3FB8C

Kcsa potassium channel in the open-conductive state with 20 a opening at t112 in the presence of rb+ ion
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
WRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
publication title KcsA Potassium channel in the open-conductive state with 20 A opening at T112 in the presence of Rb+ ion
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 26
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3fb8C00
4UUJC 5EBLC 3AG1C 1OCZC 3T2MA 4PDMA 3ZRSA 5IY5C 3OR6C 3K0DA 3BEHA 3OUSA 4R7CA 2DYRC 4MS2A 4CBCA 2EILC 3RW0A 3RBZA 4JTAB 2WLLA 1XL6A 2X6CA 4R8CA 4R50A 4DXWA 1K4DC 4GX5A 4MTOA 2EINC 2Y69C 1R3IC 2OCCC 4MVUA 4XDKA 4GX0A 3F5WC 3SYCA 2BOBC 4LP8A 2Q69A 4HZ3A 3X2QC 3E86A 2HVJC 2Q6AA 2QKSA 2W0FC 4EKWA 4XDLA 1BL8A 3UKMA 3AG3C 1KKDA 3ABMC 5B1AC 4PA7A 4PA3A 3FB5C 3E8FA 4J9YB 4MVZA 4R6ZA 1M56C 4RAIA 3SPHA 3OGCC 1R3LC 4WFGA 3STZC 4P9OA 3E89A 3SYPA 3UM7A 3E8GA 2X6AA 4LBEC 4QE9A 5E1AC 2IH3C 1R3JC 4H37A 1V54C 2NLJC 2ITCC 3TCUA 4JTDB 4RUFA 3LDCA 2A79B 2WLLB 1G4YB 1OCCC 2DYSC 3ABLC 4KFMA 2AHYA 3LDEA 5B1BC 2H8PC 2ITDC 4I9WA 3RVYA 4JTCB 3E8BA 3ABKC 2R9RB 2WLKA 1ORQC 3K08A 4PA9A 3R65A 3IGAC 4H33A 4PDVA 3K04A 3ASNC 5CBHA 1P7BA 1M57C 2WLNA 1XL4A 4MW3A 4OXSA 2HJFC 3JYCA 3EFFK 4PDLA 4MTFA 5EBWC 3SPJA 4J9ZB 2WLIA 4TWKA 4ZBMA 3TETA 2Q67A 4HYOA 3SYQA 1JVMA 2KB1A 4P30A 2EIKC 1R3KC 3ASOC 3LNMB 4MW8A 4P2ZA 3T1CA 5CBGA 4MVSA 3E8HA 4PDRA 1S5HC 4LCUC 3T4ZA 4P9PA 2P7TC 4MSWC 4PA6A 1V55C 2EIJC 5BZBA 5KUMA 2A9HA 2EIMC 4RUEA 2YEVA 4MVRA 3AG4C 3FB8C 4F4LA 5J9PC 3AG2C 2WLHA 3SYOA 4RO2A 5EBMC 4MVOA 3F7YC 5KUKA 1J95A 1LNQA 2DWDC 4MTGA 4XDJA 1QLEC 2BOCC 3LDDA 3F7VC 5EC1C 3SPIA 2ZD9A 4QNHB 3FB6C 2K1EA 4WFHA 2ATKC 4GX1A 3ZJZA 5B3SC 3FB7C 3K03A 5EC2C 2WLIB 2WLMA 3IFXA 4G28B 3SYAA 3WG7C 2ZXWC 1OCOC 3OUFA 3HPLC 3RVZA 3SJQC 2A0LA 4MVQA 4X89A 5CBFA 2QTOA 2AHZA 4X8AA 3VOUA 3STLC 2HFEC 1K4CC 3LUTB 3K06A 2Q68A 4QE7A 3E83A 3SPCA 5EK0A 3SPGA 1ZWIC 2IH1C 3K0GA 3PJSK 3KG2A 4PA4A 4WFFA 3GB7C 4X88A 1OCRC 4G27B 3OR7C 4BW5A 4WFEA 2HVKC 2DWEC 2X6BA 4MVMA 2JK5C 4GX2A 3T4DA 2HG5C 2WLJA
chains in the Genus database with same CATH superfamily
1VARA 2OCCB 2QSAA 2A7WA 3D36C 4IGGA 1L0LH 2EJ7A 2VWKA 2QM4A 3FD9A 4LF4B 2IJJA 5B1OA 1GN3A 1PV0A 4O2BA 4KL1A 4JYAB 3K9SA 5JCOA 1EBOA 1SQXH 2IU0A 4J9YB 2ZCEA 3C3SA 4X20B 1XHXA 1V55B 3HKDA 3JD1A 2N74A 4OPAA 3OGCC 4GCZA 3WB2A 4JAAA 1GKFA 4B3MB 1HW7A 2PY5A 2XTAA 2ZE6A 4MT8A 5KHIA 3LSUA 3RYHB 1JFFB 1ORQC 4TOIA 1H2LA 4LH7A 3TGUH 3K04A 2ZR2A 1HNWB 2WLNA 4PDLA 1I08A 2HJFC 3D3IA 5C8YA 1WB8A 2FTKA 3OT7A 2CDYA 2HKOA 1K92A 3AG4B 4LFAB 2A3QA 2B9ZA 1WPBA 4MVSA 1J5EO 4QIWF 1QQCA 4P9PA 4PA6A 2GHYA 1NKDA 3AG1B 3OE7G 3AG7A 4PHZA 2CAZC 4MVRA 4GYCB 2WAMA 3CMAV 4F6RA 1LNQA 1NH2D 3GVMA 4LF9B 3F7VC 5D5PA 4IL6Z 5IYCO 3CE2A 1R1BA 3B8MA 2ATKC 1TAEA 3SJBC 1GMGA 1JQ0A 5EC2C 2IJHA 1XMOB 3RVZA 1VQMV 2A0LA 4FLVA 3OMIB 4J10A 5LMNB 1SQQH 4LR3A 3M7MX 1H2KA 3STLC 2GUZB 3VQYA 3B2EE 2QWQB 3BA9A 4GKKO 1MSDA 1Y66A 2ZE7A 1YTFB 1CP9A 3ZRSA 4FLYA 3OR6C 4I4TB 3K0DA 5LP6A 1JX9A 1NTKH 2ZINA 1VQ6V 4UV8A 1RP3B 4UVAA 2Y0IA 1RM1B 3WB0A 4HZ3A 1BS3A 4ASUG 1NJIW 4C7UA 2ZNIA 4O4JB 4YY3O 4DR5B 4R6ZA 4KP4A 5L3EA 1VF6A 4IIJB 3W7WA 4P9OA 4LBEC 3CS5A 3ZRWB 1WLEA 3OAAG 1KBHA 2UXCO 2PI4A 4JI8O 4ICGA 5CMUA 5H9CA 3JATA 1US6A 2YXLA 4UB6Z 3N2GA 4BR6A 1Y76B 3JD3A 3DSQA 4JV5B 4TWKA 4BW9A 2EJRA 2QKCA 2EIMB 3SYQA 4WBNB 2N04A 3B40A 3CCJV 1XNQB 4LCUC 2Z0AA 5BMVB 2A9HA 4RUEA 2XAFA 1FAFA 4H13B 3VQWA 4WF9V 3WG7B 4EEQA 5IJ9B 1S77D 5A2QN 2F4VB 2DQ0A 1VIBA 4K35A 4PI2A 4WFBV 2UUBO 1Q82W 1TGOA 3BPZA 1K97A 2QWPB 4QE7A 2ZE5A 1A32A 1VF6C 1XEQA 2CTWA 2RDCA 3AK3A 2PZSA 3CPWU 1GTOA 4E4EA 4X20A 4EFBA 1PNMA 2QM7A 1JR9A 2K9PA 3KZIZ 2N05A 3IAYA 3QF7A 4ZHQB 2JEUA 3B09A 5KHHA 4CBCA 4NB5A 2EULA 1ZSPA 3HKBB 4DV5B 3QTCA 1VEWA 1XMQB 3RYHA 1JFFA 1SQGA 4GKJB 2UXDB 3H1HH 1NR1A 4X65O 3DGEA 4BIZA 1YCIA 3FB5C 5GTHZ 5CA0B 4FPPA 1JA8A 3TK1A 5ITZB 1M1KW 3ZIAG 1VQ8V 3E89A 3UM7A 4JI4B 3G71V 1D2DA 4ZKIA 4TQFA 2ITDC 1SKVA 4CS2A 2ILMA 3W7XA 4GZRB 2CK3G 3IGAC 3SR2C 2YIAA 1VF7A 2QR4A 2O57A 1XNRB 3OTOB 1Y4MA 2E76B 1P4RA 4P2ZA 1WA8B 1DF4A 4I0XB 2QWOB 1HNZB 2GUZA 3CCMV 4MSWC 1V55C 5JJNB 3QO8A 2ETNA 4PV1B 5CB4B 1I94O 5B3SB 1IX9A 3GWKC 5J9PC 5H5NA 4MTGA 2YS8A 3LDDA 3SPIA 4DR2B 4U3JB 4DV0O 1M5IA 1N32B 1GM8A 4I4TA 1WP7A 3CCSV 4G28B 3SYAA 2Q5ZA 1VQOV 2ZM6O 2F95B 4DV2O 2Q0OC 3JCZA 1Q7YW 2B1IA 2DQ3A 4DK0A 1MNGA 1Q6UA 5BR8B 2X6BA 1K3EA 2NN4A 4O4JA 4JI0B 3TJTA 1QU7A 3AG1C 4IIJA 4ZOLB 4PDMA 3ZRWA 2OTLV 4DV3B 2Q9LA 4HAMA 1U97A 1MZFA 3JALB 5LA6B 3VQVA 2VS0A 4MVUA 4U7OA 2YICA 4LP8A 1IDSA 1FS0G 4EKWA 1TA8A 4WFAV 4UV9A 2ARHA 4DUYO 3W7TA 4J7ZA 2Q7GA 4WBNA 2D3OW 3STZC 4DR3O 1P7GA 1H2SB 1NU1H 3CRCA 2NLJC 1SQPH 3OFNG 3TCUA 3CCLV 5BMVA 2XAGA 3QO5A 1N8RW 5FNVB 3U0ZA 4DR7O 5IJ9A 4UCTA 1L0NH 4LF5O 4JYCA 4PDVA 2PYLA 1P7BA 1IZ3A 1RM1C 4Z1VA 4ZBMA 4K0KO 1KP3A 3IC7A 2Q67A 4PELA 1EN6A 2Q4PA 1WAZA 2KB1A 3CCUV 1N0NA 2EIKC 1URFA 1K9MW 1BMFG 5KAFZ 4GUNA 2YEVB 4F4LA 4X62B 4FK5C 2Y4UA 3JARA 3WFVA 2EZOA 4ZHQA 2BE3A 3SJCC 4JI1B 5IDJA 3JCUZ 4QJFB 1K5QA 1Z5WA 3ABMB 1RSOB 4JI7B 3ABTA 1GAXA 3HKBA 1BQ0A 4LFBB 2QKAA 3O9OA 5IWAO 3EVKA 3CC4V 2CGOA 3DC5A 2UXBB 3APOA 3K5NA 2CE4A 1I5XA 1NTMH 2DWEC 3E22B 3H1JH 4DV7O 5CA0A 5ITZA 1YXBA 4J7JA 4B08A 4N21A 1W59A 1NVPD 3J80N 2JDIG 3BHPA 5DN6G 1GN6A 3QG5A 4B3SO 2B1GA 3S3WA 1WJZA 1M93A 3FX7A 2IJIA 1YZBA 3SYPA 1MZEA 4KUMA 2FMLA 2VQEB 4DR6B 2AHYA 3BAAA 1GRJA 5CB4A 4DV1O 2Z3YA 4L8JA 4DUZO 3ETDA 3CC7V 1FXKC 1AR1B 5DEDA 3N2KB 4U3JA 1R6KA 4J7KA 2E75B 1E1QG 1PKXA 4JPRA 4DR4B 2RNBA 1OCRB 4X66B 2F66C 5LMUB 4OX9B 4QGPA 4YHHB 4JF3A 4DK1A 4FIPC 1OHHG 4CH5A 1Y67A 4ZOLA 1VQLV 2GSMB 4WFHA 4G2KA 3RWRD 3JALA 5LA6A 4UCUA 3DTUB 2JJ1G 3A8TA 2F23A 2R9AA 1XHZA 4I5SA 3CSXA 1G1XB 1UPGA 3HB3B 3T4DA 1VQ7V 1AR4A 2LQTA 3OUSA 3OM3B 2QA4V 5LOVB 4MS2A 1E79G 2V1DA 4AILC 4JTAB 1QHTA 3ABUA 2ZR3A 4DW1A 4MTXA 3LNNA 5FNVA 1VQNV 2QKSA 3K79A 1BHAA 4XDLA 1YEWA 4UCSA 1JOYA 4PA7A 3E8FA 3N27A 1KU9A 4JI3O 1VQ9V 1HP8A 2UU9B 2X6AA 3AG2B 2UUCB 1PL0A 3JASB 5BY1A 2HEPA 2H8PC 1IXMA 2JEXA 1AI7A 1YJNV 1ZAUA 1SZTA 1SRYA 1XQ8A 1V9PA 5KA5A 4JI5B 3OEHG 3CEIA 3CRQA 1JVMA 1RSOA 2BSKB 5KLVH 3RT3C 2IJKA 4QPKA 4KHPO 2R70A 3TXSA 3FB8C 3E22A 1XREA 2Z5UA 4FVMA 3ZJZA 3K03A 3JAMN 2WLIB 3OUFA 3WB1A 1QVFU 3OTFA 2QE7G 5CBFA 1BSMA 3LSSA 1EN5A 3A0HZ 2LGWA 1QCEA 5EK0A 3UT5A 5J2UB 4NTWA 4DV6O 2GBOA 5FL7G 2XAJA 4B7EA 2YI8A 2ADPA 3ZHUA 1IBKB 3JAWB 4TSFG 4NKGB 4I50B 2YI9A 1XOUA 2UXXA 4JAVA 3I56V 4X64O 1QNMA 1TVKB 4CH3A 4MTOA 1WNSA 3CYOA 2JGUA 5B5EZ 2X7RB 1HDJA 2Q69A 5KA6A 2W0FC 2UUAB 3ABMC 3N2KA 3ASOB 2KQXA 1MMMA 5CA3A 2X0LA 2Y48A 4NR1A 2LJ2A 2Y4TA 1YIJV 1Q90D 2IH3C 2CGNA 3H1LH 4D6TH 2XAQA 4NXNB 1MSWD 3AEIA 1M4UA 2ZNJA 3E8BA 4CZZA 1SETA 3K08A 4JZ2A 4D7TA 4BAYA 2EIKB 5CBHA 3M99B 1B04A 2V4DA 1CEZA 1F7YA 1R73A 1IBMB 3IJ4A 2FYUH 4PDRA 3QO7A 1N36B 1DLBA 5EIBC 3D8CA 4B3RB 4CS3A 1NTZH 2EILB 1D5NA 1HNXO 3CHXA 3ML0A 2HHHB 2VQFB 2LP7A 1Y74B 1S5LZ 1GM9A 1IBLB 1QBZA 1F4MA 4X89A 4LF7B 3L72H 1FD9A 2F93B 3LUTB 1COWG 3TXQA 3K06A 2QTSA 2DJVA 2XOKG 5F2VO 1ZWIC 5KX5B 4PA4A 1ZL8B 1OCRC 3JAKB 2CUGA 1EFRG 1W2BU 1G8MA 1FXHA 4DO2A 4K8XA 3T1YO 1MABG 1HR0B 1MOFA 3JASA 3RW0A 1NT2B 4R50A 4GX5A 2RJZA 2Q0AA 3ZX6A 2BOBC 3CP1A 3L75H 2XT9A 1NI8A 1N4CA 1VF5B 3OD4A 1UJWB 4LF4O 3ZRVA 4JYAO 4AHCA 3EXAA 1L8DA 1K33A 2F43G 4LF6B 2BSKA 1FXKB 1VP7A 4RUFA 2VRZA 1AB3A 2A79B 2Q7EA 3LDEA 4B3MO 3ZS8C 5IYDO 4JTCB 4DR1B 1I0HA 3C3TA 5D5QA 4JI6B 4E2LA 5LGTA 1Q6HA 4JAUA 5EBWC 4OXSA 4MTFA 1S76D 2WLIA 3I5DA 2KKWA 1HNWO 5CA1B 3NXSA 3CJHB 1BQZA 4W4KA 4YIPA 1AROP 4LFAO 4FFBB 3I55V 3JD2A 4JI2B 5J2UA 2E5LB 1MG1A 5IY5B 3AG2C 2DYRB 3JD0A 5JVDB 2BOCC 3JAWA 1R6TA 2ZD9A 3FB6C 1BT8A 3SDLA 4LF9O 4I50A 2W0XA 3NR7A 1TUBB 5L3DA 4B3TB 3P3PA 5C93A 1TVKA 3ZHRA 2DN9A 4MVQA 2QTOA 1YF2A 1XMOO 5LMNO 3KKYA 2IH1C 2P6JA 3PJSK 4FJCC 5GW7A 3UCSC 1KQSU 2OWOA 4Q6GA 3OR7C 2HVKC 1GK9A 1QR9A 1N34B 1GM7A 4LC1A 1SS3A 4FZ0A 4J11A 1K34A 3ABKB 3APQA 4NXMB 5H6QA 3FYEB 4LF8B 4DXWA 1NS1A 3F5WC 4BIUA 3E86A 1BL8A 2FKXA 4EB6B 4X1IB 1GN4A 2ZQMA 2EIJB 4DR5O 3SPHA 1R3LC 5DECA 4YXWG 3ZBHA 1P84F 3FAVB 2DYSC 3MDSA 3ZMSA 5KAIZ 1PL4A 2LO1A 3S3XA 2CTPA 2JVDA 3B77A 2H94A 1Y76A 2EBOA 1QR8A 4FFKA 2CTRA 3SPJA 1Y74A 4JV5O 2AGAA 2Q7HA 2JS3A 3ASOC 1K7DA 4UXNA 4LFCB 3CC2V 1XNQO 2QWRB 1AVMA 1AI6A 1SQVH 5KX5A 1S3JA 3THOA 1ZL8A 4J41A 3JAKA 4FM1A 3T1HB 3B4SA 3HR0A 2YUAA 1B06A 4I9QA 1TUEB 2ZE8A 3DXRB 3RYIB 3FB7C 2F4VO 4NTXA 3IFXA 2DOSA 2LGQA 3HPLC 1FJGB 2KSDA 4KXRA 2AHZA 3CCEV 4ZI7B 2QWNB 3E83A 3UO2A 5TISZ 4DV4B 3KG2A 4X88A 2YIBA 4DYLA 4AQYO 2ZIMA 4HNAB 4GX2A 3ABLB 2HG5C 2D2CB 4UUJC 5B1BB 3FKSG 4W4LA 4R7CA 1FXKA 2EILC 1YHQV 3RBZA 1YITV 2X6CA 1NQTA 2EX3A 5JH7B 1Q86W 1R3IC 2PF4E 3SYCA 3G80A 2JJ2G 4DV5O 4DW0A 5L3CA 1XMQO 2UXDO 4GKJO 5L3GA 3K57A 2G38A 5CA1A 3CJHA 1X59A 2MW2B 2OCHA 1Q8IA 4QE9A 4H37A 4FFBA 3PN1A 4JI4O 1K8AW 2E74B 2BTOA 2V7QG 1H38A 2DE0X 5BXZA 1K5SA 1B3QA 5JVDA 3R65A 4H33A 3A2FA 1B6QA 1XL4A 1TUBA 1JMKC 3ZMZA 1P49A 4J9ZB 2Y0PA 4J80A 1J5EB 3OTOO 1XNRO 1PM9A 1WA8A 3T1CA 1PD3A 3H1KH 4I0XA 1BZKA 3T4ZA 5FPOA 2P7TC 1AR5A 1HNZO 3H9VA 4MVOA 1N33O 4F6RB 1QLEC 5A9GA 3L74H 2K1EA 1H8EG 3BCCH 3K3WA 4DR2O 3ETEA 1EZVH 1N32O 3BY6A 3AG3B 1YVWA 1HWYA 4JYBA 1AJQA 2ZDIA 2GV9A 3VOUA 4GKKB 3WU2Z 4XBFA 3HKCB 2OIEA 2DW4A 4EB6A 4X1IA 5EZYB 4AI8A 4UCOA 5BR8O 2HR3A 1FYJA 2WLJA 4IYIA 4JI0O 3T2MA 1FKAO 5IY5C 1I5YA 4ABMA 3E2EA 2DYRC 3FAVA 1RPOA 1KKCA 2YSUB 4DV3O 1VQPV 3QVNA 4R8CA 4FLZA 2JGDB 2AW9A 4WCEV 1BE3H 1H2MA 1NZ6A 4TV8B 3H01A 3KCXA 1IXBA 5J2TB 5KMGB 1AJNA 4YY3B 2XHBA 1YSCA 1KMIZ 3P3NA 4UFZA 1OZ0A 1H2GA 4UB8Z 5K1PA 5FLXN 2UXCB 4JI8B 1GN2A 1Z5VA 4FMTA 3CMEV 2GTAA 3ABKC 3RN4A 1OCOB 2WLKA 3DXRA 3RYIA 5GTIZ 1BHBA 1ZUQA 3ZHTA 2ZDIC 5JJJB 2BTQB 5CN0A 1SESA 1H2NA 4MW8A 4DRXB 2OIGA 4ZI7A 2DMXA 2EIJC 1UFIA 4LNUB 2YEVA 4RWUA 1G6UA 1SC5B 2WLHA 4HNAA 3F7YC 4O2AB 2NNUA 2W6IG 2VWJA 1OJHA 1M90W 4X62O 4NVPA 1WPXA 3JSNA 1NR7A 4TQDA 1AILA 1PP9H 3LSQA 2UUBB 2UXNA 3VBBA 5JJEB 1WP8A 2P22C 2M7WA 3W7SA 4JI1O 2IBZH 3ETQA 3K5OA 5JH7A 2P4VA 4UCVA 4JI7O 1BGYH 3BVOA 3UQ8A 2HFEC 1K4CC 2Q68A 2HJDA 4LFBO 1NH2B 3K0GA 4WFFA 1X4TA 3B8NA 4F6EA 2UXBO 4JYYA 4MVMA 4X9QA 2ADQB 3ZRXA 2IM9A 5LHGA 1THZA 1DF5A 5KHJA 3DC6A 3BRCA 4K3AA 4O4IB 3MD0A 1EZJA 3ASNB 3VQXA 2Q8VA 3ICXA 4FM2A 1KUQA 4UVBA 4GX0A 2LW1A 4X65B 1RFYA 2HVJC 3EHBB 3MHSC 1YJWV 1EM1A 3M8AA 2DYSB 4TUYB 3CRRA 4WFGA 1SA0B 1R3JC 2F1MA 4PI0A 4BIOA 3ABLC 2WLLB 1G4YB 5B1BC 2VQEO 3RVYA 4DR6O 5JWPA 1S72V 1OV9A 4JASA 3J81N 4ZIBA 4I55B 4U3FH 4X1YB 1KECA 3J7AU 2YXYA 3ZMUA 2RMKB 4GLXA 3EFFK 1SQBH 4CH6A 5IT9N 2XUMA 1ENVA 4DR4O 5JCOC 1U96A 4X66O 4Z2WA 5LMUO 1I94B 3HKCA 4OX9O 5BZBA 1F51A 4N23A 3HKEB 4YHHO 5EZYA 3KCYA 2AXTZ 5KUKA 4DV0B 4RQFA 1Q81W 4YIOA 5IE9A 1WN7A 2PUSA 2EINB 2PI5A 2H3OA 2P67A 2ZM6B 3CX5F 4DV2B 4OGQB 5LXTB 5B66Z 3ETGA 2JGDA 4H44B 4TV8A 5J2TA 1Q3EA 5KMGA 3F5TA 4A5UB 1SQFA 1IVSA 4WFEA 4O4LB 1S5JA 1L1FA 1DK1A 3H1IH 1OCCB 2PTMA 1JJOA 2P5OA 1YTFD 5LOVA 3CXHF 1SZXA 3D3QA 3JD4A 4JGSA 2WA4A 2HP8A 5H2FZ 3AG3C 2CH7B 2BCCH 4DUYB 4B7KA 4FZ1A 1XUQA 5IYZB 4DR3B 2BTQA 4RAIA 1F23A 5GONB 2EZPA 4DRXA 2UU9O 1QVGU 1I7FA 2UUCO 4LNUA 5HFLA 4DR7B 2ZKOA 3C90A 2QEXV 5LP6C 4LF5B 4O2AA 2R9RB 4GT1A 3MHHC 5L3FA 5KHGA 3ZN0A 4JZGA 2LFSA 2XAHA 4K0KB 4LH6A 4JI5O 1O9GA 4EFEA 4TT3G 1R3KC 5CBGA 2PGGA 1QLEB 4Z1MG 2E3CA 2FB5A 2WA3A 3CB2A 2MK3A 4AQYB 2ODMA 4FLWA 3Q4HB 5IJ0B 1XBLA 4RO2A 2YC0A 3RYFB 3CXCU 3JARB 3K5LA 2Y69B 4FLTA 2JRIA 4GX1A 1AP5A 3ZHSA 5EYPB 3X2QB 3ZEDA 1GH6A 1ZX3A 1OCOC 4O4IA 2Q73A 5B1AB 5IWAB 3G6BA 3FYIB 1M56B 5L3BA 2IU3A 3IC9A 4QPJA 2YXHA 4DV7B 4G27B 4BW5A 1V54B 2WPDG 3A0BZ 4YJ3B 1KD1W 4TUYA 2L35A 2OYQA 5LHIA 1OCZC 1FFTB 2YIBD 1IBKO 1SA0A 1YDXA 3K58A 4FLUA 3RYCB 3ZHVA 3UO3A 2WLLA 1XL6A 1SERA 5LYJB 1K4DC 1M57B 2OCCC 1MA1A 3MAQA 1WB7A 3SGIA 4I55A 4X1YA 4B3SB 3OEEG 2UUAO 4MVZA 5KHKA 3OW2U 2AZ2A 3CCVV 3E8GA 1GO3F 2ZT9B 4JTDB 4PD4F 1Z2GA 4DV1B 3OMNB 5JQGB 1YI2V 4I9WA 4DUZB 4NXNO 3HKEA 4LWSB 4IT5A 1N33B 5LL6Y 2ZXWB 4NYKA 2GDSA 4IHJB 4PA9A 4YJ2B 5IYBO 3ASNC 4TV9B 1Q6IA 1FPOA 3AK2A 1Y6XA 1VMGA 1Q43A 4HYOA 1H8HG 5LXTA 3K5MA 3LNMB 3E8HA 1IBMO 1F4NA 1VQ4V 2LFRA 1N36O 4D7SA 3AG4C 4UCRA 4O4LA 4X1KB 3SYOA 4B3RO 2DWDC 1PNLA 1AP6A 2NR5A 2HHHO 1S0VA 1FFXB 2VQFO 3O65A 1EN4A 2WLMA 3L9DA 2JS5A 2KG7B 4UVCA 1N0JA 3E35A 1IBLO 1VQKV 3CWBH 1LUVA 2RQ6A 4X8AA 4CS4A 2P06A 2M6YA 4LF7O 2RN9A 3SPGA 3ZHQA 2CH7A 3P32A 1LUWA 3ZN1A 2QJ1A 1W0KG 1M9NA 4H0LB 1RPRA 5IYZA 1XDCA 2HLDG 3RGBA 3CRAA 5GONA 1NBMG 5LGUA 4RQEA 2QDOA 3BEHA 1PPJH 2WWWA 1HR0O 2RCVA 2LW7A 3OGIB 2EINC 3AK1A 4O4HB 2ZIOA 2R72A 1ROPA 3UKMA 3RFRA 3G6EV 1KKDA 4PA3A 1XI1A 4L87A 4JI3B 1ZTEA 5LBQA 3CD6V 2W6JG 3GWOA 2C2AA 1QLNA 3QNEA 3BABA 1AJPA 1NVPB 2GTSA 4LF6O 3K9AA 1OCCC 4KFMA 3Q4HA 1T5EA 5IJ0A 3ZCCA 4BWAA 4O2BB 3RYFA 2YIDA 1DTOA 4DR1O 3BFRA 3CCQV 3JYCA 4JI6O 2OTJV 4U7NA 5EYPA 3TETA 3HKDB 4OPHA 4CC6A 3ZMTA 4FLXA 4P30A 4K8ZA 1KP2A 3CRMA 3K59A 4KHPB 1IURA 2IW5A 5KUMA 2EIMC 4JI2O 2OT5A 3R66A 2E5LO 2QGNA 1J95A 4YJ3A 3W7UA 4CC5A 2PYJA 5H6RA 1KB9F 5C8YB 3RYCA 3WG7C 4B3TO 3SJQC 5LYJA 1XILA 1D5AA 2WSSG 2XASA 3SPCA 4DV6B 3UT5B 1SF9A 3GB7C 3JSLA 2JK5C 3L71H 1JPXA 5EBLC 5E79Z 4X64B 1N34O 3L73H 2B5UA 1YJ9V 3P30A 1LR1A 2A06H 2QM8A 2P4KA 3BA8A 5JQGA 1JJ2U 5DM6V 4NXMO 2Y69C 4LWSA 4LF8O 4XDKA 3X2QC 2Q6AA 4IHJA 1AI5A 4YJ2A 1ZLZA 2R9IA 5B1AC 3SJAC 3G4SV 4Q20A 2YDEA 4CH4A 4TV9A 2FL4A 1M56C 4FM0A 3A0RA 1PNKA 1FXVA 3U11A 5E1AC 3OMAB 5LP6B 1V54C 3CCRV 2ITCC 3LDCA 5EIBD 1KYOF 4J42A 2P90A 4NTYA 1E1RG 1VQ5V 4X1KA 3D36A 3FFQA 1KC8W 5LGNA 1M57C 4MW3A 3U10A 5LHHA 1FFXA 5AG2A 5K1XA 2JIZG 2KG7A 5HFMA 2AZ0A 2CTQA 4PJ0Z 4I7ZB 1S5HC 4LFCO 1DGSA 1CXZB 4IYHA 1K73W 1HNXB 3G67A 5EBMC 1AI4A 3JATB 3T1HO 4XDJA 1CPYA 4HBNA 5EC1C 4QNHB 3N2GB 1BCCH 1O9HA 5B3SC 2XNDG 2L6LA 1JCHA 2ZXWC 1R6NA 4O4HA 1FJGO 3ZMVA 1Q5OA 1OCZB 1W0JG 4DV4O 3T1YB 5FPRA 3L70H 5B1NA
chains in the Genus database with same CATH topology
2OCCB 1YTFD 1K34A 3ABKB 3JD4A 4N21A 5H6QA 3FYEB 4DXWA 4JGSA 1NVPD 3F5WC 2JDIG 2IJJA 4BIUA 5B1OA 3E86A 1BL8A 5DN6G 3AG3C 1EBOA 2IU0A 4J9YB 2B1GA 1V55B 2ZQMA 2EIJB 3JD1A 4RAIA 3SPHA 2IJIA 3OGCC 1R3LC 1F23A 3SYPA 4GCZA 4YXWG 2EZPA 4KUMA 1QVGU 1GKFA 2DYSC 2AHYA 5HFLA 4MT8A 3ZMSA 2Z3YA 2QEXV 3ETDA 3B77A 2R9RB 3CC7V 1FXKC 1ORQC 2H94A 1AR1B 4GT1A 3MHHC 5L3FA 3ZN0A 3K04A 1R6KA 2EBOA 2ZR2A 2LFSA 2XAHA 2WLNA 4PDLA 1QR8A 2HJFC 3D3IA 1E1QG 3SPJA 1PKXA 4JPRA 2FTKA 1OCRB 2HKOA 1K92A 3AG4B 4TT3G 1R3KC 3ASOC 5CBGA 1K7DA 4MVSA 4UXNA 1QLEB 4QIWF 4P9PA 4Z1MG 3CC2V 4PA6A 2GHYA 1AI6A 3AG1B 1NKDA 3OE7G 2MK3A 4JF3A 1S3JA 4MVRA 2WAMA 4FIPC 4RO2A 3CMAV 1OHHG 1LNQA 1NH2D 3CXCU 3F7VC 1TUEB 5IYCO 3B8MA 1VQLV 2Y69B 2GSMB 4WFHA 2ATKC 4GX1A 3FB7C 1GMGA 1JQ0A 5EC2C 3X2QB 3IFXA 2IJHA 4G2KA 1OCOC 3DTUB 3HPLC 5B1AB 3RVZA 1VQMV 2A0LA 3OMIB 2AHZA 2JJ1G 3FYIB 3CCEV 1M56B 3STLC 2IU3A 5L3BA 3E83A 4QPJA 3KG2A 4X88A 1Y66A 4G27B 4I5SA 4BW5A 1V54B 3HB3B 2WPDG 4GX2A 1YTFB 3ABLB 1KD1W 3T4DA 2HG5C 4UUJC 5B1BB 5LHIA 1OCZC 1FFTB 1CP9A 3ZRSA 1VQ7V 3FKSG 3OR6C 3K0DA 1JX9A 3OUSA 3OM3B 4R7CA 2QA4V 1FXKA 4MS2A 1E79G 2V1DA 2EILC 1YHQV 3RBZA 4JTAB 1YITV 2WLLA 1XL6A 2X6CA 1NQTA 1SERA 1VQ6V 3ABUA 1K4DC 2ZR3A 1M57B 4UV8A 1Q86W 1R3IC 2OCCC 4MTXA 4UVAA 3SYCA 1RM1B 1VQNV 2JJ2G 4HZ3A 1NJIW 4ASUG 2QKSA 3K79A 1BHAA 4XDLA 5L3CA 1JOYA 4PA7A 5L3GA 3OEEG 3E8FA 4MVZA 4R6ZA 4KP4A 5L3EA 3OW2U 3CCVV 1VQ9V 3W7WA 4P9OA 3E8GA 2X6AA 4LBEC 3AG2B 3ZRWB 1GO3F 4QE9A 4H37A 1WLEA 3OAAG 1PL0A 4JTDB 1K8AW 3OMNB 2PI4A 1YI2V 2V7QG 2H8PC 4I9WA 5CMUA 1IXMA 2JEXA 5H9CA 1AI7A 1H38A 1YJNV 2ZXWB 1K5SA 1SZTA 1SRYA 4PA9A 5KA5A 3R65A 4H33A 5IYBO 1B6QA 3ASNC 1XL4A 3JD3A 3OEHG 3ZMZA 4J9ZB 4TWKA 2EJRA 2EIMB 4HYOA 3SYQA 1H8HG 1JVMA 3LNMB 3T1CA 1PD3A 3CCJV 3E8HA 4LCUC 3T4ZA 2P7TC 1F4NA 2IJKA 1VQ4V 2LFRA 2A9HA 4QPKA 4RUEA 2XAFA 3AG4C 3FB8C 4WF9V 3WG7B 3SYOA 4MVOA 2DWDC 2Z5UA 1QLEC 1S77D 1PNLA 2K1EA 1H8EG 1S0VA 2DQ0A 3K3WA 3ETEA 3ZJZA 3K03A 2WLIB 2WLMA 3BY6A 3OUFA 3AG3B 4WFBV 1QVFU 4UVCA 3E35A 2QE7G 1Q82W 1HWYA 4JYBA 5CBFA 1VQKV 1K97A 1AJQA 2ZDIA 3LSSA 4X8AA 3VOUA 4QE7A 1QCEA 4XBFA 5EK0A 3SPGA 2DW4A 3P32A 3CPWU 3ZN1A 5FL7G 1GTOA 2XAJA 1W0KG 1M9NA 1PNMA 2HR3A 1RPRA 2QM7A 2HLDG 2WLJA 3T2MA 4TSFG 1NBMG 5IY5C 5LGUA 2JEUA 2UXXA 1I5YA 3BEHA 2WWWA 4JAVA 4RQEA 3I56V 3E2EA 2DYRC 4CBCA 1RPOA 2YSUB 1VQPV 4R8CA 4MTOA 3CYOA 2EINC 4WCEV 3H01A 2X7RB 2Q69A 5KA6A 1ROPA 2W0FC 3UKMA 1NR1A 3G6EV 1AJNA 1KKDA 3ABMC 3DGEA 3ASOB 1YSCA 4PA3A 4BIZA 3FB5C 5CA3A 1OZ0A 2X0LA 2Y48A 4FPPA 4L87A 5LBQA 3CD6V 3TK1A 1H2GA 2W6JG 1M1KW 3ZIAG 3GWOA 1VQ8V 1YIJV 2C2AA 3E89A 3UM7A 1QLNA 3QNEA 2IH3C 3G71V 1AJPA 1NVPB 2XAQA 4ZKIA 3K9AA 1OCCC 1MSWD 4KFMA 4FMTA 2ITDC 3CMEV 3AEIA 3ZCCA 3E8BA 4CZZA 3ABKC 3W7XA 1OCOB 2WLKA 1SETA 3K08A 2CK3G 1DTOA 3IGAC 4BAYA 2EIKB 5CBHA 3CCQV 1BHBA 3JYCA 3M99B 4U7NA 2ZDIC 2OTJV 1CEZA 3TETA 1Y4MA 3ZMTA 1R73A 5CN0A 4P30A 1SESA 1KP2A 1P4RA 4P2ZA 4MW8A 1DF4A 4PDRA 3QO7A 3CCMV 4MSWC 1V55C 2EIJC 2IW5A 3QO8A 5KUMA 1DLBA 2EIMC 2YEVA 5B3SB 5J9PC 2WLHA 2OT5A 2EILB 3F7YC 1J95A 2NNUA 2W6IG 4MTGA 3W7UA 3ML0A 1M90W 3LDDA 3SPIA 1WPXA 5H6RA 1GM8A 1NR7A 3CCSV 2LP7A 3WG7C 4G28B 3LSQA 3SYAA 1GM9A 2UXNA 3VBBA 1QBZA 2M7WA 3W7SA 1VQOV 1F4MA 3SJQC 4X89A 3JCZA 2HFEC 1COWG 1K4CC 3K06A 2Q68A 3LUTB 2WSSG 2XASA 2B1IA 2DQ3A 2XOKG 3SPCA 1Q7YW 1NH2B 1ZWIC 3K0GA 4PA4A 4WFFA 3GB7C 3B8NA 1OCRC 1EFRG 2X6BA 4MVMA 1K3EA 2JK5C 1W2BU 1G8MA 3ZRXA 1FXHA 4DO2A 5LHGA 1JPXA 1MABG 1THZA 3AG1C 5EBLC 1MOFA 4PDMA 2B5UA 1DF5A 3ZRWA 1YJ9V 3P30A 2OTLV 4HAMA 2QM8A 3RW0A 3MD0A 1EZJA 1JJ2U 3ASNB 4R50A 5DM6V 4GX5A 2Y69C 4MVUA 4U7OA 4UVBA 4GX0A 4XDKA 2BOBC 3CP1A 4LP8A 3X2QC 1FS0G 2HVJC 2Q6AA 1UJWB 1AI5A 4EKWA 3EHBB 4WFAV 2R9IA 3MHSC 5B1AC 3G4SV 4Q20A 1YJWV 3ZRVA 4UV9A 1M56C 2DYSB 3W7TA 4WFGA 2D3OW 3STZC 1K33A 2F43G 1PNKA 1FXVA 3A0RA 5E1AC 3OMAB 1R3JC 1V54C 2NLJC 2ITCC 1FXKB 3OFNG 3TCUA 3CCRV 4RUFA 3LDCA 3CCLV 2XAGA 2A79B 2WLLB 1G4YB 3ABLC 2P90A 3LDEA 5B1BC 1E1RG 3RVYA 1VQ5V 3QO5A 1N8RW 3D36A 4JTCB 5IYDO 1S72V 4JASA 1KC8W 1KECA 4E2LA 4JYCA 4PDVA 5LGTA 5LGNA 1P7BA 3ZMUA 1M57C 4JAUA 5EBWC 4MW3A 4OXSA 5LHHA 3EFFK 1RM1C 4MTFA 1S76D 2WLIA 4ZBMA 1KP3A 3IC7A 2Q67A 2JIZG 3NXSA 4PELA 1ENVA 5HFMA 3CCUV 2KB1A 2EIKC 1AROP 1K9MW 1S5HC 1BMFG 3I55V 5BZBA 1F51A 3JD2A 1K73W 2YEVB 1MG1A 4N23A 5IY5B 4F4LA 3AG2C 5EBMC 2DYRB 1AI4A 4FK5C 5KUKA 3JD0A 4XDJA 4RQFA 1Q81W 1CPYA 2BOCC 5EC1C 2ZD9A 4QNHB 3FB6C 3WFVA 2EINB 2EZOA 2PI5A 5L3DA 5B3SC 2XNDG 5IDJA 2P67A 1JCHA 2ZXWC 5C93A 4QJFB 1K5QA 1R6NA 3ABMB 4MVQA 3ETGA 3ABTA 2QTOA 3CC4V 3ZMVA 1OCZB 1W0JG 2IH1C 2P6JA 3PJSK 4FJCC 5GW7A 1KQSU 3OR7C 4WFEA 2HVKC 2DWEC 1I5XA 1L1FA 1GK9A 1QR9A 1GM7A 1OCCB 4LC1A 5B1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUJ C;  5EBL C;  3AG1 C;  1OCZ C;  3T2M A;  4PDM A;  3ZRS A;  5IY5 C;  3OR6 C;  3K0D A;  3BEH A;  3OUS A;  4R7C A;  2DYR C;  4MS2 A;  4CBC A;  2EIL C;  3RW0 A;  3RBZ A;  4JTA B;  2WLL A;  1XL6 A;  2X6C A;  4R8C A;  4R50 A;  4DXW A;  1K4D C;  4GX5 A;  4MTO A;  2EIN C;  2Y69 C;  1R3I C;  2OCC C;  4MVU A;  4XDK A;  4GX0 A;  3F5W C;  3SYC A;  2BOB C;  4LP8 A;  2Q69 A;  4HZ3 A;  3X2Q C;  3E86 A;  2HVJ C;  2Q6A A;  2QKS A;  2W0F C;  4EKW A;  4XDL A;  1BL8 A;  3UKM A;  3AG3 C;  1KKD A;  3ABM C;  5B1A C;  4PA7 A;  4PA3 A;  3FB5 C;  3E8F A;  4J9Y B;  4MVZ A;  4R6Z A;  1M56 C;  4RAI A;  3SPH A;  3OGC C;  1R3L C;  4WFG A;  3STZ C;  4P9O A;  3E89 A;  3SYP A;  3UM7 A;  3E8G A;  2X6A A;  4LBE C;  4QE9 A;  5E1A C;  2IH3 C;  1R3J C;  4H37 A;  1V54 C;  2NLJ C;  2ITC C;  3TCU A;  4JTD B;  4RUF A;  3LDC A;  2A79 B;  2WLL B;  1G4Y B;  1OCC C;  2DYS C;  3ABL C;  4KFM A;  2AHY A;  3LDE A;  5B1B C;  2H8P C;  2ITD C;  4I9W A;  3RVY A;  4JTC B;  3E8B A;  3ABK C;  2R9R B;  2WLK A;  1ORQ C;  3K08 A;  4PA9 A;  3R65 A;  3IGA C;  4H33 A;  4PDV A;  3K04 A;  3ASN C;  5CBH A;  1P7B A;  1M57 C;  2WLN A;  1XL4 A;  4MW3 A;  4OXS A;  2HJF C;  3JYC A;  3EFF K;  4PDL A;  4MTF A;  5EBW C;  3SPJ A;  4J9Z B;  2WLI A;  4TWK A;  4ZBM A;  3TET A;  2Q67 A;  4HYO A;  3SYQ A;  1JVM A;  2KB1 A;  4P30 A;  2EIK C;  1R3K C;  3ASO C;  3LNM B;  4MW8 A;  4P2Z A;  3T1C A;  5CBG A;  4MVS A;  3E8H A;  4PDR A;  1S5H C;  4LCU C;  3T4Z A;  4P9P A;  2P7T C;  4MSW C;  4PA6 A;  1V55 C;  2EIJ C;  5BZB A;  5KUM A;  2A9H A;  2EIM C;  4RUE A;  2YEV A;  4MVR A;  3AG4 C;  3FB8 C;  4F4L A;  5J9P C;  3AG2 C;  2WLH A;  3SYO A;  4RO2 A;  5EBM C;  4MVO A;  3F7Y C;  5KUK A;  1J95 A;  1LNQ A;  2DWD C;  4MTG A;  4XDJ A;  1QLE C;  2BOC C;  3LDD A;  3F7V C;  5EC1 C;  3SPI A;  2ZD9 A;  4QNH B;  3FB6 C;  2K1E A;  4WFH A;  2ATK C;  4GX1 A;  3ZJZ A;  5B3S C;  3FB7 C;  3K03 A;  5EC2 C;  2WLI B;  2WLM A;  3IFX A;  4G28 B;  3SYA A;  3WG7 C;  2ZXW C;  1OCO C;  3OUF A;  3HPL C;  3RVZ A;  3SJQ C;  2A0L A;  4MVQ A;  4X89 A;  5CBF A;  2QTO A;  2AHZ A;  4X8A A;  3VOU A;  3STL C;  2HFE C;  1K4C C;  3LUT B;  3K06 A;  2Q68 A;  4QE7 A;  3E83 A;  3SPC A;  5EK0 A;  3SPG A;  1ZWI C;  2IH1 C;  3K0G A;  3PJS K;  3KG2 A;  4PA4 A;  4WFF A;  3GB7 C;  4X88 A;  1OCR C;  4G27 B;  3OR7 C;  4BW5 A;  4WFE A;  2HVK C;  2DWE C;  2X6B A;  4MVM A;  2JK5 C;  4GX2 A;  3T4D A;  2HG5 C;  2WLJ A; 
#chains in the Genus database with same CATH topology
 1VAR A;  2OCC B;  2QSA A;  2A7W A;  3D36 C;  4IGG A;  1L0L H;  2EJ7 A;  2VWK A;  2QM4 A;  3FD9 A;  4LF4 B;  2IJJ A;  5B1O A;  1GN3 A;  1PV0 A;  4O2B A;  4KL1 A;  4JYA B;  3K9S A;  5JCO A;  1EBO A;  1SQX H;  2IU0 A;  4J9Y B;  2ZCE A;  3C3S A;  4X20 B;  1XHX A;  1V55 B;  3HKD A;  3JD1 A;  2N74 A;  4OPA A;  3OGC C;  4GCZ A;  3WB2 A;  4JAA A;  1GKF A;  4B3M B;  1HW7 A;  2PY5 A;  2XTA A;  2ZE6 A;  4MT8 A;  5KHI A;  3LSU A;  3RYH B;  1JFF B;  1ORQ C;  4TOI A;  1H2L A;  4LH7 A;  3TGU H;  3K04 A;  2ZR2 A;  1HNW B;  2WLN A;  4PDL A;  1I08 A;  2HJF C;  3D3I A;  5C8Y A;  1WB8 A;  2FTK A;  3OT7 A;  2CDY A;  2HKO A;  1K92 A;  3AG4 B;  4LFA B;  2A3Q A;  2B9Z A;  1WPB A;  4MVS A;  1J5E O;  4QIW F;  1QQC A;  4P9P A;  4PA6 A;  2GHY A;  1NKD A;  3AG1 B;  3OE7 G;  3AG7 A;  4PHZ A;  2CAZ C;  4MVR A;  4GYC B;  2WAM A;  3CMA V;  4F6R A;  1LNQ A;  1NH2 D;  3GVM A;  4LF9 B;  3F7V C;  5D5P A;  4IL6 Z;  5IYC O;  3CE2 A;  1R1B A;  3B8M A;  2ATK C;  1TAE A;  3SJB C;  1GMG A;  1JQ0 A;  5EC2 C;  2IJH A;  1XMO B;  3RVZ A;  1VQM V;  2A0L A;  4FLV A;  3OMI B;  4J10 A;  5LMN B;  1SQQ H;  4LR3 A;  3M7M X;  1H2K A;  3STL C;  2GUZ B;  3VQY A;  3B2E E;  2QWQ B;  3BA9 A;  4GKK O;  1MSD A;  1Y66 A;  2ZE7 A;  1YTF B;  1CP9 A;  3ZRS A;  4FLY A;  3OR6 C;  4I4T B;  3K0D A;  5LP6 A;  1JX9 A;  1NTK H;  2ZIN A;  1VQ6 V;  4UV8 A;  1RP3 B;  4UVA A;  2Y0I A;  1RM1 B;  3WB0 A;  4HZ3 A;  1BS3 A;  4ASU G;  1NJI W;  4C7U A;  2ZNI A;  4O4J B;  4YY3 O;  4DR5 B;  4R6Z A;  4KP4 A;  5L3E A;  1VF6 A;  4IIJ B;  3W7W A;  4P9O A;  4LBE C;  3CS5 A;  3ZRW B;  1WLE A;  3OAA G;  1KBH A;  2UXC O;  2PI4 A;  4JI8 O;  4ICG A;  5CMU A;  5H9C A;  3JAT A;  1US6 A;  2YXL A;  4UB6 Z;  3N2G A;  4BR6 A;  1Y76 B;  3JD3 A;  3DSQ A;  4JV5 B;  4TWK A;  4BW9 A;  2EJR A;  2QKC A;  2EIM B;  3SYQ A;  4WBN B;  2N04 A;  3B40 A;  3CCJ V;  1XNQ B;  4LCU C;  2Z0A A;  5BMV B;  2A9H A;  4RUE A;  2XAF A;  1FAF A;  4H13 B;  3VQW A;  4WF9 V;  3WG7 B;  4EEQ A;  5IJ9 B;  1S77 D;  5A2Q N;  2F4V B;  2DQ0 A;  1VIB A;  4K35 A;  4PI2 A;  4WFB V;  2UUB O;  1Q82 W;  1TGO A;  3BPZ A;  1K97 A;  2QWP B;  4QE7 A;  2ZE5 A;  1A32 A;  1VF6 C;  1XEQ A;  2CTW A;  2RDC A;  3AK3 A;  2PZS A;  3CPW U;  1GTO A;  4E4E A;  4X20 A;  4EFB A;  1PNM A;  2QM7 A;  1JR9 A;  2K9P A;  3KZI Z;  2N05 A;  3IAY A;  3QF7 A;  4ZHQ B;  2JEU A;  3B09 A;  5KHH A;  4CBC A;  4NB5 A;  2EUL A;  1ZSP A;  3HKB B;  4DV5 B;  3QTC A;  1VEW A;  1XMQ B;  3RYH A;  1JFF A;  1SQG A;  4GKJ B;  2UXD B;  3H1H H;  1NR1 A;  4X65 O;  3DGE A;  4BIZ A;  1YCI A;  3FB5 C;  5GTH Z;  5CA0 B;  4FPP A;  1JA8 A;  3TK1 A;  5ITZ B;  1M1K W;  3ZIA G;  1VQ8 V;  3E89 A;  3UM7 A;  4JI4 B;  3G71 V;  1D2D A;  4ZKI A;  4TQF A;  2ITD C;  1SKV A;  4CS2 A;  2ILM A;  3W7X A;  4GZR B;  2CK3 G;  3IGA C;  3SR2 C;  2YIA A;  1VF7 A;  2QR4 A;  2O57 A;  1XNR B;  3OTO B;  1Y4M A;  2E76 B;  1P4R A;  4P2Z A;  1WA8 B;  1DF4 A;  4I0X B;  2QWO B;  1HNZ B;  2GUZ A;  3CCM V;  4MSW C;  1V55 C;  5JJN B;  3QO8 A;  2ETN A;  4PV1 B;  5CB4 B;  1I94 O;  5B3S B;  1IX9 A;  3GWK C;  5J9P C;  5H5N A;  4MTG A;  2YS8 A;  3LDD A;  3SPI A;  4DR2 B;  4U3J B;  4DV0 O;  1M5I A;  1N32 B;  1GM8 A;  4I4T A;  1WP7 A;  3CCS V;  4G28 B;  3SYA A;  2Q5Z A;  1VQO V;  2ZM6 O;  2F95 B;  4DV2 O;  2Q0O C;  3JCZ A;  1Q7Y W;  2B1I A;  2DQ3 A;  4DK0 A;  1MNG A;  1Q6U A;  5BR8 B;  2X6B A;  1K3E A;  2NN4 A;  4O4J A;  4JI0 B;  3TJT A;  1QU7 A;  3AG1 C;  4IIJ A;  4ZOL B;  4PDM A;  3ZRW A;  2OTL V;  4DV3 B;  2Q9L A;  4HAM A;  1U97 A;  1MZF A;  3JAL B;  5LA6 B;  3VQV A;  2VS0 A;  4MVU A;  4U7O A;  2YIC A;  4LP8 A;  1IDS A;  1FS0 G;  4EKW A;  1TA8 A;  4WFA V;  4UV9 A;  2ARH A;  4DUY O;  3W7T A;  4J7Z A;  2Q7G A;  4WBN A;  2D3O W;  3STZ C;  4DR3 O;  1P7G A;  1H2S B;  1NU1 H;  3CRC A;  2NLJ C;  1SQP H;  3OFN G;  3TCU A;  3CCL V;  5BMV A;  2XAG A;  3QO5 A;  1N8R W;  5FNV B;  3U0Z A;  4DR7 O;  5IJ9 A;  4UCT A;  1L0N H;  4LF5 O;  4JYC A;  4PDV A;  2PYL A;  1P7B A;  1IZ3 A;  1RM1 C;  4Z1V A;  4ZBM A;  4K0K O;  1KP3 A;  3IC7 A;  2Q67 A;  4PEL A;  1EN6 A;  2Q4P A;  1WAZ A;  2KB1 A;  3CCU V;  1N0N A;  2EIK C;  1URF A;  1K9M W;  1BMF G;  5KAF Z;  4GUN A;  2YEV B;  4F4L A;  4X62 B;  4FK5 C;  2Y4U A;  3JAR A;  3WFV A;  2EZO A;  4ZHQ A;  2BE3 A;  3SJC C;  4JI1 B;  5IDJ A;  3JCU Z;  4QJF B;  1K5Q A;  1Z5W A;  3ABM B;  1RSO B;  4JI7 B;  3ABT A;  1GAX A;  3HKB A;  1BQ0 A;  4LFB B;  2QKA A;  3O9O A;  5IWA O;  3EVK A;  3CC4 V;  2CGO A;  3DC5 A;  2UXB B;  3APO A;  3K5N A;  2CE4 A;  1I5X A;  1NTM H;  2DWE C;  3E22 B;  3H1J H;  4DV7 O;  5CA0 A;  5ITZ A;  1YXB A;  4J7J A;  4B08 A;  4N21 A;  1W59 A;  1NVP D;  3J80 N;  2JDI G;  3BHP A;  5DN6 G;  1GN6 A;  3QG5 A;  4B3S O;  2B1G A;  3S3W A;  1WJZ A;  1M93 A;  3FX7 A;  2IJI A;  1YZB A;  3SYP A;  1MZE A;  4KUM A;  2FML A;  2VQE B;  4DR6 B;  2AHY A;  3BAA A;  1GRJ A;  5CB4 A;  4DV1 O;  2Z3Y A;  4L8J A;  4DUZ O;  3ETD A;  3CC7 V;  1FXK C;  1AR1 B;  5DED A;  3N2K B;  4U3J A;  1R6K A;  4J7K A;  2E75 B;  1E1Q G;  1PKX A;  4JPR A;  4DR4 B;  2RNB A;  1OCR B;  4X66 B;  2F66 C;  5LMU B;  4OX9 B;  4QGP A;  4YHH B;  4JF3 A;  4DK1 A;  4FIP C;  1OHH G;  4CH5 A;  1Y67 A;  4ZOL A;  1VQL V;  2GSM B;  4WFH A;  4G2K A;  3RWR D;  3JAL A;  5LA6 A;  4UCU A;  3DTU B;  2JJ1 G;  3A8T A;  2F23 A;  2R9A A;  1XHZ A;  4I5S A;  3CSX A;  1G1X B;  1UPG A;  3HB3 B;  3T4D A;  1VQ7 V;  1AR4 A;  2LQT A;  3OUS A;  3OM3 B;  2QA4 V;  5LOV B;  4MS2 A;  1E79 G;  2V1D A;  4AIL C;  4JTA B;  1QHT A;  3ABU A;  2ZR3 A;  4DW1 A;  4MTX A;  3LNN A;  5FNV A;  1VQN V;  2QKS A;  3K79 A;  1BHA A;  4XDL A;  1YEW A;  4UCS A;  1JOY A;  4PA7 A;  3E8F A;  3N27 A;  1KU9 A;  4JI3 O;  1VQ9 V;  1HP8 A;  2UU9 B;  2X6A A;  3AG2 B;  2UUC B;  1PL0 A;  3JAS B;  5BY1 A;  2HEP A;  2H8P C;  1IXM A;  2JEX A;  1AI7 A;  1YJN V;  1ZAU A;  1SZT A;  1SRY A;  1XQ8 A;  1V9P A;  5KA5 A;  4JI5 B;  3OEH G;  3CEI A;  3CRQ A;  1JVM A;  1RSO A;  2BSK B;  5KLV H;  3RT3 C;  2IJK A;  4QPK A;  4KHP O;  2R70 A;  3TXS A;  3FB8 C;  3E22 A;  1XRE A;  2Z5U A;  4FVM A;  3ZJZ A;  3K03 A;  3JAM N;  2WLI B;  3OUF A;  3WB1 A;  1QVF U;  3OTF A;  2QE7 G;  5CBF A;  1BSM A;  3LSS A;  1EN5 A;  3A0H Z;  2LGW A;  1QCE A;  5EK0 A;  3UT5 A;  5J2U B;  4NTW A;  4DV6 O;  2GBO A;  5FL7 G;  2XAJ A;  4B7E A;  2YI8 A;  2ADP A;  3ZHU A;  1IBK B;  3JAW B;  4TSF G;  4NKG B;  4I50 B;  2YI9 A;  1XOU A;  2UXX A;  4JAV A;  3I56 V;  4X64 O;  1QNM A;  1TVK B;  4CH3 A;  4MTO A;  1WNS A;  3CYO A;  2JGU A;  5B5E Z;  2X7R B;  1HDJ A;  2Q69 A;  5KA6 A;  2W0F C;  2UUA B;  3ABM C;  3N2K A;  3ASO B;  2KQX A;  1MMM A;  5CA3 A;  2X0L A;  2Y48 A;  4NR1 A;  2LJ2 A;  2Y4T A;  1YIJ V;  1Q90 D;  2IH3 C;  2CGN A;  3H1L H;  4D6T H;  2XAQ A;  4NXN B;  1MSW D;  3AEI A;  1M4U A;  2ZNJ A;  3E8B A;  4CZZ A;  1SET A;  3K08 A;  4JZ2 A;  4D7T A;  4BAY A;  2EIK B;  5CBH A;  3M99 B;  1B04 A;  2V4D A;  1CEZ A;  1F7Y A;  1R73 A;  1IBM B;  3IJ4 A;  2FYU H;  4PDR A;  3QO7 A;  1N36 B;  1DLB A;  5EIB C;  3D8C A;  4B3R B;  4CS3 A;  1NTZ H;  2EIL B;  1D5N A;  1HNX O;  3CHX A;  3ML0 A;  2HHH B;  2VQF B;  2LP7 A;  1Y74 B;  1S5L Z;  1GM9 A;  1IBL B;  1QBZ A;  1F4M A;  4X89 A;  4LF7 B;  3L72 H;  1FD9 A;  2F93 B;  3LUT B;  1COW G;  3TXQ A;  3K06 A;  2QTS A;  2DJV A;  2XOK G;  5F2V O;  1ZWI C;  5KX5 B;  4PA4 A;  1ZL8 B;  1OCR C;  3JAK B;  2CUG A;  1EFR G;  1W2B U;  1G8M A;  1FXH A;  4DO2 A;  4K8X A;  3T1Y O;  1MAB G;  1HR0 B;  1MOF A;  3JAS A;  3RW0 A;  1NT2 B;  4R50 A;  4GX5 A;  2RJZ A;  2Q0A A;  3ZX6 A;  2BOB C;  3CP1 A;  3L75 H;  2XT9 A;  1NI8 A;  1N4C A;  1VF5 B;  3OD4 A;  1UJW B;  4LF4 O;  3ZRV A;  4JYA O;  4AHC A;  3EXA A;  1L8D A;  1K33 A;  2F43 G;  4LF6 B;  2BSK A;  1FXK B;  1VP7 A;  4RUF A;  2VRZ A;  1AB3 A;  2A79 B;  2Q7E A;  3LDE A;  4B3M O;  3ZS8 C;  5IYD O;  4JTC B;  4DR1 B;  1I0H A;  3C3T A;  5D5Q A;  4JI6 B;  4E2L A;  5LGT A;  1Q6H A;  4JAU A;  5EBW C;  4OXS A;  4MTF A;  1S76 D;  2WLI A;  3I5D A;  2KKW A;  1HNW O;  5CA1 B;  3NXS A;  3CJH B;  1BQZ A;  4W4K A;  4YIP A;  1ARO P;  4LFA O;  4FFB B;  3I55 V;  3JD2 A;  4JI2 B;  5J2U A;  2E5L B;  1MG1 A;  5IY5 B;  3AG2 C;  2DYR B;  3JD0 A;  5JVD B;  2BOC C;  3JAW A;  1R6T A;  2ZD9 A;  3FB6 C;  1BT8 A;  3SDL A;  4LF9 O;  4I50 A;  2W0X A;  3NR7 A;  1TUB B;  5L3D A;  4B3T B;  3P3P A;  5C93 A;  1TVK A;  3ZHR A;  2DN9 A;  4MVQ A;  2QTO A;  1YF2 A;  1XMO O;  5LMN O;  3KKY A;  2IH1 C;  2P6J A;  3PJS K;  4FJC C;  5GW7 A;  3UCS C;  1KQS U;  2OWO A;  4Q6G A;  3OR7 C;  2HVK C;  1GK9 A;  1QR9 A;  1N34 B;  1GM7 A;  4LC1 A;  1SS3 A;  4FZ0 A;  4J11 A;  1K34 A;  3ABK B;  3APQ A;  4NXM B;  5H6Q A;  3FYE B;  4LF8 B;  4DXW A;  1NS1 A;  3F5W C;  4BIU A;  3E86 A;  1BL8 A;  2FKX A;  4EB6 B;  4X1I B;  1GN4 A;  2ZQM A;  2EIJ B;  4DR5 O;  3SPH A;  1R3L C;  5DEC A;  4YXW G;  3ZBH A;  1P84 F;  3FAV B;  2DYS C;  3MDS A;  3ZMS A;  5KAI Z;  1PL4 A;  2LO1 A;  3S3X A;  2CTP A;  2JVD A;  3B77 A;  2H94 A;  1Y76 A;  2EBO A;  1QR8 A;  4FFK A;  2CTR A;  3SPJ A;  1Y74 A;  4JV5 O;  2AGA A;  2Q7H A;  2JS3 A;  3ASO C;  1K7D A;  4UXN A;  4LFC B;  3CC2 V;  1XNQ O;  2QWR B;  1AVM A;  1AI6 A;  1SQV H;  5KX5 A;  1S3J A;  3THO A;  1ZL8 A;  4J41 A;  3JAK A;  4FM1 A;  3T1H B;  3B4S A;  3HR0 A;  2YUA A;  1B06 A;  4I9Q A;  1TUE B;  2ZE8 A;  3DXR B;  3RYI B;  3FB7 C;  2F4V O;  4NTX A;  3IFX A;  2DOS A;  2LGQ A;  3HPL C;  1FJG B;  2KSD A;  4KXR A;  2AHZ A;  3CCE V;  4ZI7 B;  2QWN B;  3E83 A;  3UO2 A;  5TIS Z;  4DV4 B;  3KG2 A;  4X88 A;  2YIB A;  4DYL A;  4AQY O;  2ZIM A;  4HNA B;  4GX2 A;  3ABL B;  2HG5 C;  2D2C B;  4UUJ C;  5B1B B;  3FKS G;  4W4L A;  4R7C A;  1FXK A;  2EIL C;  1YHQ V;  3RBZ A;  1YIT V;  2X6C A;  1NQT A;  2EX3 A;  5JH7 B;  1Q86 W;  1R3I C;  2PF4 E;  3SYC A;  3G80 A;  2JJ2 G;  4DV5 O;  4DW0 A;  5L3C A;  1XMQ O;  2UXD O;  4GKJ O;  5L3G A;  3K57 A;  2G38 A;  5CA1 A;  3CJH A;  1X59 A;  2MW2 B;  2OCH A;  1Q8I A;  4QE9 A;  4H37 A;  4FFB A;  3PN1 A;  4JI4 O;  1K8A W;  2E74 B;  2BTO A;  2V7Q G;  1H38 A;  2DE0 X;  5BXZ A;  1K5S A;  1B3Q A;  5JVD A;  3R65 A;  4H33 A;  3A2F A;  1B6Q A;  1XL4 A;  1TUB A;  1JMK C;  3ZMZ A;  1P49 A;  4J9Z B;  2Y0P A;  4J80 A;  1J5E B;  3OTO O;  1XNR O;  1PM9 A;  1WA8 A;  3T1C A;  1PD3 A;  3H1K H;  4I0X A;  1BZK A;  3T4Z A;  5FPO A;  2P7T C;  1AR5 A;  1HNZ O;  3H9V A;  4MVO A;  1N33 O;  4F6R B;  1QLE C;  5A9G A;  3L74 H;  2K1E A;  1H8E G;  3BCC H;  3K3W A;  4DR2 O;  3ETE A;  1EZV H;  1N32 O;  3BY6 A;  3AG3 B;  1YVW A;  1HWY A;  4JYB A;  1AJQ A;  2ZDI A;  2GV9 A;  3VOU A;  4GKK B;  3WU2 Z;  4XBF A;  3HKC B;  2OIE A;  2DW4 A;  4EB6 A;  4X1I A;  5EZY B;  4AI8 A;  4UCO A;  5BR8 O;  2HR3 A;  1FYJ A;  2WLJ A;  4IYI A;  4JI0 O;  3T2M A;  1FKA O;  5IY5 C;  1I5Y A;  4ABM A;  3E2E A;  2DYR C;  3FAV A;  1RPO A;  1KKC A;  2YSU B;  4DV3 O;  1VQP V;  3QVN A;  4R8C A;  4FLZ A;  2JGD B;  2AW9 A;  4WCE V;  1BE3 H;  1H2M A;  1NZ6 A;  4TV8 B;  3H01 A;  3KCX A;  1IXB A;  5J2T B;  5KMG B;  1AJN A;  4YY3 B;  2XHB A;  1YSC A;  1KMI Z;  3P3N A;  4UFZ A;  1OZ0 A;  1H2G A;  4UB8 Z;  5K1P A;  5FLX N;  2UXC B;  4JI8 B;  1GN2 A;  1Z5V A;  4FMT A;  3CME V;  2GTA A;  3ABK C;  3RN4 A;  1OCO B;  2WLK A;  3DXR A;  3RYI A;  5GTI Z;  1BHB A;  1ZUQ A;  3ZHT A;  2ZDI C;  5JJJ B;  2BTQ B;  5CN0 A;  1SES A;  1H2N A;  4MW8 A;  4DRX B;  2OIG A;  4ZI7 A;  2DMX A;  2EIJ C;  1UFI A;  4LNU B;  2YEV A;  4RWU A;  1G6U A;  1SC5 B;  2WLH A;  4HNA A;  3F7Y C;  4O2A B;  2NNU A;  2W6I G;  2VWJ A;  1OJH A;  1M90 W;  4X62 O;  4NVP A;  1WPX A;  3JSN A;  1NR7 A;  4TQD A;  1AIL A;  1PP9 H;  3LSQ A;  2UUB B;  2UXN A;  3VBB A;  5JJE B;  1WP8 A;  2P22 C;  2M7W A;  3W7S A;  4JI1 O;  2IBZ H;  3ETQ A;  3K5O A;  5JH7 A;  2P4V A;  4UCV A;  4JI7 O;  1BGY H;  3BVO A;  3UQ8 A;  2HFE C;  1K4C C;  2Q68 A;  2HJD A;  4LFB O;  1NH2 B;  3K0G A;  4WFF A;  1X4T A;  3B8N A;  4F6E A;  2UXB O;  4JYY A;  4MVM A;  4X9Q A;  2ADQ B;  3ZRX A;  2IM9 A;  5LHG A;  1THZ A;  1DF5 A;  5KHJ A;  3DC6 A;  3BRC A;  4K3A A;  4O4I B;  3MD0 A;  1EZJ A;  3ASN B;  3VQX A;  2Q8V A;  3ICX A;  4FM2 A;  1KUQ A;  4UVB A;  4GX0 A;  2LW1 A;  4X65 B;  1RFY A;  2HVJ C;  3EHB B;  3MHS C;  1YJW V;  1EM1 A;  3M8A A;  2DYS B;  4TUY B;  3CRR A;  4WFG A;  1SA0 B;  1R3J C;  2F1M A;  4PI0 A;  4BIO A;  3ABL C;  2WLL B;  1G4Y B;  5B1B C;  2VQE O;  3RVY A;  4DR6 O;  5JWP A;  1S72 V;  1OV9 A;  4JAS A;  3J81 N;  4ZIB A;  4I55 B;  4U3F H;  4X1Y B;  1KEC A;  3J7A U;  2YXY A;  3ZMU A;  2RMK B;  4GLX A;  3EFF K;  1SQB H;  4CH6 A;  5IT9 N;  2XUM A;  1ENV A;  4DR4 O;  5JCO C;  1U96 A;  4X66 O;  4Z2W A;  5LMU O;  1I94 B;  3HKC A;  4OX9 O;  5BZB A;  1F51 A;  4N23 A;  3HKE B;  4YHH O;  5EZY A;  3KCY A;  2AXT Z;  5KUK A;  4DV0 B;  4RQF A;  1Q81 W;  4YIO A;  5IE9 A;  1WN7 A;  2PUS A;  2EIN B;  2PI5 A;  2H3O A;  2P67 A;  2ZM6 B;  3CX5 F;  4DV2 B;  4OGQ B;  5LXT B;  5B66 Z;  3ETG A;  2JGD A;  4H44 B;  4TV8 A;  5J2T A;  1Q3E A;  5KMG A;  3F5T A;  4A5U B;  1SQF A;  1IVS A;  4WFE A;  4O4L B;  1S5J A;  1L1F A;  1DK1 A;  3H1I H;  1OCC B;  2PTM A;  1JJO A;  2P5O A;  1YTF D;  5LOV A;  3CXH F;  1SZX A;  3D3Q A;  3JD4 A;  4JGS A;  2WA4 A;  2HP8 A;  5H2F Z;  3AG3 C;  2CH7 B;  2BCC H;  4DUY B;  4B7K A;  4FZ1 A;  1XUQ A;  5IYZ B;  4DR3 B;  2BTQ A;  4RAI A;  1F23 A;  5GON B;  2EZP A;  4DRX A;  2UU9 O;  1QVG U;  1I7F A;  2UUC O;  4LNU A;  5HFL A;  4DR7 B;  2ZKO A;  3C90 A;  2QEX V;  5LP6 C;  4LF5 B;  4O2A A;  2R9R B;  4GT1 A;  3MHH C;  5L3F A;  5KHG A;  3ZN0 A;  4JZG A;  2LFS A;  2XAH A;  4K0K B;  4LH6 A;  4JI5 O;  1O9G A;  4EFE A;  4TT3 G;  1R3K C;  5CBG A;  2PGG A;  1QLE B;  4Z1M G;  2E3C A;  2FB5 A;  2WA3 A;  3CB2 A;  2MK3 A;  4AQY B;  2ODM A;  4FLW A;  3Q4H B;  5IJ0 B;  1XBL A;  4RO2 A;  2YC0 A;  3RYF B;  3CXC U;  3JAR B;  3K5L A;  2Y69 B;  4FLT A;  2JRI A;  4GX1 A;  1AP5 A;  3ZHS A;  5EYP B;  3X2Q B;  3ZED A;  1GH6 A;  1ZX3 A;  1OCO C;  4O4I A;  2Q73 A;  5B1A B;  5IWA B;  3G6B A;  3FYI B;  1M56 B;  5L3B A;  2IU3 A;  3IC9 A;  4QPJ A;  2YXH A;  4DV7 B;  4G27 B;  4BW5 A;  1V54 B;  2WPD G;  3A0B Z;  4YJ3 B;  1KD1 W;  4TUY A;  2L35 A;  2OYQ A;  5LHI A;  1OCZ C;  1FFT B;  2YIB D;  1IBK O;  1SA0 A;  1YDX A;  3K58 A;  4FLU A;  3RYC B;  3ZHV A;  3UO3 A;  2WLL A;  1XL6 A;  1SER A;  5LYJ B;  1K4D C;  1M57 B;  2OCC C;  1MA1 A;  3MAQ A;  1WB7 A;  3SGI A;  4I55 A;  4X1Y A;  4B3S B;  3OEE G;  2UUA O;  4MVZ A;  5KHK A;  3OW2 U;  2AZ2 A;  3CCV V;  3E8G A;  1GO3 F;  2ZT9 B;  4JTD B;  4PD4 F;  1Z2G A;  4DV1 B;  3OMN B;  5JQG B;  1YI2 V;  4I9W A;  4DUZ B;  4NXN O;  3HKE A;  4LWS B;  4IT5 A;  1N33 B;  5LL6 Y;  2ZXW B;  4NYK A;  2GDS A;  4IHJ B;  4PA9 A;  4YJ2 B;  5IYB O;  3ASN C;  4TV9 B;  1Q6I A;  1FPO A;  3AK2 A;  1Y6X A;  1VMG A;  1Q43 A;  4HYO A;  1H8H G;  5LXT A;  3K5M A;  3LNM B;  3E8H A;  1IBM O;  1F4N A;  1VQ4 V;  2LFR A;  1N36 O;  4D7S A;  3AG4 C;  4UCR A;  4O4L A;  4X1K B;  3SYO A;  4B3R O;  2DWD C;  1PNL A;  1AP6 A;  2NR5 A;  2HHH O;  1S0V A;  1FFX B;  2VQF O;  3O65 A;  1EN4 A;  2WLM A;  3L9D A;  2JS5 A;  2KG7 B;  4UVC A;  1N0J A;  3E35 A;  1IBL O;  1VQK V;  3CWB H;  1LUV A;  2RQ6 A;  4X8A A;  4CS4 A;  2P06 A;  2M6Y A;  4LF7 O;  2RN9 A;  3SPG A;  3ZHQ A;  2CH7 A;  3P32 A;  1LUW A;  3ZN1 A;  2QJ1 A;  1W0K G;  1M9N A;  4H0L B;  1RPR A;  5IYZ A;  1XDC A;  2HLD G;  3RGB A;  3CRA A;  5GON A;  1NBM G;  5LGU A;  4RQE A;  2QDO A;  3BEH A;  1PPJ H;  2WWW A;  1HR0 O;  2RCV A;  2LW7 A;  3OGI B;  2EIN C;  3AK1 A;  4O4H B;  2ZIO A;  2R72 A;  1ROP A;  3UKM A;  3RFR A;  3G6E V;  1KKD A;  4PA3 A;  1XI1 A;  4L87 A;  4JI3 B;  1ZTE A;  5LBQ A;  3CD6 V;  2W6J G;  3GWO A;  2C2A A;  1QLN A;  3QNE A;  3BAB A;  1AJP A;  1NVP B;  2GTS A;  4LF6 O;  3K9A A;  1OCC C;  4KFM A;  3Q4H A;  1T5E A;  5IJ0 A;  3ZCC A;  4BWA A;  4O2B B;  3RYF A;  2YID A;  1DTO A;  4DR1 O;  3BFR A;  3CCQ V;  3JYC A;  4JI6 O;  2OTJ V;  4U7N A;  5EYP A;  3TET A;  3HKD B;  4OPH A;  4CC6 A;  3ZMT A;  4FLX A;  4P30 A;  4K8Z A;  1KP2 A;  3CRM A;  3K59 A;  4KHP B;  1IUR A;  2IW5 A;  5KUM A;  2EIM C;  4JI2 O;  2OT5 A;  3R66 A;  2E5L O;  2QGN A;  1J95 A;  4YJ3 A;  3W7U A;  4CC5 A;  2PYJ A;  5H6R A;  1KB9 F;  5C8Y B;  3RYC A;  3WG7 C;  4B3T O;  3SJQ C;  5LYJ A;  1XIL A;  1D5A A;  2WSS G;  2XAS A;  3SPC A;  4DV6 B;  3UT5 B;  1SF9 A;  3GB7 C;  3JSL A;  2JK5 C;  3L71 H;  1JPX A;  5EBL C;  5E79 Z;  4X64 B;  1N34 O;  3L73 H;  2B5U A;  1YJ9 V;  3P30 A;  1LR1 A;  2A06 H;  2QM8 A;  2P4K A;  3BA8 A;  5JQG A;  1JJ2 U;  5DM6 V;  4NXM O;  2Y69 C;  4LWS A;  4LF8 O;  4XDK A;  3X2Q C;  2Q6A A;  4IHJ A;  1AI5 A;  4YJ2 A;  1ZLZ A;  2R9I A;  5B1A C;  3SJA C;  3G4S V;  4Q20 A;  2YDE A;  4CH4 A;  4TV9 A;  2FL4 A;  1M56 C;  4FM0 A;  3A0R A;  1PNK A;  1FXV A;  3U11 A;  5E1A C;  3OMA B;  5LP6 B;  1V54 C;  3CCR V;  2ITC C;  3LDC A;  5EIB D;  1KYO F;  4J42 A;  2P90 A;  4NTY A;  1E1R G;  1VQ5 V;  4X1K A;  3D36 A;  3FFQ A;  1KC8 W;  5LGN A;  1M57 C;  4MW3 A;  3U10 A;  5LHH A;  1FFX A;  5AG2 A;  5K1X A;  2JIZ G;  2KG7 A;  5HFM A;  2AZ0 A;  2CTQ A;  4PJ0 Z;  4I7Z B;  1S5H C;  4LFC O;  1DGS A;  1CXZ B;  4IYH A;  1K73 W;  1HNX B;  3G67 A;  5EBM C;  1AI4 A;  3JAT B;  3T1H O;  4XDJ A;  1CPY A;  4HBN A;  5EC1 C;  4QNH B;  3N2G B;  1BCC H;  1O9H A;  5B3S C;  2XND G;  2L6L A;  1JCH A;  2ZXW C;  1R6N A;  4O4H A;  1FJG O;  3ZMV A;  1Q5O A;  1OCZ B;  1W0J G;  4DV4 O;  3T1Y B;  5FPR A;  3L70 H;  5B1N A; 
#chains in the Genus database with same CATH homology
 2OCC B;  1YTF D;  1K34 A;  3ABK B;  3JD4 A;  4N21 A;  5H6Q A;  3FYE B;  4DXW A;  4JGS A;  1NVP D;  3F5W C;  2JDI G;  2IJJ A;  4BIU A;  5B1O A;  3E86 A;  1BL8 A;  5DN6 G;  3AG3 C;  1EBO A;  2IU0 A;  4J9Y B;  2B1G A;  1V55 B;  2ZQM A;  2EIJ B;  3JD1 A;  4RAI A;  3SPH A;  2IJI A;  3OGC C;  1R3L C;  1F23 A;  3SYP A;  4GCZ A;  4YXW G;  2EZP A;  4KUM A;  1QVG U;  1GKF A;  2DYS C;  2AHY A;  5HFL A;  4MT8 A;  3ZMS A;  2Z3Y A;  2QEX V;  3ETD A;  3B77 A;  2R9R B;  3CC7 V;  1FXK C;  1ORQ C;  2H94 A;  1AR1 B;  4GT1 A;  3MHH C;  5L3F A;  3ZN0 A;  3K04 A;  1R6K A;  2EBO A;  2ZR2 A;  2LFS A;  2XAH A;  2WLN A;  4PDL A;  1QR8 A;  2HJF C;  3D3I A;  1E1Q G;  3SPJ A;  1PKX A;  4JPR A;  2FTK A;  1OCR B;  2HKO A;  1K92 A;  3AG4 B;  4TT3 G;  1R3K C;  3ASO C;  5CBG A;  1K7D A;  4MVS A;  4UXN A;  1QLE B;  4QIW F;  4P9P A;  4Z1M G;  3CC2 V;  4PA6 A;  2GHY A;  1AI6 A;  3AG1 B;  1NKD A;  3OE7 G;  2MK3 A;  4JF3 A;  1S3J A;  4MVR A;  2WAM A;  4FIP C;  4RO2 A;  3CMA V;  1OHH G;  1LNQ A;  1NH2 D;  3CXC U;  3F7V C;  1TUE B;  5IYC O;  3B8M A;  1VQL V;  2Y69 B;  2GSM B;  4WFH A;  2ATK C;  4GX1 A;  3FB7 C;  1GMG A;  1JQ0 A;  5EC2 C;  3X2Q B;  3IFX A;  2IJH A;  4G2K A;  1OCO C;  3DTU B;  3HPL C;  5B1A B;  3RVZ A;  1VQM V;  2A0L A;  3OMI B;  2AHZ A;  2JJ1 G;  3FYI B;  3CCE V;  1M56 B;  3STL C;  2IU3 A;  5L3B A;  3E83 A;  4QPJ A;  3KG2 A;  4X88 A;  1Y66 A;  4G27 B;  4I5S A;  4BW5 A;  1V54 B;  3HB3 B;  2WPD G;  4GX2 A;  1YTF B;  3ABL B;  1KD1 W;  3T4D A;  2HG5 C;  4UUJ C;  5B1B B;  5LHI A;  1OCZ C;  1FFT B;  1CP9 A;  3ZRS A;  1VQ7 V;  3FKS G;  3OR6 C;  3K0D A;  1JX9 A;  3OUS A;  3OM3 B;  4R7C A;  2QA4 V;  1FXK A;  4MS2 A;  1E79 G;  2V1D A;  2EIL C;  1YHQ V;  3RBZ A;  4JTA B;  1YIT V;  2WLL A;  1XL6 A;  2X6C A;  1NQT A;  1SER A;  1VQ6 V;  3ABU A;  1K4D C;  2ZR3 A;  1M57 B;  4UV8 A;  1Q86 W;  1R3I C;  2OCC C;  4MTX A;  4UVA A;  3SYC A;  1RM1 B;  1VQN V;  2JJ2 G;  4HZ3 A;  1NJI W;  4ASU G;  2QKS A;  3K79 A;  1BHA A;  4XDL A;  5L3C A;  1JOY A;  4PA7 A;  5L3G A;  3OEE G;  3E8F A;  4MVZ A;  4R6Z A;  4KP4 A;  5L3E A;  3OW2 U;  3CCV V;  1VQ9 V;  3W7W A;  4P9O A;  3E8G A;  2X6A A;  4LBE C;  3AG2 B;  3ZRW B;  1GO3 F;  4QE9 A;  4H37 A;  1WLE A;  3OAA G;  1PL0 A;  4JTD B;  1K8A W;  3OMN B;  2PI4 A;  1YI2 V;  2V7Q G;  2H8P C;  4I9W A;  5CMU A;  1IXM A;  2JEX A;  5H9C A;  1AI7 A;  1H38 A;  1YJN V;  2ZXW B;  1K5S A;  1SZT A;  1SRY A;  4PA9 A;  5KA5 A;  3R65 A;  4H33 A;  5IYB O;  1B6Q A;  3ASN C;  1XL4 A;  3JD3 A;  3OEH G;  3ZMZ A;  4J9Z B;  4TWK A;  2EJR A;  2EIM B;  4HYO A;  3SYQ A;  1H8H G;  1JVM A;  3LNM B;  3T1C A;  1PD3 A;  3CCJ V;  3E8H A;  4LCU C;  3T4Z A;  2P7T C;  1F4N A;  2IJK A;  1VQ4 V;  2LFR A;  2A9H A;  4QPK A;  4RUE A;  2XAF A;  3AG4 C;  3FB8 C;  4WF9 V;  3WG7 B;  3SYO A;  4MVO A;  2DWD C;  2Z5U A;  1QLE C;  1S77 D;  1PNL A;  2K1E A;  1H8E G;  1S0V A;  2DQ0 A;  3K3W A;  3ETE A;  3ZJZ A;  3K03 A;  2WLI B;  2WLM A;  3BY6 A;  3OUF A;  3AG3 B;  4WFB V;  1QVF U;  4UVC A;  3E35 A;  2QE7 G;  1Q82 W;  1HWY A;  4JYB A;  5CBF A;  1VQK V;  1K97 A;  1AJQ A;  2ZDI A;  3LSS A;  4X8A A;  3VOU A;  4QE7 A;  1QCE A;  4XBF A;  5EK0 A;  3SPG A;  2DW4 A;  3P32 A;  3CPW U;  3ZN1 A;  5FL7 G;  1GTO A;  2XAJ A;  1W0K G;  1M9N A;  1PNM A;  2HR3 A;  1RPR A;  2QM7 A;  2HLD G;  2WLJ A;  3T2M A;  4TSF G;  1NBM G;  5IY5 C;  5LGU A;  2JEU A;  2UXX A;  1I5Y A;  3BEH A;  2WWW A;  4JAV A;  4RQE A;  3I56 V;  3E2E A;  2DYR C;  4CBC A;  1RPO A;  2YSU B;  1VQP V;  4R8C A;  4MTO A;  3CYO A;  2EIN C;  4WCE V;  3H01 A;  2X7R B;  2Q69 A;  5KA6 A;  1ROP A;  2W0F C;  3UKM A;  1NR1 A;  3G6E V;  1AJN A;  1KKD A;  3ABM C;  3DGE A;  3ASO B;  1YSC A;  4PA3 A;  4BIZ A;  3FB5 C;  5CA3 A;  1OZ0 A;  2X0L A;  2Y48 A;  4FPP A;  4L87 A;  5LBQ A;  3CD6 V;  3TK1 A;  1H2G A;  2W6J G;  1M1K W;  3ZIA G;  3GWO A;  1VQ8 V;  1YIJ V;  2C2A A;  3E89 A;  3UM7 A;  1QLN A;  3QNE A;  2IH3 C;  3G71 V;  1AJP A;  1NVP B;  2XAQ A;  4ZKI A;  3K9A A;  1OCC C;  1MSW D;  4KFM A;  4FMT A;  2ITD C;  3CME V;  3AEI A;  3ZCC A;  3E8B A;  4CZZ A;  3ABK C;  3W7X A;  1OCO B;  2WLK A;  1SET A;  3K08 A;  2CK3 G;  1DTO A;  3IGA C;  4BAY A;  2EIK B;  5CBH A;  3CCQ V;  1BHB A;  3JYC A;  3M99 B;  4U7N A;  2ZDI C;  2OTJ V;  1CEZ A;  3TET A;  1Y4M A;  3ZMT A;  1R73 A;  5CN0 A;  4P30 A;  1SES A;  1KP2 A;  1P4R A;  4P2Z A;  4MW8 A;  1DF4 A;  4PDR A;  3QO7 A;  3CCM V;  4MSW C;  1V55 C;  2EIJ C;  2IW5 A;  3QO8 A;  5KUM A;  1DLB A;  2EIM C;  2YEV A;  5B3S B;  5J9P C;  2WLH A;  2OT5 A;  2EIL B;  3F7Y C;  1J95 A;  2NNU A;  2W6I G;  4MTG A;  3W7U A;  3ML0 A;  1M90 W;  3LDD A;  3SPI A;  1WPX A;  5H6R A;  1GM8 A;  1NR7 A;  3CCS V;  2LP7 A;  3WG7 C;  4G28 B;  3LSQ A;  3SYA A;  1GM9 A;  2UXN A;  3VBB A;  1QBZ A;  2M7W A;  3W7S A;  1VQO V;  1F4M A;  3SJQ C;  4X89 A;  3JCZ A;  2HFE C;  1COW G;  1K4C C;  3K06 A;  2Q68 A;  3LUT B;  2WSS G;  2XAS A;  2B1I A;  2DQ3 A;  2XOK G;  3SPC A;  1Q7Y W;  1NH2 B;  1ZWI C;  3K0G A;  4PA4 A;  4WFF A;  3GB7 C;  3B8N A;  1OCR C;  1EFR G;  2X6B A;  4MVM A;  1K3E A;  2JK5 C;  1W2B U;  1G8M A;  3ZRX A;  1FXH A;  4DO2 A;  5LHG A;  1JPX A;  1MAB G;  1THZ A;  3AG1 C;  5EBL C;  1MOF A;  4PDM A;  2B5U A;  1DF5 A;  3ZRW A;  1YJ9 V;  3P30 A;  2OTL V;  4HAM A;  2QM8 A;  3RW0 A;  3MD0 A;  1EZJ A;  1JJ2 U;  3ASN B;  4R50 A;  5DM6 V;  4GX5 A;  2Y69 C;  4MVU A;  4U7O A;  4UVB A;  4GX0 A;  4XDK A;  2BOB C;  3CP1 A;  4LP8 A;  3X2Q C;  1FS0 G;  2HVJ C;  2Q6A A;  1UJW B;  1AI5 A;  4EKW A;  3EHB B;  4WFA V;  2R9I A;  3MHS C;  5B1A C;  3G4S V;  4Q20 A;  1YJW V;  3ZRV A;  4UV9 A;  1M56 C;  2DYS B;  3W7T A;  4WFG A;  2D3O W;  3STZ C;  1K33 A;  2F43 G;  1PNK A;  1FXV A;  3A0R A;  5E1A C;  3OMA B;  1R3J C;  1V54 C;  2NLJ C;  2ITC C;  1FXK B;  3OFN G;  3TCU A;  3CCR V;  4RUF A;  3LDC A;  3CCL V;  2XAG A;  2A79 B;  2WLL B;  1G4Y B;  3ABL C;  2P90 A;  3LDE A;  5B1B C;  1E1R G;  3RVY A;  1VQ5 V;  3QO5 A;  1N8R W;  3D36 A;  4JTC B;  5IYD O;  1S72 V;  4JAS A;  1KC8 W;  1KEC A;  4E2L A;  4JYC A;  4PDV A;  5LGT A;  5LGN A;  1P7B A;  3ZMU A;  1M57 C;  4JAU A;  5EBW C;  4MW3 A;  4OXS A;  5LHH A;  3EFF K;  1RM1 C;  4MTF A;  1S76 D;  2WLI A;  4ZBM A;  1KP3 A;  3IC7 A;  2Q67 A;  2JIZ G;  3NXS A;  4PEL A;  1ENV A;  5HFM A;  3CCU V;  2KB1 A;  2EIK C;  1ARO P;  1K9M W;  1S5H C;  1BMF G;  3I55 V;  5BZB A;  1F51 A;  3JD2 A;  1K73 W;  2YEV B;  1MG1 A;  4N23 A;  5IY5 B;  4F4L A;  3AG2 C;  5EBM C;  2DYR B;  1AI4 A;  4FK5 C;  5KUK A;  3JD0 A;  4XDJ A;  4RQF A;  1Q81 W;  1CPY A;  2BOC C;  5EC1 C;  2ZD9 A;  4QNH B;  3FB6 C;  3WFV A;  2EIN B;  2EZO A;  2PI5 A;  5L3D A;  5B3S C;  2XND G;  5IDJ A;  2P67 A;  1JCH A;  2ZXW C;  5C93 A;  4QJF B;  1K5Q A;  1R6N A;  3ABM B;  4MVQ A;  3ETG A;  3ABT A;  2QTO A;  3CC4 V;  3ZMV A;  1OCZ B;  1W0J G;  2IH1 C;  2P6J A;  3PJS K;  4FJC C;  5GW7 A;  1KQS U;  3OR7 C;  4WFE A;  2HVK C;  2DWE C;  1I5X A;  1L1F A;  1GK9 A;  1QR9 A;  1GM7 A;  1OCC B;  4LC1 A;  5B1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...