3FB8C

Kcsa potassium channel in the open-conductive state with 20 a opening at t112 in the presence of rb+ ion
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
WRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
publication title KcsA Potassium channel in the open-conductive state with 20 A opening at T112 in the presence of Rb+ ion
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 26
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3fb8C00
5CBFA 4MTGA 4X88A 5B3SC 3SPHA 4P30A 3X2QC 4P2ZA 5IY5C 3RVZA 2AHZA 4MW3A 3SJQC 2IH1C 3E83A 2X6BA 2ZD9A 3PJSK 4MVOA 4WFFA 3K06A 2OCCC 1K4DC 3T4DA 4R7CA 4MVMA 2WLJA 4QNHB 3LDCA 3ABMC 4DXWA 4R50A 4MVZA 2BOCC 4JTAB 2EIMC 5EBMC 1KKDA 3JYCA 4MVUA 3OUFA 3IGAC 2WLHA 4J9YB 5EK0A 2HVKC 3EFFK 4XDKA 3SPGA 4F4LA 3AG4C 1ZWIC 3OR6C 3UKMA 2DWEC 2WLIB 1OCOC 4MVRA 1OCRC 1ORQC 2ATKC 2YEVA 4WFHA 5EBLC 1QLEC 3BEHA 2WLNA 3E8FA 3TCUA 2QTOA 4PA4A 4GX5A 4PDRA 2K1EA 2R9RB 5CBGA 4MTOA 5BZBA 3SPCA 2A79B 3FB7C 2X6CA 2Q68A 2ZXWC 3OGCC 4KFMA 3FB6C 3LDDA 4HZ3A 3SPIA 3SPJA 3K03A 1P7BA 3AG3C 4GX1A 1R3LC 4LP8A 1J95A 1M56C 4PA9A 5EBWC 5J9PC 5B1BC 3E8BA 3FB8C 3RBZA 2H8PC 3FB5C 3K08A 1V54C 4PDVA 5B1AC 2Q6AA 3RVYA 5EC1C 4TWKA 1R3IC 4MS2A 4X8AA 3AG2C 5E1AC 3HPLC 3AG1C 1XL6A 3ZJZA 3T2MA 3F7VC 3RW0A 2QKSA 4H33A 4R8CA 4XDJA 3SYQA 2ITDC 3ABKC 3K0GA 4MTFA 2WLIA 3E89A 4MW8A 4EKWA 2NLJC 2WLLB 3SYCA 4GX2A 3LNMB 1R3KC 4G28B 4RAIA 3GB7C 3ASNC 4QE7A 4GX0A 4HYOA 3WG7C 2Q69A 4I9WA 3ASOC 2ITCC 4G27B 4WFEA 3LDEA 3IFXA 4H37A 4RO2A 2X6AA 3LUTB 4P9PA 3STLC 2BOBC 3SYPA 2HVJC 3E8HA 4CBCA 3OR7C 4JTCB 4X89A 3VOUA 3T1CA 3ABLC 4ZBMA 5EC2C 1S5HC 2HJFC 4PDLA 2IH3C 4MVSA 4MSWC 3STZC 1BL8A 3K04A 2Q67A 4LBEC 3UM7A 2EIJC 5CBHA 2Y69C 3R65A 3K0DA 4LCUC 1V55C 4MVQA 4R6ZA 3T4ZA 3OUSA 4JTDB 4PDMA 2EILC 1JVMA 2DWDC 2WLLA 1XL4A 2EIKC 1LNQA 3TETA 2KB1A 4RUFA 4J9ZB 2AHYA 2DYRC 4BW5A 2P7TC 3SYAA 1G4YB 5KUKA 3KG2A 4UUJC 3SYOA 2WLMA 1OCCC 2EINC 2W0FC 1M57C 4XDLA 3E86A 3F5WC 3ZRSA 1K4CC 4P9OA 4WFGA 1R3JC 1OCZC 4PA6A 4PA7A 3F7YC 4PA3A 2HG5C 4OXSA 4RUEA 3E8GA 2A9HA 2DYSC 5KUMA 2WLKA 2JK5C 2A0LA 2HFEC 4QE9A
chains in the Genus database with same CATH superfamily
1PNLA 5B3SC 1NT2B 1S76D 2KKWA 2Y0IA 5J2TA 2DOSA 1K34A 1NTZH 4MVZA 4CZZA 2VQFO 3IGAC 4DV6B 2M6YA 3UKMA 1WNSA 3CJHB 1CEZA 2ATKC 2QKCA 1PM9A 2M7WA 2YEVA 3A0HZ 3A0BZ 2G38A 3FAVA 3OMIB 2Q0AA 2YIBD 2EIMB 5KAIZ 4DYLA 1L0NH 5EIBD 4Z1VA 5LXTB 3ZRWB 1H8EG 3FB8C 3I56V 4H0LB 4DR6O 4FLZA 1GM8A 1MOFA 2ZNIA 4X20A 1ZTEA 4X64B 3E89A 1BHAA 1NS1A 1XILA 1FXKA 4A5UB 3L9DA 4G27B 2UU9O 3OMNB 3QO8A 5KX5B 2ZE5A 4WF9V 1KP2A 4H37A 2BOBC 3SJBC 1N36O 3N2KB 4X1KB 2IM9A 3CRMA 2YIDA 3WB0A 3K0DA 4R6ZA 4LC1A 4JTDB 1YIJV 3D36A 1GKFA 2QE7G 1PKXA 1Z2GA 5LMNB 4EB6A 4YJ3A 5CA3A 5LP6A 4U3FH 3ABLB 2QWPB 5J2TB 1KMIZ 2ZDIC 1BE3H 2HJDA 3QF7A 4KHPB 1Q82W 1TGOA 2LP7A 3X2QB 4UB6Z 3MD0A 2YEVB 1QNMA 4E2LA 3L72H 2VS0A 3FAVB 1WP8A 3H1KH 3SPHA 5H2FZ 3X2QC 1SA0A 1H2GA 3FX7A 4NXMO 2PYLA 1GMGA 3HKDA 4QNHB 4DXWA 4R50A 4YXWG 2CGNA 1N33O 3JATA 4KXRA 2ZXWB 2AXTZ 5B1NA 1PPJH 4X20B 4EFBA 1TA8A 4FLWA 1I94B 4CH3A 4JI7O 3EVKA 5LBQA 2A79B 5BMVA 3FB7C 2ZXWC 3FB6C 3W7UA 1N34O 2YXHA 3IJ4A 4NTYA 3CCEV 3ZHTA 5JJNB 5J9PC 4JASA 1FXKC 4DR2B 1DF5A 1Q6UA 1SESA 4DK0A 1AILA 1TUEB 2PGGA 3O65A 4K8XA 2ZCEA 4JYAO 4LF8B 4EB6B 4YJ3B 3UT5A 5LP6B 5JWPA 3BA8A 4QE7A 2Y4TA 2Q69A 2C2AA 3T1HO 2ZIMA 4PHZA 3D36C 1H2KA 5LP6C 3MDSA 3JD4A 1ROPA 3SJAC 1DLBA 2OT5A 2XNDG 2Y69C 3R65A 5ITZA 1SA0B 1LUVA 1M57B 3W7XA 2IU3A 3BHPA 4H13B 3TETA 4QPKA 3HKDB 1M4UA 3JATB 4LFAO 1QCEA 3B40A 1M57C 4P9OA 3APQA 3PN1A 3F7YC 4BIUA 3ABUA 1RM1B 1S77D 4DUZB 5BMVB 5CBFA 1AI4A 2X6BA 2UXDO 4IIJA 1OCOB 1FXVA 4D7TA 1NJIW 1NVPD 1SRYA 1SZTA 4WCEV 3ZBHA 4F4LA 2L35A 1AJNA 1OCOC 5KMGA 4DR7O 1OJHA 1WJZA 3E8FA 3K5MA 3ZCCA 1ZX3A 1F7YA 3UT5B 1I5XA 4LFBO 3AG7A 3AG4B 4PJ0Z 1P7BA 2OCHA 3P3PA 4DR1B 1IVSA 3SGIA 1IBMB 5EBWC 4YHHB 1PNKA 3FB5C 2UUAB 3HPLC 4X1YA 3WG7B 4D6TH 5ITZB 2LW1A 1FPOA 1XNRB 5A2QN 3IC9A 2OYQA 2JS3A 5BY1A 4JI1B 3GB7C 2N74A 1XMQO 3WG7C 3O9OA 1EN6A 4I9WA 3ICXA 5CA1A 1X59A 5CA0A 3ZMSA 4B7EA 4LFCO 3CP1A 2F95B 2EILB 5IWAO 1NZ6A 1S5HC 1XNQB 2UXNA 2OTLV 3KZIZ 4BWAA 4DV4O 1ZSPA 4JI0O 3ASOB 5IYBO 3T4ZA 5JVDA 1VP7A 5LMUB 1GN3A 1DK1A 3C3SA 1OCCB 3DGEA 1BZKA 4DR5B 2EILC 5EZYA 1JVMA 3JALA 4IIJB 3FYIB 4ABMA 4OGQB 1VQMV 3VQVA 1MA1A 4G2KA 3G6BA 2MK3A 1OCCC 2UXCB 3CD6V 2ZIOA 1K4CC 5KMGB 3T1YB 2WLKA 4JI8B 2DQ3A 4P2ZA 4TV8A 5JQGA 1O9GA 1W59A 3ZS8C 3E83A 5LYJA 2ODMA 1SQBH 4QIWF 4ZOLA 4JI3O 4KUMA 2FL4A 4I7ZB 1BMFG 4X1YB 4WBNA 3OR6C 3RYFA 2E3CA 1KECA 2ZE7A 4W4KA 1M56B 4X1IB 3TK1A 4Q20A 2A3QA 4FIPC 2YUAA 5LHGA 4QPJA 4BAYA 3W7TA 1F4NA 1AJQA 1FS0G 5CMUA 5CA1B 1M56C 3RBZA 4J42A 4NXNB 1NTMH 1WP7A 3MHSC 2OIGA 1YXBA 3OTOO 2QKAA 2AZ0A 3DSQA 2ETNA 5JVDB 2F4VO 2ZNJA 2JDIG 1VARA 5DEDA 2AZ2A 5D5PA 5EZYB 3JALB 4G28B 1NTKH 4FZ1A 1N4CA 4LF9O 3UCSC 4PV1B 1MABG 1YF2A 4TQDA 1F4MA 4DV7B 4YIPA 1U96A 1YCIA 2EJ7A 1ZAUA 1O9HA 4UCOA 3CCMV 4LBEC 4LH7A 2MW2B 4TV8B 5JQGB 1GAXA 2VQEB 4DV5O 5LYJB 2Z5UA 3ETDA 2ILMA 4Z1MG 4J9ZB 4JF3A 2DMXA 1K5QA 2CAZC 4KL1A 3ZRVA 4ZOLB 4WFAV 1YHQV 1ZUQA 4WBNB 5IYCO 3CRQA 4XDLA 3RYFB 1N32O 1WPBA 1NR7A 2DN9A 4O2BA 5LOVA 2UXXA 4OXSA 3E8GA 4HAMA 4TT3G 1H2SB 2BTQB 2X0LA 5JCOA 5JJEB 2HFEC 4HBNA 3KKYA 4UV9A 1W0JG 4P30A 3J81N 5B66Z 2ZD9A 3PJSK 3JARA 2ZT9B 3K06A 1K4DC 5D5QA 1OCRB 2HHHB 1SQXH 4I9QA 1K3EA 1KKDA 5EK0A 1HNWO 2HVKC 4ICGA 1ZWIC 2CH7A 2Q0OC 3SJCC 1OCRC 3OMAB 3BEHA 2YS8A 3RYIA 3U0ZA 2R9RB 2LQTA 5L3BA 1IZ3A 4YY3O 3AG2B 4LF7O 1Y66A 1EFRG 5KLVH 1XMOB 3QO7A 3VQYA 2RN9A 5EC1C 3AG2C 2IJJA 4K0KB 3RW0A 4J7ZA 3J80N 4MW8A 1S0VA 5FPRA 4AQYO 4JYYA 3OEEG 1MSDA 3ZEDA 3IFXA 3L75H 2Q73A 3K3WA 3CYOA 2PF4E 2QM7A 2O57A 3OR7C 3B8NA 4ZBMA 4O2BB 4E4EA 5LOVB 4J80A 2JGDA 5IJ9A 4JZGA 3UM7A 2PI4A 1AI5A 1FJGO 3OUSA 3CRCA 4JV5B 1FFXA 2DWDC 3JARB 2XASA 3JAMN 3QVNA 2YI8A 1H2LA 1G6UA 5JCOC 5L3CA 1N0NA 1BQ0A 1M1KW 3GWOA 3ETQA 1SQGA 3CWBH 2CH7B 3ZRSA 5H6RA 4PA6A 4RUEA 3RYIB 2QM4A 2LFSA 2A0LA 3L70H 1GH6A 4U3JB 4GT1A 1EN4A 2VWKA 4R7CA 1MNGA 2WA3A 1BHBA 2W6JG 2NNUA 3RGBA 3LDCA 5IYZB 4JI4B 3H1IH 2R9IA 2Q7HA 2XUMA 1TAEA 3L73H 4LF4B 3ZHRA 1GN6A 4DR6B 2V1DA 4ASUG 3TCUA 2PUSA 3BRCA 3TGUH 3ZX6A 2B1GA 2QWQB 3CS5A 4I5SA 4PI2A 1PL4A 4GCZA 3AEIA 1NH2D 4PDVA 3ZMUA 3RVYA 5C8YA 2JGDB 5IJ9B 3CC2V 3JASA 3VQWA 1N36B 4JI2O 2CTWA 4LWSA 4MTFA 1H8HG 1WB8A 5GONA 2NLJC 1FFXB 5E79Z 2QJ1A 4RAIA 1VIBA 3E35A 3ASNC 4DUYO 4JI6B 3G4SV 4U7NA 5KA5A 3LDEA 1L1FA 4RO2A 3LUTB 1V55B 4X65B 4RQFA 3K04A 1SF9A 2JIZG 3LSSA 4DV3B 1V55C 2LO1A 2YICA 3K5LA 4PDMA 3I5DA 1R6TA 1IXBA 2Q5ZA 4B3MO 2E5LO 4LF6O 1YEWA 1B04A 3IAYA 1JOYA 4FVMA 2Y4UA 1IBKO 5KUKA 2WLMA 4B3SB 3F5WC 4O4LA 4CS3A 1OZ0A 1R1BA 3G80A 2HR3A 1K7DA 1Z5VA 4DO2A 4UCTA 5B1OA 1YJNV 1VQKV 2DJVA 4JI7B 3ETGA 3JSLA 2XAFA 1Q3EA 4PD4F 4BR6A 3CPWU 3TXSA 2CE4A 1OHHG 5C8YB 1BGYH 2EZOA 3OUFA 2R9AA 4XDKA 2XAHA 3JASB 5BR8B 4LWSB 5LL6Y 2WLNA 4PA4A 1GK9A 3ZHUA 3C3TA 1SERA 3CB2A 2NN4A 4JYAB 3TXQA 1XBLA 4PA9A 4NR1A 1A32A 2HP8A 4J7JA 4ZKIA 1KBHA 5EYPA 5LGTA 4B3TB 4AI8A 4X64O 4FLYA 2B1IA 3T1HB 4X66O 2CK3G 1S72V 4H33A 2Q9LA 4J10A 1XEQA 5HFLA 4EKWA 1FXKB 2YIBA 2CTQA 4DR3O 3CRRA 1S3JA 4O4LB 3E8HA 2A7WA 4OX9B 1L0LH 2CDYA 3A8TA 1IBLB 4D7SA 1K9MW 1BL8A 1NR1A 4J41A 4NTWA 5LMNO 3CMEV 1Y74A 1NBMG 2ZR2A 4KHPO 1VQ8V 3AK1A 4FMTA 1SKVA 1LNQA 1M9NA 3THOA 1FKAO 4DV1B 5BXZA 3CCQV 2Y69B 4UUJC 5IDJA 3NXSA 1B6QA 2JJ2G 3C90A 4NTXA 2HG5C 1IDSA 1YTFB 4FLVA 2A9HA 1CXZB 1FFTB 1N0JA 4Q6GA 3WB2A 3ABMB 2H94A 4JI5B 3AK2A 3JCUZ 3SJQC 2IH1C 3OAAG 4JAVA 2DQ0A 1Y4MA 3BY6A 4GKJB 2ZQMA 2JRIA 3N27A 4DK1A 3QNEA 1CPYA 3ABMC 4UB8Z 5EYPB 3HB3B 2N05A 5EBMC 1I94O 1AB3A 1ZL8A 3HKEA 2DE0X 3ZIAG 3JCZA 2UXBB 4FFKA 1SQVH 2KQXA 3JAKA 1BCCH 3UQ8A 1KQSU 5BZBA 1KD1W 3SPIA 3SPJA 4DR2O 3FFQA 1XI1A 1QLNA 1OV9A 1GN4A 1R3IC 2KG7A 2IJHA 5GW7A 1XL6A 2D2CB 3ZRXA 1LUWA 5EIBC 3RWRD 4R8CA 1D5AA 2RCVA 3E22A 1S5JA 1Y74B 1M93A 3ZN0A 2R72A 1QR9A 3SYCA 3U11A 3KCXA 2F1MA 2LFRA 1J5EB 4JYCA 2IU0A 3P30A 3ZMVA 3LSQA 3JAWA 2IH3C 5CB4A 5J2UA 4MVQA 5LA6A 5C93A 4ZHQA 2OTJV 4MTXA 1OCZB 4LF5O 4W4LA 3ML0A 1U97A 3HKCA 3HKEB 3APOA 4B7KA 2QWOB 3RN4A 2ZM6O 4JI3B 1OCZC 2JVDA 3JAKB 4DR4B 4QE9A 1KYOF 2RDCA 1AR5A 1SQFA 4GLXA 3H1HH 3OD4A 2UUCB 1H2MA 3A2FA 3G6EV 2KG7B 2WLHA 2PTMA 1RPRA 2IBZH 4MVRA 3E22B 5H5NA 5EBLC 1TUBA 2QTOA 3H9VA 2RMKB 1QHTA 4FM0A 5B1AB 1JPXA 2F4VB 1Y6XA 4YHHO 3BABA 4HZ3A 4JPRA 3K57A 3BFRA 4GX1A 3NR7A 5B1AC 4X8AA 4O4HA 1AJPA 3JAWB 3B09A 2Q4PA 2GTSA 2B9ZA 3T2MA 1THZA 5CB4B 5J2UB 3K0GA 2IJIA 4JI1O 5LA6B 1VQLV 1NQTA 1V9PA 4ZHQB 1GO3F 1SETA 3LNMB 2RJZA 4QJFB 2OWOA 3FKSG 3HKCB 1PD3A 3STLC 1XNQO 4X9QA 5CA0B 3T1CA 2FYUH 4B3RB 4C7UA 4DR5O 2DYRB 4UFZA 3U10A 4K8ZA 1UPGA 1YVWA 3L74H 2EINB 2GV9A 3DTUB 3H1JH 3KCYA 5IYDO 2DYRC 1Q86W 1E79G 2EINC 3T1YO 4JI8O 1FXHA 3M7MX 1R3JC 1Q90D 3CC4V 4PA3A 4DRXA 1TUBB 1HNWB 4L8JA 3B4SA 4GX5A 1S5LZ 1K33A 5L3DA 4DV2B 1YITV 3CCJV 3Q4HA 4YY3B 4MVMA 2Q7EA 2FMLA 2WLJA 1WB7A 1GRJA 3RYHA 1KU9A 1NVPB 4JTAB 1XOUA 4O4HB 1G8MA 4J9YB 5F2VO 1AP5A 1NKDA 3ABTA 2P90A 1PV0A 2QSAA 4X62B 3CC7V 2P5OA 3AK3A 4JAAA 5CBGA 1M5IA 1AVMA 3M8AA 5LHIA 4NXNO 3K03A 3OGIB 1W2BU 3ABKB 2Q8VA 1QVFU 1I08A 2H8PC 1Q81W 3K08A 1HNZO 4GKKB 2Q6AA 2HKOA 3K5NA 3F7VC 2ITDC 3ABKC 3QTCA 2BTOA 4LR3A 2XHBA 1KKCA 4IHJA 2LGQA 5CN0A 1FJGB 1YJWV 4DV7O 3K9AA 1K97A 1IXMA 3SDLA 5EC2C 4DRXB 3D3QA 4YIOA 1B06A 2EIKB 1JQ0A 4MVSA 1K73W 4NYKA 2VQEO 3D8CA 4UV8A 2UUBO 4O4IA 5IE9A 1YI2V 1TVKA 3Q4HB 4TUYA 4NB5A 2EIKC 5GTIZ 1JJ2U 3RYHB 5AG2A 4JGSA 3OFNG 1DTOA 1JCHA 2RNBA 3E2EA 3E86A 2QWRB 5DECA 2WAMA 2OCCB 1WN7A 5KUMA 4I55A 4IYHA 4HNAA 4O4JA 3G71V 1Q43A 1RPOA 3R66A 4CS4A 5KAFZ 2EBOA 1SQPH 4I0XA 2OCCC 2FTKA 1IX9A 3P3NA 1AR1B 2P6JA 1Y76A 4MVUA 2JEUA 1JJOA 3K59A 2VQFB 1MSWD 4PDRA 4IHJB 1VQPV 1V54B 3CE2A 3AG1B 1M90W 1ZLZA 3ZN1A 4L87A 1J95A 2AGAA 5B1BC 4LH6A 4K0KO 4FJCC 3VBBA 1V54C 3LNNA 5A9GA 1ENVA 1F51A 5LGUA 3AG1C 4J7KA 5KHGA 4IYIA 2AW9A 4GYCB 4O4IB 2EULA 2QR4A 1TVKB 2GUZA 4GX2A 5JJJB 5H6QA 4K35A 4UVCA 1H2NA 4B3MB 2E5LB 4LF6B 2A06H 1LR1A 1FAFA 2UU9B 1N8RW 2CUGA 1BSMA 4CS2A 1R73A 3ASNB 4TV9A 2EIJC 3CX5F 4I55B 4JV5O 4HNAB 5FPOA 4O4JB 1HR0O 3ETEA 2WLLA 4I0XB 3TJTA 4RUFA 2VWJA 1SZXA 2AHYA 1AP6A 5KHKA 2L6LA 1Y76B 2LJ2A 2Z0AA 3BVOA 5IY5B 4ZI7A 4DV0O 3K58A 2ADQB 4GZRB 2JK5C 3ZHVA 3B77A 3A0RA 1JA8A 3DC5A 5IY5C 1UFIA 4MW3A 1GN2A 4ZIBA 1PL0A 1FYJA 4JI4O 5KHIA 3DXRA 3T4DA 4LF4O 1VQ6V 4PELA 1RP3B 1VF6C 4NXMB 2EIMC 5IT9N 1HNXO 2OIEA 3QO5A 3H01A 1N33B 4CC5A 4RQEA 2GBOA 4X66B 2K1EA 2KSDA 2GUZB 1US6A 3G67A 5FNVA 2X6CA 2Q68A 4OPHA 4AHCA 3LDDA 2ZKOA 2YXLA 1GM9A 1R3LC 4DV6O 3OEHG 2P67A 4DR3B 2R70A 2ZE8A 1N34B 5LHHA 4TWKA 2GTAA 4F6RA 3RYCA 3EXAA 4TV9B 3CCRV 1E1RG 2WLIA 4JYBA 3DC6A 4JI6O 5GONB 2WLLB 1DF4A 4IGGA 1YJ9V 2PYJA 2YIAA 5KHHA 1MG1A 4X65O 4TSFG 4DW0A 2PY5A 4YJ2A 1NI8A 1XDCA 4ZI7B 1DGSA 3ABLC 4QGPA 5L3EA 3W7WA 4DV3O 4MSWC 1IURA 3CCUV 2YC0A 3IC7A 3OE7G 4LCUC 4LNUA 5H9CA 2ARHA 3GWKC 3DXRB 1XL4A 3VQXA 4B3SO 2DYSB 4BW5A 2P7TC 3RT3C 3P32A 3JD3A 4N23A 1I5YA 3BPZA 1B3QA 1EM1A 3WFVA 3CEIA 3M99B 4LFAB 2DYSC 3FD9A 4FM2A 5FNVB 4MTGA 4FLTA 3BA9A 2BSKA 4UVAA 1SQQH 4MVOA 3UO2A 5BR8O 2UXDB 3W7SA 1FD9A 2PZSA 1WLEA 4WFBV 4F6RB 3RYCB 2F23A 1I7FA 2WLIB 2K9PA 1ORQC 3F5TA 4MTOA 3SR2C 3SPCA 1Q6HA 4KFMA 2XT9A 4DR7B 5K1PA 1G1XB 2ZE6A 4B3TO 4LP8A 3HKBA 2P4VA 4YJ2B 3E8BA 4LFBB 1NH2B 2EX3A 3BCCH 4XDJA 1QU7A 3S3XA 3SYQA 5L3GA 2XAJA 4LNUB 1VMGA 3UO3A 5DM6V 4J11A 2NR5A 4WFEA 3H1LH 5FLXN 3LSUA 4OX9O 1IBLO 4LF5B 1K92A 1XMQB 4JTCB 1NU1H 1VQ9V 2Q7GA 4LFCB 5CBHA 4LF8O 2ZM6B 1VF7A 4BW9A 5IJ0A 2CTPA 5IWAB 1YZBA 2BSKB 4CH5A 4K3AA 4DV1O 4EEQA 4DV4B 4TQFA 4JI0B 1AR4A 2KB1A 1RM1C 2CGOA 4FFBA 1QR8A 2IJKA 3I55V 1HW7A 5B5EZ 3SYAA 3KG2A 1GM7A 2CTRA 1R6KA 2W0FC 4H44B 4UCVA 4JI5O 2HLDG 3WU2Z 1BQZA 4FLXA 4UCRA 2LGWA 1HWYA 1AI7A 1VEWA 4GKJO 1VF5B 3RVZA 2AHZA 4DW1A 1VQ7V 3JD2A 1Q7YW 3HKBB 2XOKG 1WPXA 4CH6A 4I4TA 2UXBO 1I0HA 1ZL8B 3JYCA 4F6EA 3J7AU 1VQ5V 3AG4C 4DUZO 4AILC 2WWWA 2IW5A 2W6IG 1BT8A 2XAQA 3AG3B 4X1IA 4IT5A 4O2AA 3OW2U 2F43G 2P4KA 1URFA 2F66C 3CXCU 4I50A 3AG3C 3CCVV 2WPDG 1P4RA 3FYEB 2Z3YA 4MS2A 3CMAV 1MZFA 2FKXA 1P84F 1YDXA 2JGUA 1D2DA 5IJ0B 4CC6A 5GTHZ 2EJRA 3OTOB 3L71H 1R6NA 4DR1O 1J5EO 1IBMO 1R3KC 1EZJA 1Q5OA 4FFBB 2GDSA 4GX0A 3ASOC 2B5UA 2UUAO 1JX9A 1X4TA 3SYPA 2HVJC 5JH7A 4LF9B 4GUNA 4CBCA 1XQ8A 4X89A 2QWNB 2HJFC 2ZINA 1XNRO 2P06A 2ZR3A 1AROP 4UCUA 4JAUA 4PI0A 1MMMA 5FL7G 1AI6A 2EZPA 1D5NA 1VQ4V 1XUQA 4FPPA 3JSNA 4I4TB 4DV5B 2DW4A 5KA6A 5TISZ 4OPAA 3SYOA 4JZ2A 3EHBB 2QA4V 4BIOA 4WFGA 4DR4O 2QDOA 3ZMZA 5LMUO 3WB1A 3ZHSA 5LGNA 2BTQA 1N32B 4O2AB 3CRAA 1KC8W 5HFMA 1RFYA 2UUCO 4X88A 4UVBA 2QGNA 4I50B 5KHJA 1T5EA 3MHHC 2UXCO 1QLEB 1QBZA 3ZHQA 4Z2WA 3K9SA 3SPGA 1HNZB 2JS5A 3CSXA 3K79A 1CP9A 1EN5A 1QLEC 1K5SA 1JFFA 2HEPA 4LF7B 5JH7B 1GTOA 3ZMTA 2D3OW 2YDEA 1P7GA 2QKSA 1H38A 3CCSV 2UUBB 1PNMA 1WA8A 4HYOA 2E74B 4FM1A 1L8DA 2X6AA 4AQYB 4B3RO 1KB9F 2ADPA 1JR9A 1QVGU 4KP4A 4PDLA 3STZC 4BIZA 5K1XA 1SS3A 4FK5C 2QEXV 2V7QG 1E1QG 4RWUA 2GHYA 2P22C 3N2GA 3JD1A 4UCSA 1P49A 1G4YB 2JEXA 1JMKC 5L3FA 3BAAA 2PI5A 1BS3A 3GVMA 1EBOA 3OTFA 4DV2O 4U3JA 1JFFB 3K5OA 4FLUA 1Y67A 3QG5A 1F23A 4TOIA 3OM3B 4XBFA 2H3OA 2LW7A 2F93B 1Z5WA 4WFFA 3B2EE 1SC5B 3CCLV 5IYZA 2BOCC 4EFEA 1EZVH 4X62O 3EFFK 1UJWB 1K8AW 1RSOA 2Y0PA 2DWEC 4CH4A 2JJ1G 3HR0A 4WFHA 3CHXA 5DN6G 2XTAA 3OGCC 2HHHO 1WA8B 2FB5A 4UXNA 4GKKO 1HDJA 1KUQA 3CXHF 1Q6IA 2N04A 2V4DA 2QM8A 5E1AC 3ZJZA 4B08A 2Y48A 1MZEA 4IL6Z 3CJHA 2XAGA 2WSSG 4MT8A 5B1BB 1QQCA 3JD0A 2RQ6A 2VRZA 1VF6A 3N2GB 1XMOO 4JI2B 1HR0B 2YI9A 1Q8IA 2ITCC 5LXTA 1WAZA 3ZRWA 4P9PA 4DUYB 3B8MA 2YSUB 2BCCH 4NVPA 3VOUA 1XREA 1COWG 3D3IA 1KP3A 2BE3A 2Q67A 3S3WA 4U7OA 1PP9H 3RFRA 4DV0B 2YXYA 1VQOV 1YSCA 4TUYB 2E76B 1HP8A 2E75B 2EIJB 5KX5A 1W0KG 3MAQA 4NKGB 5B3SB 1XHZA 2QTSA 2GSMB 4N21A 1RSOB 3N2KA 4X1KA 4PA7A 1IBKB 1YTFD 2X7RB 1HNXB 2ZDIA 2W0XA 2WA4A 1XHXA 1VQNV 3OT7A 4FZ0A
chains in the Genus database with same CATH topology
4MTGA 4UV9A 1PNLA 5B3SC 1W0JG 4P30A 4UVAA 1S76D 2ZD9A 3PJSK 4MVOA 3K06A 1K4DC 1OCRB 1K34A 4MVZA 4CZZA 1K3EA 3G6EV 3W7SA 1KKDA 3IGAC 2WLHA 5EK0A 1WLEA 2HVKC 4WFBV 1ZWIC 3UKMA 1CEZA 1RPRA 2WLIB 4MVRA 2YEVA 1OCRC 1ORQC 2ATKC 2M7WA 3OMAB 5EBLC 3BEHA 2QTOA 2R9RB 3OMIB 4MTOA 3SPCA 5B1AB 5L3BA 2EIMB 1JPXA 4KFMA 3AG2B 4HZ3A 1Y66A 1EFRG 4JPRA 3QO7A 3ZRWB 1H8EG 4GX1A 4LP8A 3E8BA 3FB8C 3I56V 5B1AC 1NH2B 5EC1C 4X8AA 3AG2C 1AJPA 1GM8A 1MOFA 2IJJA 3T2MA 1THZA 3RW0A 4XDJA 3SYQA 3K0GA 5L3GA 2IJIA 2XAJA 3E89A 4MW8A 1S0VA 1BHAA 1VQLV 1NQTA 1GO3F 5DM6V 1SETA 1FXKA 3LNMB 3OEEG 4QJFB 4G27B 4WFEA 3OMNB 3QO8A 4WF9V 3IFXA 1KP2A 3FKSG 1PD3A 4H37A 3K3WA 3STLC 2BOBC 3CYOA 2QM7A 1K92A 3OR7C 4JTCB 3B8NA 3T1CA 4ZBMA 1VQ9V 3UM7A 5CBHA 2PI4A 2DYRB 1AI5A 3K0DA 4R6ZA 3OUSA 4LC1A 4JTDB 1YIJV 3D36A 1GKFA 2EINB 1PKXA 2QE7G 2DWDC 5CA3A 3ABLB 2XASA 2KB1A 3DTUB 1RM1C 5L3CA 1QR8A 2IJKA 2ZDIC 3I55V 5IYDO 2DYRC 1M1KW 3SYAA 3GWOA 1Q86W 3KG2A 1E79G 1GM7A 1Q82W 2EINC 1R6KA 2LP7A 2W0FC 3X2QB 3ZRSA 1FXHA 3MD0A 5H6RA 1R3JC 4PA6A 3CC4V 2YEVB 2HLDG 4PA3A 4RUEA 4E2LA 2LFSA 4GX5A 2A0LA 1HWYA 1AI7A 1K33A 5L3DA 3SPHA 3X2QC 3RVZA 1H2GA 2AHZA 4GT1A 1YITV 1VQ7V 3JD2A 3CCJV 1Q7YW 4R7CA 2XOKG 4MVMA 1WPXA 1GMGA 1BHBA 2WLJA 4QNHB 2W6JG 2NNUA 3LDCA 4DXWA 4R50A 4YXWG 1NVPB 4JTAB 2R9IA 3JYCA 1G8MA 4J9YB 1VQ5V 2ZXWB 1NKDA 5B1NA 3AG4C 3ABTA 2P90A 2WWWA 2IW5A 2W6IG 2V1DA 4ASUG 2XAQA 3AG3B 3CC7V 3TCUA 5LBQA 5CBGA 3OW2U 2A79B 3FB7C 2B1GA 2ZXWC 2F43G 5LHIA 3FB6C 3W7UA 3K03A 4I5SA 3CCEV 3CXCU 1W2BU 3ABKB 3AG3C 4GCZA 5J9PC 1QVFU 3AEIA 2H8PC 1NH2D 3K08A 3CCVV 2WPDG 4PDVA 3ZMUA 1P4RA 2Q6AA 3FYEB 2Z3YA 4JASA 3RVYA 1FXKC 2HKOA 4MS2A 3CC2V 3CMAV 1DF5A 3F7VC 1SESA 2ITDC 3ABKC 4MTFA 1TUEB 1H8HG 2EJRA 1R6NA 2NLJC 5CN0A 4RAIA 1R3KC 3E35A 1EZJA 3ASNC 4QE7A 4GX0A 1YJWV 3G4SV 2Q69A 4U7NA 5KA5A 3ASOC 2B5UA 3K9AA 2C2AA 3LDEA 1L1FA 1K97A 4RO2A 3LUTB 1JX9A 1IXMA 3SYPA 2HVJC 1V55B 4CBCA 4X89A 5EC2C 4RQFA 2HJFC 3JD4A 2EIKB 1JQ0A 1ROPA 4MVSA 1K73W 1DLBA 2OT5A 2JIZG 2XNDG 3K04A 2Y69C 2ZR3A 3LSSA 3R65A 4UV8A 1AROP 1V55C 4JAUA 5FL7G 4PDMA 1M57B 3W7XA 2IU3A 1YI2V 1JJ2U 2EIKC 3TETA 1AI6A 4QPKA 2EZPA 1VQ4V 4FPPA 1JOYA 4JGSA 3OFNG 2DW4A 1DTOA 5KA6A 5KUKA 3SYOA 2WLMA 1JCHA 3E2EA 1QCEA 1M57C 3EHBB 2QA4V 3E86A 3F5WC 4P9OA 1OZ0A 4WFGA 3F7YC 2HR3A 2WAMA 3ZMZA 4BIUA 2OCCB 3ABUA 1RM1B 5KUMA 1S77D 5LGNA 1K7DA 4DO2A 5CBFA 5B1OA 1KC8W 5HFMA 1YJNV 4X88A 4UVBA 1VQKV 1AI4A 3G71V 1RPOA 3ETGA 2X6BA 2EBOA 2XAFA 2OCCC 1OCOB 1FXVA 3MHHC 3CPWU 1QLEB 1QBZA 2FTKA 1AR1B 1SRYA 1NVPD 1SZTA 1NJIW 2P6JA 1OHHG 2EZOA 3OUFA 2JEUA 4MVUA 4WCEV 3SPGA 4XDKA 2XAHA 4F4LA 1Q81W 1AJNA 3K79A 1OCOC 1CP9A 1QLEC 1K5SA 2WLNA 3E8FA 4PA4A 3ZCCA 1GK9A 4PDRA 1MSWD 1VQPV 1SERA 1V54B 1I5XA 3AG1B 3AG4B 1M90W 1P7BA 3ZN1A 4L87A 1J95A 4PA9A 5EBWC 5B1BC 1GTOA 1PNKA 3FB5C 4FJCC 1V54C 3VBBA 3ZMTA 4ZKIA 5LGTA 1ENVA 2B1IA 1F51A 5LGUA 3HPLC 3AG1C 2CK3G 2D3OW 1S72V 2QKSA 4H33A 1H38A 3WG7B 3CCSV 5HFLA 4EKWA 1FXKB 4GX2A 1PNMA 3GB7C 5H6QA 4HYOA 3WG7C 4I9WA 4UVCA 2X6AA 1S3JA 3ZMSA 3E8HA 1QVGU 4KP4A 1N8RW 3CP1A 2EILB 1S5HC 4PDLA 2UXNA 3STZC 1K9MW 1R73A 1BL8A 1NR1A 3ASNB 4BIZA 2OTLV 2EIJC 4FK5C 2QEXV 3ASOB 5IYBO 2V7QG 1E1QG 3CMEV 3T4ZA 1NBMG 1OCCB 2GHYA 3DGEA 2ZR2A 2EILC 1VQ8V 1JVMA 4FMTA 3ETEA 2WLLA 3JD1A 3FYIB 1LNQA 1M9NA 4RUFA 1VQMV 2AHYA 3CCQV 1G4YB 2JEXA 2Y69B 4G2KA 4UUJC 2MK3A 1OCCC 5IDJA 3NXSA 3CD6V 5IY5B 1B6QA 5L3FA 1K4CC 2JJ2G 2PI5A 2HG5C 1YTFB 1EBOA 2A9HA 1FFTB 2WLKA 2DQ3A 2JK5C 3ABMB 3B77A 2H94A 3A0RA 4P2ZA 5IY5C 1F23A 4MW3A 3OM3B 1PL0A 2IH1C 3E83A 3OAAG 4JAVA 3SJQC 4XBFA 2DQ0A 1Y4MA 3BY6A 4WFFA 2ZQMA 3T4DA 1VQ6V 4QIWF 4PELA 3QNEA 1CPYA 3CCLV 3ABMC 2BOCC 3HB3B 2EIMC 4KUMA 5EBMC 3QO5A 1BMFG 3H01A 3EFFK 1UJWB 1K8AW 3ZIAG 3JCZA 3OR6C 2DWEC 2JJ1G 1KECA 4WFHA 4RQEA 1M56B 3TK1A 4Q20A 2K1EA 1KQSU 5DN6G 5BZBA 1KD1W 4FIPC 5LHGA 4QPJA 2X6CA 2Q68A 3OGCC 4BAYA 3W7TA 3LDDA 4UXNA 1GM9A 3SPJA 3SPIA 1F4NA 1AJQA 1FS0G 5CMUA 1R3LC 1M56C 3RBZA 3OEHG 2P67A 1QLNA 5LHHA 2QM8A 4TWKA 1R3IC 3MHSC 5E1AC 2IJHA 5GW7A 1XL6A 3ZJZA 3ZRXA 2Y48A 4R8CA 3CCRV 1E1RG 2WLIA 4JYBA 2XAGA 2WSSG 4MT8A 2JDIG 5B1BB 3JD0A 3ZN0A 2WLLB 1DF4A 1QR9A 3SYCA 4G28B 1YJ9V 1MG1A 2ITCC 1MABG 2LFRA 4TSFG 3ZRWA 4P9PA 4JYCA 2IU0A 1F4MA 3B8MA 3P30A 2YSUB 3ZMVA 3VOUA 3ABLC 5L3EA 1COWG 3LSQA 3W7WA 3D3IA 2IH3C 1KP3A 4MSWC 2Q67A 4LBEC 3CCMV 3CCUV 4U7OA 3IC7A 3OE7G 4LCUC 4MVQA 1VQOV 5C93A 1YSCA 2OTJV 5H9CA 4MTXA 1OCZB 1XL4A 2Z5UA 3ETDA 4Z1MG 4J9ZB 2DYSB 4JF3A 1K5QA 3ZRVA 3ML0A 4BW5A 2P7TC 2EIJB 3P32A 4WFAV 1YHQV 3JD3A 4N23A 1I5YA 1W0KG 5IYCO 5B3SB 4XDLA 2GSMB 4N21A 3WFVA 1NR7A 1OCZC 3M99B 4PA7A 1YTFD 2X7RB 2UXXA 4OXSA 3E8GA 2DYSC 4HAMA 4TT3G 2X0LA 1VQNV 2ZDIA 2HFEC 4QE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBF A;  4MTG A;  4X88 A;  5B3S C;  3SPH A;  4P30 A;  3X2Q C;  4P2Z A;  5IY5 C;  3RVZ A;  2AHZ A;  4MW3 A;  3SJQ C;  2IH1 C;  3E83 A;  2X6B A;  2ZD9 A;  3PJS K;  4MVO A;  4WFF A;  3K06 A;  2OCC C;  1K4D C;  3T4D A;  4R7C A;  4MVM A;  2WLJ A;  4QNH B;  3LDC A;  3ABM C;  4DXW A;  4R50 A;  4MVZ A;  2BOC C;  4JTA B;  2EIM C;  5EBM C;  1KKD A;  3JYC A;  4MVU A;  3OUF A;  3IGA C;  2WLH A;  4J9Y B;  5EK0 A;  2HVK C;  3EFF K;  4XDK A;  3SPG A;  4F4L A;  3AG4 C;  1ZWI C;  3OR6 C;  3UKM A;  2DWE C;  2WLI B;  1OCO C;  4MVR A;  1OCR C;  1ORQ C;  2ATK C;  2YEV A;  4WFH A;  5EBL C;  1QLE C;  3BEH A;  2WLN A;  3E8F A;  3TCU A;  2QTO A;  4PA4 A;  4GX5 A;  4PDR A;  2K1E A;  2R9R B;  5CBG A;  4MTO A;  5BZB A;  3SPC A;  2A79 B;  3FB7 C;  2X6C A;  2Q68 A;  2ZXW C;  3OGC C;  4KFM A;  3FB6 C;  3LDD A;  4HZ3 A;  3SPI A;  3SPJ A;  3K03 A;  1P7B A;  3AG3 C;  4GX1 A;  1R3L C;  4LP8 A;  1J95 A;  1M56 C;  4PA9 A;  5EBW C;  5J9P C;  5B1B C;  3E8B A;  3FB8 C;  3RBZ A;  2H8P C;  3FB5 C;  3K08 A;  1V54 C;  4PDV A;  5B1A C;  2Q6A A;  3RVY A;  5EC1 C;  4TWK A;  1R3I C;  4MS2 A;  4X8A A;  3AG2 C;  5E1A C;  3HPL C;  3AG1 C;  1XL6 A;  3ZJZ A;  3T2M A;  3F7V C;  3RW0 A;  2QKS A;  4H33 A;  4R8C A;  4XDJ A;  3SYQ A;  2ITD C;  3ABK C;  3K0G A;  4MTF A;  2WLI A;  3E89 A;  4MW8 A;  4EKW A;  2NLJ C;  2WLL B;  3SYC A;  4GX2 A;  3LNM B;  1R3K C;  4G28 B;  4RAI A;  3GB7 C;  3ASN C;  4QE7 A;  4GX0 A;  4HYO A;  3WG7 C;  2Q69 A;  4I9W A;  3ASO C;  2ITC C;  4G27 B;  4WFE A;  3LDE A;  3IFX A;  4H37 A;  4RO2 A;  2X6A A;  3LUT B;  4P9P A;  3STL C;  2BOB C;  3SYP A;  2HVJ C;  3E8H A;  4CBC A;  3OR7 C;  4JTC B;  4X89 A;  3VOU A;  3T1C A;  3ABL C;  4ZBM A;  5EC2 C;  1S5H C;  2HJF C;  4PDL A;  2IH3 C;  4MVS A;  4MSW C;  3STZ C;  1BL8 A;  3K04 A;  2Q67 A;  4LBE C;  3UM7 A;  2EIJ C;  5CBH A;  2Y69 C;  3R65 A;  3K0D A;  4LCU C;  1V55 C;  4MVQ A;  4R6Z A;  3T4Z A;  3OUS A;  4JTD B;  4PDM A;  2EIL C;  1JVM A;  2DWD C;  2WLL A;  1XL4 A;  2EIK C;  1LNQ A;  3TET A;  2KB1 A;  4RUF A;  4J9Z B;  2AHY A;  2DYR C;  4BW5 A;  2P7T C;  3SYA A;  1G4Y B;  5KUK A;  3KG2 A;  4UUJ C;  3SYO A;  2WLM A;  1OCC C;  2EIN C;  2W0F C;  1M57 C;  4XDL A;  3E86 A;  3F5W C;  3ZRS A;  1K4C C;  4P9O A;  4WFG A;  1R3J C;  1OCZ C;  4PA6 A;  4PA7 A;  3F7Y C;  4PA3 A;  2HG5 C;  4OXS A;  4RUE A;  3E8G A;  2A9H A;  2DYS C;  5KUM A;  2WLK A;  2JK5 C;  2A0L A;  2HFE C;  4QE9 A; 
#chains in the Genus database with same CATH topology
 1PNL A;  5B3S C;  1NT2 B;  1S76 D;  2KKW A;  2Y0I A;  5J2T A;  2DOS A;  1K34 A;  1NTZ H;  4MVZ A;  4CZZ A;  2VQF O;  3IGA C;  4DV6 B;  2M6Y A;  3UKM A;  1WNS A;  3CJH B;  1CEZ A;  2ATK C;  2QKC A;  1PM9 A;  2M7W A;  2YEV A;  3A0H Z;  3A0B Z;  2G38 A;  3FAV A;  3OMI B;  2Q0A A;  2YIB D;  2EIM B;  5KAI Z;  4DYL A;  1L0N H;  5EIB D;  4Z1V A;  5LXT B;  3ZRW B;  1H8E G;  3FB8 C;  3I56 V;  4H0L B;  4DR6 O;  4FLZ A;  1GM8 A;  1MOF A;  2ZNI A;  4X20 A;  1ZTE A;  4X64 B;  3E89 A;  1BHA A;  1NS1 A;  1XIL A;  1FXK A;  4A5U B;  3L9D A;  4G27 B;  2UU9 O;  3OMN B;  3QO8 A;  5KX5 B;  2ZE5 A;  4WF9 V;  1KP2 A;  4H37 A;  2BOB C;  3SJB C;  1N36 O;  3N2K B;  4X1K B;  2IM9 A;  3CRM A;  2YID A;  3WB0 A;  3K0D A;  4R6Z A;  4LC1 A;  4JTD B;  1YIJ V;  3D36 A;  1GKF A;  2QE7 G;  1PKX A;  1Z2G A;  5LMN B;  4EB6 A;  4YJ3 A;  5CA3 A;  5LP6 A;  4U3F H;  3ABL B;  2QWP B;  5J2T B;  1KMI Z;  2ZDI C;  1BE3 H;  2HJD A;  3QF7 A;  4KHP B;  1Q82 W;  1TGO A;  2LP7 A;  3X2Q B;  4UB6 Z;  3MD0 A;  2YEV B;  1QNM A;  4E2L A;  3L72 H;  2VS0 A;  3FAV B;  1WP8 A;  3H1K H;  3SPH A;  5H2F Z;  3X2Q C;  1SA0 A;  1H2G A;  3FX7 A;  4NXM O;  2PYL A;  1GMG A;  3HKD A;  4QNH B;  4DXW A;  4R50 A;  4YXW G;  2CGN A;  1N33 O;  3JAT A;  4KXR A;  2ZXW B;  2AXT Z;  5B1N A;  1PPJ H;  4X20 B;  4EFB A;  1TA8 A;  4FLW A;  1I94 B;  4CH3 A;  4JI7 O;  3EVK A;  5LBQ A;  2A79 B;  5BMV A;  3FB7 C;  2ZXW C;  3FB6 C;  3W7U A;  1N34 O;  2YXH A;  3IJ4 A;  4NTY A;  3CCE V;  3ZHT A;  5JJN B;  5J9P C;  4JAS A;  1FXK C;  4DR2 B;  1DF5 A;  1Q6U A;  1SES A;  4DK0 A;  1AIL A;  1TUE B;  2PGG A;  3O65 A;  4K8X A;  2ZCE A;  4JYA O;  4LF8 B;  4EB6 B;  4YJ3 B;  3UT5 A;  5LP6 B;  5JWP A;  3BA8 A;  4QE7 A;  2Y4T A;  2Q69 A;  2C2A A;  3T1H O;  2ZIM A;  4PHZ A;  3D36 C;  1H2K A;  5LP6 C;  3MDS A;  3JD4 A;  1ROP A;  3SJA C;  1DLB A;  2OT5 A;  2XND G;  2Y69 C;  3R65 A;  5ITZ A;  1SA0 B;  1LUV A;  1M57 B;  3W7X A;  2IU3 A;  3BHP A;  4H13 B;  3TET A;  4QPK A;  3HKD B;  1M4U A;  3JAT B;  4LFA O;  1QCE A;  3B40 A;  1M57 C;  4P9O A;  3APQ A;  3PN1 A;  3F7Y C;  4BIU A;  3ABU A;  1RM1 B;  1S77 D;  4DUZ B;  5BMV B;  5CBF A;  1AI4 A;  2X6B A;  2UXD O;  4IIJ A;  1OCO B;  1FXV A;  4D7T A;  1NJI W;  1NVP D;  1SRY A;  1SZT A;  4WCE V;  3ZBH A;  4F4L A;  2L35 A;  1AJN A;  1OCO C;  5KMG A;  4DR7 O;  1OJH A;  1WJZ A;  3E8F A;  3K5M A;  3ZCC A;  1ZX3 A;  1F7Y A;  3UT5 B;  1I5X A;  4LFB O;  3AG7 A;  3AG4 B;  4PJ0 Z;  1P7B A;  2OCH A;  3P3P A;  4DR1 B;  1IVS A;  3SGI A;  1IBM B;  5EBW C;  4YHH B;  1PNK A;  3FB5 C;  2UUA B;  3HPL C;  4X1Y A;  3WG7 B;  4D6T H;  5ITZ B;  2LW1 A;  1FPO A;  1XNR B;  5A2Q N;  3IC9 A;  2OYQ A;  2JS3 A;  5BY1 A;  4JI1 B;  3GB7 C;  2N74 A;  1XMQ O;  3WG7 C;  3O9O A;  1EN6 A;  4I9W A;  3ICX A;  5CA1 A;  1X59 A;  5CA0 A;  3ZMS A;  4B7E A;  4LFC O;  3CP1 A;  2F95 B;  2EIL B;  5IWA O;  1NZ6 A;  1S5H C;  1XNQ B;  2UXN A;  2OTL V;  3KZI Z;  4BWA A;  4DV4 O;  1ZSP A;  4JI0 O;  3ASO B;  5IYB O;  3T4Z A;  5JVD A;  1VP7 A;  5LMU B;  1GN3 A;  1DK1 A;  3C3S A;  1OCC B;  3DGE A;  1BZK A;  4DR5 B;  2EIL C;  5EZY A;  1JVM A;  3JAL A;  4IIJ B;  3FYI B;  4ABM A;  4OGQ B;  1VQM V;  3VQV A;  1MA1 A;  4G2K A;  3G6B A;  2MK3 A;  1OCC C;  2UXC B;  3CD6 V;  2ZIO A;  1K4C C;  5KMG B;  3T1Y B;  2WLK A;  4JI8 B;  2DQ3 A;  4P2Z A;  4TV8 A;  5JQG A;  1O9G A;  1W59 A;  3ZS8 C;  3E83 A;  5LYJ A;  2ODM A;  1SQB H;  4QIW F;  4ZOL A;  4JI3 O;  4KUM A;  2FL4 A;  4I7Z B;  1BMF G;  4X1Y B;  4WBN A;  3OR6 C;  3RYF A;  2E3C A;  1KEC A;  2ZE7 A;  4W4K A;  1M56 B;  4X1I B;  3TK1 A;  4Q20 A;  2A3Q A;  4FIP C;  2YUA A;  5LHG A;  4QPJ A;  4BAY A;  3W7T A;  1F4N A;  1AJQ A;  1FS0 G;  5CMU A;  5CA1 B;  1M56 C;  3RBZ A;  4J42 A;  4NXN B;  1NTM H;  1WP7 A;  3MHS C;  2OIG A;  1YXB A;  3OTO O;  2QKA A;  2AZ0 A;  3DSQ A;  2ETN A;  5JVD B;  2F4V O;  2ZNJ A;  2JDI G;  1VAR A;  5DED A;  2AZ2 A;  5D5P A;  5EZY B;  3JAL B;  4G28 B;  1NTK H;  4FZ1 A;  1N4C A;  4LF9 O;  3UCS C;  4PV1 B;  1MAB G;  1YF2 A;  4TQD A;  1F4M A;  4DV7 B;  4YIP A;  1U96 A;  1YCI A;  2EJ7 A;  1ZAU A;  1O9H A;  4UCO A;  3CCM V;  4LBE C;  4LH7 A;  2MW2 B;  4TV8 B;  5JQG B;  1GAX A;  2VQE B;  4DV5 O;  5LYJ B;  2Z5U A;  3ETD A;  2ILM A;  4Z1M G;  4J9Z B;  4JF3 A;  2DMX A;  1K5Q A;  2CAZ C;  4KL1 A;  3ZRV A;  4ZOL B;  4WFA V;  1YHQ V;  1ZUQ A;  4WBN B;  5IYC O;  3CRQ A;  4XDL A;  3RYF B;  1N32 O;  1WPB A;  1NR7 A;  2DN9 A;  4O2B A;  5LOV A;  2UXX A;  4OXS A;  3E8G A;  4HAM A;  4TT3 G;  1H2S B;  2BTQ B;  2X0L A;  5JCO A;  5JJE B;  2HFE C;  4HBN A;  3KKY A;  4UV9 A;  1W0J G;  4P30 A;  3J81 N;  5B66 Z;  2ZD9 A;  3PJS K;  3JAR A;  2ZT9 B;  3K06 A;  1K4D C;  5D5Q A;  1OCR B;  2HHH B;  1SQX H;  4I9Q A;  1K3E A;  1KKD A;  5EK0 A;  1HNW O;  2HVK C;  4ICG A;  1ZWI C;  2CH7 A;  2Q0O C;  3SJC C;  1OCR C;  3OMA B;  3BEH A;  2YS8 A;  3RYI A;  3U0Z A;  2R9R B;  2LQT A;  5L3B A;  1IZ3 A;  4YY3 O;  3AG2 B;  4LF7 O;  1Y66 A;  1EFR G;  5KLV H;  1XMO B;  3QO7 A;  3VQY A;  2RN9 A;  5EC1 C;  3AG2 C;  2IJJ A;  4K0K B;  3RW0 A;  4J7Z A;  3J80 N;  4MW8 A;  1S0V A;  5FPR A;  4AQY O;  4JYY A;  3OEE G;  1MSD A;  3ZED A;  3IFX A;  3L75 H;  2Q73 A;  3K3W A;  3CYO A;  2PF4 E;  2QM7 A;  2O57 A;  3OR7 C;  3B8N A;  4ZBM A;  4O2B B;  4E4E A;  5LOV B;  4J80 A;  2JGD A;  5IJ9 A;  4JZG A;  3UM7 A;  2PI4 A;  1AI5 A;  1FJG O;  3OUS A;  3CRC A;  4JV5 B;  1FFX A;  2DWD C;  3JAR B;  2XAS A;  3JAM N;  3QVN A;  2YI8 A;  1H2L A;  1G6U A;  5JCO C;  5L3C A;  1N0N A;  1BQ0 A;  1M1K W;  3GWO A;  3ETQ A;  1SQG A;  3CWB H;  2CH7 B;  3ZRS A;  5H6R A;  4PA6 A;  4RUE A;  3RYI B;  2QM4 A;  2LFS A;  2A0L A;  3L70 H;  1GH6 A;  4U3J B;  4GT1 A;  1EN4 A;  2VWK A;  4R7C A;  1MNG A;  2WA3 A;  1BHB A;  2W6J G;  2NNU A;  3RGB A;  3LDC A;  5IYZ B;  4JI4 B;  3H1I H;  2R9I A;  2Q7H A;  2XUM A;  1TAE A;  3L73 H;  4LF4 B;  3ZHR A;  1GN6 A;  4DR6 B;  2V1D A;  4ASU G;  3TCU A;  2PUS A;  3BRC A;  3TGU H;  3ZX6 A;  2B1G A;  2QWQ B;  3CS5 A;  4I5S A;  4PI2 A;  1PL4 A;  4GCZ A;  3AEI A;  1NH2 D;  4PDV A;  3ZMU A;  3RVY A;  5C8Y A;  2JGD B;  5IJ9 B;  3CC2 V;  3JAS A;  3VQW A;  1N36 B;  4JI2 O;  2CTW A;  4LWS A;  4MTF A;  1H8H G;  1WB8 A;  5GON A;  2NLJ C;  1FFX B;  5E79 Z;  2QJ1 A;  4RAI A;  1VIB A;  3E35 A;  3ASN C;  4DUY O;  4JI6 B;  3G4S V;  4U7N A;  5KA5 A;  3LDE A;  1L1F A;  4RO2 A;  3LUT B;  1V55 B;  4X65 B;  4RQF A;  3K04 A;  1SF9 A;  2JIZ G;  3LSS A;  4DV3 B;  1V55 C;  2LO1 A;  2YIC A;  3K5L A;  4PDM A;  3I5D A;  1R6T A;  1IXB A;  2Q5Z A;  4B3M O;  2E5L O;  4LF6 O;  1YEW A;  1B04 A;  3IAY A;  1JOY A;  4FVM A;  2Y4U A;  1IBK O;  5KUK A;  2WLM A;  4B3S B;  3F5W C;  4O4L A;  4CS3 A;  1OZ0 A;  1R1B A;  3G80 A;  2HR3 A;  1K7D A;  1Z5V A;  4DO2 A;  4UCT A;  5B1O A;  1YJN V;  1VQK V;  2DJV A;  4JI7 B;  3ETG A;  3JSL A;  2XAF A;  1Q3E A;  4PD4 F;  4BR6 A;  3CPW U;  3TXS A;  2CE4 A;  1OHH G;  5C8Y B;  1BGY H;  2EZO A;  3OUF A;  2R9A A;  4XDK A;  2XAH A;  3JAS B;  5BR8 B;  4LWS B;  5LL6 Y;  2WLN A;  4PA4 A;  1GK9 A;  3ZHU A;  3C3T A;  1SER A;  3CB2 A;  2NN4 A;  4JYA B;  3TXQ A;  1XBL A;  4PA9 A;  4NR1 A;  1A32 A;  2HP8 A;  4J7J A;  4ZKI A;  1KBH A;  5EYP A;  5LGT A;  4B3T B;  4AI8 A;  4X64 O;  4FLY A;  2B1I A;  3T1H B;  4X66 O;  2CK3 G;  1S72 V;  4H33 A;  2Q9L A;  4J10 A;  1XEQ A;  5HFL A;  4EKW A;  1FXK B;  2YIB A;  2CTQ A;  4DR3 O;  3CRR A;  1S3J A;  4O4L B;  3E8H A;  2A7W A;  4OX9 B;  1L0L H;  2CDY A;  3A8T A;  1IBL B;  4D7S A;  1K9M W;  1BL8 A;  1NR1 A;  4J41 A;  4NTW A;  5LMN O;  3CME V;  1Y74 A;  1NBM G;  2ZR2 A;  4KHP O;  1VQ8 V;  3AK1 A;  4FMT A;  1SKV A;  1LNQ A;  1M9N A;  3THO A;  1FKA O;  4DV1 B;  5BXZ A;  3CCQ V;  2Y69 B;  4UUJ C;  5IDJ A;  3NXS A;  1B6Q A;  2JJ2 G;  3C90 A;  4NTX A;  2HG5 C;  1IDS A;  1YTF B;  4FLV A;  2A9H A;  1CXZ B;  1FFT B;  1N0J A;  4Q6G A;  3WB2 A;  3ABM B;  2H94 A;  4JI5 B;  3AK2 A;  3JCU Z;  3SJQ C;  2IH1 C;  3OAA G;  4JAV A;  2DQ0 A;  1Y4M A;  3BY6 A;  4GKJ B;  2ZQM A;  2JRI A;  3N27 A;  4DK1 A;  3QNE A;  1CPY A;  3ABM C;  4UB8 Z;  5EYP B;  3HB3 B;  2N05 A;  5EBM C;  1I94 O;  1AB3 A;  1ZL8 A;  3HKE A;  2DE0 X;  3ZIA G;  3JCZ A;  2UXB B;  4FFK A;  1SQV H;  2KQX A;  3JAK A;  1BCC H;  3UQ8 A;  1KQS U;  5BZB A;  1KD1 W;  3SPI A;  3SPJ A;  4DR2 O;  3FFQ A;  1XI1 A;  1QLN A;  1OV9 A;  1GN4 A;  1R3I C;  2KG7 A;  2IJH A;  5GW7 A;  1XL6 A;  2D2C B;  3ZRX A;  1LUW A;  5EIB C;  3RWR D;  4R8C A;  1D5A A;  2RCV A;  3E22 A;  1S5J A;  1Y74 B;  1M93 A;  3ZN0 A;  2R72 A;  1QR9 A;  3SYC A;  3U11 A;  3KCX A;  2F1M A;  2LFR A;  1J5E B;  4JYC A;  2IU0 A;  3P30 A;  3ZMV A;  3LSQ A;  3JAW A;  2IH3 C;  5CB4 A;  5J2U A;  4MVQ A;  5LA6 A;  5C93 A;  4ZHQ A;  2OTJ V;  4MTX A;  1OCZ B;  4LF5 O;  4W4L A;  3ML0 A;  1U97 A;  3HKC A;  3HKE B;  3APO A;  4B7K A;  2QWO B;  3RN4 A;  2ZM6 O;  4JI3 B;  1OCZ C;  2JVD A;  3JAK B;  4DR4 B;  4QE9 A;  1KYO F;  2RDC A;  1AR5 A;  1SQF A;  4GLX A;  3H1H H;  3OD4 A;  2UUC B;  1H2M A;  3A2F A;  3G6E V;  2KG7 B;  2WLH A;  2PTM A;  1RPR A;  2IBZ H;  4MVR A;  3E22 B;  5H5N A;  5EBL C;  1TUB A;  2QTO A;  3H9V A;  2RMK B;  1QHT A;  4FM0 A;  5B1A B;  1JPX A;  2F4V B;  1Y6X A;  4YHH O;  3BAB A;  4HZ3 A;  4JPR A;  3K57 A;  3BFR A;  4GX1 A;  3NR7 A;  5B1A C;  4X8A A;  4O4H A;  1AJP A;  3JAW B;  3B09 A;  2Q4P A;  2GTS A;  2B9Z A;  3T2M A;  1THZ A;  5CB4 B;  5J2U B;  3K0G A;  2IJI A;  4JI1 O;  5LA6 B;  1VQL V;  1NQT A;  1V9P A;  4ZHQ B;  1GO3 F;  1SET A;  3LNM B;  2RJZ A;  4QJF B;  2OWO A;  3FKS G;  3HKC B;  1PD3 A;  3STL C;  1XNQ O;  4X9Q A;  5CA0 B;  3T1C A;  2FYU H;  4B3R B;  4C7U A;  4DR5 O;  2DYR B;  4UFZ A;  3U10 A;  4K8Z A;  1UPG A;  1YVW A;  3L74 H;  2EIN B;  2GV9 A;  3DTU B;  3H1J H;  3KCY A;  5IYD O;  2DYR C;  1Q86 W;  1E79 G;  2EIN C;  3T1Y O;  4JI8 O;  1FXH A;  3M7M X;  1R3J C;  1Q90 D;  3CC4 V;  4PA3 A;  4DRX A;  1TUB B;  1HNW B;  4L8J A;  3B4S A;  4GX5 A;  1S5L Z;  1K33 A;  5L3D A;  4DV2 B;  1YIT V;  3CCJ V;  3Q4H A;  4YY3 B;  4MVM A;  2Q7E A;  2FML A;  2WLJ A;  1WB7 A;  1GRJ A;  3RYH A;  1KU9 A;  1NVP B;  4JTA B;  1XOU A;  4O4H B;  1G8M A;  4J9Y B;  5F2V O;  1AP5 A;  1NKD A;  3ABT A;  2P90 A;  1PV0 A;  2QSA A;  4X62 B;  3CC7 V;  2P5O A;  3AK3 A;  4JAA A;  5CBG A;  1M5I A;  1AVM A;  3M8A A;  5LHI A;  4NXN O;  3K03 A;  3OGI B;  1W2B U;  3ABK B;  2Q8V A;  1QVF U;  1I08 A;  2H8P C;  1Q81 W;  3K08 A;  1HNZ O;  4GKK B;  2Q6A A;  2HKO A;  3K5N A;  3F7V C;  2ITD C;  3ABK C;  3QTC A;  2BTO A;  4LR3 A;  2XHB A;  1KKC A;  4IHJ A;  2LGQ A;  5CN0 A;  1FJG B;  1YJW V;  4DV7 O;  3K9A A;  1K97 A;  1IXM A;  3SDL A;  5EC2 C;  4DRX B;  3D3Q A;  4YIO A;  1B06 A;  2EIK B;  1JQ0 A;  4MVS A;  1K73 W;  4NYK A;  2VQE O;  3D8C A;  4UV8 A;  2UUB O;  4O4I A;  5IE9 A;  1YI2 V;  1TVK A;  3Q4H B;  4TUY A;  4NB5 A;  2EIK C;  5GTI Z;  1JJ2 U;  3RYH B;  5AG2 A;  4JGS A;  3OFN G;  1DTO A;  1JCH A;  2RNB A;  3E2E A;  3E86 A;  2QWR B;  5DEC A;  2WAM A;  2OCC B;  1WN7 A;  5KUM A;  4I55 A;  4IYH A;  4HNA A;  4O4J A;  3G71 V;  1Q43 A;  1RPO A;  3R66 A;  4CS4 A;  5KAF Z;  2EBO A;  1SQP H;  4I0X A;  2OCC C;  2FTK A;  1IX9 A;  3P3N A;  1AR1 B;  2P6J A;  1Y76 A;  4MVU A;  2JEU A;  1JJO A;  3K59 A;  2VQF B;  1MSW D;  4PDR A;  4IHJ B;  1VQP V;  1V54 B;  3CE2 A;  3AG1 B;  1M90 W;  1ZLZ A;  3ZN1 A;  4L87 A;  1J95 A;  2AGA A;  5B1B C;  4LH6 A;  4K0K O;  4FJC C;  3VBB A;  1V54 C;  3LNN A;  5A9G A;  1ENV A;  1F51 A;  5LGU A;  3AG1 C;  4J7K A;  5KHG A;  4IYI A;  2AW9 A;  4GYC B;  4O4I B;  2EUL A;  2QR4 A;  1TVK B;  2GUZ A;  4GX2 A;  5JJJ B;  5H6Q A;  4K35 A;  4UVC A;  1H2N A;  4B3M B;  2E5L B;  4LF6 B;  2A06 H;  1LR1 A;  1FAF A;  2UU9 B;  1N8R W;  2CUG A;  1BSM A;  4CS2 A;  1R73 A;  3ASN B;  4TV9 A;  2EIJ C;  3CX5 F;  4I55 B;  4JV5 O;  4HNA B;  5FPO A;  4O4J B;  1HR0 O;  3ETE A;  2WLL A;  4I0X B;  3TJT A;  4RUF A;  2VWJ A;  1SZX A;  2AHY A;  1AP6 A;  5KHK A;  2L6L A;  1Y76 B;  2LJ2 A;  2Z0A A;  3BVO A;  5IY5 B;  4ZI7 A;  4DV0 O;  3K58 A;  2ADQ B;  4GZR B;  2JK5 C;  3ZHV A;  3B77 A;  3A0R A;  1JA8 A;  3DC5 A;  5IY5 C;  1UFI A;  4MW3 A;  1GN2 A;  4ZIB A;  1PL0 A;  1FYJ A;  4JI4 O;  5KHI A;  3DXR A;  3T4D A;  4LF4 O;  1VQ6 V;  4PEL A;  1RP3 B;  1VF6 C;  4NXM B;  2EIM C;  5IT9 N;  1HNX O;  2OIE A;  3QO5 A;  3H01 A;  1N33 B;  4CC5 A;  4RQE A;  2GBO A;  4X66 B;  2K1E A;  2KSD A;  2GUZ B;  1US6 A;  3G67 A;  5FNV A;  2X6C A;  2Q68 A;  4OPH A;  4AHC A;  3LDD A;  2ZKO A;  2YXL A;  1GM9 A;  1R3L C;  4DV6 O;  3OEH G;  2P67 A;  4DR3 B;  2R70 A;  2ZE8 A;  1N34 B;  5LHH A;  4TWK A;  2GTA A;  4F6R A;  3RYC A;  3EXA A;  4TV9 B;  3CCR V;  1E1R G;  2WLI A;  4JYB A;  3DC6 A;  4JI6 O;  5GON B;  2WLL B;  1DF4 A;  4IGG A;  1YJ9 V;  2PYJ A;  2YIA A;  5KHH A;  1MG1 A;  4X65 O;  4TSF G;  4DW0 A;  2PY5 A;  4YJ2 A;  1NI8 A;  1XDC A;  4ZI7 B;  1DGS A;  3ABL C;  4QGP A;  5L3E A;  3W7W A;  4DV3 O;  4MSW C;  1IUR A;  3CCU V;  2YC0 A;  3IC7 A;  3OE7 G;  4LCU C;  4LNU A;  5H9C A;  2ARH A;  3GWK C;  3DXR B;  1XL4 A;  3VQX A;  4B3S O;  2DYS B;  4BW5 A;  2P7T C;  3RT3 C;  3P32 A;  3JD3 A;  4N23 A;  1I5Y A;  3BPZ A;  1B3Q A;  1EM1 A;  3WFV A;  3CEI A;  3M99 B;  4LFA B;  2DYS C;  3FD9 A;  4FM2 A;  5FNV B;  4MTG A;  4FLT A;  3BA9 A;  2BSK A;  4UVA A;  1SQQ H;  4MVO A;  3UO2 A;  5BR8 O;  2UXD B;  3W7S A;  1FD9 A;  2PZS A;  1WLE A;  4WFB V;  4F6R B;  3RYC B;  2F23 A;  1I7F A;  2WLI B;  2K9P A;  1ORQ C;  3F5T A;  4MTO A;  3SR2 C;  3SPC A;  1Q6H A;  4KFM A;  2XT9 A;  4DR7 B;  5K1P A;  1G1X B;  2ZE6 A;  4B3T O;  4LP8 A;  3HKB A;  2P4V A;  4YJ2 B;  3E8B A;  4LFB B;  1NH2 B;  2EX3 A;  3BCC H;  4XDJ A;  1QU7 A;  3S3X A;  3SYQ A;  5L3G A;  2XAJ A;  4LNU B;  1VMG A;  3UO3 A;  5DM6 V;  4J11 A;  2NR5 A;  4WFE A;  3H1L H;  5FLX N;  3LSU A;  4OX9 O;  1IBL O;  4LF5 B;  1K92 A;  1XMQ B;  4JTC B;  1NU1 H;  1VQ9 V;  2Q7G A;  4LFC B;  5CBH A;  4LF8 O;  2ZM6 B;  1VF7 A;  4BW9 A;  5IJ0 A;  2CTP A;  5IWA B;  1YZB A;  2BSK B;  4CH5 A;  4K3A A;  4DV1 O;  4EEQ A;  4DV4 B;  4TQF A;  4JI0 B;  1AR4 A;  2KB1 A;  1RM1 C;  2CGO A;  4FFB A;  1QR8 A;  2IJK A;  3I55 V;  1HW7 A;  5B5E Z;  3SYA A;  3KG2 A;  1GM7 A;  2CTR A;  1R6K A;  2W0F C;  4H44 B;  4UCV A;  4JI5 O;  2HLD G;  3WU2 Z;  1BQZ A;  4FLX A;  4UCR A;  2LGW A;  1HWY A;  1AI7 A;  1VEW A;  4GKJ O;  1VF5 B;  3RVZ A;  2AHZ A;  4DW1 A;  1VQ7 V;  3JD2 A;  1Q7Y W;  3HKB B;  2XOK G;  1WPX A;  4CH6 A;  4I4T A;  2UXB O;  1I0H A;  1ZL8 B;  3JYC A;  4F6E A;  3J7A U;  1VQ5 V;  3AG4 C;  4DUZ O;  4AIL C;  2WWW A;  2IW5 A;  2W6I G;  1BT8 A;  2XAQ A;  3AG3 B;  4X1I A;  4IT5 A;  4O2A A;  3OW2 U;  2F43 G;  2P4K A;  1URF A;  2F66 C;  3CXC U;  4I50 A;  3AG3 C;  3CCV V;  2WPD G;  1P4R A;  3FYE B;  2Z3Y A;  4MS2 A;  3CMA V;  1MZF A;  2FKX A;  1P84 F;  1YDX A;  2JGU A;  1D2D A;  5IJ0 B;  4CC6 A;  5GTH Z;  2EJR A;  3OTO B;  3L71 H;  1R6N A;  4DR1 O;  1J5E O;  1IBM O;  1R3K C;  1EZJ A;  1Q5O A;  4FFB B;  2GDS A;  4GX0 A;  3ASO C;  2B5U A;  2UUA O;  1JX9 A;  1X4T A;  3SYP A;  2HVJ C;  5JH7 A;  4LF9 B;  4GUN A;  4CBC A;  1XQ8 A;  4X89 A;  2QWN B;  2HJF C;  2ZIN A;  1XNR O;  2P06 A;  2ZR3 A;  1ARO P;  4UCU A;  4JAU A;  4PI0 A;  1MMM A;  5FL7 G;  1AI6 A;  2EZP A;  1D5N A;  1VQ4 V;  1XUQ A;  4FPP A;  3JSN A;  4I4T B;  4DV5 B;  2DW4 A;  5KA6 A;  5TIS Z;  4OPA A;  3SYO A;  4JZ2 A;  3EHB B;  2QA4 V;  4BIO A;  4WFG A;  4DR4 O;  2QDO A;  3ZMZ A;  5LMU O;  3WB1 A;  3ZHS A;  5LGN A;  2BTQ A;  1N32 B;  4O2A B;  3CRA A;  1KC8 W;  5HFM A;  1RFY A;  2UUC O;  4X88 A;  4UVB A;  2QGN A;  4I50 B;  5KHJ A;  1T5E A;  3MHH C;  2UXC O;  1QLE B;  1QBZ A;  3ZHQ A;  4Z2W A;  3K9S A;  3SPG A;  1HNZ B;  2JS5 A;  3CSX A;  3K79 A;  1CP9 A;  1EN5 A;  1QLE C;  1K5S A;  1JFF A;  2HEP A;  4LF7 B;  5JH7 B;  1GTO A;  3ZMT A;  2D3O W;  2YDE A;  1P7G A;  2QKS A;  1H38 A;  3CCS V;  2UUB B;  1PNM A;  1WA8 A;  4HYO A;  2E74 B;  4FM1 A;  1L8D A;  2X6A A;  4AQY B;  4B3R O;  1KB9 F;  2ADP A;  1JR9 A;  1QVG U;  4KP4 A;  4PDL A;  3STZ C;  4BIZ A;  5K1X A;  1SS3 A;  4FK5 C;  2QEX V;  2V7Q G;  1E1Q G;  4RWU A;  2GHY A;  2P22 C;  3N2G A;  3JD1 A;  4UCS A;  1P49 A;  1G4Y B;  2JEX A;  1JMK C;  5L3F A;  3BAA A;  2PI5 A;  1BS3 A;  3GVM A;  1EBO A;  3OTF A;  4DV2 O;  4U3J A;  1JFF B;  3K5O A;  4FLU A;  1Y67 A;  3QG5 A;  1F23 A;  4TOI A;  3OM3 B;  4XBF A;  2H3O A;  2LW7 A;  2F93 B;  1Z5W A;  4WFF A;  3B2E E;  1SC5 B;  3CCL V;  5IYZ A;  2BOC C;  4EFE A;  1EZV H;  4X62 O;  3EFF K;  1UJW B;  1K8A W;  1RSO A;  2Y0P A;  2DWE C;  4CH4 A;  2JJ1 G;  3HR0 A;  4WFH A;  3CHX A;  5DN6 G;  2XTA A;  3OGC C;  2HHH O;  1WA8 B;  2FB5 A;  4UXN A;  4GKK O;  1HDJ A;  1KUQ A;  3CXH F;  1Q6I A;  2N04 A;  2V4D A;  2QM8 A;  5E1A C;  3ZJZ A;  4B08 A;  2Y48 A;  1MZE A;  4IL6 Z;  3CJH A;  2XAG A;  2WSS G;  4MT8 A;  5B1B B;  1QQC A;  3JD0 A;  2RQ6 A;  2VRZ A;  1VF6 A;  3N2G B;  1XMO O;  4JI2 B;  1HR0 B;  2YI9 A;  1Q8I A;  2ITC C;  5LXT A;  1WAZ A;  3ZRW A;  4P9P A;  4DUY B;  3B8M A;  2YSU B;  2BCC H;  4NVP A;  3VOU A;  1XRE A;  1COW G;  3D3I A;  1KP3 A;  2BE3 A;  2Q67 A;  3S3W A;  4U7O A;  1PP9 H;  3RFR A;  4DV0 B;  2YXY A;  1VQO V;  1YSC A;  4TUY B;  2E76 B;  1HP8 A;  2E75 B;  2EIJ B;  5KX5 A;  1W0K G;  3MAQ A;  4NKG B;  5B3S B;  1XHZ A;  2QTS A;  2GSM B;  4N21 A;  1RSO B;  3N2K A;  4X1K A;  4PA7 A;  1IBK B;  1YTF D;  2X7R B;  1HNX B;  2ZDI A;  2W0X A;  2WA4 A;  1XHX A;  1VQN V;  3OT7 A;  4FZ0 A; 
#chains in the Genus database with same CATH homology
 4MTG A;  4UV9 A;  1PNL A;  5B3S C;  1W0J G;  4P30 A;  4UVA A;  1S76 D;  2ZD9 A;  3PJS K;  4MVO A;  3K06 A;  1K4D C;  1OCR B;  1K34 A;  4MVZ A;  4CZZ A;  1K3E A;  3G6E V;  3W7S A;  1KKD A;  3IGA C;  2WLH A;  5EK0 A;  1WLE A;  2HVK C;  4WFB V;  1ZWI C;  3UKM A;  1CEZ A;  1RPR A;  2WLI B;  4MVR A;  2YEV A;  1OCR C;  1ORQ C;  2ATK C;  2M7W A;  3OMA B;  5EBL C;  3BEH A;  2QTO A;  2R9R B;  3OMI B;  4MTO A;  3SPC A;  5B1A B;  5L3B A;  2EIM B;  1JPX A;  4KFM A;  3AG2 B;  4HZ3 A;  1Y66 A;  1EFR G;  4JPR A;  3QO7 A;  3ZRW B;  1H8E G;  4GX1 A;  4LP8 A;  3E8B A;  3FB8 C;  3I56 V;  5B1A C;  1NH2 B;  5EC1 C;  4X8A A;  3AG2 C;  1AJP A;  1GM8 A;  1MOF A;  2IJJ A;  3T2M A;  1THZ A;  3RW0 A;  4XDJ A;  3SYQ A;  3K0G A;  5L3G A;  2IJI A;  2XAJ A;  3E89 A;  4MW8 A;  1S0V A;  1BHA A;  1VQL V;  1NQT A;  1GO3 F;  5DM6 V;  1SET A;  1FXK A;  3LNM B;  3OEE G;  4QJF B;  4G27 B;  4WFE A;  3OMN B;  3QO8 A;  4WF9 V;  3IFX A;  1KP2 A;  3FKS G;  1PD3 A;  4H37 A;  3K3W A;  3STL C;  2BOB C;  3CYO A;  2QM7 A;  1K92 A;  3OR7 C;  4JTC B;  3B8N A;  3T1C A;  4ZBM A;  1VQ9 V;  3UM7 A;  5CBH A;  2PI4 A;  2DYR B;  1AI5 A;  3K0D A;  4R6Z A;  3OUS A;  4LC1 A;  4JTD B;  1YIJ V;  3D36 A;  1GKF A;  2EIN B;  1PKX A;  2QE7 G;  2DWD C;  5CA3 A;  3ABL B;  2XAS A;  2KB1 A;  3DTU B;  1RM1 C;  5L3C A;  1QR8 A;  2IJK A;  2ZDI C;  3I55 V;  5IYD O;  2DYR C;  1M1K W;  3SYA A;  3GWO A;  1Q86 W;  3KG2 A;  1E79 G;  1GM7 A;  1Q82 W;  2EIN C;  1R6K A;  2LP7 A;  2W0F C;  3X2Q B;  3ZRS A;  1FXH A;  3MD0 A;  5H6R A;  1R3J C;  4PA6 A;  3CC4 V;  2YEV B;  2HLD G;  4PA3 A;  4RUE A;  4E2L A;  2LFS A;  4GX5 A;  2A0L A;  1HWY A;  1AI7 A;  1K33 A;  5L3D A;  3SPH A;  3X2Q C;  3RVZ A;  1H2G A;  2AHZ A;  4GT1 A;  1YIT V;  1VQ7 V;  3JD2 A;  3CCJ V;  1Q7Y W;  4R7C A;  2XOK G;  4MVM A;  1WPX A;  1GMG A;  1BHB A;  2WLJ A;  4QNH B;  2W6J G;  2NNU A;  3LDC A;  4DXW A;  4R50 A;  4YXW G;  1NVP B;  4JTA B;  2R9I A;  3JYC A;  1G8M A;  4J9Y B;  1VQ5 V;  2ZXW B;  1NKD A;  5B1N A;  3AG4 C;  3ABT A;  2P90 A;  2WWW A;  2IW5 A;  2W6I G;  2V1D A;  4ASU G;  2XAQ A;  3AG3 B;  3CC7 V;  3TCU A;  5LBQ A;  5CBG A;  3OW2 U;  2A79 B;  3FB7 C;  2B1G A;  2ZXW C;  2F43 G;  5LHI A;  3FB6 C;  3W7U A;  3K03 A;  4I5S A;  3CCE V;  3CXC U;  1W2B U;  3ABK B;  3AG3 C;  4GCZ A;  5J9P C;  1QVF U;  3AEI A;  2H8P C;  1NH2 D;  3K08 A;  3CCV V;  2WPD G;  4PDV A;  3ZMU A;  1P4R A;  2Q6A A;  3FYE B;  2Z3Y A;  4JAS A;  3RVY A;  1FXK C;  2HKO A;  4MS2 A;  3CC2 V;  3CMA V;  1DF5 A;  3F7V C;  1SES A;  2ITD C;  3ABK C;  4MTF A;  1TUE B;  1H8H G;  2EJR A;  1R6N A;  2NLJ C;  5CN0 A;  4RAI A;  1R3K C;  3E35 A;  1EZJ A;  3ASN C;  4QE7 A;  4GX0 A;  1YJW V;  3G4S V;  2Q69 A;  4U7N A;  5KA5 A;  3ASO C;  2B5U A;  3K9A A;  2C2A A;  3LDE A;  1L1F A;  1K97 A;  4RO2 A;  3LUT B;  1JX9 A;  1IXM A;  3SYP A;  2HVJ C;  1V55 B;  4CBC A;  4X89 A;  5EC2 C;  4RQF A;  2HJF C;  3JD4 A;  2EIK B;  1JQ0 A;  1ROP A;  4MVS A;  1K73 W;  1DLB A;  2OT5 A;  2JIZ G;  2XND G;  3K04 A;  2Y69 C;  2ZR3 A;  3LSS A;  3R65 A;  4UV8 A;  1ARO P;  1V55 C;  4JAU A;  5FL7 G;  4PDM A;  1M57 B;  3W7X A;  2IU3 A;  1YI2 V;  1JJ2 U;  2EIK C;  3TET A;  1AI6 A;  4QPK A;  2EZP A;  1VQ4 V;  4FPP A;  1JOY A;  4JGS A;  3OFN G;  2DW4 A;  1DTO A;  5KA6 A;  5KUK A;  3SYO A;  2WLM A;  1JCH A;  3E2E A;  1QCE A;  1M57 C;  3EHB B;  2QA4 V;  3E86 A;  3F5W C;  4P9O A;  1OZ0 A;  4WFG A;  3F7Y C;  2HR3 A;  2WAM A;  3ZMZ A;  4BIU A;  2OCC B;  3ABU A;  1RM1 B;  5KUM A;  1S77 D;  5LGN A;  1K7D A;  4DO2 A;  5CBF A;  5B1O A;  1KC8 W;  5HFM A;  1YJN V;  4X88 A;  4UVB A;  1VQK V;  1AI4 A;  3G71 V;  1RPO A;  3ETG A;  2X6B A;  2EBO A;  2XAF A;  2OCC C;  1OCO B;  1FXV A;  3MHH C;  3CPW U;  1QLE B;  1QBZ A;  2FTK A;  1AR1 B;  1SRY A;  1NVP D;  1SZT A;  1NJI W;  2P6J A;  1OHH G;  2EZO A;  3OUF A;  2JEU A;  4MVU A;  4WCE V;  3SPG A;  4XDK A;  2XAH A;  4F4L A;  1Q81 W;  1AJN A;  3K79 A;  1OCO C;  1CP9 A;  1QLE C;  1K5S A;  2WLN A;  3E8F A;  4PA4 A;  3ZCC A;  1GK9 A;  4PDR A;  1MSW D;  1VQP V;  1SER A;  1V54 B;  1I5X A;  3AG1 B;  3AG4 B;  1M90 W;  1P7B A;  3ZN1 A;  4L87 A;  1J95 A;  4PA9 A;  5EBW C;  5B1B C;  1GTO A;  1PNK A;  3FB5 C;  4FJC C;  1V54 C;  3VBB A;  3ZMT A;  4ZKI A;  5LGT A;  1ENV A;  2B1I A;  1F51 A;  5LGU A;  3HPL C;  3AG1 C;  2CK3 G;  2D3O W;  1S72 V;  2QKS A;  4H33 A;  1H38 A;  3WG7 B;  3CCS V;  5HFL A;  4EKW A;  1FXK B;  4GX2 A;  1PNM A;  3GB7 C;  5H6Q A;  4HYO A;  3WG7 C;  4I9W A;  4UVC A;  2X6A A;  1S3J A;  3ZMS A;  3E8H A;  1QVG U;  4KP4 A;  1N8R W;  3CP1 A;  2EIL B;  1S5H C;  4PDL A;  2UXN A;  3STZ C;  1K9M W;  1R73 A;  1BL8 A;  1NR1 A;  3ASN B;  4BIZ A;  2OTL V;  2EIJ C;  4FK5 C;  2QEX V;  3ASO B;  5IYB O;  2V7Q G;  1E1Q G;  3CME V;  3T4Z A;  1NBM G;  1OCC B;  2GHY A;  3DGE A;  2ZR2 A;  2EIL C;  1VQ8 V;  1JVM A;  4FMT A;  3ETE A;  2WLL A;  3JD1 A;  3FYI B;  1LNQ A;  1M9N A;  4RUF A;  1VQM V;  2AHY A;  3CCQ V;  1G4Y B;  2JEX A;  2Y69 B;  4G2K A;  4UUJ C;  2MK3 A;  1OCC C;  5IDJ A;  3NXS A;  3CD6 V;  5IY5 B;  1B6Q A;  5L3F A;  1K4C C;  2JJ2 G;  2PI5 A;  2HG5 C;  1YTF B;  1EBO A;  2A9H A;  1FFT B;  2WLK A;  2DQ3 A;  2JK5 C;  3ABM B;  3B77 A;  2H94 A;  3A0R A;  4P2Z A;  5IY5 C;  1F23 A;  4MW3 A;  3OM3 B;  1PL0 A;  2IH1 C;  3E83 A;  3OAA G;  4JAV A;  3SJQ C;  4XBF A;  2DQ0 A;  1Y4M A;  3BY6 A;  4WFF A;  2ZQM A;  3T4D A;  1VQ6 V;  4QIW F;  4PEL A;  3QNE A;  1CPY A;  3CCL V;  3ABM C;  2BOC C;  3HB3 B;  2EIM C;  4KUM A;  5EBM C;  3QO5 A;  1BMF G;  3H01 A;  3EFF K;  1UJW B;  1K8A W;  3ZIA G;  3JCZ A;  3OR6 C;  2DWE C;  2JJ1 G;  1KEC A;  4WFH A;  4RQE A;  1M56 B;  3TK1 A;  4Q20 A;  2K1E A;  1KQS U;  5DN6 G;  5BZB A;  1KD1 W;  4FIP C;  5LHG A;  4QPJ A;  2X6C A;  2Q68 A;  3OGC C;  4BAY A;  3W7T A;  3LDD A;  4UXN A;  1GM9 A;  3SPJ A;  3SPI A;  1F4N A;  1AJQ A;  1FS0 G;  5CMU A;  1R3L C;  1M56 C;  3RBZ A;  3OEH G;  2P67 A;  1QLN A;  5LHH A;  2QM8 A;  4TWK A;  1R3I C;  3MHS C;  5E1A C;  2IJH A;  5GW7 A;  1XL6 A;  3ZJZ A;  3ZRX A;  2Y48 A;  4R8C A;  3CCR V;  1E1R G;  2WLI A;  4JYB A;  2XAG A;  2WSS G;  4MT8 A;  2JDI G;  5B1B B;  3JD0 A;  3ZN0 A;  2WLL B;  1DF4 A;  1QR9 A;  3SYC A;  4G28 B;  1YJ9 V;  1MG1 A;  2ITC C;  1MAB G;  2LFR A;  4TSF G;  3ZRW A;  4P9P A;  4JYC A;  2IU0 A;  1F4M A;  3B8M A;  3P30 A;  2YSU B;  3ZMV A;  3VOU A;  3ABL C;  5L3E A;  1COW G;  3LSQ A;  3W7W A;  3D3I A;  2IH3 C;  1KP3 A;  4MSW C;  2Q67 A;  4LBE C;  3CCM V;  3CCU V;  4U7O A;  3IC7 A;  3OE7 G;  4LCU C;  4MVQ A;  1VQO V;  5C93 A;  1YSC A;  2OTJ V;  5H9C A;  4MTX A;  1OCZ B;  1XL4 A;  2Z5U A;  3ETD A;  4Z1M G;  4J9Z B;  2DYS B;  4JF3 A;  1K5Q A;  3ZRV A;  3ML0 A;  4BW5 A;  2P7T C;  2EIJ B;  3P32 A;  4WFA V;  1YHQ V;  3JD3 A;  4N23 A;  1I5Y A;  1W0K G;  5IYC O;  5B3S B;  4XDL A;  2GSM B;  4N21 A;  3WFV A;  1NR7 A;  1OCZ C;  3M99 B;  4PA7 A;  1YTF D;  2X7R B;  2UXX A;  4OXS A;  3E8G A;  2DYS C;  4HAM A;  4TT3 G;  2X0L A;  1VQN V;  2ZDI A;  2HFE C;  4QE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...