3FB6A

Kcsa potassium channel in the partially open state with 16 a opening at t112
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
publication title KcsA Potassium channel in the partially open state with 16 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6A02
1FH5L 4HPOH 4R8WH 3V6OE 3QO1B 4OLXL 4UQ2B 2BMKB 5DMIL 3RAJH 2GTZA 5IBTL 4L8DB 4NC1E 3CVHA 2AXFA 4LCIL 2FEDC 1I9RL 2VLJA 3QNXB 3OJVC 4UTBH 1MNUL 3DX7B 4HIJB 1MFCL 3TIDA 1B6UA 3LQZA 5H94B 3FB8B 5FHAH 4JHAH 5LGJB 2EDBA 3O6LL 3BEWA 5GGSY 1CDCA 3G04A 3PWLB 1YYLL 3FQNA 1A1NA 4P2QB 1BM3L 2X4RA 2XZCL 3STLB 1QSEE 2ZG2A 5T3ZL 2WV3A 3S98A 1MCHA 1RUQL 4ODTL 3VG9B 1IC1A 4TSBH 43C9A 5A2JH 2B2XH 2IANA 3BEVA 4OT1H 2B5IB 5D7LD 1EEUA 4MWFB 3LN5B 4K55A 4LSQL 4JR9L 4PJAA 1KJ2L 4AY0A 1TETH 3K74B 3FB5A 1YEKL 5CP7A 4LQ1A 4P46A 2EXWC 2X1OA 2DJSA 2Z4QB 4NHCH 3GO1L 3VGGA 4XPAH 3DI3B 5DLML 4NO0D 5B39G 4NNXA 4PV8A 3SE9L 1UB6A 1EAPA 1IEBA 5FO7B 2ZPKL 2R4SH 2BDNH 4QTHB 4Y4HA 1VA9A 2Y9RT 4PBWD 5CKGA 1H8NA 5HHOD 2G60L 5FECB 3MRIA 5LCVL 5HYEA 4I3SL 3DGCR 4Q6IC 3S9DB 4YXKL 3QUMA 1FNGA 2X09A 4TVPD 1YEHH 5HHNA 2HRPL 4ONGL 5BO1L 3RRQA 3BGMB 2QJDA 3QCUL 2DBLH 3PWUA 2AJUL 2V9RA 5D1ZA 5DFWH 3S4SB 1G7IA 2VDOH 2GI7A 3WDJA 4X6CF 1GCFA 3IXTB 5D7IF 3MNWB 4HJ0C 1MRCL 2GK2A 3LS5H 1QLRB 1BD2A 1N6UA 3RFZC 2E9IA 3F7QA 5FCUL 3BN3B 5I71B 1SYVA 1IKNA 3O4LA 3P0VL 2Q86A 1QPXA 3I6KB 5EU3A 3TNMB 1IAIL 5C9JB 5CBEB 4XVTL 3OL2A 4IRJA 5ALCH 3GMNB 4P2OD 4QXUH 5TF1L 5I9QC 4YHNB 1ZLUH 5JXAH 2W0FB 3ULUH 2AQ1A 5IVOA 3B2UD 1RHFA 1XR9A 3JV4B 3IDYB 3MBEC 4JPWL 4IIQC 3EHBD 3S37L 3P4MA 5ACMA 2F58L 4HJJH 1NGPL 1Q1JH 4UINL 3RY5A 1T0PB 5LJYH 3IFLL 1CFVL 1OAXH 3ZYZA 2V2TB 4A6YL 3JXAA 2B1AL 2YEZA 5J7CC 2IJ0C 5JIKA 4BZ1H 5DVOA 5C86A 1S5HB 2EDNA 5GJSL 3T0ED 3SGJC 3N1PC 1JMXA 1X44A 4OCYH 3WNKA 4FQJL 7FABH 3EZ8A 4UIKL 5F1NB 5F3HB 4LCYA 2DQCL 1A3QA 1HSAB 1P69B 3BW9B 3QUXD 4NZDA 2A9NL 2OX5A 1KCRH 4M4RA 2X4NB 3RX7A 3FZUC 2UZIL 3V7AG 1H3PL 2BOBB 2EICA 5I16B 4MSWB 5TGBB 3HCVB 4OLEA 5GS2H 3AAZA 5J8OA 3GJFB 2YOCA 1XGQA 4LKXA 3WKMH 1IM9D 5IK3B 4PRNB 1CK0L 1I9IL 4NKMA 5HXMA 3F6LA 1A3LH 3V79C 4NJ9H 4POUB 3QEUA 4NPYB 4B41A 4Y1AB 2P45B 3EO9L 3FO9B 1OT1A 3AREC 4M1DH 5D7JD 1EFXA 4EUPH 2RJMA 3CSYB 1DL7L 5HDQL 5LGHH 1JGLL 4JO2H 2AV7A 3O2DA 1LHZA 2NY5L 4YPJA 4M02A 3TVMD 4RAVA 2C3VB 3GJFK 4S1RH 2BY0A 2XZQH 4HCRH 3FOMA 3VXMB 1T7XA 4XWGH 3REWB 1GVIA 3O45A 3VFVA 4YFEA 4ZAKC 5H2BB 4OZFH 4ZODA 4U1SA 1T22B 5D8JL 2JJSC 3HMXL 4RFOH 1IL1B 2WUCL 2ATKB 3ET9F 3K8MA 3LKSA 3HUJE 5DJ0A 4MGXA 1I1AC 5KJRH 3S35H 1BMGA 4LLVA 3VFPA 3FQTA 5IIEA 4LCCC 2GTZB 5IVNA 5T3ZD 1DBAL 1MREL 1VADA 1S7QA 2GEEA 5E7FA 1OAKL 2VLJB 4LHUA 5FK9B 1YNKL 2IBZX 2DB8A 3HS0A 3OGCA 4C55A 5B8CA 3TIDB 2AK1L 4PJ8D 1AHWC 3LQZB 2R15A 1KJMA 1J8KA 3S36H 4Q74A 3BEWB 1EDQA 3G04B 3FQNB 2OJEA 1A1NB 1FIEA 5EU6A 2H45A 2X4RB 4N0YL 4XBGA 5EB9A 4S1DD 5T3XH 1NCWH 5K59E 6CGTA 3LD8B 4WUKH 43C9B 5BZDA 1WK0A 2Q8BH 4RA0C 1QUNA 2AAVA 2V6HA 3TH4T 1FAIH 3BEVB 1BBDH 3UAJD 5HGGS 2DLFH 2AEIT 5DXWA 2VDPH 3TO4C 2V5RA 4LGRB 1FE8H 3O3UN 3M1BA 3W39A 5CP7B 3FB5B 4X7EC 4MXQC 2Z9TA 2WWKT 2NPLX 3HE7C 4P46B 4LCWA 3ZKXB 4PV8B 1EAPB 1IEBB 2IH3A 2PW1A 4Y4HB 2FECI 2EIDA 5ELIA 4PR5A 5F6HJ 4Z7VF 4LVNC 3DX8B 4YHML 3QUMB 1FNGB 4LLQA 4LASH 2HFGH 3ARXA 4ZFGL 3UYRL 5L0QC 1I7UA 4JRXE 5FIEA 3SKUD 5EN2A 1VEMA 3VXTA 3CLEL 5M94B 2IADA 4FQXD 4N5EC 4PJXB 2X4QA 4XAKD 3BZFB 1GXEA 3VXSA 1BD2B 5GIRB 5E08H 3SHSA 1E4XL 1HKLL 3QDJE 1E0OB 3GRWA 3O8XC 1SYVB 1IGJB 3QWRA 2ED7A 5FGCB 2Q86B 1BEYH 4ERSH 1OAZH 4YDIH 1MHEA 1T21A 1A7QL 4KH2A 4IRJB 3RTQC 4P23C 1T2JA 2XXMB 2R4RL 3ARRA 5F96L 3ARQA 4M6AA 1YPZA 3MOBL 3QI9C 3FFDA 1B6DA 4AEEA 5CJBA 4P3WA 4NKIH 4M93B 1N59A 3KYMA 5EPMA 3P4MB 1JPFB 4QXTA 1ZLVH 1SY6A 4Z95H 3BUTA 2HVJA 2K1MA 4F57H 4Z7QE 3GSWA 2H2PC 1OVZA 5E00A 3HC0A 4YJZL 3MBEB 3TZVD 3PABB 3RX5A 2IFFH 2YEZB 2WBJC 1LO4L 2F8OA 2O61A 1VGKB 1G7QA 3O3AB 3HAEA 3NFSH 1VCAA 1H0DA 3QQ4A 3LKPA 3P0YH 2ICWJ 3S88H 4PLNC 4LCYB 3FMGH 2PTVA 2PTTA 1CE6B 2EKSA 4JG1H 4XNYL 4WUUD 4NWUH 2Q76A 1YMHB 3ARFC 5D5ME 3P11H 2XKNA 5EIQA 3D2UD 4UTAL 1OM3H 2P44B 4O00A 4OV6F 1XGQB 5KVDL 4LKXB 1G84A 5E9DA 1B4RA 4NKMB 1U2HA 5IQ7L 1D9KC 2P8PA 2EDFA 1IILE 3O4OC 3DV6A 1DQDH 3QEUB 4YHKL 1HILB 3VH8G 3ABZA 1IEHA 3H0TA 5EA0L 3KDMA 2R1YA 1UA6H 4DKFL 1PW3A 4PRPD 5F9DC 2MJWA 4H1LG 4FNLH 1TPXB 5BS0B 5DO2D 1XAUA 4RAVB 3OJDA 5D7LA 1IGFH 1DBMH 3NFNA 3O45B 2VXSH 3VFVB 2BHUA 4Z7OE 1YEJL 3IFPA 3S6CA 3W11C 1YEFL 3FTGA 3LKSB 3MROA 4M00A 2PCPB 4LLVB 3VFPB 3FQTB 3B9KA 1YECH 4HWBL 5C0IA 3MRHA 4JVPA 1INQA 5F9JA 2NYYD 1VADB 1S7QB 4YBLB 4LHUB 3HS0B 3OGCB 5HHOA 5B8CB 4F3FB 1TJIH 5EU7E 2VDML 5KSAC 1KJMB 3ZDYE 2K7QA 1XF3A 1URLA 3MJ7A 1FN4A 3VI3E 2OJEB 5HYSG 5EU6B 2ZKHH 3HZMA 3DJ9A 4XBGB 5DJYA 2VUOA 4JY4A 1AFVL 4XCYB 1FZKA 3LZFL 5BZDB 4PG9A 1LP9E 4XB7A 1TVHB 3BP5A 1JGVL 4XPBH 1FL5A 2E8YA 3IDXH 3PWPD 5DEZA 2NMSA 1JCKA 2Q8AH 4HPOL 4R8WL 3M1BB 3W39B 2UZYB 4WEUD 1CGYA 2KBGA 4LCWB 4XMKH 1GGUA 4TNWK 4GG6A 2DLGA 1DQML 1FNFA 5GS1A 4P2OA 1J8HE 4KY1H 5HHMB 1F3DH 5EG6C 4F9PA 4UTBL 1BF2A 3U79A 1A64A 4TVSa 4HS6B 5FHAL 4JHAL 4PR5B 4KRNA 5DD1H 3STZA 3CK0H 5GZNC 3D39D 1I8KA 3D1MC 5E5MA 2HAZA 3CXDH 4LLQB 4MS8C 3V6FA 2AK4D 1RUAH 1BLNA 2B8OT 4WWKD 4OT1L 1I7UB 4NM8H 4NQXA 2AKRA 4TQEH 3C60C 4XX1E 5EN2B 3VXTB 3S97C 4C4KO 3LOWA 5CD5C 3FB6B 2IADB 1TETL 3AXLA 2X4QB 4MA7H 2JELL 3K2UH 2HTKC 3QSKB 4NHCL 3T0EA 3IDUA 4XPAL 5D1XC 4NN7C 1MHHA 2YKLL 2E7MA 1MHEB 5IV2A 1T21B 4FN0A 2BDNL 5ACLA 2Y23A 3QUXA 3GKZA 3WE6A 1CD9B 3BKCH 1YPZB 3FFDB 3MRCA 4QRRD 1YEHL 5DMKA 1MCJA 2G9HA 2GW5A 1N59B 3KYMB 4U1KA 4XRCA 1IM9A 5EPMB 2D31A 2DBLL 4QXTB 3WUZA 1KPRA 1JGDB 5D1QD 2VDOL 3CFEA 5DHXB 4EQ2A 5C6PB 2HVJB 1XIWB 1H3UA 5E00B 5D7JA 4XC3L 4OV5A 3WFZA 4JZJA 3MQIA 3FAXA 3SOBH 2O61B 3NPSB 1S9XA 1G7QB 3GMRA 4X0KA 3WXWH 3HAEB 3THML 4Y2DD 1UFUA 5ALCL 4OGAC 3QQ4B 3TVMA 4QXUL 1KCUL 4ORZC 4KTDH 4GW4B 5JXAL 1SVZA 2PTTB 3ULUL 2EKSB 3SE3A 3ZKMC 4PGCA 5F8RC 4ZO6A 4PIRF 4O9HH 2AEWA 2N56A 2XKNB 1FV1B 1JTOA 4XZUB 3EJZD 1T80A 4WGWB 1MEXL 1RY7B 1OAXL 2BERA 2P8PB 5I6XC 2NY2C 2APTA 3TT3L 4UQ3A 3DV6B 3ARFB 3SCMD 4QWWD 2NZIA 1L0QA 1H3GA 1ZVHA 5E2TH 3SBWC 3H0TB 4PJ8A 3BI9X 3KDMB 5CBAA 1KJ2A 4OCYL 1X5LA 7FABL 4G80A 1NH6A 2CUMA 4GS7C 4JANA 3VFMA 3EDFA 4K7PX 2BRRL 2HT4D 5HJ3A 1INEH 5L7XL 3WD5H 5I2IA 3PL6D 1KCRL 2Z93A 3OJDB 2QADC 3TH2T 5D7LB 4RWYL 3NFNB 1A21A 1PJ9A 4TSCH 3G6JA 3IFPB 5KSBF 3PP3H 2EH8H 3VGFA 3FTGB 1QEWA 4LKCA 1A3LL 1T66C 4NJ9L 3GM8A 3NH7H 3LDBB 4NO0B 3HKFA 3ZHDA 4L9LC 4OZHA 4OLZL 5ISZD 4M1DL 3MRHB 5EO9B 1F42A 3PQYE 5LGHL 5HHOB 2C7UA 2VIRA 3CFBA 4JO2L 1C08A 2BVEA 1XF3B 4WRLA 3HMWH 3MJ7B 1T2QH 1A7NH 3HZMB 5DJYB 4S1RL 2XZQL 4HCRL 4JY4B 1FZKB 4XWGL 3BRFA 4PG9B 4JKPH 3BP5B 4Y5YC 4LF3A 2NX5E 4DUWA 4AIXA 1FL5B 3EO1A 2UWEE 2LAGB 4RFOL 3MGTA 2D4FA 2MPAH 4MLIA 3VXPA 3MV7E 2BY3A 5DRZA 3SY0A 5BV7C 5KJRL 2ZUUA 1E27B 4GG6B 2ZCLH 3HLAA 5GS1B 4P2OB 5KANG 1AC0A 3ROLB 5JW4N 4ODVH 1KSRA 1TTUA 5DT1H 4A6YA 5DI8A 5C0BA 3S36L 1XF1A 4WHTA 3INUH 1QLEH 5CSGA 2Q87A 2QQNH 5T3XL 1NCWL 5E5MB 5KS9E 2R1XA 3V6FB 3QIUD 4WUKL 2P48B 4LRIA 4M5YH 1BLNB 2Q8BL 3WFEH 1FAIL 4RIRB 1BBDL 3BYTA 2NY0C 3MRJA 4NQXB 3FT2B 2AKRB 4K8RH 3TZVA 1RQ5A 1FE8L 3ZE2E 35C8H 3AXLB 1T20A 1P6AB 2R9HC 2OCFD 5KG9A 4MXWL 3E2HB 4DOHB 3T0EB 5MEND 4P9MH 1MHHB 3MV9D 2H1PH 4HLZH 2P8LA 1E4WH 2YSSB 2P5ED 4YBQD 5IV2B 2FO4A 3A6BL 3PV6A 1CU4H 2ZUQB 3N06B 3QUXB 4LBEB 3ZLQC 4WUUA 4OI7A 4JEGB 3MRCB 2E9JA 5DMKB 2GHWB 3D2UA 4CUCA 4LASL 2G9HB 2HFGL 3QR2A 5INCA 4UBDD 3TN0C 1EHLH 4EI5D 4U1KB 1IM9B 2D31B 1M7XA 3QO0A 1KPRB 2B39A 3WSQH 2OR7A 3CFEB 3GKWH 1IKFH 2XTJC 5DQJA 4J3VA 1A0QH 5D7JB 4OV5B 1UC6A 4OZGE 4IEFB 4JZJB 5E08L 3TCLA 3KG5A 2W38A 3L7FA 1MJ7H 3NACH 1S9XB 3GMRB 3GSOA 4X0KB 4PRPA 2OI9C 1BEYL 4ERSL 1NMBH 1OAZL 1HQ4A 4XPHL 4YDIL 8CGTA 1S78D 4WI8A 3W82A 4JFFE 3TVMB 3Q5OA 3NVQA 5GRXG 3ARBC 3O9WC 5F6HI 4FG6D 3CMGA 2UUDK 3CSBA 5B38B 4YDVA 4RGOH 1Q0YH 1UADC 4PGCB 3RWIA 4NKIL 1F02I 1A6PA 2DWEA 3W81A 5CFHA 4Z95L 3MCLH 4L3CA 3LB6D 1CXHA 2I27N 2G2RA 5ICZA 2FHFA 3V4PL 4OJFH 2IFFL 3KVQA 3FRPA 4PJ8B 4KJQD 4JQXC 4XNMB 5CBAB 2VZOA 4OB5H 3EYFA 2E7HA 1EHXA 1F3RB 4I0PD 1HHIB 5K9JL 4G80B 2DQHH 4JANB 4LEXH 3P0YL 2PO6C 3VFMB 1MAMH 1TZGH 4XMLH 5D70H 3S88L 2YXMA 3FMGL 4GLRI 5HJ3B 4QF1B 4KKCC 1IC5H 3W9EA 5I2IB 3WIFA 3SPVA 2Z93B 4NWUL 5KVGH 4J3SA 3P11L 3PWPA 4XVUD 1OM3L 2VDQH 3G6JB 3U2SA 4G8IB 2PR4H 3MYJA 4WJ5A 2IAMD 3H6JA 5C1MB 4LKCB 4I9WE 3AU1B 4AEIH 1DQDL 3OWEA 3SKNA 1OGAD 4QLRA 3HPJA 4Q2ZA 1PY9A 2YD7A 1YNLH 2C7UB 2VIRB 3CFBB 3KR3H 1NKOA 3SKMA 4DVBA 3D39A 5ESQA 1C08B 5B4MC 4OQTH 3Q1SH 4FNLL 1JYXA 2NR6D 4Z76B 2N1KA 5IJKC 3MCKA 4WWKA 4F2MA 3EYSH 3LKNB 1KLUB 1OTTD 1IGFL 1F2XK 2VXSL 2AGJL 2EECA 2H32A 2X7LA 3QEQD 4JQVA 4LF3B 5F9WC 4NQEE 3DRTB 3LS4L 4FQXB 4JHZA 4KMQA 1VHPA 3EO1B 3HUJF 5J3HC 3MGTB 3VXPB 5DRZB 3SY0B 3IDJA 4J3XA 3MUY1 1YECL 3GSVA 4BZYA 4OFYD 4PJ9C 3V5DB 4J6RH 4DEPB 3TNNA 4G8GD 2O5YH 2AABL 1F11A 1ZHKA 5T1KD 3MGAA 1TJIL 2C1OA 2EDRA 3V5HA 5F9AC 4PRDB 3T8XA 5DI8B 3QUYC 4KMTH 4WU5A 4QRRA 4WHTB 4F7CA 3GDBA 2NQCA 1NBZA 2VH5H 2WZPD 3SDDD 2ZKHL 5K59F 5SWZE 4JO1L 1G6VK 5D1QA 2DRUA 1C8PA 1R3KA 4CJ0A 2GJZA 3UC0H 3P77A 5F6IB 3W5NA 1V05A 3G9AB 3TZVB 4JB9L 3NIGF 1OT2A 1T20B 2GJ6E 2C3HA 4ELME 1QBAA 1SHMA 5KG9B 5J11B 1J0YA 4XMKL 1U8HA 5CGTA 4Y2DA 2K9UA 1PZ5A 2EIBA 1MCPL 3N50A 4GG8B 4KY1L 2P8LB 5K33A 3BDYH 1G7JA 1MI5E 3PV6B 5LKNA 5J6GA 2ARJQ 4QYOA 5DD1L 3TFKC 3CK0L 5D2LA 2AXGB 4Y7MA 4OBRA 4K07A 3RWHA 3GIZL 5I1AA 3CXDL 3D2UB 4Y5VB 4LU5H 1RUAL 1RIHH 3WEXA 5INDB 2ARWA 5INCB 4XI5C 2VO5A 3QO0B 2DWDB 4RFNB 4NM8L 1RSFA 4TQEL 3V4UH 2XFXB 5TDNB 3SCMA 4HWUA 3K2UL 3WFCH 1KC5H 3TCLB 1S5IH 1NBVH 4G9FE 4XCFH 3GSOB 4PRPB 5JHLH 5I0DA 1HQ4B 3LKRA 1S9KC 1CQYA 3N85L 3MV11 3ZYIA 3VDAA 2DKSA 4HWBA 3BIAX 4YDVB 1R5WA 2X1WL 3RWIB 3TWCH 3KHOA 4GRWE 2DWEB 5F7EH 5C0RL 1QA9A 4ZTOH 1F8TH 3FOLA 1RZJC 4Z7QF 2Y72A 4L3CB 4PREB 4PGJA 1TFHA 4TOYH 4FZEH 4GMTH 1B0GA 3IGAA 4WGVB 3QDJD 3VXQA 4N5UA 5DWUH 1FYHB 3SOBL 3WXWL 5JW5A 3C08H 3KJ6L 3LHPL 1JZ3A 4MJ6A 5FYLE 3S37X 4KTDL 2GIYA 2HLFC 3O6FA 2ADGA 5MI0C 5D5MF 3W9EB 4IDJH 4XHJD 3SPVB 5I74C 4LP4A 2W92A 3PWPB 1XGTA 5KSUB 3U2SB 3E6FA 4WJ5B 1UXSA 1CGVA 4NQCE 1U8OA 3EDDA 1CF8L 5SWSD 2VOTA 3SO3C 4TUKH 3SKNB 3RL1A 4ODBD 3LQAL 12E8L 5EC1A 5FDWA 4Q2ZB 3LEXA 3FN0H 4MLSA 5E2TL 3V4VH 4IOFC 4MB3A 5FHBH 1HK6A 3BRDA 1BBJA 4LOUD 5L2KE 4L8SC 5I8EA 1MY5A 4OQ1A 1JZ6A 3CVIH 1KCSH 3OPZH 1JI1A 4PD4J 3SKMB 1KCVH 3D39B 4DVBB 5ESQB 1OTUD 3QIUA 2AK4B 4P3CH 1JV5B 1INEL 3MCKB 4WWKB 3WD5L 5JDSA 4NC1C 2X4SA 1DDHA 4Z7OF 3V6OA 2Y36H 3LY6A 1I3VA 4LNVA 2X7LB 4TSCL 3NA4A 1WT5C 4QKXB 4H8WH 3LN4A 4FFWC 3RVVD 2FZ3A 3WO4B 4PJDA 4ZUTA 2Y25A 5DUPL 5MENA 2VZSA 5GRJH 3NH7L 1I1YA 4DGVH 5CZXD 3IDJB 2CK0H 3MV9A 2VXTH 1HIMH 3GSVB 1W72H 4KK9D 2P5EA 5DTFA 4AMKH 3TNNB 2D0GA 1F11B 4QHMA 3IAGC 1RZIA 2H41A 3KLSA 1L6XA 1ZHKB 3ZDYF 2FB4L 2C1OB 2CD0A 3V5HB 4F33A 3T8XB 3ZKNC 3VI3F 4QRRB 5JR1H 4TRPH 1NBZB 1A7NL 3R4DA 4EI5A 4M6MH 1LP9F 5I15H 5FUZH 5D1QB 1R3KB 3GMQA 4JKPL 5DD0H 2GJZB 3MO1A 1ZA6A 3P77B 1ULVA 1V8HA 3RWCA 5D1ZC 4HZLB 3JTSA 3I3DA 3VWJA 4CMHC 4Y0GA 4WI9A 3VXUE 4KPHH 1FC1A 1LO2H 4QHLA 4Z0XB 4Y2DB 4G7VL 3VD5A 2ZCLL 1PZ5B 1TLKA 1PVHA 3H3PH 1G9NC 1IKNC 1G7JB 4V1DE 4ODVL 1I75A 4H26A 5C0FA 5J6GB 3INUL 1QLEL 1T6VN 4QYOB 2L4OA 5LGKA 5D2LB 2QQNL 4QTIH 3RWHB 5I1AB 1LGVA 4M5YL 4NT6A 2IG2H 3UX9B 3RIAF 1KTLA 5D71H 3KWWA 4HK0B 2P42B 5IVXE 4X6DA 1QP1A 4XC1H 5F88B 3SCMB 2Y07H 3DGGA 4LIQE 1A7PH 1J8HD 2HYMA 4P9ML 1AGFA 2CKBB 2OJZH 1MVFA 5I66A 4I0PA 3T09A 1KPUA 4LLWA 1EVTC 1E4WL 1F13A 3QNZA 3E3QC 3LKRB 1YA5A 4PLKD 1CU4L 5KW9H 3PL6B 4U6TA 4YE4H 4E41E 1X5YA 2I60H 2ESVE 1WEJH 2CGRH 1R5WB 3HZKA 4RX4D 1P1ZB 4EUPA 4Y89A 2XWBA 3NMEA 1KYOK 3RY6C 2Q20A 4KXZH 2YWZA 2PXYD 3CIQA 1QA9B 5I8KL 2YZ1A 3ILQC 3WSQL 3FOLB 1CZ8L 1OGAA 2E8ZA 3GKWL 1CICC 1IKFL 2ZOKB 3C2AH 4PGBB 4HCRA 1A0QL 5ISZB 2FBJL 3VXQB 1GIGH 1CGUA 2C3WA 1DANT 2NY7H 1C5CH 5GGRY 3MFFA 3PXJA 5DJAB 3IAPA 3NACL 4OZFA 5JW5B 1KEML 4L1HA 1NMBL 4F58H 3QZWG 5E8DH 2M1KA 4MJ6B 1ND0B 3SJVA 4NIKB 4LLMA 3GHBH 2DMKA 3FHQA 43CAB 4RGOL 1CD8A 1Q0YL 3H8NA 5L8JB 4JFXA 3QEQA 5DRWA 1CVSC 3U9PH 4JN2B 2HA1A 4N0RA 1XGTB 1G7HB 3PJSA 4LVOC 2SEBA 5J13B 2R23A 3ULVE 3E6FB 3MCLL 1UXSB 2DMCA 4YXLH 5DRNA 5AYQA 3MNZA 2H6PA 4GW5A 5F1IA 3AMKA 4QOKD 4OFYA 2G5BA 1A9BA 3O81A 3F7VA 2XZZA 5EC1B 2E9WA 5LG1A 4G8GA 4OJFL 1SJXA 4UNUA 2LVCA 3LEXB 5JORB 3PGDB 4B7IA 3MYZA 5DVNA 1U93A 2QLVB 2OR8A 5T1KA 4UMGA 1BBJB 4XWOC 4HPYH 2PW2B 5IJVA 5I8EB 4IS6A 4OB5L 1MCSA 3GSRB 3MRMA 4W4OC 4LEXL 4X7TA 5I75B 1RAMA 1MAML 1TZGL 4XMLL 5D70L 2B0SH 1DANU 3QIUB 1IC5L 5D9SB 4LL9A 4TTDD 1DDHB 4X7SH 4LVHB 2GAZA 5L8KB 5KVGL 2YPLD 2P5WE 3QPXH 1YMME 4DJMA 1BOYA 4NKOA 3C5JA 4MAYD 3LN4B 3EYOA 2PR4L 4NFCA 4X7FC 1FVDA 4PJDB 4ZUTB 3C6LD 5I1EL 5MENB 5IW1A 4WTWA 3IS1X 1I1YB 3MV9B 4FQ2H 3F65A 1JNHA 2P5EB 5DTFB 5DMGC 2BVYA 5D2NA 2F5AL 3L9RA 3O2WH 4YIQA 4DW2H 1P2CA 1YNLL 3BJLA 5EDXA 5EORH 3KR3L 4UUJA 3C8HA 3HHRB 4XCCH 3QXVA 3CU7A 4JDTH 4OQTL 5E70A 3Q1SL 3ARGA 2BNUA 1GGCL 4QRTA 4EI5B 2HN7A 3EYSL 5GGUB 3WHE1 5KN5B 1U8PB 4N90E 4ZOBA 3GMQB 2HT3D 4CVZA 1ZA6B 3A6OA 1FFRA 3RWCB 3D18B 1FG9C 3MUZ1 2ORBH 3BAEH 3JTSB 4Y4KD 4K23H 1GH7A 2DLTA 5EZJA 4QHLB 3PQYD 2EE2A 2B7DT 1T1YA 4J6RL 3HI6H 5HI3C 5CCKH 4YDLB 4KK6C 3TYFA 4HIHA 2YC1A 4WI3A 3MLZH 1JRHH 1IGIH 1FZOA 4LSDA 2HJLA 4KMTL 3BH8A 3U9UB 5C0FB 3V7MA 5IKCA 5KS9F 5HGBA 2VH5L 3FN3A 3DI2B 5FM5M 1YY9D 4DZBB 3GB7A 2NX5D 3CJJA 4KKBD 4NT6B 4XTRC 3TC9A 1KTLB 5GJTH 4LRNH 3UC0L 3VGBA 1D7FA 3KWWB 4KJPD 5HGHA 5DJ2A 5A2IH 3ZE2F 3PDOA 3QDJA 4KI1A 4X4MA 4JG0L 3DGGB 2E3VA 3KYAA 2Y6SD 1NUDA 2DM4A 1X5HA 1LEKA 3DUSA 5JPMA 1CDBA 4I0PB 1KPUB 4FQQA 4LLWB 2EDJA 3DETD 3BDYL 1MF2H 1Q0XL 1KXTB 4BH8A 4JKMA 2O5ZH 3P3YA 1SMAA 5F7HA 5HPMA 4IRSA 2GITB 1QFHA 1J12A 3HZKB 4EUPB 2XQBL 4MQTB 2DIAA 5EO0B 2XWBB 4LU5L 2VERN 1RIHL 5CWSA 3RUGE 4MZ3A 4PB9H 1PG7H 2IAMB 1D5ZA 4CAGA 4Y8AA 4WVRA 2LU7A 4S11A 5SWSA 3CDGB 2BSED 3V4UL 1OGAB 4JGJA 1TZIA 1RUKH 3AS1A 1CIUA 3P9MA 4OZGF 3RDTC 3TBSB 1PEWA 2I5YH 3SE8H 4UILL 4YHOH 3ES6A 1A7RH 4OKDA 1WBZA 3UBXB 1KC5L 4PPTA 1S5IL 1NBVL 3CZFA 4OZFB 5IMMA 2XYCA 1R3JA 5I1IH 5JHLL 3JWDC 3V0VA 5EUOA 4R9HA 2HMID 3AMLA 4LLMB 1BQLH 1JYVA 1RJCA 1NGZA 5ACZA 5C71A 4N8VG 1FCCA 1AO7E 4RRPG 5L88L 4JFXB 3TWCL 2XG4A 5DRWB 1KPVA 4FOMA 4XAWH 2VDNH 2R0ZL 4R97C 3PJSB 3T77A 2XPGA 2AP2A 2SEBB 3LN9A 4ZTOL 1F8TL 3MREA 1P4LB 4G6JH 3UZEA 3MLRH 5IROA 4TOYL 3QXAA 4FZEL 5DRNB 3ZE1E 3B3IA 3MNZB 2H6PB 5F1IB 4L4VE 3QIWC 1FL6A 2G5BB 1A9BB 3FJTA 5FV2A 3R0MA 4G8GB 5IF0A 4LLYA 1KIRA 3B9KC 4PLOB 1U93B 1LILA 3KXFD 5T1KB 4HBCH 4X8XA 2UVEA 4R0LA 2EDHA 4M43H 5D96C 2FX7H 1WICA 4IS6B 5E5RB 1DUZA 4K71C 1NMAL 1ROWA 1X4YA 3MRMB 3NCFB 1JK8A 2VNCA 4X7TB 3SDDB 2JJTA 4UNTA 1NUNB 1YJDH 3TIEA 3L3IA 2D4DA 5HI4C 4QNPE 2DLEA 4MD5A 5ADPL 4ELKA 4NCC2 4IDJL 3P4OA 2GAZB 3MA9H 5GSRA 3QIBD 1ZT1A 5EU7C 2VISA 4Y19E 5IHLB 4NKOB 3C5JB 4PBVC 2PYEE 1HHGA 3EYOB 4OI8A 4MA1B 1W0YT 5IW1B 4TUKL 1EAJA 4EIGB 3ARSA 4PJ7A 1JNHB 2AERT 3FN0L 4ZMAT 3V4VL 5FHBL 5D2NB 2CLZA 3L9RB 5F7LB 2E27L 5MHSE 4YIQB 1P2CB 3OAUL 3CVIL 1KCSL 4UUJB 3OPZL 1KCVL 1UWXH 2FJFA 4ZPVB 3U4BH 4XH2A 4L4TE 1NUGA 5CJXC 3AM8C 4P3CL 3MLVH 1GC1C 1TIUA 2BNUB 4QRTB 1X9QA 2HN7B 1NANI 2PYFA 2HKHH 1LDSA 2Y36L 4CVZB 4JREC 5E6ID 1CCZA 4ZXBC 1JGUL 5IFAH 1J8HA 5GRJL 2A77L 4CU6A 4DGVL 2PN5A 2VXTL 5EZJB 4XB8A 2CJUH 1W72L 4GFTB 1WVZA 1T1YB 4AMKL 1FGNH 3ALWA 4X6EA 4POYA 5J6HB 1KV3A 3TYFB 2FGWH 2YC1B 3MNVA 1HH9A 4OF8A 2FYYB 1QFOA 1FZOB 3CX5J 5HHVH 4RX4A 2LU4A 2HJLB 4PRHE 2DBJA 3QDAA 1KUMA 4XMPH 5JR1L 4W81A 5DF0A 5IKCB 1W0VA 5HGBB 4U4BA 4MNGE 4M6ML 1K4CB 1B4JH 5I15L 3GB7B 4IOSD 3WN5A 3SDXA 5DD0L 3BIBX 4PJHE 5I1DB 4XNQA 5DJ2B 3IDGA 3MA7A 3QDJB 4PJFA 3L5XH 2XT1B 1ZLVK 2ZZUT 2YUXA 4KPHL 1LO2L 3S36X 5HI5D 1ZVSA 3DUSB 5JPMB 2C3GA 3IT8D 4OM0H 3U82B 1XGRA 3H3PL 1UWEH 1ZWIA 5J1TC 3ZDXE 4WTXA 2QL1A 4B0MM 4BH8B 4YLQT 1QNZH 2PUQT 5SWZD 5TQ2H 3DXAE 4WEBH 5HPMB 1KT2B 2IH1A 1FSKB 4QTIL 4R7NA 1HQRB 1OB1B 4K9EC 5CWSB 4S2SA 1OSZA 5D71L 5SWSB 4H88H 5CAYB 3D25B 3GHEH 2GJ6D 4QOKA 3NZHH 3X14A 5L2JA 1TZIB 2Y07L 3GM0A 3P9WB 4LDEB 5A2FA 3AVEA 5CEZH 4ZUSB 4M7JH 3EJJX 1WBZB 3RZCC 4ODSH 1A7PL 1JF1A 4F7PB 4P2YA 3O3EB 2OJZL 3CZFB 5IMMB 1R3JB 5FDYA 4L5FH 3V0VB 5EUOB 2YD3A 2C3XA 2NZ9C 5D5MB 5KW9L 3WS3A 1CFBA 1VSCA 4YE4L 3BPLC 1NGZB 5ACZB 2J5LC 2I60L 1WEJL 3O2VL 1BAFH 5TJWK 2YPLA 1JN6A 4GRWF 3SGDH 2A38A 1KPVB 4X9GA 4MAYA 3TJHD 2CKNA 4EOWH 3T77B 1BJ1J 3T3MF 2XPGB 5DYOA 3C6LA 3C5SA 2OR9H 5IMLA 1V7NH 2IBBA 5TDPA 1NGXA 2H3NB 4AH2B 3QXAB 4G6AD 4PJGA 3C2AL 3B3IB 5C3TA 5I1GL 1FL6B 1GIGL 2YD9A 1I85A 2D7OA 4C4KT 1ITBB 2NY7L 5FYJE 1WLHA 2OYPA 5IF0B 4LLYB 1KIRB 1HXMB 4LEOA 3DPBA 4R0LB 3QG6B 1N5AA 4G5ZL 2XOTA 3BUYA 5E8DL 4AL8H 1DUZB 3P73A 1K4DA 4GKOA 1LNUA 2C26A 4I18A 1WJ3A 1G0YR 1WSST 2JCCA 3L3IB 4MD5B 4Z6AT 3L3KA 4ELKB 1YEGH 4LSVH 3P4OB 3U9PL 5GSRB 4E0RA 1ZT1B 1UKQA 2VISB 5D6DA 1J86A 1YEDA 5JLZA 2C5DC 4Y4KA 4H1LH 1U8NA 3U0TA 3IDMB 1R0AH 1AY1H 4YXLL 1EO8L 4U6YA 5DDHA 3PQYA 4EQ3A 4GRLC 1Q72H 3QP3A 3EO0A 5SX5K 4LSSH 3L6FB 4TYUA 1NEZA 4PJ7B 4DQOH 4MZ2A 3BGFC 2CLZB 4Y5XC 4HPYL 5C0AE 5SV3A 4NKDA 2A0LD 3B9AA 4RSVA 2FJFB 2B0SL 3H9HA 1EGJA 2NX5A 1HINH 5JQHC 1BJ8A 3PUCA 4JM2D 2AJZA 1B88A 2UWEA 1PGRB 2QTEA 4WO4D 5C0JA 5C92A 2PYFB 1QHOA 4QCIB 3HNVH 3L5JA 3QPXL 2YD6A 3V5KA 1MLBA 5EIIA 3QUMH 2ICEA 5DS8A 1G7MA 2EYTA 4YK4B 4OCXH 2UVFA 3R0NA 1CR9H 4KDWA 1J8HB 1OL0A 5GQBA 1A14H 4XCEA 4UOW0 4FQ2L 4LSPH 2YN5A 2F5BH 1J0ZA 1H3TA 4RMWA 3O2WL 4MXVE 4X6EB 5C9KA 4DW2L 5GXBB 1HH9B 1B0RA 2MOVA 5EORL 1I9EA 1LVEA 4GBXD 1WGOA 2WWKO 2R29H 1W0VB 1C5BH 2WK2A 3ULUF 1MSPA 2PXYB 1KEGH 4WFEE 4Q58C 3WN5B 4HG4K 1QFWH 5LWYL 1NAKL 1AE6H 3QFJE 4XNQB 1VEPA 2VL5A 3MA7B 4PJFB 2ORBL 2NY5C 3BAEL 3FQUA 3MOAH 4YFLF 1QHPA 4LAQL 5C0GA 4K23L 4HKZA 1WTGT 4PP2A 1CFQB 4N0UA 1Q9KA 5HPOA 1CT8B 3C5ZD 1WWWX 2XI9A 1ZVSB 3HI6L 5CCKL 1OAUH 3L3OA 5C0CD 2CIIB 1OHQA 3MLZL 2DI9A 4FQCH 5IEHA 4Y16A 1IGIL 1ED3A 4MQSB 1U58A 5KAQF 5HD8D 2HG5A 1HE7A 5DK2A 4R7NB 1BQSA 1GGBH 3LSOA 4S2SB 5IVXF 3VU2A 1Z9MA 5GJTL 1OSZB 4LRNL 5F72S 4QOKB 3X14B 5L2JB 3VXUD 2E7BA 3HZVA 3KXFA 1QRNE 2QQLH 1JF1B 3H42H 3U0WH 2FDBP 3ULSA 3ZT6A 3U46A 1VGEH 3VRLE 2AVGA 1NCCH 3HR5A 5EZOH 4BFEA 1MF2L 1PKQA 2R2BB 4S0TD 4ZD3H 3WS3B 5FO9B 1QVOB 4TUJA 1UEMA 4F80A 2YPLB 4L1DA 3QIBA 4NUGH 4D9QE 2R2EA 3O2DH 4MAYB 5ECJE 4PB9L 1PG7L 4N9GA 4AJ0A 3O0RH 5DYOB 3C5SB 5IMLB 5TDPB 4BQ8A 1NGXB 2FRGP 3FQXB 1N6VA 4MJ2A 3QXUA 4LSUH 3PP3K 3MRBB 2I5YL 5E2WL 3SE8L 2NY3D 1F4HA 3WUWA 1A7RL 4GXVL 4F15C 4LEOB 1WCQA 4ODXB 1S7WA 3JVGC 1N5AB 5I1IL 2CQVA 1WWBX 3BUYB 2GQHA 3CH1A 4E41D 1K5NA 3P73B 1K4DB 1LNUB 4I18B 2VSCA 1T1WA 3BP4A 1OTSD 5ESVA 5CUSH 1T6WA 5C2BL 2DQGH 1VPOH 2JCCB 3EGSA 4MQ7A 1L9MA 3L3KB 4JFDD 4PGEA 5JZ7D 5E6IA 5ETUA 4XAWL 4E0RB 1DN2A 1GHFH 4HGMA 3ULVF 1UCBH 2VLRE 1YEDB 4GQPH 4EEEA 5JLZB 3O41A 4Y4KB 3MXWH 4JQVC 1U8NB 4S10A 5JOFA 3MLRL 1U8JB 1F4XL 3OTTA 4U6YB 5DDHB 3PQYB 1VDGA 3EO0B 1F4WL 3CFDA 3P40A 3VMNA 1NEZB 2LTQC 1DLHA 2N4IA 5HYIA 1HYSD 3TESA 4M43L 2FX7L 1A9EA 5DD3L 2BNQA 5JHDE 1NANH 3UTQA 5BW7C 4K7PH 4NKDB 4F37K 2YBRB 3NA9H 2GUOA 3H9HB 2GY5A 1YY8A 4XPFL 4HIXH 5GS0C 2NX5B 4FFYH 5IVZA 2AJZB 5TFSH 2BY2A 3UTSE 1RZ7H 1B2WH 1HHKB 1MOEA 2UWEB 5C0JB 1L0YA 3MA9L 3QG7H 3ULVD 3V5KB 1MLBB 5EIIB 1GPOH 2ICEB 1OW0A 5DS8B 1R3LA 4OLVH 4HMDA 1X5AA 5F21B 3ZTJG 4MMXC 3KJ4C 2CSPA 4XCEB 2ZCHL 1E28A 1M4KA 1CXKA 3GMOB 2J8UA 1FL3A 3EUUA 1B0RB 3MGOA 2BSSA 3T0BA 4YO0B 1BFSA 1NGYA 3EOAA 1BX2A 3MLVL 1A1MB 1X5JA 3B5GA 1YMMD 1IFHH 3JWOH 2HKHL 2GJ6A 4J3TA 3W0WD 4ELMA 2X10A 5IFHH 2UYLA 3KS0J 1NCAL 3A67H 1P84K 4X9FA 4YQXH 4Z77A 5IFAL 1JZ4A 2ICCA 3DMMC 2D7PA 4HKZB 4W6WB 4Q9CA 4XNUH 4N0UB 1Q9KB 3MFGB 1U3JA 5KSVA 2CJUL 3FO0H 1MCLA 4JFHE 4OCSH 4JFQA 1FGNL 4JFEE 5BVPL 1NCDH 3L3OB 2FGWL 3HI1A 5IEHB 4MNQD 1WFOA 5IM7A 5HHVL 1ED3B 1U58B 5GRVL 3HAEH 4P49A 4XMPL 2DM3A 3OMZA 1MFBH 2HG5B 3AS0A 4UIMA 1UT9A 3CXHJ 5DK2B 4MJIE 5E1HB 1MJUH 3IU3A 3K1DA 4EN3C 3RWDA 3LH2L 2DL2A 1EEZB 4M8QA 4X98A 1KTDA 4KVNH 5DEFA 3L5XL 4DN3H 1N0XH 5F9OH 1QPPA 1N26A 3HZVB 3KXFB 1T2XA 1NJ9B 4U1MA 3KLAA 3ULSB 3QFDA 4OM0L 1HYRC 3U46B 1UWEL 3QISA 2OL3B 4LLAA 1W2KT 2J8HA 3ZL4H 1D5XB 1PKQB 4Y4FD 3RVXD 3OG6B 4QXGH 4M9PA 1FG2A 5TQ2L 2VZTA 4TUJB 4WEBL 2BCKA 1J05A 3O6FC 4ZNEA 3QIBB 4GAFB 1EUTA 3SGKC 2R2EB 5TE7L 2YPKA 4YC2B 5TE6L 5JOEA 5ICXA 1T89C 4H88L 1JYNA 3NZHL 3STBA 3I02A 2J88H 2FBOJ 3WUWB 5CEZL 4PB0L 1Y0LA 4M7JL 3RL2A 2H8PA 4ODSL 2VLKA 5LBSH 3T1WA 1S7WB 4L5FL 3SDAC 3IJYA 3BPNB 3CH1B 1K5NB 4JM2A 3BP4B 5ESVB 4X83A 2FD6H 3EGSB 4WO4A 1W72A 4MQ7B 3IDIB 1BAFL 2DTSA 1OPGH 5DUMH 3PIQB 3X17A 4WHYH 4Q9BA 4TVPH 5E6IB 2ARJA 5ETUB 2FO1A 4EOWL 1FJ1A 5CGMA 4H0IA 2OR9L 5DHVA 3O41B 1SBBA 5JOFB 4C56E 1HKFA 5C09E 2A2QT 3QAZC 3E1F1 3PWJA 1XCQA 1SEBA 4KRPC 2VDLL 4OIIH 1V7MH 1CGSH 3CFDB 1INDH 3X3FL 4F9LA 4XP6H 1QSZA 1DLHB 2DF3A 2VE6A 3G9VA 3LPFA 4GBXA 1A9EB 4AL8L 1ZS8B 3UTQB 3GI8H 5BZWA 1EMTH 4UOW1 1AO7D 1TQBC 5E99H 4QNPF 2GUOB 1A6UH 1YY8B 3AB0B 1KENH 4MAUH 32C2A 1GZPA 3BT2H 3MLSH 3QXWA 1YEGL 4U6XA 4ZPTA 4KFZC 2X2YA 4L4VD 1D6VL 1R0AL 4ZUWA 1AY1L 2CRZA 4M48H 3C5ZA 3ULUC 3EOTH 1Q72L 3VWJC 2WNGA 1A6WL 4LSSL 4QHKI 5DFVD 4N8PA 5C0CA 3ZSTA 5E5UB 1IARB 1CBVH 1E28B 3RZWA 1H8SA 1JHLH 1JWSA 2CIKA 3GI9H 4IHOA 2J8UB 1FL3B 5ENWB 5SWZB 3MGOB 4MD0B 5B3NA 2BSSB 3EYQD 2W0KA 4P5TC 2Z35A 3T2PA 1NGYB 3EOAB 4HKBA 5AUMA 3U7WH 1HINL 1FORH 4UNVA 3VI4E 3HG1E 2VR5A 1XZ0A 4Y19D 3OKYA 5A16A 1WZ1H 5EOTA 1DSFH 2GJ6B 4ELMB 5C0ND 2UYLB 3I3EA 4OCXL 4Z77B 3TA3C 1CR9L 1N4XH 4GXUM 4PTUB 4L3EE 2J6EH 1NBQA 1MI5B 4LSPL 3UJJH 3C09C 3OX8B 4JVWA 3BVNA 4JFQB 4XHQA 2DQUL 4XNZC 4ENED 1FNLA 4P2RD 4KQ3H 4WV1C 2Y1VA 3HI1B 2BRQA 2VWEC 2KH2B 3FRPG 1LO5A 2MWCA 1TZHA 1C5BL 1F45A 3G6AA 5AAMA 5E1AA 4UIMB 3WYRA 4OKVB 2RIKA 1S9YA 4JFZH 3M45A 4P5KA 4NQDE 3IU3B 4PJHF 4XVJH 3RWDB 2XN9A 3VFNB 1QFWL 4UAOB 2NXYD 3AY4C 1AGBA 1I9RH 3CFCH 5DURB 4X98B 1KTDB 5CJOL 3MOAL 1WF5A 2NY4D 3VFUA 1JPTH 3O6LH 1HNFA 1JYWA 1R5IA 5CGYC 1EEYA 2CPCA 4U1MB 1BM3H 4P0DA 3KLAB 4GQ9L 4N0FB 2DQFA 3QFDB 4KGJA 1PQZA 1OAUL 1RUQH 4ODTH 3EDJA 3QUZA 4PRHD 4Q0XL 1A6TA 4FQCL 4CADA 3DX9A 2R0WL 3MRGA 4JR9H 1FG2B 3A0OA 4JFDA 4OD3H 5CILH 1J05B 2VN4A 1XEDA 1UH4A 1AQKL 2ICWA 3DO3A 3L3JA 4PJIE 1GGBL 3NGBC 4XP9H 1WWAX 2NXZD 2X6MA 4BKLA 5DLMH 2P47B 3BWAB 2DD8L 1SJEA 4Y1AD 4ZNCD 2EDEA 2ZPKH 5ABDE 3I02B 4APQD 2XV6B 5FYKH 1Y0LB 2G60H 1G7PA 5ALBH 4I3SH 5D7KE 4KTYA 3H42L 5EC2A 3U1SH 1UYWH 2FSEA 1VGEL 4ONGH 1HZHH 5C07E 5BO1H 1NCCL 5GGSA 1I7RA 5LQBH 3A6CH 3E0GA 4FTVA 4OSUL 3DXAD 4ZD3L 4JM2B 1LEGA 4YAQB 4KKLD 1WAAA 1WC7A 5I0ZA 4WO4B 5MERA 1W72B 1U8IA 1T5WA 3UTTE 4NUGL 5HVWA 3BQUC 3E8UH 3O6MH 4I77L 4K3JH 1AR1D 2LU3A 4I0KA 2XRAH 5CJ5A 1FJ1B 3V9FA 4UV7H 5DHVB 3P0VH 3WLWC 4IOIA 4GH7B 1U91A 3PWJB 4PS4L 5TF1H 1XCQB 3HR6A 3H9SE 1Y6KR 1SEBB 3RNKA 1JF6A 1CDGA 1IBGH 4U1GB 3D5OF 1FLRH 1S3KH 2VE6B 1M7DA 4GBXB 4JPWH 1ONQA 2ZUYA 1RZFH 2FEDD 5BZWB 1CIDA 4PV9A 3GSUA 4PJCE 5CUSL 3K8KA 3WNPA 1CFVH 2D2OA 3B8YA 1GZPB 3VGEA 1HI6A 5BV7H 3ARGC 3W0WA 4HS3A 4BQCA 3HE6C 2EE6A 1GHFL 1UM6H 4PUBH 4ZPTB 5IWLA 3L1OL 1UCBL 4WFFE 2WWMC 2GK0A 1ZANH 3MXWL 2CDFA 2VB5A 4ZUWB 1S7XA 4GKZA 1O7SA 5FYJD 5B39A 3C9NA 3C5ZB 4PJ5E 3BISA 4UIKH 4TN9A 1U42A 4MQXC 2EXWD 2XTJE 5C0CB 1P9MC 2A9NH 4MNQA 1JWSB 2CIKB 4HHAA 4IHOB 5IBLC 1P5UA 2EDYA 4PJBA 1Y18A 3QA3A 1Z5LA 3NA9L 1Z3GH 2Z0BA 1H5BB 2Z35B 3L95B 5E4EC 4HKBB 1CK0H 5AUMB 1WQVT 4FFYL 1UZ8A 1RZ7L 1B2WL 1XZ0B 2F53E 4XCNA 5A16B 3MOQA 5EOTB 4V2BA 1FPTH 3DVGA 1WIUA 3UP1A 1GPOL 3VXUB 3UPRA 2W07A 3MRLB 1DL7H 3S5LB 2WBWB 5HDQH 4OLVL 2AXJA 1G0DA 2DL9A 2NLJA 4F7MA 1CTOA 1JGLH 1MCNA 4HJ0D 4J12A 4MXVF 4Q6YA 3DUHA 5C0AD 3BVNB 4JZNA 3H7LA 4Y4FA 1EUUA 2VKWA 1TENA 1U8QA 4MHHG 3DIFB 3WJJC 3HI5H 2ZUVA 3QPQC 1QSFE 1LO5B 3BN9C 1VACA 3G6AB 5BVJA 3OAZK 5E1AB 2NY1C 5L6YH 4IRSC 4P5KB 1UWGH 4GSDH 3MBED 1X5GA 3MJ8A 1MREH 4RGNE 1U6AL 1AGBB 2WP3O 2NY3B 3TYGH 3A67L 4YQXL 4BQ6A 3RVTC 3QQ9C 4O2EA 2APFA 3RVWC 1XT5A 4LLDA 4XNUL 1R5IB 1EEYB 4LSRH 3F12B 3FO0L 2DQFB 1VFAA 3GNMH 4E41B 1MFDL 1PQZB 3LEYH 4ZSOE 3DHMA 5JOPE 1NCDL 3CC5B 4CADB 2MCG1 5IBUB 3DX9B 1JJUA 3RUGA 4I2XA 3OKNA 4JCMA 1GL4B 3MRGB 3VXNA 4JFDB 3JZ7A 1JNLH 1MFBL 2W0LA 5IB3A 5H37H 1OARH 4PG2C 3RQ3A 2FH8A 1MJUL 5SX4I 3L3JB 3QFJD 3OKKA 4ETQA 4KDTA 4KKAC 3FZUD 4BA8A 4LQFL 3PWVA 4Z7UF 2M26A 5H8DA 4KVNL 4DN3L 5F9OL 1IRAY 5JUEL 2CDEA 3PWLA 1A5FH 4P2QA 1D3CA 4WCYH 4YHMH 5EC2B 3VRLF 5CS7A 1S7RA 3S8WA 2FSEB 3ARED 4W4NA 1AO7A 5GGSB 4WHCA 3UYRH 3IKCA 1CVRA 4MWFA 3ZHKA 1LEGB 1QO3A 4HMEA 4BH7A 2ERJB 2EDKA 3CLEH 4LPCA 5MERB 2JJTC 1U8IB 4R2GC 1IC4H 3OKLA 4JHBA 2L0DA 3KPSE 1WCBA 2IPUK 2YUZA 4ZAKD 2OK0H 4WHDA 5IESH 4QGTA 4NNYA 1U91B 2J88L 3QB7C 1EVUA 1I1AD 1Z9SA 4YHZH 1RHHB 2DI8A 3T0WA 2XG5A 5LBSL 4OD1L 1DE4A 3P0GB 3UPAA 4P4KC 1M7DB 4JFPA 1T0MB 1ONQB 5DJXA 4Z18A 4RMUA 3GSUB 3S4SA 3LAFA 2FD6L 1YMMB 4Y88A 4Y19A 1BJ1H 4CRPA 4D9QD 1L4IA 2LABA 5DUML 4HK3J 3W0WB 2GCYA 4HS3B 5JIPA 2ZG3A 2M8XA 3RWEA 1LO4H 1X5KA 4KUCF 3L3DB 3VRIA 5HDOA 1NC2D 2GK0B 2V2WA 1S7XB 4GKZB 2W9EH 5B39B 3C9NB 3TO4D 1V7ML 1CGSL 4N0CC 1T04A 1INDL 3D0LA 2E9BA 4MXQD 4HF5H 4P2RA 5KAQG 3HE7D 3QDHA 5EZIH 3OKEA 4BFIB 4MNQB 4KI5E 1J5OL 2RFXA 4HHAB 2YK1L 3RJDA 4UTAH 1Y18B 3GI8L 1EMTL 4M1GL 5E99L 1A6UL 2MQCA 1L7IH 1TQCC 5SWQA 3LEVH 1KENL 4MAUL 5MEQA 3BT2L 3MLSL 2WAHA 1UCTA 1SVCP 3IVKA 4FMFA 5BQ7A 3UPRB 3MLYH 4QRPE 3WDHA 4P9HC 5EZLA 2JF1A 4M48L 2NLJB 4F7MB 2GT9B 3EKCA 3EOTL 2F74A 4N5ED 1Q9WB 5C7XH 1U95A 5JHDD 2QSTA 4O02H 1RU9H 5DD6A 4Y4FB 3WBDA 5E6YA 4BFGA 3GI9L 2Z8VC 3O8XD 3BHBA 3BSZL 2BOBA 4CW1B 1U8QB 4IJ3B 4MSWA 4KTEH 3HCVA 1YEJH 2CKBH 1MIMH 3IRPX 5FOBA 3X3GH 1AXSA 3RTQD 4P23D 5IK3A 3UTSD 3U7WL 3QT2A 4X9BA 1F5WA 1YEFH 5BVJB 1EO7A 3QI9D 4Y1AA 1DSFL 2AEPH 1NFIA 3IXAA 5F97E 5HVHB 3MJ8B 4APQA 2VRAA 5DR5H 5LVEA 2NY1B 4XGZA 1N4XL 4BK4A 2J6EL 3ZYJA 3JSSA 4XNXH 4LLDB 5DJDA 2H2PD 4NN6C 3UJJL 3UTPD 7CGTA 2DLIA 3KLHC 4JFOB 4WI7A 1O5DT 1VFAB 3BMVA 2WBJD 3DX6A 5E7BA 1RVFL 3PNWA 4ZO7A 3REWA 3VFRB 4KQ3L 2VC2H 1KJVA 5CHNA 1RZJH 5CMAA 3RUGB 1T22A 1OD9A 5T5NF 3VXNB 5F7DA 1SJHA 1X4XA 1IL1A 2ATKA 1BVZA 5IB3B 2VLJE 4PLJC 1BPVA 3OQ3B 5KBNC 4JFZL 3ARDC 2BX5A 1J0HA 4XVJL 3OKKB 4ETQB 4ACPA 3ARFD 5BRZE 4WFHE 1DQMH 3ZZ1A 5AYUH 3CFCL 3PWVB 1RULL 5FK9A 4OCWH 3VH8A 2AJXH 1T83C 2XWTA 3DWTA 1JPTL 3TT1L 1D9KD 1OD7A 2IANE 1K3ZA 2CDEB 2W60B 2VLLA 4WW2F 1I85C 5C6TH 4PJAE 2A83B 1S7RB 4H1LA 1AO7B 3B2VH 5CJQL 2K7PA 3IKCB 1XGPB 4MCZB 5FA3A 1QO3B 4U0RB 5CILL 4OD3L 3I85A 4BH7B 1PY4A 5I18H 2CLRA 4NHUA 1I1FB 2JELH 2AQ3A 2D7QA 3OKLB 1FVEA 2Z91A 4ONHA 4XP9L 3VRJB 4YUEH 5J57B 5FF6A 4L4VB 4LSTH 4X6FA 1U41A 2YKLH 1WCBB 4JN1H 2Q3AA 1XR8B 4WI4A 3KPMA 4MCYA 4DK6A 4NNYB 2MCPH 2Q7YB 3W11D 5FYKL 5AZEH 2VQTA 5ALBL 4QT5A 4UU9A 3DX8A 3U1SL 4AQ1B 1UYWL 1DE4B 1HZHL 3PHOA 4JFPB 4HUVA 4G43A 5DJXB 5HYSA 4K8RC 3A6CL 5LQBL 5K9QG 1BD2E 3MRFA 1PG7X 1NCNA 3OB0K 4Q6IA 5KSAD 3T3PF 4Y19B 1IQDA 1J1PH 5FGCE 3O4LE 4M6NH 4PJXA 1UWXK 4MB5A 3BZFA 2ENSA 2GCYB 4ZOEA 4XC3H 1RV6X 5GIRA 3E8UL 5IR1A 1OLZA 3O6ML 4K3JL 1XGYH 3RWEB 5J12B 1U3ZA 3SDCC 5MP6H 2XRAL 1F58H 3VRIB 3SGEI 1IGJA 1TJHH 2MNUA 4HT1H 1L7TH 4UV7L 3THMH 8FABA 2V2WB 3EOYG 4MD4A 1MELA 1KCUH 5C0AA 3BJ91 3VD7A 4FMKA 1T04B 1IBGL 3D0LB 4P2RB 4HULB 1NMCB 2LAAA 4CDHA 4G3YL 3I3BA 1FLRL 1S3KL 3OKEB 3SDYL 5EU4A 1JWUA 4X5LA 2RFXB 1RZFL 1I7TA 3V8CA 1JPFA 3UDWC 3T0DA 3JUYA 2FATH 5DEGA 5SWQB 1MEXH 3E3QE 1VFBB 5MEQB 4P3DA 5GZND 5BV7L 5GRVK 3TT3H 3MBEA 1GGYA 2NXYB 3PABA 4IIQA 5IQ9A 2G75A 4EBQH 2BNRD 3IVKB 1EBAA 1CD0A 4MS8D 3S96A 5BQ7B 1UM6L 2JE8A 4H0GA 4PUBL 4C56D 1VGKA 3WFDH 2D7NA 1DVFC 3O3AA 1NFDF 2WIIA 1ZANL 2NY4B 4MMZC 4C59B 3RI5K 3RKDC 2BJML 3C60D 5EZLB 4YGAB 2OP4H 3RGVB 4FHBD 2X4PA 3IB4A 5CD5D 2D0HA 1FP5A 2F74B 1CE6A 2BRRH 1R3IH 5L7XH 2HTKD 4PRHB 1E4KC 1U95B 3SGJA 4ZTPH 5D1XD 5DD6B 4OCMC 1YMHA 1M71A 3MXVL 4RWYH 1SJVA 3BHBB 2RBLA 3FO2A 5FM5O 1CLYH 3CMOL 1MPAL 5F7MC 5FOBB 1AXSB 4Y16C 1Z3GL 4AYFA 3VI4F 4PJHB 2ZUTA 2VABB 1DLFH 1S7TA 1WFTA 4P48A 2NXZB 4B7LA 4ZUVA 2W9DH 3QJFB 1HILA 4M62H 5F93C 5IW3A 1NFIB 4OLUL 1FPTL 4OLZH 3IXAB 3HNTH 4APQB 5I1KL 4WI6A 1U3HC 3QCVH 5F44A 2VLME 4XGZB 1N6QH 5DJDB 6FABH 5F7UA 5BS0A 3AREA 5ESAA 1FO0L 3NCEB 1S7SB 1X7QA 3VXRD 1P7HL 3DX6B 3DXAB 3PNWB 1Z0NA 1N8ZA 4AZ8A 1KJVB 5CLWA 3GUTA 1HWGB 3HI5L 4JJHA 5CHNB 3MZGB 4CVXA 5CMAB 2IQ9L 3HG1D 4OGAD 1QBLH 1SJHB 1U2CA 3FO1B 5F7DB 1WFUA 3TPUB 4HWNA 4KROC 1QZ1A 3F58L 5L6YL 2ADJB 2PCPA 3ZKMD 1P4BH 1U8MB 1UWGL 4GSDL 4ZAKA 4MNHB 2J4WH 1C5DA 2JJSA 5EU6E 3P4NA 4L3ED 4D3CH 3TYGL 3VH8B 3D3VD 4HDIA 4F3FA 2XWTB 4PJEA 1I1AA 4Z7WF 1IGTA 4OZIA 4YZFE 2RHEA 2NY2D 2VLLB 3KPRE 4LCCA 5E03A 1F3JA 2XQYG 4LSRL 2YRLA 4H5SB 4Q9RL 2X70A 3GNML 3LEYL 4H1LB 4XCYA 1LEIB 2PETA 1AHWA 15C8H 1TVHA 1I1CA 1PX3A 4WDIB 5FA3B 4JAMA 3JWNC 3NCYP 1JNLL 2IMNA 4NQDD 4FRWA 4PJIF 5E2UH 2CLRB 5FYKD 1OARL 3PXHA 4NHUB 5DRXA 2Z8SA 3NIGE 4GRMB 4MXWH 4ONOA 4OAWA 1IZJA 1FVEB 1NC2A 2Z91B 4ONHB 2QADD 5FF6B 4X6FB 1L9NA 3Q6GH 5EU5A 4K3HA 1KJ3L 3TO4A 2AJSH 2EC9T 1DFBH 3KPMB 3A6BH 4MCYB 1N0LA 1EO5A 3HE7A 4HS6A 1T66D 4KK8D 1A5FL 4QT5B 5I8CA 4UU9B 4M7KL 1J11A 4WCYL 1Z6JT 5I19H 3PHOB 1UJ3C 4HUVB 1M05A 4G43B 4YR6A 5HYSB 3VXSE 1JUFB 3MRFB 5IFJA 1XF2B 4Q6IB 1IQDB 4FQPA 3FB6A 3NCMA 1A47A 3Q6FA 3CPLB 2OMBA 1IAII 1OAQH 3B6SA 4UT7H 1IC4L 2EYSA 4PFEA 5IR1B 4DFHA 2WSKA 1YPZE 4XP4H 1NUFA 8FABB 1V3KA 2OK0L 5IESL 4XPHH 4LPXA 4MD4B 3MTRA 2BZDA 5JIIA 4KJWC 5C0AB 4K94H 4YHZL 5C07D 3O8XA 1EV2E 5EU4B 1JWUB 1YC8A 4FFVC 2EC9U 4P23A 3RTQA 3DO7A 1I7TB 4PJCF 5I9QB 3VA6A 1JGDA 4HUNB 2Z31C 3S3SA 3QI9A 4F8TA 5DEGB 4NKQB 3VG0H 2WUBH 4P3DB 1XIWA 4LNRA 3RIFK 2DJ4A 5JXEC 1MCBA 2HTLC 3V4PH 4IIQB 5IQ9B 2G75B 3F62A 1TDQA 3S96B 2NY6C 3UJIH 2WIIB 2NY0D 5K9JH 4RA3A 2W9EL 4I0CC 2X4PB 1GAFH 1Y6MR 4GW4A 3VWKC 2WBJA 2R9HD 3ARZA 4HF5L 5E9DE 5EZIL 1QR1A 3PGFH 4J7RA 1WZKA 1M71B 2IPTH 4N1HB 3FO2B 3BZDA 1EK3A 1FV1A 4HIEA 5E94A 4NSKB 4XZUA 2FX9H 3DNKA 5ID0A 4GOSA 1L7IL 3LMJL 1X5XA 3LEVL 3QFJB 2ZUXA 1VERA 1S7TB 4DKDC 3LQMA 5HGAA 3ARFA 4ZUVB 1B9ZA 5T33H 4DN4H 2QR0A 5F1OB 3TN0D 3MLYL 3IS0X 4GAGL 1D9KA 4CVWA 4R96B 4POZC 4ZO8A 3W2DH 2MKWA 5LXGH 2AJYH 3AREB 2DIJA 5ESAB 4RMSA 1ZK9A 5C7XL 5IUSA 3BOVA 1X7QB 1U3HB 4O02L 5FM4A 1RU9L 2VTFA 2CXKA 1N8ZB 2XWJB 4YDJA 3HZYA 2AGJH 1HCVA 3GUTB 4KTEL 2CKBL 1S9VB 4G8EA 1MIML 3LS4H 4CVXB 3X3GL 1ZOXA 1GZQA 3ARBD 3O9WD 3U30C 4WW2C 1G1YA 3GSXA 4JO3L 3SE4A 5HHOE 4NO0A 1BZ9B 4QHNA 4OF5A 2AEPL 4M4PA 1KF9B 5HYJD 4ZAKB 4TTGA 4TVPE 2E7LC 4OF6A 5EO9A 1C5DB 2AABH 3P4NB 2IEPA 5DR5L 5AWNH 3LKOA 3QDGD 3PG2A 1GGIH 4HDIB 2AI0H 1AD0A 4PJEB 1I1AB 1BZ7A 1IGTB 4OZIB 3DLQR 3FT3A 4XNXL 4LCCB 1RIVH 4LHJB 1F3JB 1E6JH 1EFQA 2X70B 4JO1H 4HXAH 4NRYB 4H8WC 1ZHLB 2VC2L 1C7SA 1AHWB 5KSAA 1RZJL 1EBPA 4JAMB 1KELH 4GG6E 2PO6D 4JB9H 5SX5H 1CTNA 4HX1A 4ZYKA 5DZLA 1MHCB 1UVQB 5DRXB 2WQ8A 4OAWB 4KKCD 1E27A 1NC2B 25C8H 2R69H 4O5LH 1I3RA 1MCPH 2E6QA 3EJYC 5EU5B 5AYUL 1BWWA 3ROLA 1ZGLP 3TO4B 4OCWL 1LMKA 2AJXL 2DQTH 4X99B 3UO1H 3HE7B 4J4PC 3KYKH 5I8CB 3OGOE 5ILTH 1X5IA 3GIZH 5C6TL 1DEEA 5CLTA 1CXFA 3B2VL 1M05B 4YR6B 3NIFF 4X6CA 4RIRA 5D7IA 5IFJB 3FT2A 2HJFB 1I8MA 3GK8H 1NLDH 4LVNB 3DROA 3GMLA 5B4MD 2DKMA 2BNRA 4KKNA 5I18L 3Q6FB 4IMLA 1JZ2A 3TBVA 3B6SB 2CDGA 2EYSB 4JPVL 3MUGA 1MIEH 4YUEL 5L0QB 4LSTL 4JM4H 1ZHBA 3C60A 5IHUH 1NGQH 4JN1L 2YSSA 4KAQH 5DC0A 3N85H 2MCPL 4GT7A 5J3HD 1UH2A 5AZEL 5JHDB 4LBEA 5D1XA 3O8XB 4P4RA 1K3IA 4PP1C 1U8KA 4LPYA 4OTXH 4PJ9D 4PD4K 3FB7A 2D7TH 4P23B 3RTQB 3UTSB 3DO7B 1NQBA 2J6EA 5C0RH 3QWOA 4FXKA 5CSZA 1JNNH 3GJEA 1ZT4A 3QI9B 4LFHG 1J1PL 2AS5M 3QUYD 1PYWA 4M6NL 2B4CC 4LNRB 5L8LB 4CN1A 2RR3A 3KPSD 1QSVA 1EERB 1AQDA 1XGYL 3VGAC 1J9CT 5MP6L 1F58L 1TJHL 4HT1L 4WFGE 1L7TL 1JZ5A 4CMMB 2X4TA 2D3VA 3KJ6H 3LHPH 3BX7C 2BC4A 1ERNA 4AIZA 3VXRA 1OCWH 2WBJB 2YD1A 3HB3C 2XACC 5EFIA 5B38A 4KI5F 1QR1B 4CJ1A 1JP5A 3QJHB 5T3ZE 3ZSSA 2KUTA 4HIEB 5E94B 3EIFA 1LDPL 5ID0B 1CL7I 2FATL 3UYOD 4KU1A 1CF8H 1NKRA 3TFKD 2C9AA 5HGAB 5DA0B 5I73C 2RCSH 4JHWH 3LQAH 12E8H 1DBJH 4ODHL 4EBQL 4L3EA 1J18A 5E2VH 1G9MC 2QR0B 1DBBH 3WFDL 3D3VA 3NAAH 4XI5D 1G9NL 2H9GA 4XNMA 1JTPA 4NN5C 3V52H 1XCTA 1D9KB 4X8JA 1HHIA 3O4OB 3DARA 2OP4L 3QUKA 4RISH 4F7TB 3VFGH 2YWYA 3TPKA 3SBWA 1JTTA 1R3IL 1HH6A 4QF1A 1FNSL 3KYNA 4ZTPL 3RWGA 1OQOA 4K9EH 3RY4A 2VQUA 3HPLA 4LVEA 1UB5B 4YDJB 4Z7NE 1CFSA 2H2SC 3HZYB 1CLYL 1NC4D 4OZHE 3QUZC 4YGVA 4G8EB 4G8IA 2HLAA 1VFMA 4EXPX 1MCOH 1GZQB 1C16A 5DUPH 1DLFL 3GSXB 1P7KA 3AU1A 3V0WH 5I1CH 2LQRA 4QHNB 3RHWF 2W9DL 4JQIL 4M62L 3BZ4A 1NL0H 4YHIA 4I1NB 4QRPD 4RBPK 1QR4A 3HNTL 3QCVL 3LKOB 5DJ8A 2FB4H 1AD0B 1JPGA 1BZ7B 1N6QL 2GTWB 4MHHI 1FFOA 3FT3B 4L9LA 6FABL 5I76A 4Z76A 2FEEI 2XIDA 4CVUA 4XAKE 1LWRA 1EZVY 3BMWA 1FZJA 3QNYB 3LKNA 5FOJA 1KLUA 4U1NA 3BO8A 4S1SH 5KSAB 2QHLA 3JV0A 3DRTA 4FQXA 3WKNA 2W91A 3DSNA 1NDMA 1QBLL 3OAYH 4RMTA 5J9PA 1G6RH 4HX1B 2HLFD 4ZYKB 5HHQB 3BPCA 3GMPA 2JB5H 3X13A 3T1FA 3U36B 1P4BL 5C0BE 4Y5YA 5CZKA 4G7VH 2J4WL 1I3RB 3V5DA 4D3CL 4HK3N 2E6JA 4Z7VA 4ZFFA 4PRDA 1BQHG 1G1CA 4JDZB 1H9VA 4PJAF 1DEEB 2BY1A 3EBAA 1CWVA 4XXCC 4IOFD 4X6CB 15C8L 5DJZB 1WZLA 4MYWB 1BJMA 1IEAB 1MLCA 5D7IB 4UV4H 2ZUSA 1I8MB 2BVUA 3DROB 3GMLB 4IBLT 3ROOA 2FJHB 3QHTC 2BNRB 5E2UL 4IMLB 5EBGA 3TBVB 4C56B 3QYCA 2CDGB 5BRZD 1VESA 3N1GC 1EGJH 3MUGB 4WUUE 2BOCA 1ZHBB 2D9CA 3C60B 3Q6GL 4GG8A 1S7UA 3WFHA 2AJSL 2IAND 4FFWD 1DFBL 1EHAA 3RX8A 4NCDA 1A8JH 5D1XB 1QSED 4EDWH 2AXGA 4NN7B 4P4RB 3X12A 4FA8A 4TPRH 5I19L 4KV5E 1U8KB 4Y5VA 5INDA 5HVGB 3FB7B 4D94A 3T2QA 3IFOB 5D93C 2HT2C 4NC2B 2DWDA 4GKSB 5I8KH 3D69A 3QWOB 2R8SL 4FXKB 5CSZB 3GJEB 1ZT4B 1IGYA 1CZ8H 4Z9KB 2XFXA 5TDNA 3ZKND 5J4MA 1FO0A 1PYWB 4PRPE 4YHYC 1OAQL 2FBJH 4UT7L 1AQDB 1AGDA 4XP4L 1J87A 1KEMH 2X4TB 5JW3H 4RGMC 2ZSVA 1DJSA 4D9RE 2BC4B 5D1ZD 1NLBH 2OBGA 4KRMB 4KHTH 4K94L 4AIZB 3VXRB 1EA9C 5T5NG 2YD8A 5EFIB 5DK0B 4QRSA 4YFLI 1F6LL 1RZKH 3HG1B 2ATPA 4HH9A 3O9WA 1FVCA 3O4LD 4DZ8A 2DIBA 2X42A 2A6JA 2P7TA 2A6KA 4PREA 3BPOC 3VG0L 2WUBL 3LIZH 1WIPA 3BZEB 3FQRA 5HYJA 4XVSL 4O58H 5JPNB 4L3EB 4Z0BL 1PLGH 3QDGA 1LO0H 1BIIB 2O5XL 3D3VB 3UJIL 2H9GB 4IMKC 1XCTB 5I6XB 5HYFA 2NY2B 4X8JB 4P59L 5GGRA 5I30L 3QUKB 3CCHB 4K7FA 1GAFL 4U1LA 3AGVA 3T0AA 4KC3B 4X6BA 2XKSA 1HH6B 4NGHH 4AEFA 3PGFL 4RGNC 4JQXA 3KYNB 3RWGB 3OR6A 2HKFL 1I3GL 1VKXA 3HPLB 2IPTL 2QSCH 1CFSB 2MFNA 1AR2A 4G6FD 4GS7B 1F90H 2PO6A 4NQDB 5KSUA 2FX9L 4JPKH 4YGVB 2HLAB 4BQ9A 3GIVB 3K7UA 2OL3H 2L7UA 1C16B 5I1EH 1FBIH 1H8OA 4MVBC 1P7KB 4NOBA 2QADB 5BOPA 1ZTXL 1OP3K 3BZ4B 4YHIB 3GGWB 5T33L 5F7WC 4DN4L 4KDTC 2F5AH 5C0EB 3CNKA 3WXVH 3QXDA 1RI8A 3HRPA 3ILQD 3DVIA 1YJDC 5DJ8B 3W2DL 3AROA 3BDBA 1JPGB 2E7CA 3IETB 1D6EA 3KPNB 1CICD 5LXGL 1FFOB 4L9LB 5I76B 2AJYL 5DQDH 2AK4A 2HRLA 1JV5A 1GGCH 1TCRA 1FZJB 2BK8A 4JO4L 4U1NB 4X9HA 3BO8B 3WS6C 2E5EA 3VG9C 1EFXD 4ZQKB 5E6ZA 3NABH 3ZE0E 1CDJA 2B5IC 3UZQA 4HWZA 1NDMB 5IJKA 5J9PB 2CMRH 4TNWF 1AIFA 4DTGL 1IGCH 1HHJA 3BPCB 3GMPB 3X13B 3T1FB 5F7KC 4Y5YB 2N7AA 1BHGA 5GGQH 3KPQA 4RMRA 3FN9A 5AWNL 1GGIL 4Z7VB 2AI0L 4HFWA 1D5IL 4YZFF 1A4KA 4YX2H 2YA0A 5BV7B 3QBTB 4ZFFB 5C07B 3EYUH 3BIKA 1RIVL 3D9AH 1E6JL 4PJ9A 3SQBA 4MJ4A 3EYVA 2EIZA 3QQ3B 4UT6H 2DQEH 1B90A 2P24B 4HXAL 3ARTA 3NZ8B 1EIBA 4K2UL 4XWOD 2Y5TB 1RMFL 3SKOA 5J1AB 1MAKA 3QUYA 1MLCB 4U7SA 2OTPA 1KELL 2DAVA 4HZLA 3ROOB 4JG0H 1K2DA 5F89B 4DCQA 4WNQB 1VFUA 1SYSB 5FGBC 3KYOA 4LCUA 4HH8A 4OBSA 1DCLA 25C8L 2R69L 4Z0XA 4O5LL 3G5YA 2NY0B 3DHJA 2BOCB 3DV4A 4CU7A 5CEXA 2XA3A 1I8LC 5I71C 2V2XB 1S7UB 3WFHB 4ZS6C 4R4NC 5EWIH 3K0WA 4FQIL 3UJTH 2DQTL 4PTTA 3KPRD 1CXEA 1TJGL 1Q0XH 3UO1L 4I3GA 3U0PA 1QRKA 3KYKL 1RUMH 3VW3L 5GS0H 2WP3T 5IB5A 5ILTL 1MUJB 3KPTA 3X12B 4NZRH 4LPTA 2XQBH 5ITBL 1FZMA 3BP7A 4I5BA 2BXZA 2Q7NA 2WM0A 5DMGD 2FJGA 3IDYC 4HEPG 2WINB 4DKAA 3D69B 4HK0A 3GFUA 3GK8L 1IGYB 1NLDL 1ZLSH 3UYPA 5F88A 5FGSA 1FO0B 4KWUA 4KI5C 4OFDA 1IAOA 4UILH 2XA8H 4UB0H 3TN0B 5E8EA 1YPZF 1MIEL 1AGDB 2CKBA 4AK1A 4JM4L 5FB8A 5IHUL 1IAIM 1NGQL 4BSWA 4DAGH 4WENB 1IGMH 4KAQL 2OZ4H 2XTJB 4YNYA 2ZSVB 2I07A 2HVKA 3C6SA 5K9QI 3PL6A 5DJ6A 1GC1L 3TBTA 1BFOB 1P1ZA 5L88H 5D72H 2OI9B 1NC4A 4QRSB 4JRXD 2BVOA 4OTXL 4B53A 1PBYA 2D7TL 2ATPB 5HI3D 2R0ZH 3J8F7 4HH9B 4KK6D 3UPCA 1DN0A 3ARBB 1FVCB 3O9WB 3QWRD 4DZ8B 1JNNL 2A6JB 1H3XA 1TXKA 2P7TB 3T3ME 3ZKSD 2VXUH 2A6KB 2YXFA 3MJ9H 4OIBA 3IYLW 2ZOKA 4PGBA 1TVDA 1X4ZA 3FQRB 5HYJB 5ISZA 4QRPA 1CQKA 5DJAA 1C7TA 3QDGB 3FKUS 4XTRD 4HS8H 4HIIB 5CJ8A 1AXTH 1ND0A 5GGRB 1NMAH 4K7FB 4U1LB 1OCWL 5FGRA 43CAA 2BHYA 4X6BB 3S34L 1KN2H 2QKIA 2D03H 4BSVA 5ADPH 2EDOA 3OR6B 5KSBA 3LCYA 2R2HB 1IQWH 4JN2A 1VKXB 3CX5K 4KGLA 1PEZA 1G7HA 2PO6B 2EEBA 2BP3A 2E6PA 4MDIB 1OF2A 3BYYA 5AG9A 4GRWH 2RCSL 4JHWL 1DBJL 3WCYA 4D9LH 1J10A 5E2VL 2HFFB 5JORA 3PGDA 1C1EH 1DBBL 2NW2A 3NAAL 4P99A 4NZUL 4QEGA 2E27H 2HFTA 1DP0A 2PW2A 3IFNH 3QXDB 5AZ2H 3V52L 3F6IA 3OAUH 3GSRA 3MRKA 2JK5A 3V6BR 4ZSOB 1KNOA 1D6EB 3JBG7 5E9DD 4RISL 3RDTD 3QZWB 3VFGL 5C8JB 4KHXH 1TCRB 4PJDE 2HJKA 2VAJA 4L8SA 5D9SA 4K9EL 4CBPA 5MENE 4N8VA 3LD8C 1CD1A 5FYLH 1FIGH 2ICES 3MV9E 4RRPA 2ADFL 4X4ZA 5F1SA 3MRRA 4HWZB 2P5EE 4BM7A 1JGUH 4V2CB 3GSNH 1MCOL 4J1UA 5BRZA 1AIFB 3V0WL 1HHJB 5I1CL 2A77H 4BK5A 1S7VA 1NL0L 3MV8E 4GAYB 4P46C 1WT5A 4J3WA 5F9WB 3KPQB 3QWQB 2IC2A 2ITCA 3ZKXC 1AI1H 4E9LA 5KOVC 2J12B 3ARWA 2EYRA 4HFWB 1A4KB 1QSEA 5F7FA 1VEOA 4Y4HC 5DHVH 5A3ID 2X4OA 4EDXB 3BIKB 1F6FB 1TVBA 2V5TA 2DQIH 3QIWD 2VXVL 4PJ9B 1T1XA 3EYVB 2EIZB 5GGUA 3ULUE 5KN5A 1CDHA 1U8PA 3B9KD 3IJSB 4FXGA 4S1SL 3SKOB 4GG6F 3QUYB 5I1JH 1FAKT 5DSCB 3HRZA 4LMQE 2FL5A 2BSTA 4Z8FL 3D18A 5CIPH 1G6RL 4AQOA 3KPSB 4WTZG 1K2DB 4DCQB 3L3HA 3VGDA 1CE1L 2JB5L 5HI4D 4ZFZA 4D0CA 3KYOB 4LCUB 3BDXA 2FECL 4OGXL 3K4ZA 2UZXB 3G5YB 1T03H 2ID5A 3DV4B 1MRFH 3V8OA 5CEXB 1RZ8A 1G7LA 4I3RH 3B83A 1MWAB 1NBYA 4PTTB 3U0PB 4IRJC 3WIIH 5GGVY 3U9UA 5J1SC 2VITA 2FLRT 3KPPA 5IB5B 3G5VB 4X6DE 3EFFA 2HFEA 3M8OH 4J2XA 4H25B 1FZMB 4DZBA 3B9EA 3BP7B 4I5BB 1WWCA 4KZEL 2FJGB 2V7HA 4M93C 1RK1A 3P30H 3SQOH 4UV4L 3W9DA 1MCFA 3L7EB 4LHQB 2VWEE 1IAOB 2DOCA 5E8EB 5JMRA 2ILLA 1EGJL 1ES0B 5GZOC 5FB8B 4K3DH 4JY6A 4BSWB 4WY7H 3T4AB 4D0BB 4YNYB 4PYHA 1KB9J 1WISA 4J3UA 2I07B 1BVKA 4ZXBD 3OAZH 2HVKB 3C6SB 2EZ0C 3HC3H 5DJ6B 3BKYH 4EDWL 3TBTB 3O2VH 2KKQA 2GITA 4TPRL 1OGAE 1A4JA 1NC4B 5EO0A 4U2ZA 2BVOB 4JGMA 2IAMA 5EOCJ 1DN0B 3WHXB 3DURA 1V3LA 1KIQA 3CDGA 5KVEH 1C12A 5DGRA 4LPUA 1A2YA 2FCBA 3TBSA 4G8FA 4BJLA 3RY6A 3UEZA 5I1GH 4QRPB 3RVUC 1KLFA 2CR6A 3DVFA 4FS0A 3SJVE 3UBXA 4QGYA 2EXYC 4BUHA 5KZCD 5HHXH 4GLRH 4G5ZH 1RD6A 1CICA 5JW3L 2FLBT 3QEQE 1QKZH 3I9GH 1NLBL 4LIQH 5DFTA 4KHTL 4PRAA 1J1OH 1TPXC 4BSVB 2QKIB 4KK5C 4JY5H 2BFVH 2V5YA 4HMCA 4NBZB 5T3XE 5KSBB 1J88A 1EJ6A 1RZKL 2VN7A 4YWGH 4OFVA 3KAAA 5C3LD 4G8GE 4ZDHA 1P4LA 2DMBA 1LO3L 4DUXA 1OF2B 5MI0B 1EO8H 3LIZL 3OV6A 5I74B 1IVLA 4YH6A 4O58L 4WFGD 4HZAA 1PLGL 3EZJB 1LO0L 4BUGA 5J06A 2NW2B 4U33A 2EEAA 3ECBA 4YBLC 3MRKB 2JK5B 3SO3B 1KXQE 3G6JF 3SDDA 5B8CC 1KNOB 2XICA 2MHAA 4XT1C 2R0KH 1OY3B 4NGHL 1J0IA 3RZCD 2HJKB 4L8SB 4Z7NF 3PHSA 3RHWK 3CVHB 2AXFB 1CGWA 2QSCL 4OZHF 1RFDL 4N8VB 1CD1B 3HUJA 4W4OA 4NO5A 1F90L 4JPKL 1REIA 3Q0HA 4NDMA 3MRRB 2NZ9D 2OL3L 4HC1L 5D2NE 5E0QA 4J1UB 1MHPH 5BRZB 3MLTA 1FBIL 4ZOAA 5I8OH 3S4SG 4HUKB 1S7VB 1WZMA 4KQ4H 2IANB 3ULVH 3FCTA 3KPRA 1CLZL 1B3JA 2ITCB 3WXVL 4PJAB 1RPQA 2EYRB 2LFGA 1QSEB 1QLFA 2VJXA 4ZPVA 2X4OB 2PNDA 1EJOH 1WFNA 4Z78A 5DQDL 1TVBB 2DYPD 3VD9A 1T1XB 3VA2C 4NNXB 1VB9A 1UB6B 2I9LA 4FXGB 5LWYH 5IG7A 1NAKH 1MFNA 1KB5H 3NABL 5GHWH 3B5TA 3B9VA 3HRZB 1I3UA 2FL5B 2BSTB 3MRIB 2CMRL 4M3JA 1OLLA 3L3HB 4LAQH 5ID1A 1IGCL 4M1CC 5TE4H 5HHNB 3MBXL 4ZFZB 1J7VR 4D0CB 4U1IA 2OM5A 3E6HA 5C2UB 1FFNA 3I6LE 5F70A 1JIBA 5GGQL 3PWUB 2IBZY 1RZ8B 3U7YH 1G7LB 4DWHA 5D1ZB 2EE9A 5J6HA 3UZVB 1G7IB 5A2LH 4GUPA 1NBYB 3O6KL 5DJCA 4CMHB 4YX2L 2FYYA 2WMPA 3EYUL 2VITB 3KPPB 1P4IH 4GRLD 3CFIC 3D9AL 2X9XA 4JRXA 3JWOC 3EFFB 2VMFA 4MA3A 2HFEB 3S3JA 4M6OH 1K4CA 4UT6L 2DQEL 2EDDA 4X4ME 4FZ8L 3O4LB 1AKJD 5EU3B 1TTFA 2X44D 2V7HB 1RK1B 4U05A 1ODAA 1HEZA 3OXRA 3PF2A 5I1DA 3W9DB 4JJ5A 2CK2A 3MV7D 3CAFA 2W9LA 5C0BD 1BQUA 3PP4H 1TITA 1XIWC 1XR9B 4J8RA 4FQLH 4Q7DA 4RWHA 3NPSC 4JY6B 5EWIL 1BVLA 3UJTL 1BVKB 1RUML 2F8VA 2EDXA 2GKIA 5GS0L 4JE4B 5SWSE 5KTEH 4KV5F 1KT2A 1A02N 1I9JL 4NZRL 4G6FB 1A4JB 4HGKC 4O2CA 1HQRA 1OB1A 5JMOC 4J23A 3DURB 3Q3GA 3IU4L 1KIQB 1T7YA 3D25A 1C12B 1ZLSL 5HSFA 1A2YB 2AXHA 3NCYS 3QEGH 4G8FB 5E2WH 2MSPA 2XA8L 5EUOE 4UB0L 3RPKA 3T04D 4ZUSA 5EO1A 4GXVH 4F7PA 3O3EA 4NNPH 1RIUH 4OF3A 3V2AR 1MCIA 3AAZB 4DAGL 1CICB 4MX7A 1IGML 2OZ4L 3RDTA 3K4DA 4FFZH 5D5MA 4DGIL 3IAQA 5C2BH 3H3KA 1LK3L 3T65A 4N1EA 1PG7W 2RAMA 2AJVH 4PRAB 3RA7H 1CDYA 1CL7L 5D72L 4JZOA 1EFXB 1Q9OA 5C08E 5CZVL 3WMSA 4ZDHB 2APWA 4BFBD 2AV7B 2VXUL 2H3NA 1N64H 3MJ9L 1F4XH 1UXWA 4AH2A 1CI5A 1QD0A 2PF6A 2XXCB 3TO2A 3FOMB 3SE4C 1F4WH