3FB6A

Kcsa potassium channel in the partially open state with 16 a opening at t112
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
publication title KcsA Potassium channel in the partially open state with 16 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6A02
1R3JA 2J88L 2VZ1A 1EZVX 2XRAL 4XMLH 1NCUA 2W0LA 3RVXC 5H35A 1BD2D 3DBXA 4ZFZB 3LV3B 4QEGA 3CUPA 2Q20A 3IFLL 4HS8H 3IU3A 1FNAA 3IDUA 4H8WL 3QPXH 1ZLVH 4FQJH 3RY4A 3LZFL 5D6CA 4X4MA 1MHCA 1J7VR 1XF1A 4UBDD 3FQTB 1ITBB 1MCOL 1QRNA 2XQBL 1JFQH 1QVOA 1MFBH 1V8HA 1DZBA 5I74C 1OHQA 5C0IA 2C5DC 1T1YB 2E9WA 4L3EB 3B5GA 4PJIF 3IXAB 3QIBD 4HJ0C 3P9MA 4KJPC 4X6CA 1KENL 2GT9A 1YN6B 3OJDB 2BXZA 4FQHA 4LCIH 4WU7B 3MXWH 3R8QA 1UB5A 3G6JE 1OAXH 3EO9L 3PGFL 4PG9B 1MIMH 3LDBC 1T1ZA 2Z4QA 1GGCL 3KPSB 3SOBL 4UAOC 4F7CA 3VXUA 2HH0H 1DQQB 1L4IA 1SHMA 1XF5B 1XFPA 5HJ3B 3SCMD 4HHAB 3O41A 4PRDB 4TPRL 3LEVH 3VI4E 5F9OH 4DEPC 4XC1L 4BZ1H 5IB5A 3X17A 2CKBH 5DVNA 1HHHA 5C0BE 1UACH 4CVXA 2VXQL 2E27L 2UZIL 3KLSA 1MVUA 4JZJB 5GISL 1C08B 4UT9L 1A8JH 2FWOB 1A1OB 1TQBB 2YN5A 3RKDC 1TZHB 1DCLA 1NCAH 3SE8H 2QSCH 5E5RB 4IMLB 4GG6A 5CAYB 3OKMA 25C8L 1OLZA 5B22A 2BVPA 5SWSA 1WCBA 2UYLA 2EH8H 2F9BT 2RIKA 4O58L 2Z91B 2W59A 1WBYB 3JWDL 5I1EL 1JE6A 3HC3H 3R0MA 3RGVD 1RZ8A 5DQDL 4ZFGL 3IVKA 4LGRB 1ZGLP 4X6FA 1JGDA 3TJHC 4FTVA 1CTNA 1A6TB 5IMOA 5ENWB 2P46B 3RNKB 5KOMC 3QUML 5ESAA 3MFFB 3NVQA 5KS9F 3L6FA 3BT2L 2VC2L 1CF8H 1H3TA 4NYLA 4PP1D 1R3IL 5HDQL 3BPNC 3WXVH 4YFDB 2X4QA 4EI5B 3WFDL 4KRPC 4NQED 2YPVH 4OF6A 4YBHA 2XWJB 5IKCA 4WHYH 3PHQB 5IK3B 3JWOH 3WFZA 3BIKA 4YDIH 3C5ZB 4NQCE 1DBBL 1EO7A 3EGSA 5TDNB 5JDJA 2EYSB 1VEMA 3GMQA 1SM3H 1U8NA 3ESUF 4LHUB 4LSQH 5IVXE 4FN0A 4JGMA 3V6ZB 1F00I 4PJBE 4CJ0A 1U3ZA 1EPFA 1JUFA 3G04B 4FABL 2I9TA 5GGQH 3WD5H 5HYJE 3BIBX 3G6JA 3CFBA 4JFYA 5GSVB 1A3LH 1T4KB 3WUWB 1NFDF 2F19L 3O8XB 3CZFA 2NW2A 3MLTA 4OBSA 4JO2H 3TYGH 3MV7E 1N3NB 5D93C 1TNMA 4FQXD 2B0SL 2HJKA 4HKZA 5C0BA 5JO5A 1NFIA 2HG5B 4Y4FA 4K7PY 2X4NA 1IGFH 3C5JA 3MLXH 1JHLL 2G5BB 1OSPL 2PF6A 4K7FB 4YZFF 2NXZD 3TBVA 4U1JA 2EDLA 4JANA 3U2SB 3GDBA 1RIVL 4KXZH 1AGEB 3PWLB 4X8JA 2EE6A 4S11A 5C0DB 3HI5H 3T4YB 4J3TA 5GRWA 3SE3A 3C6LB 5D8JL 1YPZF 4F8TA 1MREL 2AK4E 1DBKH 2X05A 1KPUB 3ZMRA 1HHGA 1YEHL 2CMRH 4DCQA 3F62A 5J12B 3NCMA 2VERN 4M02A 3JV5A 1A2YA 1R3HB 2NXYB 1T66C 2PW1A 2NZ9D 1BX2A 1OGAE 4C56D 3MACH 4D0CA 1C16A 1W0VB 3D0LB 4ODWA 3DO7B 5KSVA 3ULUL 4P4KD 3QQ9C 3SDDB 3LIZL 4JRYE 5B3NA 4J4PD 2ZOLB 3DSFL 5IF0A 5ANMB 3NN8B 3F7RA 4HJGA 1FFOB 1CFTA 3P11H 3QHZH 5CEXA 4JHBA 5IVXB 2GUOB 3PWVB 4K3JL 5EULV 4LAJH 3U46A 3MRKB 5F96H 3T2PA 4IEFB 3L3DB 3NGBB 4M62H 4M7LL 1BF2A 4F9LA 2WSKA 4NN7B 3ARGB 5EUOF 1HSBA 2V17L 3HC0A 4NQCA 4DN3H 4LRIC 3HE7D 1CI5A 5J1AB 2BNRE 4KRMB 5C70A 5KJRH 4JHWL 1YEFH 2HKHL 3NAAL 4S2SB 2BOBB 4NC2B 4PJBA 4WV1A 1UCBL 1LEIB 4O2EB 3SDYL 5EORH 2E7MA 2YMXH 3MREB 4G5ZH 4S0TD 2I26N 4YJZL 2YPLD 4XPGH 1MLCA 4S1QL 5DRNB 2YA0A 5HYJA 3TV3H 3S96A 4NT6B 1IAOA 4CL7A 4LFHD 1OAZH 1QSZA 3UROR 5GPRA 4M5YL 3B6SA 4K3EL 2ADFH 1DE4A 4MVBD 4UMGA 4YDLC 3MV7A 5DD5L 1AD9A 1CDCA 1G9NC 2XWTB 1AHWC 1IZJA 4M6MH 4KKAD 2G9HA 1E27B 1R3KB 1EFXB 4PJ8C 4GKZA 3RX5A 3MRFB 5B8CC 1NCBL 2AJUL 1REIA 3MRQA 4QHKI 4LCWB 1DN0A 1MCBA 2ZCKH 3ULSB 4LLVA 5T3ZH 5JNYA 4WFEE 1XGYH 1PKOA 4MJID 3MR9A 5E8NA 1A9BB 2O5YL 1I7UA 4Z18A 1NMAL 2FJGB 3KPRA 4GRLC 4OZFG 3TVMA 4OD3H 4JZNB 2AS5M 5D7LB 2NLJB 5D2LB 2ADIA 2P8LB 2AK4A 3DMMA 2AJXH 4PTTB 5E95B 2IANB 1OY3B 1IC7L 5F1IA 3NOIA 2HJFA 2APXA 5FV1L 3KYMA 1PKQE 1ZS8B 2AXFA 5GGVY 1FNEA 3PV6B 3H6JA 3BXNB 2YSSB 1OGAA 4G8GB 4A2MA 1X5XA 5IOPB 4OCSL 1LK2B 1CIDA 3QFJE 3GSNA 4NQDD 5E94B 3QO0A 4JRYA 4E5XB 2XNAB 4P46C 4FMFA 3TGXA 5GRZA 1P7QA 5ALCH 3DRQB 3EO1B 1GOGA 1HN1A 5BV7B 4MLSA 1M6OA 2QSVA 3QG7L 5DMIL 3G6DL 5E2WL 1DUZB 1QYGL 5LXGH 3CVHB 3DROB 5DJ6A 2YR3A 5EU3A 5B38G 1BD2E 4LQ1A 3QHTC 4GUPB 3RVTD 2R0KL 4LPWA 35C8H 4FFWD 3EOAA 3IDMB 4OCXH 2BNRA 5CWSA 4GG6F 4JJ5A 2EIZA 2V2TB 5D5MB 4FFVD 3SDXA 3C8HA 1QD0A 2Y36L 2VTFA 1B2WL 3MJ7A 4YBQD 1DQJB 4DZBA 1IQWL 3JV6B 3AU1B 3Q3GA 3QWRD 1RMFH 4YDKL 3WMSA 3VFGL 4APQD 1UJ3B 4I0PB 3K1DA 5JPMB 2RAMA 4NO0B 3HPLA 5JOPD 4GW4B 3UBXI 5C0FB 5IIEA 3UBXB 3GIZH 3V6OC 3ZE2F 5D70H 4QRRB 3ARDA 3PP4L 1BJMA 2AQ3A 3KJ4C 4I18A 3ZKMC 1MWAH 3AGVA 5FXCH 4G7VH 1ZT7A 1S9KC 1NAKL 3HAEB 2V5YA 3GMRB 4NWUL 4NQSA 1I3GH 3RWGA 4J12A 2YPKB 4DUWA 3PUCA 3K3QA 2EDBA 3REWB 3FOLA 1NGWA 4PJGE 3SO3C 2I5YL 2DTML 3OAUH 4F15C 3KNBB 5DJDB 3UEZA 2MKLC 3L3JA 1OP5H 5ADOH 5J11C 4OGAC 2AJZB 4NWTH 3QQ4A 3ZHDA 5HGHB 5E7BA 3WNKA 2XXMB 1FGNL 1FFRA 4Y5VB 3RDTA 3BQUC 1QSED 3AMLA 1PKQA 2RJMA 3HB3D 1KLGA 3QAZB 2CXKA 3T1FB 4TTGA 5FCUL 5SWQB 4NZTL 5DURD 5HVFB 3QFJA 1I85C 1UENA 4NNXB 3UDWC 4ZOEA 2NNAB 1JNNL 3G6JF 1LE5A 1QBML 5DFWH 2Z0BA 3MV01 4EVNA 3PIQB 3BP7A 2PXYD 3P77B 3VI4F 2F53E 1GGBH 4LIQL 2NY0B 2JELH 2F8VA 5ERWA 4POUB 3P4OA 2B4CL 5A2LH 1TVHA 1XGPA 4YBLC 1BD2A 3HA0A 1S7WA 1DDHB 1KLUA 4NQEE 1Q1JH 3QIBB 1R5VB 4Q6YA 4Z5RB 3H3KA 1CFSA 5F6HJ 4NPYB 3U7WL 4IHOB 2GAZA 4JM2D 1F2XK 4IRSA 4OF8A 5FKPA 3UXFA 5DJYA 3DVGA 2C3XA 4BQBA 2A6JB 2CUMA 4IOIA 3F5WB 5E56A 1NSNL 1PBYA 3GBLA 1DVFC 1ORSA 2E6QA 3BKCL 3SCMB 2GCYB 2YD2A 3RRQA 3A6CH 4E42B 3FZUC 5BVPL 5TH2B 5I8KH 2ICEA 4KJQD 3O11A 3MC0A 2GITA 2FJHB 1LDPL 4RRPG 4RMRA 4YQXH 1SEQH 1VGEH 3D9AH 3EOTL 1E4KC 4UOJA 3T4AA 5MEPB 2BXYA 4TVSa 4XAWH 4ZTPL 1L0QA 4R26L 1OCWL 3FN9A 5KVFH 4LHUG 5FYLL 3IKCB 4YR6A 4GXUM 1EK3A 2YBRB 3VH8B 1NCWL 5JXAL 3ILQC 4PJGA 4Y5XC 5HDOA 4NN5B 1T83A 4HDIA 5E8OA 1GXEA 5DWUL 5D1ZC 3GMOB 1JZ7A 1U8IA 5DYOA 2VLJB 3RGVB 3VFOB 4PRAA 1C5BH 5EZJA 1P1ZB 2E7BA 4G9FE 4OLXL 1NUNB 2NY1C 2R69L 3DIFA 3D1MC 1ACYL 3ARUA 4YK4B 1QQDA 5IVXF 4HJJH 3L3OB 4PJBF 2P24B 4UV4H 3RVWD 2AK1L 5EU7C 3SE9L 3THMH 3DNKA 1BFVL 2J6EA 3H8NA 5HPOA 1YC8A 1ZT1B 1FC1A 3MRGA 4XMLL 3V0WH 5BZWB 4WHTA 2NTFA 4ZUWB 2OQJA 1TQCC 4P5MB 4C58B 3AROA 4YX2H 4C56E 3RWCB 4YAQB 2F8XC 4G6KH 2BX5A 4ZUUA 2F53A 4MA1C 2P1YA 4M6AA 3VXQB 5KVGH 2OP4H 1YNTB 3DTXB 1LO0H 4UV7L 2APFA 1B9ZA 2P42B 1KCUH 1MFBL 4OF3A 1FCGA 2DLIA 5EZOL 4NQEA 5INDA 4EXKA 3U30B 5IMKB 4YPGA 5TJWK 5IW6B 2JIXB 4KROC 4CKVX 1MCWW 2RQ8A 1G84A 3KLAA 4V1DB 2Q7YB 2C1OA 4LOUD 1P9MA 1JPSH 3CSPA 2IH1A 2A9ML 1T04A 5DMYA 3RZWA 3MGTB 3ARXA 4OZ4A 1U9KA 3LEVL 5A3IC 2XTJC 4PTUB 5F9OL 1FDLL 3LS5L 4FP8L 4P4RA 1INDH 2YPLE 1OPGH 1UACL 4M1GH 3CFDA 2NXZB 3FQRB 3K4DA 5HHMB 4GT7A 1D5XB 1G9EA 5FUOL 1CE1H 2AJYL 4FQLH 2ADJB 3CNKA 3BMVA 5J3HD 1X5KA 2VDOL 4NHUB 5H2BA 4HGWA 4LU5H 3SE8L 2XKSA 4FQXA 4F80A 3V6BR 3BWUC 2QSCL 4LASH 4WWKB 2VSCA 3WL9B 4FQIL 1DQMH 1B3JA 2ZUYA 4FOMA 4X0KB 1CT8A 3NH7H 4MAUL 1FIGL 1ZLUH 2OJEA 1XGQA 2DQFB 4G9FA 5HGAB 4ODXA 4MJIE 2VITB 1FAIL 1K4CB 1VACA 4P4KB 1Q0XH 2R0ZH 1VFAB 3MQIA 4GRWE 3FB5A 1KG0B 4AJ0A 1E4WH 3W5NA 3X3GH 3RWHA 2PO6A 1RURL 2VDNH 3VRJA 2HKFL 4IOFD 1I8LA 3S36H 1FN4A 5IHUH 5IV2A 3OAZH 4PRPE 2X7LB 5FGBA 3P0YH 2L7UA 3ARRA 5C09D 4AY0A 5JXED 5L2KD 5DHYB 4C56A 5SX5K 1V7ML 5F72S 4F58L 4NQDE 4D9RD 1BMGA 1QNZL 5D5MF 1MCJA 3REVB 3R06A 3QRGH 3VE0A 5GGRB 2VAAB 5DI8B 3P30H 5TFSL 3PGCA 4TN9A 4NKMB 1NEZB 2H45A 5I75B 2VDKH 2PNDA 1LP9E 5H8DA 3HG1A 1Q94A 3CSBA 3FONA 2X4OA 2IBBA 1QZ1A 5D1QC 1B0RA 4NRZB 5LGKA 1HDMB 2WMPA 4MHHG 4F33B 3HE7A 1X6LA 1RJYB 1MFAL 2H9GA 5BXFB 3MLVH 1JMZA 3OZ9L 5EO1B 1JNJA 2CLRB 1O0VA 3QNYB 1EV2E 2AV7B 2NY2C 3ZTNL 1I7ZB 1NC2A 3NCEB 4AIZB 5IMLA 4F7TA 2OZ4A 2XZCL 1AQKL 2OZ4L 3RVXD 3C6SB 2YPLA 3H9YA 5B39A 2EE9A 1JWUA 5B21A 3U0WL 5H37G 4CU7A 1ZLSL 2FLBT 3B8YA 5IEHA 4OQ1A 3V8CA 3QDJD 2ZPKL 3DGCR 2VZ3A 3NCCB 4Y88A 1NAMA 1KJ2A 1AC6A 5L8JB 4GKSA 1OT1A 5F7DB 3SKOA 4P3WA 5JOPE 5ABDE 3VCLA 2IH3A 1QBAA 3GGWB 2GHWB 3BO8B 4X5LA 5KBNC 3VFWB 4KHTH 2QADD 4ZQKB 5ECJE 3HI5L 1LWRA 4EDXA 1EO5A 3AXLB 4YFEA 3MZTA 4HJ0D 4L29B 1IKFH 5FHBL 5DD0H 2PUQT 3RNQB 1UXSA 1BWWA 4JPKH 1KJ3L 1KEMH 4G8IA 3KGRA 2I07B 4MJIA 5C0EA 4YDVA 5IWLA 4KTYA 4KMTH 4PBXA 2XA8H 3UBXG 4FQQB 5EBMB 4NQDB 3X3FH 5FM8A 2KUTA 3OPZH 3W81A 2H41A 3U1SL 3MACL 5CGMA 4HV8B 4GBXB 1SJHB 1ZV5A 3HAEG 2WZPD 3LHPH 1P84K 3SKMA 1MHEA 2CDGB 1V3JA 1RVFL 5H94B 1LP9B 4PRPA 4PJFE 4AH2B 4R8WH 1WEJH 4ONHB 2ICWJ 3GIVA 3MCKB 1U3HA 3IFOB 4TUOB 1RK0B 3ZL4H 4RCAA 2DLGA 4EBQH 3QCVL 2APTA 3GSNH 4G7YH 3V4VL 2JJTC 3AM8C 3TO4A 1RUPL 4BQ8A 3HUJB 4ZXBC 2EXWC 2H3NB 4UILH 4X4YA 1T0MA 2N4IA 4PGBA 4PJGF 5EUKB 4RGOH 5T3XD 4ZFFB 2YMXL 1IGML 5F7FA 4ZUTB 2BOCA 1OAYH 1OSZA 2V2XA 1E28A 3L7FA 2VJXA 4L8BA 1EJOL 1UB6A 4G6JH 4JHAH 4Y16C 3BW9B 3LRGA 2MTPA 1M7DB 4QT5A 4NHCL 5GRVL 4H26B 3CC5B 3O3EB 2ADFL 4G6AD 5HPMB 1ZSDB 3IF1B 4U1IB 4P0DA 2X4RB 3OKDB 4KRPD 4DN4H 15C8H 1JK8A 3QWRA 4P99A 2BK8A 1DTUA 3ARBC 2HFEB 2ZJSL 4PREA 4XNZB 1HNFA 4APQA 5D7JC 1KJVB 1EHNA 4BSWA 5DJXA 4EN3C 1M05A 4IIQA 4C4KT 5E8EA 1XGYL 2LTQB 3CXHK 4AM0B 3QNXB 3BEWA 4NZUL 4OD3L 4UDTB 5DJZB 5BQ7A 2XZQH 3FO0L 3TZVA 1S3KH 1QSEB 4DW2H 1A6WH 5J6HB 4P2RB 3WFHB 3WSQL 4YIQB 3FTGB 5DK0B 2VE6A 1FFQA 4LQFH 1RAMA 1UCTA 5DURB 1R0AL 2A83A 4YDJA 3HZVB 5FGCE 5FOJA 4G43B 2DQHH 1FFNA 2AJVL 3MUGB 5EO9A 5I71B 4XPTL 1S7UB 2PYFA 2I27N 3IDXL 4LLYA 3VH8G 4OFDA 3QUXA 5KAQG 5L6YL 4MNGE 2ZCLH 5FM5M 2ARJA 2CLVB 4PGCA 2C4FT 2ZUXA 3O6MH 4PJFA 1LE9B 3O2VL 3BAEL 4KRNA 5HI5C 4HIHB 4L8SB 1G1CA 4S1RL 3S98A 5F88A 3BX7C 1CG9A 4WEUD 1EJ6A 3PWPD 2VZVA 2R4SH 2MOVA 4C57C 2W65B 3MRIB 1A14H 4POZD 4Z95H 3TT1L 1BBDH 1H5BA 5CFHA 3ZE1F 3QR2A 4CGTA 4OCXL 3F12A 3U9UA 5C0RL 3OL2A 4ZS7H 4PV8B 4C55A 2B20A 3RAJH 2UUDK 3EFFB 4I3SH 3KLHD 1YY8B 5D6DA 4D0BB 4MQ7A 3CZJA 2BNUA 3SJVB 1FORH 1MELA 4HWBA 4HWBL 1TPXB 2CR6A 3L5XH 1BZ9A 4JM2A 4Z78B 2PR4H 4M61B 3ARYA 4IMKC 1RJCA 4M03A 2ZUTA 4XBGA 4XP5H 2VLRD 2PKDA 4U6TA 2ZOKB 3CFEA 3IDIA 3MRPA 5J89A 3GIZL 3VG9C 1QO3B 2HFGH 4EZMA 4F7MA 4MNHA 4XCFL 4P9HL 5EFIB 2GKIA 3I6GB 4U1KB 4G6MH 2A6DB 1CBVL 3WIIL 2EH7L 2FSEB 4L9LB 4Y5YB 1I3GL 3CMOL 1CD0A 2WANA 3CMGA 5BZDB 3MLYH 5I1GH 3MPCA 2ERJB 3BKMH 2CRZA 4A6YL 3Q1SL 1ODAA 4ISVA 4DAGL 5ADOL 1ND0B 3ARFB 4OFVA 4AQOA 5MEOA 3BEVA 1UADC 3VGFA 5E4EB 4LAQH 2BSTA 1J1OH 4MSWB 2V7NB 2HLAA 1YMMD 2GQHA 1T7VA 2R29L 2WWKO 1IT9L 2N7AA 4IJ3C 5GGUB 5BRZE 3CFJB 4UUJB 3I3BA 1YEKH 4YNYB 4LKXB 5KVEL 1T7WA 5BW7A 3HRPA 4XNUH 3QI9A 1XGUA 3DX6A 3DVNB 4KJYB 4NN6B 4I5BB 4QCIA 2ZWLT 5IQ7L 12E8L 2W91A 4MNGA 4HBQA 3KYOA 3HNTL 3MOAL 4WW2B 4R0LA 4XI5C 3TA3C 3GBNL 2H8PA 2HTLC 1K4DA 2DJSA 4BH7A 3O4OC 4PJEE 5ETUB 2V7HA 2J6EH 1ES0B 3F7VB 1E6OH 1HHJB 3EKCA 3CH8A 3I75A 5JOEA 5C09E 4GRLD 2XOTA 5L2KE 5IFJA 1RFDL 1ZHKB 4O00A 3B43A 3BI9X 4ORZC 3FO2B 1IILE 3VXTB 4D9RE 4ZFOB 5B38A 2NZIA 4X9FA 3V0VA 2X70B 4WFFD 4R7DB 3UX9B 4PJHE 4LRNL 2OR9L 3RWDA 3DURA 2Q6WB 1X4YA 2VLLA 4Z7WB 5C6PB 2VZUA 4I1NB 1GPOH 1OARL 2AXGB 4CNIB 4ORGA 3SDAB 3FCTB 5D7KD 2CRIA 3HZYB 4KVCL 4RQQA 2VNCA 1VGEL 4P46D 1HSAB 5ELIA 4OGZA 1CL7I 4GRWF 5K9JH 5B4MD 2Z8WC 1NEZG 1NGYB 4Y2DC 2QSTA 4HS6B 4LLAA 5DEFA 5KVFL 1WF5A 3CVIH 4AEHH 2VIRA 1TZIA 3RHWK 5HHPB 3W82A 4B7IA 1C5CL 1FRGH 2ZNXA 2XWBB 3QCTH 4NGHL 4ZPVB 3F58L 2FATH 1N7MH 3JWOC 4D8PB 3QDGE 3B2VH 4YGAB 3WLWC 3D18B 2D03L 3QDJE 3FB8B 5CBEB 2VZTA 5TE4H 3JSSA 2F74B 3OJDA 5KSBE 4F8QA 2DQCL 3KXFE 4Z76B 3O3DB 1C5BL 2B2XL 3QIUA 4JKLA 4KZDH 1A6UL 4Z0XA 1RUML 4CBPA 3QUZD 1LP9F 4P57A 5BRZA 3IKKA 4QXUL 3AFLA 1CFVL 4XAKE 5JDSA 3C60D 5HTSA 3IJSA 1F4XL 3O6KH 1KPRB 5F3BB 3D48R 2RB8A 1Z2KA 3H42H 2Z35B 4JZJA 1NBQA 2Q1EA 3FO1B 3ZKXB 4G80A 4Z7UB 1CR9H 4XWGH 3DX8B 5EA0L 3ZKMD 2FWOA 4L1HA 3RI5F 4IRJB 2AJSL 4XMKH 2DTSA 1X4ZA 3S36X 4OSUH 3HUJF 4LKCB 5FB8A 1MCIA 4LVOB 1U8HA 2NX5D 5D2NC 4DTGH 3E3QE 2FZ3A 4PJEA 4V2BA 1WISA 1JWMB 4OGXL 5C09A 5JXEA 3UPAA 5C2BH 3TN0D 2Y4SA 1X7QB 2Y6SC 4W70A 4I13B 1S9VA 3T04D 3BQUD 2AKRB 4UI2A 2P49B 1XCQB 3LN4B 3O6LL 3OG6B 1W72B 4MAYA 4PJHA 1NKOA 4KKBC 2Y5TA 4Q2ZA 3OX8A 2DJ4A 3BWAA 3HC4L 3N1GC 5EU6E 3VFTA 4NCC2 1XH3A 3QP3A 4ZUVB 3OR7B 4IS6A 5AYQA 3OHXA 5E7FA 1P4BH 3ZKQD 4JQVC 4OTXH 1J86A 5IB2B 1BLNB 4RMVA 4Y7MA 4UT6H 4JN2B 5F6IC 5SWZD 3EZ8A 3NFSH 4OLVL 1INDL 4OQTH 1OPGL 1QFWM 3WKMH 1JNHB 4YHML 2IG2L 3AS1A 2DM3A 2MWCA 4RRPA 2Y9RT 5AG8A 4NC0B 4U2YA 4NO3A 4FQLL 3OGCA 4YGVB 5I74B 2KPNA 1PEWA 2XFXA 1QOKA 4G3YL 1CGSL 1P4IL 5GGVH 1IEAA 3B9AA 5FA4B 5HVHC 3VWJA 1F3RB 3V6ZA 5AAWA 3BKYL 4FFZH 4XNXL 2DLTA 4YXLL 4HUWA 1CLOH 3QDGA 4Z77B 3QDJA 4NCC1 5KSBA 5AUMB 1BVLA 2AEQH 3FHQA 1WWBX 3IFPA 3KXFA 3LDBB 4O02L 5IESH 4UAOB 1NAMH 1KJ2H 3MO1B 1JBJA 3VGEA 4PGEB 1XGTB 5EO0B 4DEPB 1VFBB 4LSVH 5EZLB 4ERSL 3LEYL 3FRPA 43C9A 2GJZB 4UQ3A 2Z31C 1E4WL 3X3GL 3PJSA 5IB3A 1NDMB 3TNMB 3O2WH 5IHUL 1QFUL 3VFVA 1EHLL 5IQ9B 4H5SA 1HHKA 4LVNC 4JM2F 5L8LB 4M1DH 2VXUH 4XC3H 2OR8A 3KPNB 3MA9L 1JGEB 1O7VA 1BFOA 4X80H 1HXMB 3MRCB 3A67H 2FDBP 3MJ9L 4U6XB 5I1IH 1QFWH 5IW3A 3ILQD 4Q6IA 4GRWH 1FO0A 1P4LA 4ZMAT 4WTZG 3ABZA 2DM4A 3U9PH 1MI5B 4Q58C 4OLZH 4BZYA 2P5EB 5HHOB 3S37H 3CLFL 4PJ5D 1NCDH 2APWA 1KPUA 1J1PL 5DJAB 3RL2A 3CH1A 3RWJB 3UTQA 4U1MB 5F3HB 2NY1D 9CGTA 1UGNA 1HHIB 1R3HA 1SYSB 4NNPH 3IDGB 2VQ1B 3HS0A 3MJ8A 1YJDL 3BGMA 4QXWA 5DD6B 5EU6A 5F1KC 4UT7H 3ULVE 3BPNB 4OJFH 3CX5J 3IDYC 1UQSA 4GKNB 1FE8L 1MQ8A 1S5HA 3CCHA 4KRPB 4NQXB 1DBJL 2JCCE 1KC5H 5JUEL 4HT1H 3HMXA 5I1KL 3O3BA 3RIAK 4GSDL 5CBAB 2NTSP 1JRHI 1U93A 3P0VL 1IBGH 3EYFA 1FPTH 2NY5L 1U3YA 2YD5A 5EZIL 1NBVH 4CDHA 2XPGB 3VD3A 4N0FB 2QV2A 1ZHNA 5F44A 5IVOA 4R90H 2WUCH 1M71A 5J1AA 1R3LB 3CPLB 2VISA 4LNRA 4RFEB 4B53A 5L7XH 2EKSB 1WIUA 3VG0H 1Z9SA 1ITCA 4Z7QE 5I1CH 4FFYL 1I8IA 3A0OA 3BSZH 1LO5A 1GOHA 1KEML 3HLAA 4N8VG 4RIRB 1J5OH 3JXAA 4CADA 1WBXB 2OL3B 5D93B 3L3KB 4WW2F 3V5HA 3HI6H 4KY1L 4HGKC 4TVPD 2F5AL 4JY6B 5CJQL 1QFPA 2BVYA 3PL6D 1SJEB 1FG2A 1FQ9C 4N1HB 1RPQA 2R1XA 5GZNC 3PWPB 1WITA 4L3AA 1U92A 4LDLB 4LP4A 4KZEH 4QRUB 4K2UL 2PW2B 3T77B 5J9PA 1DUYA 2R23A 4LF3A 4Z7VE 4JO4L 1LK3H 5GS0L 5E8PB 4CMMA 5J7CC 4GAGL 4EBQL 4Z7WF 5HDBF 4DFHA 2G75B 3DETC 3I2CL 5D7LA 4LCYB 3EYUH 1IZKA 4MQXC 3T2OA 4XNMB 2AERT 1FZKB 4NZRL 4ZUSA 3MA7B 5J0BA 5TDOB 5MHSD 4UILL 1VGKB 3VMNA 4F57H 4HWEL 5DQ9B 1J0ZA 4WUUE 2PN5A 3EYOA 1FAKT 5EN2A 3TH2T 2ZKHL 4DQOH 1ROWA 2FO4A 3PE9A 1OTSC 1UYWH 4H88H 5DC0A 4N9GA 1XR8A 1FZMA 5EBLA 5HYEA 2VLRB 2A1WL 4WFFE 3K1KC 2YUZA 4YHNA 2CH8A 1S7XA 3TIDA 2JCCA 1NGPH 4XCYB 3QWOB 3M45A 5BV7L 4Z7NE 4E0RB 3EUUA 5J56B 4M8VA 1LD9A 2MFNA 1S7SB 4YFLI 3CVHL 4XMPH 1YEEH 5FHAH 2WUBH 3BFOA 3UYRH 5IBTL 2CGRH 1D9KC 2AEWA 3LPFA 5HYSA 4M7JH 5HI3C 2NMSA 4ODHH 3MRLB 1C5DB 4PP2B 3SDCA 3WS6A 5I76B 4FQCH 4YWGL 3TFKC 5F6HI 1C7TA 1FH5L 1Y6NR 5LAXA 4FQPA 1QSFE 1YMMB 4LLMB 4ODSH 1A7OH 1DQJA 3BPLC 4KDTC 3V52L 3LQAL 1A6WL 4K9EL 4TUKH 5FK9B 1L0YA 4PGZA 3TBSA 1KN2H 5DVMA 4P9ML 5CILL 2XG5A 1E6JH 1IM9D 5AWNL 4LQFL 4UB0L 5GGTA 5C8JA 4YDLB 3ZHLA 1HXYB 3NFPA 4KKLC 1KELL 3MMEB 1AHWB 4UIMB 2NW3B 2DYPB 2YKLL 1U8QB 4F3FB 1FNGB 5B8CB 2RGSA 1N5YH 1IC5L 3AUVA 4XPBL 4XCCH 5MP6H 1R5WB 4PG2A 3KYNA 5KN5B 3L5WB 2IQ9H 1W0WA 5HHNA 1R5IB 3REWA 3T0WA 4GRLB 3V6OE 5EU5B 4Z7VA 4M48L 5F89A 2IAMA 2D31A 4UIKH 3IAQA 1FL6A 5F8RC 1YA5A 4Z95L 4PRHE 5A2KH 5K59E 1U8JA 1H3WM 5EPMB 2ARJQ 1NBYB 1T1XA 2XICA 2NX5E 4UDUA 2HRPL 3VXMB 3QFDA 2BCKB 4QGYA 2AEIT 5HI4C 4KTDH 1U58A 3WFCH 4WUUA 5JORB 1FNLA 2E9JA 1Q9KA 2YD6A 3DV6A 4JY4B 3KJ6L 5KSBF 1I1AA 3VD7A 4AEFA 3JV4B 5KVDL 4WUKH 5IR1B 1P7KA 2E7HA 4P46B 4HPYL 4TSBH 4XCNB 3BKJL 3P3YA 2WQRA 4JFHD 4JZOA 1I9RL 4MX7B 5F1SA 3P73B 3MRNA 3QB7C 3P77A 1YZZA 3GBML 5D72L 4I3RH 1OLLA 1QLFB 4EIGB 3MNWA 4Y1AB 2J1KA 1FJ1B 1T6WA 3D3VD 5E9DB 4WFGD 5D71L 5GJTH 3G5XA 5T33H 1DDHA 1HH6B 1MJJA 3GHBH 2BVOB 5ICXB 3GSRB 3BRGC 2ARWA 2X4UB 4JDVB 3S3JA 1MPAL 3KYKH 4QNPF 5ITBH 3B3IB 1LEKA 2ZUVA 3X14B 3F5WA 1QSFA 1MCLA 4ZDHA 4ZD3H 3EDJA 3QUZB 2KDGA 1C12A 1U8LA 4OB5H 4XGZB 4MA7H 5F7NC 3QXVA 4IOSD 4Y16D 2EIEA 2X1XR 2CQVA 5DK2A 1KJMB 2DB8A 3KVQA 1OW0C 5L2JB 3K2UH 5F9JB 1LEGA 4M4PA 1U8KA 3KJ4B 1INQB 3EFDH 3UTOA 4XNYL 5DSCB 1HYSD 4PJAE 1HEZA 4CVWA 4P2YA 3IJYB 4LSRL 4RISL 5D7JD 3C60A 3TJEL 3SO3B 1FL3B 4F15B 2F5BL 3MODH 2HT3C 5DRZA 4QHNA 3BUYB 4HIEA 4K3DL 5DD3L 4H20H 4JKPH 3VFSA 5J11B 5DJ2A 8FABA 3SGDH 4NO5A 2GFBA 3UJTH 4LPYA 4Z0BL 5JW4Q 2VLJA 4LCUB 3BQUB 4PRHA 4BFGA 1CXEA 1CGXA 3LKNA 3N06B 3KPPA 1UVQA 4K8RD 2NX5A 5LJYH 1KIPA 1DQLH 3FQNA 2O61B 1AJ7H 2J3SA 4BA8A 2ATKB 5TE7H 4Y4FC 4LK4A 4NFCA 4PJ5E 1T3FB 2G60L 4N0YH 3RZCD 3TN0A 4NJAH 1CDUA 1K8DA 5J8OA 1YMHA 2E8YA 5SWZB 3VJ6A 3UTSE 4LSSH 4NP4L 3QHFH 3CFIC 1BAFH 4JO1H 2F58L 4BZ2L 4DKFH 4ZOAA 3LKSA 4ZO6A 4RGND 4OT1H 5GIRB 1CZ8L 3SE3C 5HI5D 4WRLA 1MJUH 2WNGA 4X9BA 5K9JL 3LEXA 2P7TB 1G6RB 5BCAA 4RMSA 2GJ6D 4YBLB 4TULL 5I30H 3OSKA 5ITFA 1F4WH 3FQWB 4WI2A 3X12A 1HCFX 1EUTA 3CJJA 4AEHL 4ACPA 2MQ3A 3B4NA 1I75A 3ZZ1A 1Z5LA 3P9LA 3BDBA 4LPXA 4S1DC 3V7MA 3ARSA 4UZGA 4OZGB 3F7YB 3JTTA 3FFCE 1DVFB 4JKKA 2UY6A 4GKOA 3S5LB 4HIJA 3WLBA 2V2WA 2YS4A 1RUKH 2P5WE 3QQNA 4LVHC 5FYKU 1T7YA 4NDMA 4PRBA 2PCPB 1N6QL 1UWEH 5SV4A 1VB9A 5C7XH 4HUMB 4PTUA 4AIXA 1EGJL 3HNVL 3GMMB 3S97C 4O2FB 2J8UB 1WV7T 2F54E 4X4XB 5DXWA 1IGJB 4F9LC 4PRNA 1I4FA 3E8UL 3CDGA 3TBTB 4PIRF 2Z93A 4PJAA 3V5KA 3GMLB 3QZWB 4QXTB 2XIDA 3NZHL 3SE4A 2FGWL 4LARL 3DV4B 4PB9H 4NSKB 4XMKL 5E6ZA 1VDGA 4YHKL 1DQTA 1HI6B 2K9UA 1J87A 4TSCL 4Y5XB 5EWIL 4WV1C 2JCCF 2R2BA 4K94H 3HPJB 4DTGL 3C87A 5DRWB 4JFPB 3HMWH 3T0XA 2RCSH 4PJ9A 1F4HA 3ES6B 3C5SB 3QG6B 1EIBA 5GQBA 3WEXB 1PG7L 2NY1B 4HG4J 2D4FA 1Y0LA 5IJVA 1JNLH 1BZ7B 3Q5YA 4ONGH 1ETZA 4RAVA 3S37X 4DGVH 4XVTH 4HSQA 1G7JA 5T1KB 4PJ5A 5DD1L 5F7UA 1FO0H 1N5AB 4Z7QF 5CIPA 43CAB 3BHBB 4XXDA 5IM7B 4Z8FH 1TQCB 5IROA 1ED3A 3UTSA 3AS0A 3MV9B 4NZJA 4UT6L 1U8OB 1QR1A 2N56A 1F5WA 4FZEH 1OAQH 1UM6L 4B0MM 4GAYA 4MA1B 3NFSL 4OQTL 5JIHA 1A7PH 3SGEI 3TA3D 1CFQA 1A1NA 1NMCC 4AG4H 1I8MB 2HTLD 2DLEA 4Y4KD 5K9QG 3ECBB 3DMMC 5JPNA 1A0QH 1A47A 4KV5F 2FEDC 2JJSA 5CD3A 3OKYA 3BPCA 4XVJH 3BZFA 3GKZA 1RZ7L 3V4PH 3FFCA 4FXKB 3VFNA 1HZHL 5K9KA 2CO7B 3DVFA 3SQOL 1ZXQA 1J05B 4DOHE 1JGUH 5FYKL 2AEQL 1WFTA 1CK0L 4JPWH 1I3RB 1J0KA 1U42A 1AXTL 2P5WA 1UM4H 5KG9B 4YUEH 3IU4H 1GIGH 2XTJB 3RA7H 3QNYA 2AV7A 1A21A 3FAXA 4G8FB 3DOSA 1X44A 4HIXL 5TQ2H 3SPVA 3PNWB 4EJ1C 1RU9L 5CMAA 2F54A 3MLPA 2CRYA 1UKQA 5AYUH 2NY4C 3FT3B 1CFNB 2ZCHL 1KPVA 1T20B 4Y2DD 3QXAB 1Z9LA 3TWCL 3QDMB 3GSQA 4RAUB 1AO7E 2A9NL 1CDBA 2DLFH 2IC2A 3STZA 1JPGA 2EECA 2EDDA 1IGYA 1KCRH 1D6EB 5DTFB 2FL5B 5AZ2H 1VEPA 1AKJA 1S7QB 5I1IL 1S7RA 4ZTOL 1RZIA 3MRJB 1CLYL 4Z7NF 3PL6A 4HUXA 1JHKH 3U9PL 3WDHA 1L7TL 3WLWD 4L29A 4X7DC 1G7IA 1ZGLB 2QQLH 4G42B 5IEKB 5IBUB 4M7KH 2C4XA 5DUML 4XP9L 1IMHC 1F45A 3UTZA 5ADPH 3H3PH 2XY2A 3BP6B 3ARDC 3P4NA 5DQJB 2V9TA 4I18C 3IRZA 4GMSH 3SGJA 3VXRB 2EDEA 5JLZB 4KH2A 1KB5A 2QBWA 3NMEA 3DXAA 3QUYD 1ORQB 2V9QA 3L7EA 4LLWA 1OAKH 3WJJC 1KC5L 1UJ3C 4GW5B 2HAZA 4LGSB 4PLKC 1DFBH 3BJ91 5C08D 1IBGL 4X5WA 3LN5A 4MLIA 3V6FA 3RUGB 3ZDZE 2EO1A 1OM3L 4Y4HD 3WIFA 4DOHB 4HKBB 3H9SE 4UQ2B 4MD0B 3WO4C 3U0TA 2FX7H 1WC7B 3S35L 5GJSL 1Q0YH 5F71A 1LMKA 3WFBH 3PWJB 3ULVH 3RDTC 4R90L 4M5ZH 5DEGA 4LEOA 4LSPL 5M94B 3KPTA 3NABL 4A2LA 1LO4H 1ADQA 5D1QB 2Y6SD 4M4RA 3WIHH 3D3VE 2MCG1 4U6HB 4XPAH 1PZUB 4WFGE 4CW1A 3T2NH 3GSVA 5T1DL 2LQRA 1P6AB 5I18H 3BSZL 3CK0L 5CGYD 4LGPB 5TQ0H 3JUZA 2NY2B 3OGOE 5K59F 5H37H 1FFPB 3VFMA 3BW9A 1OTTC 4BFEA 2OI9C 4WU5A 3QXDA 4PJ7B 4Q7DA 4L8DA 2BNQE 5BO1H 2D7TH 1FL5A 1A7NH 4MQSB 4HXBH 2BHUA 3JUYA 4KMQA 1KCSH 4RX4A 1A6VL 2HVKA 4YHYC 1IM9A 1D5ZA 1EMTH 3SY0B 2R2EB 3DX9B 4LMQI 4QOKD 3HKFA 4FZ8L 3DPBA 1AO7A 3QH3B 3E6HB 4KZEL 4IRSC 2IPTL 4F2MA 1NJ9B 1PJ9A 4WHDA 1MQKL 3UJJL 1I1CA 5I8EA 1WICA 5MERB 3KPLB 2P8PA 5TF1H 3RWFB 2WWMD 5FAAA 3ARED 4D3CH 3EYSL 4P2RA 3WKNA 1ZT4B 4MD5A 5C86A 2C3WA 1LNUB 1NGQL 4JGJA 3DVIA 1MFDL 2H1PL 3QA3B 3GO1H 1RUAH 4XPHH 3BZ4A 1KXTB 1EAPB 3VXOB 4HQQH 4OD1L 4GXUN 2X1WL 1UWGL 4DQOL 2GK0A 4H88L 3TO2B 5J06A 1FHGA 5T5NF 3SCMC 3MLSH 3UO1H 5C9JA 2CDFB 3UCRA 1PEZA 1JPFA 5GGSB 5FO7A 5BOZG 1VSCA 3G5ZA 3E6FB 4X7TB 5IW1A 2CLVA 3VGGA 2CJUL 1WJ3A 2DDQH 5FECB 4P2OA 4HIHA 2VXSH 4JFFD 4Y2OA 2FEEI 4L8SA 4RA3A 3ME0A 1A3RH 1T83C 1ZEAH 4O5LL 4QHKJ 5FYJD 4NBYB 3C09C 4OZGF 2OK0H 1IAMA 1PYWB 1YECL 3H9SA 1SEBA 3GI9L 4M1CC 4RGNE 2WUBL 3UYRL 1TVBB 3BIAX 4ZXBB 3PQYE 2D7QA 4M93C 4ODHL 3UMTA 4L4VD 3KLDA 4ALAL 2EDRA 4PB0H 3PDOA 4WCYH 4PRID 3D3VA 1WWAX 2A6IA 1F3JA 4JRXE 3HRZA 1MHHB 5FM5O 2MPAH 2W9LA 2J8UF 5GHWL 2D2OA 1QUNA 3IDJA 3HR6A 5KTEH 1DEEA 2MSPA 4TUKL 4Y16B 3SJVA 3DYOA 4L8CA 1QEWA 1E6JL 3NZ8B 1IAKB 4J6RH 1OB1B 1G7PB 4M61A 5A40E 1I9IL 4KJWC 4KMLB 1YYML 4N8VA 2BNQA 2C3VA 3KDMA 5KZCD 2P48B 4MDIB 4O51B 2HT2D 3ARBB 3DGGA 4PP1C 4XH2A 1DSFH 4QF1A 1HH9B 4QRSA 3LKRA 5D7JB 3HCVB 3OR6A 4U1NA 4DVBB 2NY6D 5FUZH 4XVUC 5L88L 1RV6X 1KCVH 4DKEL 3MGAA 3H0TB 1NDGB 5DMJB 1FZOB 4P2QD 2D7OA 2MMXA 3AC0A 4MXWH 5GSRA 5JIIA 3M8OL 3T08A 1Z9MA 5I73C 4JE4B 1A1MB 2HLFC 3T0DA 3MRDA 1P9MC 1D5MA 4Y0GA 2BFVH 2NY7H 2RBLA 3FO9B 3D69B 1AGBA 3A6BL 3K0WA 4JY5L 1ZA6A 3U30C 4QHMB 5LG1A 5I1AB 1ERNA 3D25A 2WBJD 4LL9A 5KSUA 1RK1A 3RJQB 2VO5A 3QZWG 3KPOB 1AXSB 4ETYA 5HHQB 2Y06H 5MENB 3L3HA 4I5BA 2JB6B 3V4UH 5D9SB 3ZKSD 1T1WB 2GEEA 2VL5A 4FQXC 1HQ4A 4PJDE 3MSPA 3CD4A 1NPUA 3MCLL 4W4NA 5GZND 3D6GA 3O3AA 4G8EA 1NGZB 2BMKB 2GJ6B 5JW3L 3BVNB 3W2DL 1NBZB 3RZCA 3GEWB 4NCDA 4OFKA 1X5AA 2BSSB 2OBGA 4R7NA 4J8RB 4MNQD 5LCVH 2W9EH 1BGXH 5C0GA 1EXUB 3S4SG 3VD4A 1BQHA 2CUHA 2QQQA 4YHLH 4NUJB 3CGTA 1XF4A 2X1PA 1U6AH 3MRBB 4WI4A 4MQXD 3PQYA 3L95A 1YEDB 4ZFOL 1C1EL 3Q6GH 2HVJA 1J8HD 4ZSOE 1NC4D 2DQTL 2PO6C 5ID0B 4JRXA 3RL1A 2UVFA 4DZ8A 4ZD3L 2DQJL 1I8LC 2ORBL 5JHDD 1V5JA 4P2CG 3C2AH 4C54A 2EDKA 5FGBC 2H32B 2WP3O 3TYFA 2VABB 3QXWA 2NZ9C 4H25B 3I6KB 4KAQH 4MMXC 5LWYL 2NPLX 2P45B 4I48A 4ONFH 5FF6B 3I3EA 4PJCB 4Q9BA 2WIIA 1ZTXH 2BDNH 4AEIH 4KWUA 3VG9B 2X4PA 3ALWA 3EFDL 4JFEB 4P23A 1FBIL 1CL7L 3KPMA 3O2DH 1N2RB 3H9ZA 3VFUA 1KBGL 5FKAA 2AV1A 4NKOA 3RBSA 3X11A 4GH7B 3UZVB 4O2CA 2VLKA 4ELKB 3MODL 1YYLL 2IJ0C 1D9KD 3NIGE 4BFIA 1F2QA 5A2JH 3QO1B 4JKPL 2DI8A 3HE7C 1MRDH 2VDLL 3LKOB 4R3SB 1F4YH 4L1DA 4JFOB 3SHSA 1N59B 4LLDA 2OJZH 3RY6A 3GHEH 4HKJB 3Q6FB 4IJ3B 4OD2A 1QBLH 3RTQD 1Q72L 4YHZH 3TPKA 3OXSA 3O6FA 3TNNB 1T2QH 3EYQD 1MF2H 4KKLD 4U6VL 5SX5H 1FGVH 2VLMD 1GVIA 1QLRB 5T1MB 1B90A 3F8UB 3HR5A 3M1BB 1IEBA 1KB9J 4YHPB 3RUGF 5IGXH 1WFOA 1QSVA 3NACH 2R8SH 3NTCL 1CCZA 4XP4L 1IEHA 2GTWA 4XP1L 2QTEA 3W0WD 3ARTA 4MVBC 1QRND 3TCLA 1BAFL 3EO0A 1QKZH 2CKBB 3CFKB 3FOMA 4PJDA 1SY6H 3TA3B 4KKAC 4PJXE 3I02B 4BH8A 3O4OB 1FLRH 4MA3A 5EU4A 3FB6A 4XNQB 3UZQA 1MUJB 2VXVH 5CIPH 5CCKL 1MLBB 2DQDL 3EOBB 4RDQF 4PUBH 3KR3L 5I1HL 1Q9OA 2JKXA 3H2WA 3B5HA 3QJFA 1Y6KR 5IWLC 1B0GA 5DMGD 32C2B 1QFOA 1QLEH 3VXUD 1GC1H 1RSFA 4GW1B 4UINH 1CGYA 4Y4KA 1MHPL 3QEGH 1XCQA 4ZSOA 3W9EB 3S34L 2R4RH 5HI4D 1SVCP 4HH9A 2FD6L 1W72L 2EYRA 3BPOC 5IB4A 1AGFB 3EDEA 1A5FH 2QEJA 5AZEL 1PLGH 3WNNA 1RIUH 1J1XH 3BD4A 4HCRA 1SYVB 3VXNB 5EC1B 1KTDA 5CEYB 1S9YB 2F8OA 2EIDA 1U3HC 3MNVA 4YLQT 3X13A 2VDML 1F58H 3WS3A 4Y2DB 4LSDA 3IB4A 4LBEB 1KIRB 3EYVA 1G7LA 3RPIB 2OS7A 2YXMA 3Q48A 4H1LA 3G08B 1WBZB 3SGEH 3OKEA 2MKWA 3L9RB 3U4EB 3TO4C 3CLEL 4QY8B 3F65A 3M17A 3EDKA 2CO6B 4HX1B 4L5FH 1PX3A 3VXPB 4XBEL 2ESVB 2ITDA 3MJ6A 4FTVD 4EOWH 4HMEA 2ZZUT 4PV9A 4FFWC 4HIIB 3ZDZF 4HLZG 1MFEL 2OMBA 2ZG1A 4Q9RL 4QRPB 3L3IA 4P5TA 3SKJL 4ONGL 4BFBD 4TSAL 4PJXB 5GXBB 5EZLA 1EVTC 3CX5K 2OSLB 1UXWB 2DQGL 4TVPH 3CFCH 4P5KB 1K2DA 3PHOB 4M6NH 1BP3B 4YHIB 1UZ8B 4X6DB 3TBWB 4NOBA 4HUKB 4APQC 1HKFA 1BIIA 2P8MA 3MV11 2GI7A 5DK3A 2PETA 5C08B 4IIQC 2XZAH 1S9XB 3LKPB 5D2NB 3W11D 1VKXB 3HZKA 1RJZA 5D1XA 2HT3D 1YQVH 3FQUA 4CVZA 4MCYA 3TZVC 1JHTA 4IM8A 1OAUH 1TTGA 3PP3K 3QUYA 4KXZI 4WDIB 4XVSH 1S9WA 1CLZH 4OCRH 3MRRA 3OXRB 1KB5H 4JFFE 3B9EA 4M8QA 2HTKC 1S5IL 2WINA 3OKNA 3DUUA 5FYJE 2JK5B 5T3XL 4X5XA 1W8NA 1ZWIA 4Y4HA 4X4ZA 1EZVY 1SYSA 4NFBA 1YNKL 3U7YH 5C0BD 3O0RL 4KK9C 4PY7A 5FYJU 4Y4FD 1KYOK 1JGUL 1HIMH 2OLDA 4JPWL 5T5FH 3QUXC 2DQIL 1EO8H 3HB3C 4K71C 4L4VE 3KG5A 4GS7C 4PJIB 1J88A 5F6IB 1XIWA 4BSVA 1K5NA 3ZTJG 1VFOA 1PZ5B 1ADQH 1N0XH 5BMFH 2ZUWA 3BP4B 4QOKB 3VDBA 3LH2L 1OL0A 2ITCA 4EIZC 1JRHL 5HBBA 3C8KB 1IGTA 1TVDA 2PXYC 2FYYB 5EIVA 3LSOA 3U4BH 1H5BC 1CD1A 1Q9WB 2ZSWB 5HVHB 4JFXB 3W39B 1HILB 2V5RA 1UWXH 1ZANL 1CE6A 5D6DC 4XHQA 1F6AA 5BS0D 3MRMA 4S1DD 3GJFK 1JV5B 3ULUD 6FABL 1NCCH 2QQLL 3BDXA 4JM2C 4P2QE 5I19L 1C7SA 2GSIB 1U8PB 4M7KL 2B1AL 2L0DA 4JM4L 5D7IE 3RHWF 1E4XI 2YD3A 2Z31B 3GK8L 4PR5A 3U82B 2OL3A 2OL3L 3K80A 3WHE1 2FRGP 3ROOA 2PYEB 2YWZA 5JOFA 5E99L 3CSYB 2QHRL 4IRZL 1KTKE 1OTUC 3H7LA 1B4JH 3UC0H 1EEYA 1H8NA 5DMKA 3AREA 4KJQC 4EKXA 2Q3AA 1BQLH 3R1GH 2R1YA 5C6TH 4LVNB 1RJLB 3KPQA 1T7XA 5CJXA 4JR9H 3SKNB 4EUPA 1AD0A 3QIWA 4L4TD 5KS9B 5TGBA 2LU7A 3IRPX 3IXTB 5EBWA 3GSWB 1QA9B 4YXKH 1DLHB 2Q8BL 5DS8B 1YEGL 4G6FB 1G7HB 2UUDH 4HUVB 2QKIB 5IB1B 1I8KB 2DL2A 1CDJA 5HYJD 1RULL 1TCMA 4JFFA 4PRIB 5TPWL 5DA4A 5IT2H 3U36A 3IFNL 2JB5L 4YEFA 1CQYA 5TE6H 2AJ3A 1MJ8H 3QULA 1S8DA 4O4YH 2Q86A 3WIHL 5BW7C 4NNYA 4XPAL 3QI9C 4JREC 4MDJB 1FVDB 5DC4B 4XBPB 4XT1C 1V7NH 5HGBB 1H15B 3T09A 5GRVK 3SO5A 5DHVB 3U0PB 3IDYB 4X98A 4MJ6B 5A1AA 3L5HA 5ACZB 1MCNA 1OP3K 4RSVA 4L4VA 4OAWB 4L9DA 3GJEB 3QCUL 3RVWC 4ETQA 1VPOL 2WV3A 3AAZB 3LKQA 3BGFC 4HEME 1XF3A 4WJ5B 5E6ID 2APVA 4TQEL 1EEUA 1MH5B 3HI1A 1D5IH 5DUBB 1KCSL 1L9NA 1MJ7H 4NN6C 2AABH 3KPRD 3TVMD 1YEJL 2SEBB 5FA3A 4S1SH 3DMMD 2AK4D 4HK3N 1AGDB 3BRDA 1TJHL 4M7ZC 3FFDB 5IHZB 1AIFB 2FHFA 4I77H 4PJDF 3JTSB 2YK1H 2FEDD 1XCTB 3HNSH 2VMFA 3I50L 1IM3B 5C0CB 3ARPA 1OGAD 1EEZB 2CLZA 5TF1L 4MCZB 4PLNC 4OIIL 2XN9D 5IVZB 1FNSL 2A0LD 4P2QA 3LRSB 1DQDL 3WFEL 5D7IA 1DLFH 1WCQA 4HPOH 3QEUA 3ZDXE 1KNOB 4LPCA 1G9NL 1P7QD 4XPHL 4LOUC 3G6AA 4RFNC 1KIQB 3RPKA 4TOYH 2AVGA 4NUGH 1FV1A 4PJ8A 3UO1L 1JZ4A 5B8CA 1FVEB 2NY4D 2FIRT 2DAVA 5DLMH 1K6QH 3OQ3B 3ILPB 2WBJA 3D39E 3QEQA 5DVLA 4QHLB 4NQTA 3NIFE 5HXMA 3HFMH 4PYHA 2BNRD 4MNQB 2ZSVA 2IGFH 5IMMB 1MWAB 1ZEAL 1A02N 5J3HC 3W0WE 5DDHB 3ROLA 2OK0L 2RFXB 3QIUC 4K8RH 5SV3A 1T03H 2W92A 5J1SC 4NIKB 1J8HB 3QUKA 3LCYA 4YE4L 2B8OT 1FZJB 4OZHE 3VXMA 4S0SD 5JHDB 3K74B 2LU3A 4JG0L 1K8IA 3GSXA 5AD0B 1FC2D 1JYXA 1ZLWH 4CMHC 2MPAL 3ET9F 5LQBH 5L9DL 4KQ3L 3UJIL 1KTRL 4HS3B 4XX1E 4YHOL 2W0FA 1J0IA 3T0ED 1WUNT 4DUVA 3MBED 5KANG 1NC4A 3MV8B 2QR0B 4MX7A 5HY9B 5DT1H 1CXHA 3VW3H 3O3UN 5HHXL 2Q8AL 4PLKD 5GZOC 2HFFB 2EC9U 1JZ5A 4MGXA 5CINH 3PWNA 5JXEC 2BC4A 1CN4A 3W9DB 4PD4K 4ELME 4XCEA 1IGIL 1D9KB 4XZUA 1EBAA 4HWZB 5B3JE 2YRLA 3RDTD 5INCA 1OP5K 4PJXF 2R56H 4NRXA 4MAYC 4UTAH 2D7MA 1AE6H 2Y7QA 3BPLB 3TBYA 1R3JB 4YXHL 5CJOH 3OKKA 4I8DA 3QFJD 2BFVL 3DRTA 1AY1H 5A2IH 5H35B 5C07E 3DBXB 3CUPB 3IU3B 1GGIH 5K9OA 3MGOA 4FTVE 5D6CB 3A6OA 1MHCB 1N4XL 1OTTD 1XGRA 2AI0L 3QDAA 1RHHA 2FX9H 3VXSD 1QRNB 1F90L 1QVOB 1KN4H 4JN1L 5C0IB 3RTQA 4NKDA 3SKUD 4WHYG 2XACC 4FHBD 3D39A 4X7CC 4R2GD 5E5MA 2J4WH 4EQ3A 4UNTA 2IWGA 3P9MB 3VWJC 4X6CB 1JP5A 2QQKH 2GT9B 4QTIH 4MXVE 4IRSD 3MBXH 4FQHB 3ZKNC 3MOBH 1X5GA 3W0WA 5JHLH 1UB5B 2ICES 4OLUH 1GL4B 1T1ZB 2Z4QB 4FXGB 2GJJA 4F7CB 3VXUB 1MRCH 2QADC 3O4LE 3O41B 2VKWA 5IB5B 2DMCA 1PSKH 1HHHB 4CVXB 4K94C 1W2KT 3SGKA 4CRPA 4OZHA 5FO9A 1MVUB 3AMKA 2O61A 3S88H 3BRFA 3GSOA 4AMKH 1Z0MA 3GRWH 2I60H 1GYAA 4KPHL 4F7PA 5F7MC 3NA9H 1VEOA 1WZMA 4KI5D 1CU4H 2CIIA 5I16A 4D9QD 4GG6B 3VFPA 2RHEA 3WBDA 1I1FA 2DQUH 4AT6A 4GQ9L 1PQZA 1ZTXL 3IGAA 3OKMB 1IC4H 4QYOA 4Q6IC 3E3QC 2BVPB 5SWSB 3ZDYF 3FMGL 5IJKA 1WCBB 2UYLB 4RNRA 2FO1A 2OXHA 2DF3A 1G6RA 1G6RL 3O2DL 1PW3A 1F11A 2AW2A 1G7QA 1OD9A 1RZ8B 4ELMA 4YC2C 3WE6A 3IVKB 4M1CD 2QQNH 4X6FB 1JGDB 3FRUA 4J3UA 5DFTA 1Q38A 3D87B 5ESAB 5I1JH 1TITA 1I1RA 1BFSA 3L6FB 4N0UE 5T1LD 1KTLA 4NYLB 5CP3H 5HGGS 4H1LH 4R4BA 1ZHLA 4DGYH 4QTHA 5IG7A 2X4QB 3CXDL 1HINL 5C07A 2ZG3A 3T0AA 3I9GL 2M1KA 5IKCB 1NANI 5BS0E 2BP3A 3DYMA 3MYJA 3QUMA 4MJ5A 4RWYL 5IHBA 2UWEE 3ULUE 1DBAH 2L4OA 4NQUA 5CHNA 5EBGA 3BIKB 4KJWD 3I6LD 2F53D 4OLEA 1JGVH 1IGJA 1ZK9A 1UZ6E 3EGSB 1W0YT 3GMQB 2XI9A 4M3KB 3NACL 2LAGB 4UU9A 5DJ8A 1U8NB 4G6AC 3L3GA 3OWEA 1KT2A 3IDNA 5C0AE 3WHE0 4XVUD 1T22A 4B5EA 4QRTA 2JF1A 4W4OA 1JUFB 1A7QL 1BOGA 4Q9QH 4HWNA 1JZ8A 1FLRL 4WEBL 5KOVC 2VDQH 2I9TB 1A4JA 2HWZL 4NO2A 3WNLA 4ODVH 5DR5L 1JWSA 5DRWA 5D1ZA 1IL1A 3G6JB 3CFBB 4JFYB 1RZGA 3ES6A 3QG6A 5EG6C 2HLFD 1MAMH 2NW2B 3MLTB 4L4TE 4KHXL 2R0LL 3O4LA 2YUXA 5DUPL 4K23H 4NM4H 4HC1A 2HJKB 4HC1L 4HKZB 4QLRA 1NFIB 5JO5B 5C0BB 3S4SA 4Y4FB 4ZPTA 3L1OL 1DBML 1IAIM 4I4WA 5ISZD 2GSGA 2X4NB 3C5JB 4Q0XL 4U1SB 1NGXA 2VWEE 5DJ0A 1JYWA 5JQ6H 3TBVB 3FQXA 4XHJC 4U1JB 1LQSR 4JANB 3BHBA 1A5FL 3OF6A 3D5OF 4X8JB 5TDPA 1RQ5A 5FDYA 3MV9A 1AGCA 1WZLA 2XZZA 2HFTA 5D7IF 2VOTA 1LDSA 3UTPD 1RD6A 4OZIE 1CXIA 4ZAKD 4Q74A 5LBSL 3VWKD 1HHGB 4BQ9A 2ICWA 2D0GA 3PDGA 2EDHA 4R96A 3FKUS 4G9FD 4X7SH 1O5DT 2PW1B 3MLRL 4XPFH 2MHAA 2EE3A 1BX2B 4D0CB 4FQ1L 4MB5A 1C16B 1ZLUK 3AB0C 3KPRE 1TETL 4ODWB 5KSVB 3GMNA 4POZC 3K81A 4N0UA 1X5ZA 5IF0B 2G2RA 2PO6D 4HJGB 1CFTB 1LO3L 5DJCA 3ULVC 4Q9CA 2X2YA 4LVHB 4P3DA 2YEZA 5CEXB 2Y25A 1I3RA 3RX7A 2YXFA 3KLHC 1INEH 3U46B 4LEXH 3HHRB 3NCJL 1U8MB 1ZVSA 5BS0A 5CZVL 5F1NB 2DD8L 4XTRD 1RZFL 1IAIH 2UWEA 3CFCL 4TVPL 1FVCA 1HSBB 3HC0B 1J8KA 1ACZA 3GUTA 2XN9E 4NQCB 4WY7H 2H6PB 2E3VA 4HKXA 1EX0A 4LNVA 5I2IA 1JPTL 2DL9A 4HH8A 5C0AA 2DLHA 4PJBB 4WV1B 4F37K 3HG1D 5ALBL 3SDCC 5ILTL 1T21A 4JG1L 3PF2A 4HFUH 1N64H 1MLCB 3D2UD 3J8F7 5HYJB 4FS0A 3S96B 3WV0A 1IAOB 4XVSL 2P47B 1I1YA 1XMWA 3B6SB 1DE4B 2ED8A 2LFGA 4L4TA 3PV7A 5IFHL 1TFHA 3MV7B 1AD9B 3SDXE 4LSTH 1MCKA 4OLWH 4EUPH 1GAFL 1NC2D 2XTLA 7CGTA 2G9HB 2ID5A 2H2PD 1E4XH 1TZGH 4K55A 3VI3F 2Z8RA 4XP6H 2VDRH 1BZQK 4GKZB 1CXLA 3MRQB 3PDDA 3GB7A 4OM0H 4Z7OE 1EO8L 1DN0B 5FO8A 4U1LA 4PG2C 1F8TH 4LLVB 5JNYB 4R4FH 2OTUA 3MR9B 5E8NB 1I7UB 5IFAH 5FYJH 1FSKC 4ODUA 1LO2L 3KPRB 3TVMB 1NMCB 4LCCA 4OZIA 4D9LL 2CK2A 2ADIB 2BSRA 2AK4B 3DMMB 4KTEH 2CK0H 2IPKA 3QEHB 3T0EE 1GZQB 5F1IB 2HJFB 4KUZL 2C1PA 3KYMB 4HZLA 4LPUA 5EOCH 5E6IA 2AXFB 1FNEB 4QXGH 5HHVH 2X41A 1DL7H 1OGAB 3NIFF 1NL0H 2VH5H 3B9KD 3GSNB 3Q2CA 3QO0B 4NM8L 4JRYB 4X6BA 1IFHL 1I1AC 1D5BB 4FNLL 4HUUA 4X9IA 1DR9A 1I3UA 4U1GC 1H3GA 5DHVH 1I3VA 1P7QB 4HK0A 1M6OB 2PTTA 2R2HA 1H3UA 4PRPD 5E03A 4DWHA 4K3GA 3ARVA 1VFMA 5J6GA 4X6CF 3SBWA 5DJ6B 2NY4B 4M6OH 3FN0L 1U3HD 1B4JL 2EEBA 3C08H 3GSUB 4P59H 5EU3B 3UC0L 5E08H 2XN9A 4JB9L 1ONQA 1BIHA 5I1DA 1VENA 1QRKA 2Z8SA 1BQLL 1KGCD 3R1GL 3EOAB 1T0NA 1U36A 2BNRB 5CWSB 2EDOA 4R97C 1UM5H 4JJ5B 2ZNWA 4M43H 4LIQE 3TO4D 5B4MC 3VXSE 2EDFA 2OCFD 2E6PA 3MJ7B 4DZBB 1IKNA 2V5SA 3BDYH 3VRIA 5GRUH 3WNPA 1BHGA 4HF5L 2IQAA 5E8DL 3VA2C 1IGCH 3Q3GB 4CAGA 1SMOA 2FR4B 5CZXD 3D0VA 4ELMF 1JZ6A 3U79A 3HPLB 5IIEB 3LN9A 2IF7A 5B3JF 4Y19D 1I7RA 3ARDB 1NLBL 4XB8A 2BVUA 4I18B 4IDJL 5FDWA 4WW1A 1V7NL 2O5XH 1ZT7B 3QUZC 3ELAT 1RZKH 4UTBH 4NQSB 3RWGB 1JYNA 3C60C 3CX2A 4N8CH 3FOLB 3E6FA 1NGWB 3DX7A 1KEGL 2FB4L 4P3CH 1V3MA 3E0GA 2Q76B 3L3JB 3GI8L 5CEZL 3RJDA 4KI5E 1JJUA 1RUQH 3QQ4B 3WO4B 2ED7A 4D9QE 5FYLE 1T2XA 2AABL 3T0EA 3TZVD 3RDTB 3HZMA 3MBEA 8CGTA 3O9WA 2Y5EA 4BELD 4GAJH 4EDWH 1PKQB 5LGHH 2HT4C 1KLGB 4WNQA 2LV4A 5F7EL 1LVEA 2HTKD 3LMJH 1BEYL 2ATPA 3QFJB 2YA1A 3BP5A 3PGDA 4MXVF 5JR1H 3TN0C 3KWWA 4KK9D 4EVNB 3AY4A 3BP7B 2OI9B 3QQ3A 4GMTL 3QUXD 4RGMC 4Y89A 1EBPA 4JCMA 5ERWB 2BRRL 5C0JA 3VGHA 1KIUA 3P4OB 4JPVL 2N7BA 2M8XA 2FBJL 1TVHB 1XGPB 4YHYB 1BD2B 3F6LA 1S7WB 1KLUB 2X4TA 2XKUA 4R2GB 3RIFF 2VXTL 1G7MA 1CFSB 2ADGA 2HRLA 1K6QL 4EN3A 1JI2A 4OUUA 4IRSB 5FKPB 5DJYB 3DVGB 3I6LE 3MLUL 3DWTA 1AFVL 4BQ6A 2YZ8A 4IOIB 3VXSA 3IAGC 1ORSB 1CDYA 4GG8A 4DGIL 4JAMA 1NUGA 5GRJL 7FABH 2J88H 2ICEB 2XRAH 3O11B 4PGDA 2Z92A 2GITB 4KDWA 3N9GL 1MCPL 5E4IA 3IJHA 3IFLH 1U3JA 1BWMA 3T4AB 5KW9L 3BN3B 3LZFH 1BBJA 1YN7A 3TIEA 3MTRA 1MCOH 3OBAA 3FB7A 4MB3A 2XQBH 4X6EA 1OTUD 1F97A 4YR6B 1H9VA 4XXCA 1WK0A 4YO0A 3SE4C 1YNLL 1G0XA 2BERA 2W9DH 5ISZE 3ZSTA 1GZPA 1MCFA 1MEXL 4NQVB 4PJGB 3BJLA 3MJGX 4M9OA 3K46A 4HDIB 5E8OB 1CICA 3QNZA 3C09B 2UWEF 3ULUF 1U8IB 5DYOB 5EOTA 1KLFA 4PJ9C 4PRAB 2IADA 5EZJB 1UZ6F 1X3DA 3EO9H 3PGFH 1H3XA 3DIFB 1GGCH 5DZOA 3SOBH 1O7SA 1QQDB 4N0RA 4M93B 4DVRH 4TPRH 2P43B 1ZHBA 3UTPE 4XC1H 4AENA 2VXQH 2E27H 2R56L 2UZIH 3GKWL 1D6VL 1MNUL 2WW8A 5GISH 5LGJB 4OKVA 3WUWG 3MRGB 1UKTA 4UT9H 1OVZA 3QI9D 5CUSL 2Y1VA 2E9IA 4WHTB 2NTFB 3TPUB 2OQJB 5E2TL 5IROC 4L3CA 3RVUC 1Y18A 1GC1C 3T8XA 4ZUUB 1GGIL 3HN3A 5ICZA 1N6VA 2F53B 2BVQA 4FQ2H 2CDEA 4OCWL 4OF5A 5T1LA 5CSBA 5KSAD 1AI1L 5A16A 25C8H 2CIKA 1CXFA 3IS0X 2FX9L 1TTUA 4YEEA 3ZO0A 1T2JA 5HYIA 4O58H 6CGTA 4NQEB 5INDB 3JWDH 5I1EH 1N2RA 3ARWA 4WTXA 4YPGB 1Q9LA 4HS8L 5DQDH 4ZFGH 3QPXL 4FQJL 5I73B 1A6PA 5JZ7D 3QUMH 4WO4D 3KLAB 2ZUUA 2C1OB 5E00A 4EEEA 3BT2H 5DFVD 4OZIF 1JFQL 2VC2H 4K07A 4U3CA 3RP1A 4R3SA 1T04B 1B0WA 1MRCL 5HDQH 2AQ2A 1FYTE 3HG1E 3D85D 4OZ4B 3JV0A 3VFRA 2B39A 4P4RB 2IBZX 3WFDH 1ZVYA 4OF0A 3CFDB 2A73A 1GGYA 1Z0NA 1NANH 4AMKL 4LCIL 4LHJB 2EKJA 3GMPB 3MXWL 2I60L 1EHXA 1DBBH 1OAXL 1MIML 2I9LA 3N50A 5H2BB 4HGWB 3AS2A 4FQXB 1A9EA 2HH0L 4KC3B 2ENYA 1F13A 5ISZA 1ZA3A 4GFTB 4BZ1L 2YRPA 2CKBL 5HYQA 2VR4A 1CT8B 3GFUA 1YUHA 1QPPA 5E5UB 3PL6C 4ZOBA 4XNQA 2OJEB 1XGQB 4ZNEE 2ZUSA 4F7EA 4G9FB 4ODXB 5F9AC 2FNBA 1NCAL 3MNZA 2F19H 3NFNA 1VACB 3QIUD 5I1LA 5E2VH 4ZYKA 3FB5B 2B0SH 4ZAKA 5BRZD 3VMOA 3RWHB 2PO6B 3VWKA 3VRJB 1U95A 1A4KA 4LVEA 5ESQA 1FN4B 4U33A 1JHLH 5IV2B 1OSPH 2EH8L 1BVKA 4DFIA 5HYFA 3SGJC 1MRFH 3HC3L 3CSGA 1RIVH 4C56B 2X4SA 1EHAA 1AQDA 2BJMH 2D0HA 3SDXF 1M7IA 1BOYA 3R06B 5D8JH 3VE0B 5C92A 4TYUA 4C83A 1CGTA 2W60A 3HTLX 3T65A 1CF8L 1WVZA 2Y07H 5GZOD 3VD5A 1P5VA 3MRHA 4HFWA 1YEHH 5EC2B 3HG1B 3WXVL 1Q94B 3FONB 2X4OB 4UOW0 4Z7OF 4G9DB 3WXWH 4E41E 2YPVL 1HQRA 5F7LB 5E6YA 1B0RB 1VCAA 2DWEA 4JLRA 3JWOL 4HZAA 2DWDA 4NZDA 3HE7B 1KGCE 3H7BA 3ULUH 2H9GB 4YDIL 1OWRM 4MAYD 3LIZH 2XT1B 3DSFH 3LQZA 1SM3L 1R24A 1FYTA 3NCYS 1NC2B 5IMLB 4LSQL 3P4MA 3BH9A 4F7TB 5E1AA 4K3JH 1TMCB 2YPLB 3U4AA 3MUZ1 3D2UA 1B6UA 5B39B 1BJ8A 3IETA 1JWUB 1H3PH 4JFDE 4JDTH 5GGQL 5IEHB 3RKPA 2CKNA 3WD5L 5ID1B 2V17H 5E2UH 1NAMB 1KJ2B 1V3KA 1CGVA 4GKSB 2WIMA 5C1MB 3SKOB 1A3LL 2EC8A 3VCLB 2IH3B 2C7UA 4Y19E 1AR1C 4TTDD 4JO2L 3TYGL 2HKHH 3NAAH 4NRYA 4EDXB 4LDEB 1JN6A 4WI6A 1UCBH 1AP2A 3SDYH 4LHUD 1MY7A 3PHSA 3VWJD 1J0HA 1VKXA 1IGFL 3MLXL 4GO6B 5I8CA 3QDGD 1UXSB 4S1QH 3STBA 4ZNEA 2XQYG 3N1QC 3ZKND 5FM4A 4G8IB 4MJIB 1OF2A 4YDVB 1Z6JT 5C0EB 3KXFD 2GW5A 3HE6A 4M5YH 1QFWI 4K3EH 3R4DA 4GRWB 4RZCA 3O8XD 2VN7A 5EIIA 4JDZA 4XAKD 3BPOB 1MHEB 3SKMB 5DO2D 4U1HA 2HN7A 4XRCA 2MQCA 1DBKL 1NCBH 4PRPB 2CMRL 5I66A 2AJUH 3GJFA 3PXJA 2YWYA 4QRQA 1L9MA 1GHFH 4PJIA 5CGTA 3GIVB 1U3HB 3B9KA 4P2OC 4JFQA 3H9HB 2O5YH 1HK6A 1H0DA 1NMAH 4HMDA 3QHZL 3P11L 3TO4B 1J9CT 3U83A 4X4YB 1T0MB 4E41A 4PGBB 5F96L 3IYLW 2IALA 5ICYA 1IQDA 4M62L 2PTVA 2FBOJ 4OCSH 2BOCB 4KI5F 4X83A 1A3QA 1OSZB 2V2XB 1E28B 2UV3A 3L7FB 4L8BB 1UB6B 4DN3L 1L0XA 1T5WA 2ILLA 4QT5B 5EU6D 3QSKB 3SDDD 4J3VA 5KJRL 1YEFL 2GSIA 1OQOA 1P84J 1EFQA 4LSTL 5GRYA 3QG7H 1A6ZB 1WZ1H 1YPZE 3G6DH 5DMIH 5HVGB 1JK8B 5EORL 3UTTE 4JFDA 2XY1A 4TUJA 4G5ZL 4WGWB 2IBGA 4CU6A 4XPGL 5FOBA 4PREB 4APQB 4HAFA 1XR9A 4BSWB 3TV3L 3OKOA 5DJXB 2R0KH 1M05B 3CDYA 1OAZL 3ARGD 3V5DA 4IIQB 4Y19A 5E8EB 1II4E 3BEWB 1HYSC 2Y36H 4M6ML 5BQ7B 1B2WH 3TZVB 4U0RC 2BVEA 1G7HA 1IQWH 3IT8D 4HUVA 2FJFA 1BQUA 2CXGA 4YDKH 1CDGA 2VE6B 3VFGH 2ZCKL 2A83B 4YDJB 5T3ZL 4C4KO 4J1UA 2X1QA 1FFNB 1NL0L 2PYFB 2X42A 3WHXA 4LLYB 4NBZB 3WDJA 1B88A 1TCRA 1T5XA 3QUXB 1SBSH 2AJXL 4K8RC 4NJ9H 4I2XA 4K71B 2ARJB 1NAKH 4PGCB 4GS7B 1J0JA 4PJFB 4N0CD 4XHJD 4NWUH 5JW5B 1EFXD 1J10A 5FCSH 1BJ1H 1UH4A 5F88B 2I5YH 2DTMH 1CG9B 4LCWD 1WAAE 5C2UB 3RZCC 3BMWA 3N1FC 2YD7A 3MZGB 5E08L 2PXYB 5J57B 4AK1A 3NPSC 1H5BB 1FGNH 1NFDA 3F12B 4RGNC 3U9UB 2EZ0C 5D7LD 5ALCL 3STLA 1RY7B 1YDPA 5F9WC 4MQ7B 5LXGL 4NZTH 1URLA 2YC1A 5I8OH 2BNUB 2P4AB 1IM3A 1BZ9B 4JM2B 1HYRC 1JNNH 35C8L 1QBMH 4PPTA 4PY8I 3OKLA 3ULVD 4XBGB 4U49A 3CFEB 3IDIB 3MRPB 4LIQH 1YPZA 4F7MB 4MNHB 3UTTA 1A6AA 5FUCE 1UJTA 1CVRA 1U91A 4P23C 2B4CH 2GTZA 4KRLB 1RMFL 1HWGB 3EAKA 4X8XA 2X5PA 1L7IH 3O45A 3G5YA 2HJLA 4QHLA 5J13C 5D70L 1NSNH 4ISVB 3SDCD 5MEOB 3BEVB 1MWAA 1EERB 1MWAL 3BKCH 4G7VL 2HLAB 1F42A 1I7TA 1DP0A 1MCSA 3F7PC 3GM8A 3RY6C 4PLJC 1G9MC 5I15H 1PGRB 4OF7A 5BVJA 5IBLC 1LDPH 4L3EE 5MEQA 3QJHA 3O6FC 3PABA 3OAUL 5FGCB 4MA8H 3EOTH 3QI9B 4JREB 1XGUB 3DX6B 4A6YA 1S7VA 4I0PD 4LLQA 5EUOA 4ZTPH 5GRXG 5AD0A 4NWTL 4QCIB 1FP5A 2A77H 4R26H 1OCWH 2OTWA 5FYLH 3GM0A 4OZFA 4MNGB 4QRRD 3KYOB 1HOCA 5DF0A 1NCWH 4R0LB 4X99A 1JZ3A 3BGFB 5JXAH 4UNUA 2H8PB 3RWEA 1XZ0A 1K4DB 4BH7B 1WAAA 2V7HB 2VB5A 3I75B 5DWUH 5IFJB 2FHBA 2Y72A 2IAMD 3RWIA 2YD4A 4OLXH 3R8BB 2R69H 2X44D 3DUSA 4M7ZB 5B38B 3FAWA 3V0VB 5ESVA 5KSAA 3WN5A 3BZEA 1GGBL 2JELL 3RWDB 1BM3H 3DURB 2AK1H 2VLLB 4Y4KC 3SE9H 5CP7A 5BJTB 1BFVH 3U6RA 3RBGA 4ORGB 4KDTA 4WUUD 1XF2A 1Q1JL 1I1AD 4BK4A 4RQQB 3B9DA 4KK6D 2H26A 3V0AC 4HUNB 4WO4A 5C0ND 2BY1A 4K7PH 4W6XB 2VDPH 1GSMA 3G5VA 2AEPH 4RFNB 4LLUA 2M2DA 4UV7H 5DEFB 1PAMA 2NY0D 2XKNA 3A6CL 3D85A 2VIRB 1TZIB 5I8KL 5EZOH 2W9DL 4YQXL 2I25N 4X9GA 1SEQL 4ZFZA 3LV3A 3T0VA 3D9AL 3O81A 4ZO8A 3WYRA 1G0DA 4XAWL 4YPJA 3FQTA 2LVEA 3QIUB 1QSFD 2EEDA 2A9MH 4Z0XB 4P48A 4FXGA 4P57B 5BRZB 4P5TC 5B39G 4OFYA 1T1YA 4DVRL 3P4LA 5JDSB 4L3EA 1FDLH 3LS5H 4FP8H 3SGDI 3IXAA 4LFHG 2JTDA 3IJSB 4CMHB 1JTOA 2WQ8A 1YN6A 2R2CA 5FUOH 2AJYH 1M7XA 4G80B 4WU7A 4RMUA 4PG9A 2VDOH 3KPSA 4GQPH 1DQQA 1XF5A 5FB8B 5HJ3A 4HHAA 4PRDA 4W6YB 1U8HB 4FQIH 4FQ2L 4HJJL 4UV4L 3FL7A 2FZ3B 3THML 5D1XC 1OGTB 4PJEB 2LU4A 4JO3H 1FIGH 4MAUH 2XV6B 5C09B 2L7JA 3QUYC 5L2KB 1C08A 2Z8VC 3V0WL 4MJ4A 2DIAA 4MZ3A 1A1OA 2DI7A 4YX2L 4NBXB 1TZHA 1FAIH 2VLJD 1S9VB 4PRHD 4G6KL 4IMLA 5CSZB 4PJHB 4TNVF 2HT4D 4MAYB 4Y4HC 4FG6C 3VGDA 5KVGL 2OP4L 2Y5TB 4Q2ZB 1LO0L 3OX8B 1RURH 3BWAB 5EB9A 3VFTB 2HKFH 3BD5A 1XH3B 4IS6B 4MQTB 3WCYA 3OHXB 1KCUL 5A43C 2Z91A 4U0QB 1WBYA 2FH8A 1XIWC 3NIDE 1V7MH 4WI9A 1EAJA 3P2TA 4F58H 3VMPA 1OW0A 3RNKA 1A6TA 5ENWA 1QNZH 5CGYC 3MFFA 4NO3B 3OGCB 5TFSH 1JPSL 2XFXB 5I6XC 5ANME 5FIEA 3PP3H 4JQIH 1IEAB 3DI3B 3VWJB 4MWFB 4EI5A 4HUWB 3QDGB 4M1GL 2XWJA 3QDJB 3PHQA 5IK3A 5KSBB 1BVLB 1CE1L 3KXFB 3IFPB 1MFAH 3MOQA 2JIXD 3C5ZA 1VADB 2QADB 3OZ9H 5TDNA 2AQ1A 2EYSA 1NMBH 4V1DD 4OCYH 4LU5L 3DYPA 4PJFF 4LASL 3ZTNH 4LHUA 1DQML 43C9B 2XZCH 4UQ3B 1AQKH 2OZ4H 5E2VL 3T0BA 3PJSB 4MS8C 5CZKA 2JLLA 5IB3B 4BUGA 3G04A 1WWWX 2WWMC 3NH7L 3U0WH 1ZLSH 3OV6A 3WNMA 3AREC 4U1SA 3VFVB 1SJVA 3MLWH 2RR3A 2ZPKH 4H5SB 1MRFL 1HHKB 5HHMD 4MXQC 5GSVA 1T4KA 1P7HL 3WUWA 3E1F1 3O8XA 1BFOB 5CJXC 1Q0XL 2R0ZL 2BJML 3QIWC 4Q6IB 1N3NA 1FO0B 1P4LB 3RU8H 4WWKD 2HG5A 2VDNL 3PG2A 5FHBH 3S36L 2G5BA 4AQ1B 2Y07L 4K7FA 5JQHC 4PJ9D 4YC2B 1KJ3H 3P0YL 3RL2B 3CH1B 3B5TA 3U2SA 3GJFH 3UTQB 4LCWE 4D2NA 1SVZA 3WXWL 1AGEA 3PWLA 5C0DA 3V7AG 3MJ9A 3TF7C 3OB0H 3T4YA 1X5FA 3U1SH 1VESA 1FCCA 3C6LA 3HS0B 3MJ8B 3QRGL 3KS0H 2BY0A 3BGMB 5EU6B 3P30L 5D7LE 5D2LE 1RVFH 1JF1B 1UQSB 1CDIA 2VDKL 3CDCA 1S5HB 2IANE 3CCHB 3BGAA 1CGUA 1JMXA 2OX5A 4ESKA 3ALPA 3O3BB 3UTSD 3RVUD 1U93B 3MROB 1UKSA 3EYFB 1U8MA 5C71A 1PDKA 2JE8A 5F1NA 1H3PL 4G8GE 2D7PA 4JDTL 1W0VA 1PFCA 3D0LA 3DO7A 2Z9TA 3QCVH 3BISA 5E2UL 3MLVL 3SDDA 2FIKB 1ZHNB 2ZOLA 2H6PA 3V4VH 1X9QA 5ANMA 3NN8A 1M71B 1FFOA 1RUPH 2VISB 4LNRB 5IVXA 3RGHA 2GUOA 3N1MC 3PWVA 2HT2C 4DUXA 1UA6H 3MRKA 1F3DH 3L3DA 2HMID 2BVTA 1I8IB 1WAAF 2NY6C 4X9HA 1IGMH 1LO5B 3ARGA 3FFCD 2R15A 2R9HD 3HLAB 5JIKA 5FYKD 1EJOH 4CADB 2A2QT 5M7QA 4NHCH 4KHTL 2P5WD 1OP3H 3V5HB 4S2SA 5D5ME 2BOBA 4WI5A 3T3ME 1LEIA 1KACB 4O2EA 3C8DA 1IKFL 3MREA 1BPVA 5DD0L 2ZJSH 2F54D 1FG2B 5DRNA 4JPKL 2DIBA 2R1XB 4NT6A 2WBJC 1J12A 1U92B 1GHFL 4AYFA 4KMTL 2XA8L 1DEDA 5J9PB 1DUYB 2QJDA 3X3FL 2R23B 4LF3B 3OPZL 4I0CC 4U6YB 2XWTA 4CMMB 4NZUH 4QRRE 3FO0H 1AKJD 3LHPL 1E27A 1WWCA 1R3KA 1RZKC 1EFXA 3MRFA 1XT5A 3QEHA 1GZQA 5GGRY 3WSQH 4R8WL 2EDYA 4ZUSB 4LCWA 4U7KA 1WEJL 1R0AH 3ULSA 3TT3H 3AB0B 1RZJC 2X89D 3ZT5A 3EYOB 5EN2B 3ZL4L 1A9BA 2AJVH 2FO4B 4XWOC 1CIUA 2FJGA 4XPTH 3IDXH 4JZNA 3GSNL 4MHHI 1XR8B 4N9GB 4G7YL 2NLJA 5D2LA 1FZMB 5EBLB 2P8LA 1JVKA 2DI9A 1L6ZA 4GBXD 4PTTA 5L6YH 1D5BA 2IANA 4YHNB 3TIDB 1S7XB 3O2VH 3BAEH 2JCCB 1ZS8A 3DXAD 2AXJA 4S1RH 1WZ1L 3PV6A 4RGOL 3BXNA 3OAYK 1KXQE 2YSSA 3INUH 4G8GA 5D4QA 3S6CA 1LD9B 5IOPA 4ONOA 1LK2A 1Q8MA 3GSUA 5JIPA 5E94A 1OAYL 3TT1H 4G6JL 4JHAL 4E5XA 5HYSB 5DVKA 2XNAA 5C0RH 3SDCB 1QPXA 3DRQA 3EO1A 4KK8C 5LAXB 4DN4L 1MCHA 3EJZC 15C8L 4R4NC 1DUZA 4AIOA 3CVHA 3DROA 4OUOA 5JW4M 4NKQB 3TBSB 1HCVA 4N9OB 5GS1C 4HWBH 2FR4A 4GUPA 5C8JB 4ZOCA 3NFPB 4ZODA 3IDMA 3DHJA 2AAVA 5ACMA 4IBLT 1MIEH 2V2TA 5D5MA 2XZQL 1VHPA 4RFOH 4PJEF 4XCFH 1S3KL 1NKRA 4P9HH 4DW2L 1UH2A 4HBCH 1SBSL 3RTQC 3TLRA 4NJ9L 3JV6A 1QG3A 3AU1A 3WIIH 4RX4D 1CBVH 2EH7H 3KYNB 2KQMA 3EYQC 1W0WB 3GNMH 2UZXB 3CMOH 4H8WC 5HHNB 3WJJA 1UJ3A 2WK2A 1AO7D 4I0PA 1FSKB 5JPMA 1AR1D 4NO0A 4Z7VB 4GW4A 5C0FA 2DQHL 5F89B 2WM0A 4A6YH 2IAMB 3Q1SH 4PJHF 2D31B 3UBXA 2Q76A 4QRRA 1FL6B 1PY9A 4DAGH 1U8JB 1T1XB 2ZCLL 4OZFH 4UDUB 3HAEA 2R29H 3O6ML 3GMRA 1IT9H 3LPGA 4GJTB 3QFDB 1YEIH 2YPKA 4P2RD 2IEPA 4GAFB 1CLCA 5EOCJ 4N5EC 3SGKC