IV2B 1CQKA 3OAZH 1Z9MA 4Y89A 4LLYA 4P2RD 5ACZA 4HX1B 1BD2B 3QAZC 4PB9H 4XP4L 2XG4A 2EDEA 3VG9C 3WHE0 3T65A 3O4LB 4XP6H 1QLFA 3C9NB 1OWWA 4XPHH 4BFIB 5EO1B 3VG0H 1G7HA 4MCZB 3WS3A 3BMVA 3W9EB 2AXFB 3QEQD 3FT4B 3T0EE 1KPRA 3MV7D 5D6DC 3PWPB 4ZAKD 5E6IC 1S3KH 4P49A 3IJYA 5SV4A 1AD9A 1DQQB 4KI1A 5CP3A 2CDGB 1CFNB 3C5SA 1HHGA 3O41A 4XP9H 3IXTA 5H35B 5I8KH 5EWIL 1XR9A 1DDHB 2A74A 3MROA 4XWOD 8FABB 4PJXA 3RUGB 3MRMA 4APQD 3CFJA 3H3PH 4JM2C 2D03H 2ZJSL 3ZE0E 4JPIA 1TZHB 1A7QH 1EIBA 3GSVB 4S1DC 1G6RL 3RY5A 5IESH 5E2JA 3BHBB 3BI9X 3GM0A 3PABA 3V4VL 2RR3A 4YQXH 5JOPE 4NM8L 3VXQB 3B9KD 1U41A 1HQ4A 1J86A 1KTLA 4WFHD 3SDYH 3SKNB 1XF3A 1I8LC 4JFFA 4HF5L 5ENWB 1B88A 4LVOB 4NQEE 4RWYL 2QSTA 1BFVH 1NFIA 3VDAA 1AQKL 5B3JE 2HT3D 4GKSB 4G8FA 5E6IA 3CC5A 1CICD 2A1WL 4PY8I 1AJ7L 3KYNA 4PJAB 1DN2A 1GGBL 2NY5H 2J8UE 4JR9H 4ZXBB 2FLBT 1R3LB 4WW2C 2R0WH 5I71B 3ARDC 1KIRB 4JFFE 2GTZB 4OB5L 5J8OA 4WUKL 1KJMA 2GT9A 4M4PA 2LVEA 4ENEC 5KVDH 5HVFB 2UYLA 3MTRA 5GQBA 1TJIH 5FO7B 3TA3D 1KPVB 4LVNC 4L8BA 5E5MA 4FFVC 5E00A 3B43A 1LP9E 2GJ6A 1I3GL 1JN6B 5HGGS 1CCZA 2FJFA 3NIFF 1AI1H 4MWFA 3OQ3B 3RAJH 2BCKB 4XCCH 2FWOA 4HPOL 2NXZC 5BQ7B 2NW3A 1PDKA 4YHMH 3EHBC 3MRCB 1YECL 3FHQA 2B1HH 3HUJF 3KAAA 1FCCA 3FQUA 2X89A 3WDIA 4Q97A 1X5IA 3GSXB 1YN7A 4JRYE 3RPKA 1RUKH 4K9EH 3KS0H 1FJ1A 1BOGB 3T4YA 2HFEB 3IDMA 3H9YA 1CLOH 1IC7L 3PXJA 5F1IB 2APBA 5MENB 2VO5A 4LMQI 1I1AD 5ILTH 4YHIA 1KGCE 3ZSTA 3BQUB 1DFBH 1IE5A 3O3AB 5E03A 3T3ME 2XKSA 5D71H 4IJ3B 4CMHC 2OR8A 1N59A 3QCVH 2AEQL 1KEML 4X5XB 4LLQA 4PS4L 4D0DA 3RHWF 5HPMB 4RQQB 4NRZB 1RV6X 2AI0H 3B9KB 4QRPB 5ERWB 1SEBA 1XGYL 3U0PA 1A3RL 2E7MA 3BKYH 5IFJA 2QHLA 1AGCA 5GSVA 4FS0A 4M43L 4GAGH 1U3YA 2YD1A 1JE6A 4X6FB 2XV6B 3VDCA 1EJ6A 4Y4FA 4F37F 1FZOA 4XT1C 4C54A 4ZSOB 1YEFH 3NFSH 4PJFF 1MPAL 4UIKL 3SE8L 2UZXB 5DD6A 5GRVK 3UBXG 3MRNA 2Z31C 1RK0B 3DRQB 3BEWA 2DYPA 5E5RB 3UX9B 4CL7A 3AMLA 4GW1B 4M7LL 5F96H 5HYEA 4KH2A 5D9SA 1QQDB 2ITCA 2XNAB 5T1KA 4OB5H 1P9MC 4P2QD 3JTSB 1MHEB 3RIAK 5ESQB 4ZOCA 4IS6A 1DUYB 1BIIB 4NC2B 2CDGA 5DUMH 2EKJA 2HMID 2CRIA 2WK2A 4RFNC 4PJ7A 3I6LD 3PWJA 1F00I 1RHHB 1QNZH 3LPWA 5FV1L 1UJTA 1BFOB 3MXVH 4YPGA 3CFJB 4TRPH 2P44B 1UCTA 2HN7A 3SY0B 2QQLL 4HPOH 4X9FA 4XH2B 1MF2L 3DO7B 4FRWA 3WN5C 1JK8A 2OTWB 4UT7L 1YECH 5KVEL 4TNVF 4HG4K 3ECBA 4MDIB 4RGOH 4ZUVB 4L3ED 1I1AB 4IOIB 4XCEB 2VLJD 3RX7A 4IRJA 1UJ3A 1SYVA 1KC5H 4NP4H 1YEHL 1QFUL 1AXSA 4OT1H 3UROR 4OCMC 3V8CA 1W0WB 3MLXL 4H20H 5D8JH 4ZPVA 1KT2A 2KQMA 1TTGA 1FO0A 1GGIH 4OZHE 3RVWC 5ISZE 1QR1B 2I07B 3MREA 4OF8A 5EUKA 2H2PC 4RFEA 2CIIA 4M3KB 4HDIA 1OAKL 4PRHA 1YEIH 5IB3A 4N0UA 4ZXBA 3WNKA 4G43A 3MMEB 5I1JH 5LBSL 2E6PA 2EC9U 1J87A 1V3MA 1XF2B 1SQ2N 4LRIA 3GHEH 3HE6C 4TUOB 4L5FH 4P46C 3P4OB 3MRFB 5IHBA 4OD2A 3IRPX 4JJHA 2ERJB 1O0VA 4KRMB 1OARH 3PHSA 2R1WA 1ZKAA 3L5WB 3RTQA 1I1AC 3MV9E 4KROB 1DANU 3HNSL 1VA9A 5DD3H 1NSNH 2R8SL 2J7LA 4CDGC 5I74C 1F8TH 3DSFH 5EORL 4XNXL 3NACL 5D2NC 4O51B 3CSYA 2KL6A 4LSQH 1FLRL 5ETUB 2FSEA 2F58L 5E5UB 1QRND 4NPYB 4OF3A 5EOCL 4JRXA 4M7LH 5F96L 1CBVL 5I0ZA 3U9UA 4KDVA 3MRMB 5FEBA 2A9MH 2VN7A 1PLGL 2PETA 2FEEI 5BVJB 1IZKA 2EH7H 5ITBL 2Y6SD 1KCRH 4ENED 2DIBA 2X4TA 3QDMA 4URTB 4OGAD 5F3HA 2HWZH 3U4EA 3LQZB 3NPSC 1LO0L 1A8JH 4OLXL 3JVGA 3FO0H 3OKKA 2XA8L 3GSNH 2YPVL 3L3JA 3AS2A 2JK5A 1OP5H 2WWMD 1YEKL 4G8FB 3EJJX 4OCRH 4DKEH 1MFBH 4FQCH 3VXOB 3H42H 4LQFL 3ARBC 2APTA 4YWGH 1C08A 2B0SH 4HEPG 4ZO9A 5MP6H 5ANMA 4ELKA 1UVQA 1A3LH 1EJOH 3UYPA 2LE9A 4YBLC 4I2XA 4ZSOA 2Q7YB 5CZKA 4QRSA 2UWEA 5DT1H 5EULV 2A6JA 3ZYJA 4MZ3A 1NBVH 3HA0A 2FGWH 1Q9LB 3DI2B 3RGVB 4X0KA 4OZIA 4Y5YA 3GMRA 3UPRA 4N0YH 2FJFB 1JHKH 2XN9B 1IGML 2ZUUA 2BHUA 2Z8RA 3SKOB 3TT1L 2YD7A 4E42A 4ZTOH 4KZEL 3L5XH 3VFRB 3ZHDA 1AKJA 2CMRH 2DYPD 5BOZG 4G9FB 5D6CA 2GHWB 3SGDI 3EGSB 4YAQA 4MD5A 5HJ3B 1ONQA 4P3DA 4HZLA 1I1CA 5H94B 3C08H 1C12A 5B8CC 1DANT 1I1FB 1CL7L 1WFUA 2VIRA 2GSIB 4JJ5A 1S9VA 4XRCB 1ZSDB 2I5YH 5SWZE 4PJFA 1N8ZB 2XQYG 3BT2L 1FRGH 1I1AA 3WO4C 4L3CB 1S78C 1D7FA 4JB9H 5DK0B 2FATL 4J4PD 4FQPA 4G6AD 2IMMA 5HD8C 1VGEL 1N5YH 1PX4A 2P8LA 1URLA 2XWTA 1QPPA 1DBJL 2H41A 4ZFOA 4POZC 4LSPH 1X5GA 3SKMA 4DGYL 3BPOB 3WXVL 3Q5TA 1KIPB 3RKDC 4G42B 1U8JA 4WWID 1U95A 3T0XA 5E1AA 3BUYB 3CU1A 3K1DA 1PEWA 2VE6A 3D1MC 3GMQA 2CIKB 5DQ9A 1BECA 1TTFA 5LGKA 1UC6A 5DYOB 5HPOA 5ISZB 1JGDB 5JXED 1P5UA 5J56B 4LPTA 3KLAB 1F3JA 3EBAA 1NL0H 4F15C 3FT3B 1B4JH 2SEBA 3WL9B 3MLYH 3W0WB 3L3KB 4XNYL 3U0TA 2ICCA 3B2VH 1QLEL 3LH2H 1CFQA 2IAMD 2LQRA 4X80L 3MXWH 2K1MA 1JHTA 2AAVA 1ZT7A 5IMKB 1A6PA 1C16B 2BY0A 3PGFH 5ESQA 2Q6WA 4EUPB 3L3DB 2XG5A 1JNHB 4PGDA 5EU4B 3GMLA 4GG6F 2PYFB 3O4OC 1FVDB 2VL5B 3QIBC 4PJ5D 2H45A 1ZGLM 1XH3A 4G9FD 3OR6B 2AJXH 2BVTA 2IPKB 1V5JA 2ZCKL 4DKAA 4LBEB 2J88H 4DKFL 4CDHA 2EEBA 4LAQL 4NO0A 2CH8A 3L5XL 5KZCB 5MEQA 4J2XA 4P5MA 2ICEB 2NW2A 1UM6H 1A21A 2ICWB 4NN5B 1QOKA 1G9MH 1UJ3B 2HFFA 3RA7L 5I8KL 4QHUB 3UTTB 4M93C 1UA6L 1AXTH 2OZ4H 3IF1A 5EG6C 3REWB 4NQSB 4NKQB 3DX7A 1I7ZB 2AKRA 4K7PX 1UEYA 3VFGH 5GS0D 5IGXL 3FQXA 4KGJA 4I48B 1Y6MR 3Q3GB 4YHZH 1QBLH 3PE9A 4OQTH 4GG6B 3WJLA 4W81A 3RNQB 3LN9A 4M4RA 2VWEE 4OD1L 2ZOLA 5EZLA 2YUWA 3IU3A 4PJIE 5L8KB 5GHWL 2RBLA 1NLDL 1UVQB 1KJ2A 1YN6B 3MNWA 1DEEA 1CDCA 1OT2A 3WXVH 2C9AA 1CDHA 4YBQD 2D7OA 4R4ND 4WUUD 3NIFE 1Q1JL 4LEOB 1Q72H 2AQ2A 5GSRB 5M95B 1B6UA 2B1HL 2MTPA 2ZUVA 5C9JB 3M45A 3CFEA 2OR7A 2YPLB 1CLOL 1IC7H 3U36B 4DJMA 4C56D 4P2CG 3TBWA 1GGBH 4Y19E 2NY5L 2G5BA 2V9QA 2F8OA 3ZYZA 1DQDH 4ONGH 4N8VA 1INEL 2EH8H 2A6KB 2WW8A 3LZFL 5B39A 4NQVB 4EZMA 4Z7OF 2FZ3B 3V7MA 1ZLVH 1P4LA 1B9ZA 5I2IB 1S8DB 1VEMA 4XP1L 3F6LA 1E0OB 1MIEL 1EUUA 2YK1L 1QLRB 3HR5A 3IFOA 4EUPH 1G7JB 3CFBB 3GSOB 3UTZB 1XIWC 4YHYC 1ZTXL 1IGTA 3TZVA 1T0PB 4GMTH 1CFTA 1MRDL 1W0VA 3EOYG 2HT4C 2IALA 4K7PH 5EIVA 1ULVA 1JZ8A 1DP0A 1OQOA 4I8DA 3ARGC 1FL3B 1RUPH 4FFWD 1XMWA 5C07B 3RZCC 3BPLC 4K9EL 4K3JL 2I25N 2QQNH 5SX4I 4PJ8C 2XZZA 3L5HA 1NMAL 4LCYB 3C2AL 3H9HB 2G60H 3JV0A 2E7LA 4NO3B 3BUYA 4H8WH 1CGTA 1I8LA 3H7BB 4Y4FC 1VSCA 3RRQA 3WUWG 3K4DA 5AZ2H 3CPLA 5DRXA 2XKUA 2DQUL 4AEHL 3QQ3B 2WBJD 1EPFA 2EC8A 4P2QE 3T0VA 1BX2B 4JDVA 5I1GL 4J3UA 1D5ZA 4YC2C 3WS3B 1E6JH 4H0IA 4OD1H 4NWUL 1DR9A 3IS1X 2IPUG 5TQ2L 3KPNA 1T2JA 1MJ8H 1CICA 1KBGH 4W70A 4Y19B 3WJJC 4WGVB 1NGXA 1JHTB 4L3EB 3AY4C 4ZNEE 4CVWA 4UB0H 3V6ZB 2ITDA 3TIDA 2HLFD 5GRVL 1IKFH 3GMLB 2R0KH 2V2TB 1JGLH 2FR4A 4YEEA 5T1LD 5DHXB 4BZYA 3ARVA 1MLCA 2ADJB 2NY4B 3OAUL 3QIUC 3SE8H 3MV9D 1YEFL 4WVRA 4RSVA 4NQXA 3RZCD 1MQKL 3UTPD 4PJEA 3EYSL 3QA3B 2FD6H 4BFGA 1QFWI 3QUYA 2M2DA 3A67L 1AFVH 2XZQH 3N85L 4MDJB 2RIKA 4MGXA 4WU7B 5DHYA 4F8TA 2P43B 3IFNH 3QI9A 1HHIB 3GMMB 5CEYA 3P30H 1HQ4B 5LCVH 1RZFL 1T22A 3CD4A 5C7XH 4NJ9L 4PGCA 1JVKA 2IPTL 2MKWA 2X89D 2XWTB 3FFDA 1EH9A 4PJBF 1X44A 2CKBB 3PWVA 3TF7C 1HDMA 3QDGE 2F53B 4PJDF 1FO0L 4FMKA 4L4VD 4WFFD 3ARZA 1SMAA 4UQ3A 1CVRA 2UV3A 3ZDXE 3KYKL 1Z5LA 3BZFA 1TVDA 3DIFB 43CAA 1FDLH 3X3GL 3MLTB 1HSBA 4NN6B 3MJ7A 1CLYL 3SDCB 3EKCA 1RUML 4P46A 1N0XH 3SKJL 3U4BH 1DBKH 2HP4A 4EDWH 1ZHLA 1MHHB 4YFEA 5F7DB 1U8KA 5I9QC 4ZFFA 3O4LA 3RHWK 5EOCH 1IMHC 2EDYA 5E70A 2PR4H 1NGYA 5FYLE 3FHAA 4KK9C 3MA9H 3VXTB 2JE8A 4M6OH 1AR1D 2O61B 1DBAL 2VISA 1CFBA 1D6EB 2YPKA 5IMOA 1XGQB 5IMMB 5MEPA 3ZTNL 4M9PA 1PQZB 3O2WH 4LLDB 4JQIH 5K59F 3P73A 1EEYA 3GSNB 2YA1A 3SPVA 4LP4A 3PABB 4N8VB 1JNLL 3KPQA 5I6XB 4R2GB 3U79A 4N8PA 3OWEA 5FO9A 4TUJA 5HDLA 1MNUH 3VH8B 1OARL 4K7PY 2OM5A 1EEQA 1OCWH 3TH2T 1F45A 2WBWB 4R97C 1ZXQA 3U48A 3MV9B 2YPLE 3IDMB 4C56A 1U93B 4N0FA 2WIIA 1UT9A 3EDKA 4RGNE 1IM3B 3GMNA 2EE6A 2PXYB 4OCRL 3BYYA 3TZVB 3EO9H 4OFDA 1MCDA 5CD5C 4WFHE 5C0BE 5EU5A 1R0AH 3V5DB 5JQ6L 5E7FA 1NEUA 4GAJH 1PG7W 5T3ZE 4Q2ZB 5ENWA 5TE4L 3Q6GL 5CZVL 4MQTB 3U0PB 5GGTH 4HIIB 5F3BA 3QIWB 1SJHB 5D70L 1E27B 3EIFA 3MRLB 5CSBA 2ESVD 4XNMB 1CU4H 2EYSA 3DX8B 2CDFA 5L88H 3T0EB 3QFJA 3HB3D 4EXKA 3MNWB 3VRJB 1E6OH 5HGAA 5ICZB 5IW1B 1F4WH 2O5YH 3GIVB 2YPVH 5GPRA 4KKCD 2MQ0A 3CAFA 3TO2A 2DQTH 4U6VL 3ZKQD 4OF0A 5DD1L 3W82A 3WNOA 3D9AL 1MAMH 4EI5A 4FQCL 2NY3D 2OL3B 3ARSA 4PRHD 1QO3A 4PGEB 3RWCB 1NGXB 1CL7H 2UY6A 4XPGL 3BOVA 3U2SA 3PIQA 5D1XD 1GH7A 3MV7E 4KRPD 5DD0H 4PUBL 4UV7L 5F7EH 8CGTA 2P24B 1F58L 1EK3A 1RZGB 4P23A 5CLWA 5FHAL 5LGJB 3MGOB 3MA7B 4X7TA 3O9WA 3OKLA 5INDB 5D2LE 5FF6A 2PTTA 4P3WA 4UIMA 5KZCD 3PGDA 1VENA 4MCYA 1S8DA 5JA8B 1U36A 3A6BH 5D7IB 5IFJB 3QQ9C 4QYOB 4Z76B 1A1OB 3WEXA 2DLGA 4YDJA 4PP1C 4J4PC 3GMMA 1OCWL 4XI5D 2Y25A 4DFHA 3KXFB 1W0WA 2CMRL 2P48B 4IDJL 1J05B 4MA3B 3TC9A 3WCYA 5BZWA 1QVOA 5C0CA 1HILA 3MJ9H 1MI5B 5B3NA 3MREB 3DMMA 4X99A 4ZG1A 4ERSL 3DIFA 4JFHD 2AJSL 5J6GB 1J0ZA 5IB3B 4K55A 5JR1H 2H8PB 2MJWA 2H32H 1ZAGA 1QZ1A 5DJCA 2OJZL 3DBXB 3LRGA 4HZAA 2R1XA 3ORJA 3EZJB 3LQAL 4DK3A 4PLNC 1MY5A 4ZFFB 2XZAH 4E9LA 5BXFB 3BKML 2NY3C 5HDQL 2VLME 2K3TA 5JOPD 2DAVA 4TVSa 1UWXK 4LSPL 4KQ4L 1MVFA 3E3QE 1FFNB 1P53A 4GSDL 3NN8B 5DJ6B 2O61A 2E27L 1R24B 3O6FB 5HYQB 4XC3H 5HY9B 3QZWA 2X4PB 1K8DB 1SBBA 4BKLA 4HK3N 2OTWA 1PQZA 2R56L 3C6LB 3LKQA 3MV8B 4LLMA 5E08L 5FYKD 3L9RB 3ARTA 3QHZL 1ACYL 4IS6B 4U6YA 3ARBD 3WFHB 4O02L 1SJVA 4FQXD 1IM9D 5C0NC 5ALBH 2VLKE 3SBWA 4Y4HB 3GBMH 3OX8B 2W0FB 2VDPH 3VWJB 2DQCL 4RA3A 1D9KC 3VRLF 3MLSL 1GZPA 3S5LG 1BIHA 3T2NH 2CIIB 3LH2L 5K9OA 1JK8B 3B9DA 4X80H 4PV9B 4PYGA 4L1HA 3QNYB 3HG1A 1DQMH 2X4OB 4P2QA 4PRPE 2Z31A 3QPXL 3WE6A 4J3OC 1AE6L 4FQ1L 5EIIA 1U2HA 2IH3A 2EDTA 3IKCA 5D72L 3W0WE 4IMLA 3C5ZC 1Q9OB 2UWEE 3HC4L 3E2HB 5C6TL 2AS5M 5D7LA 5I0DA 2L7JA 5TE6H 4DOHE 1UYWL 4ZSOE 5TJWK 2Q76B 5SWQB 3DURA 4JZOB 4PIRF 2A77H 4FP8L 3HPLB 3JVGC 1RJLB 1HSBB 2DQGL 4C83A 4KJQC 1QFWH 4OFVA 1RVFL 4HMEA 2GTWB 3PL6D 1KACB 1TVBB 1A9BB 1AXTL 1WEJL 4LIQH 4RGMB 3SDDD 2D9CA 2AJZB 4RFOL 2KKQA 5M94B 3O4LD 3HAEG 3MRGA 4RIRB 3TO2B 1KJ3L 3SGEI 2F15A 4E41D 3VXSD 4IIQB 5FUOH 3VXTA 3RBGA 3CXHJ 4K9EC 2GW5A 5I18H 5DJYB 1TFHA 5C6WH 4HHAB 4WFGD 4HJGA 3HE6D 1UJ3C 4M7JH 1T66D 2F19L 1UENA 4OZFB 1D6VH 1NCDL 4LSTL 5F7MC 2R29H 3P73B 2NNAA 1PZ5A 1LE5A 4PGBB 5LAXA 2C3VB 5IEKA 3IDYB 3FQRB 1RZ7L 1ZHKB 3VWKB 2X4QA 1WT5C 3QPQC 4TPRL 2X40A 4P3DB 1D5XB 3WIFB 1XIWA 1DVFA 1QUNA 3WFDL 1DUZA 4HUNB 4Z76A 1G84A 3RWFB 3NABH 3IDIA 3GMNB 4BZ2H 4G8EB 3DV4A 3EAKA 4JVPA 4LRNL 4RMTA 4X98B 5B8CA 1INEH 5F1NB 2FCBA 3D39D 2Z0BA 1G7MA 2FX9H 3F7YB 3VMNA 4Z5RA 5F89A 3WV0A 1P1ZB 2V9TA 4HAFA 1CGVA 4JRXD 5F97E 3W11D 1EEZA 2M1KA 4FA8A 4JHWH 2BFVL 3VXUB 3UP1A 5B21A 4J7RA 3KYOA 3MV7A 1KIPA 3FOLB 1S7SB 1KXQE 5FO8B 1QFHA 2J4WH 2VH5H 4NN7C 1JTOA 1SJHA 4XP6L 2C3HA 3WFZA 5EC1A 4LPCA 4HUUB 5ESVB 2ENSA 4HWEH 3HNVH 3GM8A 4X5WB 3VGEA 3N1FC 1C08B 5T1LB 3RFZC 1L7TL 2DKMA 3HPJA 1C8PA 1YJDC 4JFXB 1T5XB 1KG0B 2RQ8A 1MJJA 4JY4A 3V6OE 3HZKA 3MYJB 2APVA 1RFDL 1EMTH 4FQIL 4UUJB 3KYMA 1LO2H 2FDBP 4L8CB 1A9EB 3IDGA 1HE7A 3SDDB 5DJ6A 2A6JB 2ZPKL 2YN5A 2OBGA 1TPXB 4YX2H 4GRWB 4Q74A 1XCTB 4BK5A 4X9HA 5CFHA 2G60L 2YMXH 3TIEA 2NYYD 4L9LC 3PG2A 4PJHA 3FB6B 3WFBH 2YPLD 3B5GA 5DD5L 1DQQA 3MRRB 1OD9A 4E42B 2X44D 1FGNH 2ZJSH 3OG4B 3QDJD 3P30L 3VFRA 5C6PB 1E6JL 1TZIB 4P5TD 5HHVH 4FQQB 1UCBL 4JY6A 4CMMA 3BGMB 4MD5B 5J12C 4YQXL 4NM8H 3PGDB 3HE7A 4NM4H 5MEQB 1X5FA 4OKDA 1MFEL 1I1FA 2EO9A 2VIRB 1I1YB 4JFEA 4OIIH 3RI5K 3MV8E 5GS0H 5JOFB 5IV2A 5JZ7C 3TVMC 4LHUA 4YDJB 5E2VH 3HG1B 4JFYB 3CXHK 2CUIA 4ZDHA 1ZHBA 2DD8H 5ACZB 2VDKL 1BD2A 4X6DB 5D5ME 3S34H 4UNTA 1N3NA 2R4SL 3PDGA 4MNQB 1KTKE 3ZSSA 2HRLA 1QVOB 4XVSL 1LO3H 1N64L 3VXUD 3QHFL 4L4VE 2VXTL 3TPKA 2X2YA 1MH5B 2R0WL 1JTPA 3RVUD 2SEBB 2DMCA 3WL9A 3LSOB 2JJSC 1HHJB 2OQJB 4RRPA 5EZLB 5T3XH 3IFNL 1KLGB 1FFOA 4UBDC 4FFZL 2AI0L 4Y1AA 1TLKA 1T1XA 3D0VA 3QXUA 3UBXI 3L3DA 2IPTH 5J12B 5JXAL 1A3QA 5JHLL 5I8CA 2LVCA 3O41B 4WI5A 1ZGLB 3P77B 1A0QL 4WI2A 3O45A 3SE4A 3K0WA 5E99L 3FCTB 8FABA 1D5IH 1FFNA 3HE7C 2YWYA 4X6DF 1L7TH 4NQUA 2CQVA 4A6YA 5KVFL 1U8PA 1LK3L 2CLRA 1JYVA 3QXTA 5FYJU 2VMFA 3BRFA 4P5MB 3EZ8A 3GJFA 4JPWH 4MD0B 4I3RH 1PZ5B 4S0TD 4EUPA 1JZ7A 3S8WA 2BNUA 4KI5E 1NUNB 1N2RA 4ZPTA 1FYTA 5ADPL 5IBTH 1G7PB 3UTTA 5TE4H 4FHBD 4M3JA 5GS1B 2E6JA 3MYZA 2RHEA 5CZVH 1FGVL 2X42A 3IFPB 2R0LL 1U8OB 4X6EB 3TO4D 3JWOC 1DUZB 1I9IL 1NCUA 2R4RL 3CNKA 4RNRA 3UTZA 5C0AB 1FNSH 2VQ1A 5B39G 2WUCL 5DZOA 5IB2B 1R3KB 4BFBD 1IQWH 5DMIH 3U7WH 1CFTB 5FKPA 1L7IL 1QSEE 3HG1D 5D2NE 2GYSA 1OAQL 2J2ZA 4ODXB 4N90E 5DDHB 1QACA 4XGZA 4AT6B 3N1MC 2EICA 4APQC 3S96B 4DAGH 4PLKC 3FOLA 1NAMA 3BIKB 4TVPD 3FOMA 4HPYL 1F90L 3L3HB 1MLBA 1AGCB 4TSBH 1S7VB 3QIBD 4X7FC 4NT6B 4OGYH 4LLUB 4NGHH 2IQ9L 4KKBD 4NO0D 1EVUA 1H0DA 3GUTB 3O3EB 5JO5B 4K23H 2GJ6B 2JB6B 5EBMB 25C8L 5F7NC 3VGDA 3HAEA 1ES0A 2Z9TA 1FZOB 4PLJD 1YMHB 1M7XA 2IAMC 3D3VE 3VFUA 5SX4H 5IKCB 3O8XC 3GK8L 4QY8A 3X3FH 1GIGH 3QUML 5JIPA 1ED3B 1XGTB 4NBZB 2DYPB 4BH8A 1DLHA 1TQBB 2FZ3A 2YD5A 5DUML 1CF8H 2X70B 1BOGA 3T4YB 1HYSC 1K3IA 4U2ZA 4E5XA 2P5EA 2BVEA 3TJHD 3QEGH 3ZKSD 5I76B 4M1GH 2WAHA 3TBVB 5JIKA 2XYCA 2V2WB 1BREA 4AM0B 1T03L 5DFWH 3T2QA 4S1QH 5DK3A 2OP4L 2XWBB 1D5IL 4MSWB 2NY2D 2JF1A 4F58H 4QRRD 1EAPB 2BSSA 4H8WC 4WDIA 4H5SA 4XCYB 2NY4C 4LGRB 4CMMB 4L1DA 5SWZB 2V7NB 3SY0A 12E8H 2XRAH 3DROA 1G1CA 4MS8C 5C0EB 3BKJL 1ZWIB 5I17A 4NCC2 5EB9A 4XPGH 3NBNA 2IANE 2V5SA 1EV2E 2ZCHH 4D9QE 4K3EL 3WBDA 4G6AC 1X6LA 1IGTB 1HZHH 4P5TC 2D31A 4R7DB 2DF3A 1NFDA 4NQDA 5HDBF 4WTZA 2AABH 4YHNA 3MUGA 4MXVE 1NMCB 3X14A 3D6GA 5HHXH 3LKNA 4Z5RB 3FFDB 3GRWA 5FUZL 2XQBL 3FAWA 5J9PA 2IEPA 3QO1A 4LEXH 3VXPA 1VKXA 3ZL4H 1X6NA 4P2OD 2DM2A 1ZT4B 4KQ4H 3EYVB 4NFDA 3T77B 4KUZH 5EC2B 3U83A 3PHQB 4PJDB 5CBAB 3KYOB 3MV7B 4XXDB 3O2VL 2J8UA 5IM7B 4HDIB 4LHUD 4HWNA 4GW1A 2HFGL 5J1AB 5TDPA 3VH8G 4XMLL 4D9LH 5EC1B 1A1MA 5IBLC 1HOCA 2GJ6D 1K8IA 4Y7MA 3REVB 5EBLA 3T1WA 4JKKA 3UJIL 2RFXB 1HKLH 4YPJA 1GPOH 2B2XL 3BZDA 1BBJB 3F8UB 4PD4J 3UJJH 1RIVH 4NQEA 3R8QA 3FRUA 3RDTC 4PG9B 3E1F1 3STZA 4BH7B 1D5ZB 2BK8A 3AFLA 4UUJA 4R26L 5T1MB 1TCRB 1ZGLP 4PJEB 3MC0A 2AJSH 3HFMH 1KCVL 2FO1A 1WAAE 2AK1H 3AU1A 2PCPA 2JJWA 5HI3D 3S9DB 1WWWX 4BFEA 5JR1L 5D1XB 5TF1L 3ARED 3BDBA 5I74B 2YRLA 3C8DA 2FSEB 1HINH 5DRNA 5HSFA 1T2XA 1CF8L 1KN4H 4QRRB 1NC2A 3ILPA 5I6XC 3U9UB 3OKOB 1YEDB 4P2YA 3RWDA 5EUOF 1W8NA 2BNQB 2QTEA 4GSDH 3PWVB 1OTSD 3BP4B 2VDRH 3DJ9A 5LWYL 3RKPA 4EI5D 4NDMB 3KPRD 3W11C 4AIZA 2OS7A 3QUYB 4RMWA 4HT1L 4HUWA 2AQ1A 3P9MB 1R3KA 3K2MC 4KHXL 43CAB 3AROA 2R56H 5E08H 3LIZL 1ACYH 4JRWA 4QTHB 4UZGA 2COQA 5DLMH 2X4TB 4XVUC 5J11C 1IILE 2XTJC 1UXSA 3O6LL 2OZ4A 4D0CB 1M6OB 3FFCA 4HUVA 1JZ4A 1SY6A 1A64A 2AXJA 4G8GE 5KS9B 1Z6JT 3NPSB 4RISH 1N4XL 5FOBA 2ZUXA 1EHLL 5MERA 4U1LA 3GEWB 3F12B 3MRLA 1B0WA 3K8LA 3G5ZA 4YO0B 1WICA 5IESL 2EXYD 3CDGA 3CZJA 3V8OA 4MJ6B 1DQML 4ELKB 2QEJA 4KI5C 4WW1A 1UFUA 5F1SA 5C92A 2XN9D 3QDHA 1V7MH 5F7DA 2Q7YA 2Z4QB 4P99A 4N1CA 5CGTA 1FFPA 5IB5B 1JUFA 4Y2DC 2R2CA 5DFVC 4OFIA 3MLWL 3EDEA 3GKZA 2ED7A 4PTUB 1OTUC 2OX5A 1PKOA 1WWAX 4NNYB 3PIQB 2DBLL 2PXYA 5IMMA 1MCEA 5D5MA 1MCWW 1JGEB 3FQNB 3WUWA 4P23B 4C58B 1UB6A 1YUHA 5EPMB 1H8SA 3S4SG 1RURH 4DGIH 5E8EA 5F3HB 3FO9B 3T8XB 1YC7A 2WZPD 3DWTA 4JFPB 3P4MA 4TQEH 3JWOH 3CK0H 4HIIA 5FHBL 5JLZB 3LMJL 5I17B 2GSIA 5I18L 4OLWH 3MRJB 1DBJH 1I9RL 5GGTA 1D9KD 4M7KH 3RU8L 1HH9B 1TCMA 1CTNA 4XNMA 2CRYA 2D31B 2IH1B 3MRBB 4JDTH 4JO2L 5KTEH 1YJDH 5L0QB 2YA2A 1XCQB 1WFTA 4NQCE 2A83B 3DXAE 4WRLA 2G9HB 4M1DL 3B8SA 2AJVL 5IF0B 1GGCL 3QG6B 3BP5B 5CHNA 5CKGA 2AK4A 4NKDB 4AT6A 3DMMB 4X99B 4XX1E 4D9RE 5L2KA 1U3HB 3FKUS 5FDWA 5F3BB 4G42A 3RTQD 5F7FA 1JF1B 2QR0B 3QULB 3VFOB 1HOCB 1S9WA 3GMRB 3P11L 5DJCB 1R6VA 1S7WA 4LRNH 5GJTH 2BRRH 4PRDA 1U8IB 4KKAC 4OZHB 1BFTA 3B9AA 4N90D 1GGYA 4N8VG 2UZIL 1NGPL 4PJ5A 1KENH 3BZ4A 4XNYH 5FXCH 1YNLL 3G6DH 3GIVA 3ULVE 5IVZA 1F3JB 3BP7A 1QSED 3W9EA 5D1QA 1XGYH 4N9GA 5ESAA 2PTTB 4UIMB 5DEFA 4HZLB 5E8PA 3DX6B 4LCWA 1EHAA 2HVKA 4RGNC 3HE6B 2AXGA 2X7LA 2MHAB 1QD0A 3DVNB 1ADQH 3L9RA 1NGQL 1A6UL 2EECA 3S7GA 1JRHI 3CLFH 3LHPH 2MKLC 4MNGE 3MLUL 3VFNB 2VL5A 4LPYA 4Y0GA 3KXFA 3NFSL 4UIKH 3B9VA 2QSCH 3OX8A 4WDIB 1GHFL 2X1QA 1BJ1J 3HC3L 4DZBA 1E4JA 5C0AD 3C8HA 4FQLH 1TZHA 1XF4B 1UEMA 1G9ML 3QQ9D 1JZ3A 1D9KB 2BMKB 4GKZA 3P9MA 1I75A 2OCFD 4Z95H 1EBPA 5DD5H 1S7TB 3VGAC 1FYHB 4ZYKB 1GVIA 1EFXA 1AHWB 2OL3H 4DN3L 4NWTH 1U8MB 4GG6E 5J13B 2IPUK 3JWOL 4HCRH 3S5LA 4WHCA 4M62H 1Z9LA 2YOCA 4YHOH 1IZJA 1HEZB 3O6KL 3BAEH 4HK0B 5KJRL 3K8MA 1EA9C 4ESKA 4HSQA 3BKCH 4E41B 5GZOD 1BQLL 4YDIL 2W92A 3CDCA 3HMXH 1RJLA 1F97A 1S9YB 2ESVB 3EDJA 4JHZA 2YKLH 1DQJB 3M1BB 4XC1H 4CBPA 1CDYA 5HHMB 2J6EA 1HIML 4BKLB 2H8PA 2O26U 3FFCD 3U9PH 1KLUB 1U3JA 1RK1A 4F7PA 3RPIB 1YPZA 3K3QA 1KC5L 4NP4L 4TVPE 1OB1B 2YHGA 4EN3B 3B9EA 4OT1L 3O3BB 3QIWC 2R2BA 1TTUA 5ALCL 2DN7A 3FRUB 2I26N 4PGZA 1OAUL 5T1MA 4IIQA 4QHNA 1LO5B 3C60A 1CDJA 4ONGL 5CGYC 4DQOL 1NGPH 1OAKH 2WWMC 3O2DL 1S5IH 4AQ1B 1FNFA 1GZPB 3SDAB 1KNOB 5I1HH 5I8OH 4OI9A 2NNAB 5D7IE 4OKVA 4WV1A 4KMTL 4XNUH 1AGEB 2EDNA 4JZJC 3UAJC 2IMNA 1JF5A 4HBCL 1RUAL 1A4JB 5KSBA 2V5YA 4JFFD 5TPWH 3NFPB 4KJWC 1ZLVK 5HYJD 2MQCA 3MBXL 5JLZA 3QXWA 1A6UH 4K7PL 3BO8A 3MZGB 4YHIB 1A6AB 4PBVC 4NQTA 2G5RA 2KH2B 1T20A 3W2DH 1YYMH 4ZOAA 5KSBE 4AENA 3G9VA 5LJYH 1H8OA 1LEIA 1R3LA 3KG5A 1MQKH 2A83A 4M03A 4X5LA 4HUVB 4GW5A 2EDLA 5IBTL 1A9BA 5ADPH 2IGFH 1KCUL 1NAKL 2D3VA 3ARGB 1LEKB 2VTFA 4RRPG 2HKHL 4MNQD 4F7TB 4HUXB 4HIHB 1LK2A 3OKNA 3LN5A 3BH9B 5IEHA 3ARFB 3LRHA 2DI8A 1IQWL 1JWSA 5DMIL 3QEGL 5FV2A 1DTUA 4AH2B 3GIZL 3MPCA 3NMEA 1ZV5A 3LKRA 5TQ2H 5GIRB 5A43C 1VFBA 1MJJB 4JY4B 5CWSA 1H3TA 4HMCA 3IVKB 2WNGA 1YYLH 3WNPA 1BZ7B 3DUHA 1Y18B 1IKFL 2IBGA 1YN7B 4PR5B 3RIFK 4HFUL 1EHNA 3CSPA 4Y5YC 4EQ2A 3KPLA 5D9SB 3BFOA 1DBKL 3QHTC 2RAMA 4HGKC 4NGHL 2VNCA 5AG8A 4JFZH 3RIAF 5ICYA 1IFHL 1KELH 4BSWA 4YR6B 4FTVE 3ZE1F 1YEEH 2VZUA 1T2QH 4WGWB 2Y06L 3R0NA 3HAEH 4I0PC 4GG8A 2VABB 5FECB 4GAYA 1MCPL 3LB6C 3QB7C 2FB4H 4LASL 4WFGE 5HDBE 5HI4D 5GS3A 2VITA 1DL7L 5D1QD 3PL6A 5GGUB 1FSKB 4WHYH 4Y16B 5E8EB 5IB1B 3QNZA 1QKZL 2XQBH 5KOVC 3DUUB 2QJDA 4NRZA 2D4DA 4JQIL 1NAMH 4P3CL 5C3TA 2VXQL 4XCFL 4K2UL 5I30H 5C86A 3WIFA 5F6IC 5TQ0L 1R5WB 4X4MA 4WWKB 5FYKL 1KB5L 4G8EA 2FH8A 3MNVB 4GRLC 1JI2A 3ARXA 4Y4HC 1ZHNB 2ORBH 4U0RC 4UV4L 4DKDC 4LCUB 3IGAB 2Y36H 4ZPVB 3C5JB 1JWUB 4EQ3A 1FBIH 2VXSH 2PO6A 3SCMC 1GXEA 2D0HA 1AD0A 5DTFB 1RUMH 4F7CB 5EOQH 5AAMA 1BQHA 1XAUA 3W0WD 5I1EL 1WITA 3KPSD 4QOKE 5L2KD 4JO4L 3QULA 5D1ZD 5C07E 3WIHL 2I5YL 3C6LD 1DQJA 1GOGA 4J3VA 3UTPE 4IRZH 5ESVA 1IL1A 4M93B 1A47A 3CVIL 3ARFD 3I75B 4WO4A 3E6HA 4U1KA 1T3FA 4PRDB 5IHZA 5MI0C 3MRRA 1UWXH 3VGGA 4PJ5B 5I8CB 3O9WC 5FUZH 3D39A 4HW6A 4ODUB 4MXWH 2GFBA 5F6IB 4FFYL 3I3BA 1NFKA 1K5NB 1LDPH 2H1PL 5GGRA 5CJ8A 3VD5A 2PYEB 3AM8A 4PRPA 4A6YB 5F6HI 3TO4B 4PD4K 1QPXA 1B0GB 1GZQB 4K71B 5DEZA 5IHUL 1FN4B 1KNOA 3ZE1E 1K85A 3SE4C 3QBTB 5FA4B 1QFWM 3TZVD 1K2DA 3FAXA 3G6AA 4OKVB 2CJUL 1NDGB 3OSKA 4HFUH 2OI9C 2RCSH 1JPFA 2VZOA 1F4XL 2UUDH 2YSSA 1A4JA 3PDOA 3GI9L 2C7UB 4Y2DD 4FQQA 1EAJA 4JY6B 2WIIB 3ARQA 3RX8A 4HWUA 4P5KA 5H8DA 3PHOB 4HS6A 5JQ6H 3MUZ1 1JMZA 4NUGH 4B7LA 5CGMA 4NFCA 5E8NA 4H26A 4QXGH 2X4RB 5CSGA 4D3CH 1B90A 1QSZA 5K59E 5FYLL 3PGFL 5EU5B 1RSFA 3EOAA 4OBSA 1ZLWH 1FFOB 1LQSR 4ORGB 3V7AG 4CU7A 5IOPA 2HH0H 3D0VB 3V7AE 5I30L 5T3XE 4GRWE 3TYFA 1Q0XL 5K93A 4X7EC 4PJ8B 5EU7E 1I4FA 3OKDB 15C8L 4KTEL 4F7TA 4OAWB 2HA1A 2PNDA 3O45B 3TA3B 4P5TA 4PYHA 5CZXC 2OK0L 2BXYA 2VJXA 1VERA 4PRID 5HHPA 4O9HH 4YZFF 1VHPA 3SGKC 1T5WA 4CADA 2JB6A 3VMPA 1MCSA 1M7DB 4LLDA 4RWHA 4TOYL 2AJ3B 4FZ8H 3MO1B 4NNPH 3O9WD 3QYCA 1NC4A 3K2UH 5CJXC 1FNHA 3STBA 3O3BA 1AGBA 1QRNA 3B2UD 4MXQC 1KULA 3OXRA 4PJHF 3TCLA 2BVYA 1G7QA 4WEMB 1I7TB 5HDOA 4D0BB 4LF3A 2VXVL 3MJGX 4PJ9B 1IAMA 3LQAC 4JKWA 4GRWH 5DVMA 3MBEB 4OZGE 3UC0L 5I66A 4CKVX 2V2WA 4ONFH 2BOCB 1WF5A 1IGCL 1Q9WB 3FB8B 3QI9D 5DUPH 2Z35A 2VITB 5C0CE 4U1HA 4NCC1 1QP1A 4PJAE 5C3LD 2ADIA 5AD0A 2E9IA 3QXDA 2ADFL 2RJMA 4U6XA 1YY9C 3WLBA 2YD6A 2NY0C 1IARB 3MODH 1IM9B 2MCPH 4GUPB 2E8YA 1TVHB 5E9DB 3LOWA 2L4OA 2HJKB 3MGAA 2QLVB 5GRUH 1MCHA 5INCB 3MNVA 4B5EA 3HUJE 1CGUA 3F7RA 2LU4A 1YEGH 3H9SD 4ZNCD 1PG7H 3AB0B 1W72L 1LHZA 5L7XL 1I7RA 4YDVB 1JPTH 3BXNB 2I9TB 3LB6D 1YQVL 5L9DL 4KV5F 4F9LC 1PKQE 5KVDL 4EBQL 3QCTH 2PW2A 5EC2A 3RY4A 3ARGA 3B83A 2Y72A 3KPRA 1XR8B 1XGRA 5E6ID 5HYSG 3ULUF 3RVVD 5CINL 3VE0B 4FQXC 5J1AA 2UVFA 2YXFA 4M5ZH 3CMGA 4ELME 6FABL 5EO9A 3K4AA 4I77L 4PRIB 4KY1H 4TULL 4CVUA 5I16B 4PP2B 1A7RL 4U1SA 4POYA 5LQBL 1ES0B 4E0RA 4DCQB 5FAAA 4S1SL 5BOPA 4M61B 3G6JA 2C1OA 3DETD 3FO2B 4QY8B 1E4KC 1N7MH 4LCCA 3O6FA 4KROC 5C1MB 5HYQA 4ZQKA 3V5HA 1YC8A 3H8NA 5D2NB 3IJYB 4M1CC 4R96B 4X9GA 4GRMA 5E94B 5D1XC 4P4KA 4R7DA 4NSKB 2D03L 5C0JB 2VXVH 1KYOJ 3UXFA 2FJGA 2F5AH 1NH6A 2YSSB 3KLDA 2P8LB 4X7DC 4Y16A 3RWDB 1BVLB 2DMBA 2HTKD 4WW2A 4ZFGL 3U6RB 1MCNA 4QCIA 3F62A 3D87B 4OBRA 5IJKA 2AEIT 1LGVA 2BNRE 4JM4L 1FNEB 4RAUA 3LDBC 2E7BA 2HT2D 5BCAA 2B4CL 1U8JB 4G6FB 4MAYC 4S2SB 2AJUL 4GAGL 1JPSL 5E9DD 4UB0L 5ECJE 2YKLL 3EOAB 4XC1L 1K8IB 1S7UA 4PRHE 3RQ3A 5C6TH 3VG9B 1QHOA 5BJTB 4TPRH 3GO1H 1TDQA 3NVQA 5C0IA 4PJ7F 2X4UB 3DX7B 4KHTL 5E6YA 5F9JA 2CGRH 2DQJH 2QSCL 5TDNA 1A14H 1MJUL 1ZT4A 4PLKD 5AYUL 3LCYA 1XZ0B 4FXGA 2Q76A 5SWQA 4S11A 1YEGL 3OBAA 2NQCA 1P9MA 1KCSL 2VLLB 4K8RH 4DN4H 5A16A 4XBPA 4YIQA 3IU3B 2ILLA 2R9HD 2D2OA 1G7IB 1NCBH 3C6LA 1FAKT 4OCSL 4LDEB 5I8EA 1NC4B 1UKTA 2EKSB 4NQCB 4JLRB 5JORA 3F58H 3C60C 1CR9H 4R2GD 3UTSA 2DB8A 3P4NB 3E8UL 2W65B 1D6VL 5FYJE 4KY1L 2R9HC 5AZEL 2XXMB 3MJ6A 2W0FA 1A7RH 4NC1C 4JPVL 2X4NA