3FB9A

The crystal structure of the protein with unknown function from streptococcus pneumoniae tigr4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
GMSDAFTDVAKMKKIKEEIKAHEGQVVEMTLENGRKRQKNRLGKLIEVYPSLFIVEFGDVEGDKQVNVYVESFTYSDILTEKNLIHYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the protein with unknown function from Streptococcus pneumoniae TIGR4
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 22
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06257 VEG Biofilm formation stimulator VEG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fb9A00
2VXEA 4M77G 3JB9D 5GAMj 3FIFA 4M78D 4NL3A 3RERA 3JCMV 2EJ9A 4M7AA 4M78E 5LJ3d 5GMKl 3JCMd 2EWNA 1H641 5GMKe 2QTXA 4EMKB 4M7DE 5LJ3h 3JCMh 3V8LA 4HA8A 4XTWA 5GAOn 4M7DC 4M75B 4M7DF 3JCMg 5LJ3g 1YCYA 1D3BA 2DTHA 2DZ9A 2RM4A 3JB9F 2VC8A 3JB9H 4M78F 1BIBA 1LOJA 4NL2A 4M78C 5GMKm 5GAMh 5GAOp 1JBMA 2DKGA 4M75C 5GAMg 4X9CA 1BIAA 2VXFA 4QVDA 4M7AB 3RKXA 4JUVA 2YLCA 5LJ5h 3RIRA 5GAN6 4JRKA 1JRIA 1LJOA 4MMKA 4X9DA 1I81A 4XU2A 1WQWA 4XU1A 4C92B 5GMKh 5LJ5g 2I2LA 4XTXA 1WPYA 4XTVA 4M7AF 3L1AA 1D3BB 1I4K1 1M5Q1 4C8QA 3V7CA 3JB9J 4V2SA 4XU0A 5GAOm 3QSUA 4Y91A 4C92C 5LJ3j 4PJOC 4F7UF 3SWNA 2DXUA 4XU3A 4MMLA 2ZGWA 3HFOA 3JCMQ 4RCBA 4C92D 4EMKA 3RUXA 4PJOD 4M7AG 4M77D 3BW1A 4HT8A 4DQ2A 4M7AD 3QO3A 4M77B 5GAMf 1KQ1A 5GANd 4M7DG 4M75E 3BY7A 1B34B 1WQ7A 2E41A 3PGGA 4XQ3A 3QUIA 4M75A 4OP0A 3V7RA 5GANe 1WNLA 5LJ5f 3RESA 5GANh 4M78A 3VU3C 5LJ3e 4XTZA 4M77E 5GMKj 3JCMe 1I5LA 5GAN5 2JN0A 3JCMb 1Y96A 4C92F 4PJOF 3JCMX 4M77F 4A54A 3SB2A 2DTIA 4A53A 2E1HA 3JCMc 5LJ5d 5GAN3 2RA2A 4F7UG 1Y96B 3JCMW 4M7DA 4C8QG 2DJZA 2HNIA 2K57A 2EJGA 5GAMd 4C8QE 2DZCA 5GANf 2FB7A 2FYKA 4M78G 4C8QF 4PJOB 5GANj 5GAN2 4XTUA 4EMGA 3BFMA 4C92G 5GMKi 3FJPA 3BDUA 5GAN7 4C92E 4M77C 2E10A 2DVEA 5CAIA 2E65A 2RB6A 3GIBA 4M7DB 4M7AC 3QHSA 3HSBA 4C8QD 3JB9I 4XTYA 3JB9G 1M8VA 4JRIA 3JCMJ 4PJOG 4M75F 4N0AA 4M78B 1TH7A 4J6WA 4EMKC 1KQ2A 4M75G 5GAOq 5GAMe 2CGHA 2RD1A 2YHTA 4WF2A 1U1SA 1LNXA 1HK9A 1N9RA 3L2ZA 4J6XA 2DXTA 4F7UA 5GAOl 1I8FA 3V7SA 4QVCA 4PJOA 2EJFA 3M4GA 5LJ5e 3AHUA 4J6YA 3EFRA 3JCMP 1U1TA 5DY9A 1X01A 4M75D 4C8QB 4F7UE 5GAN8 1B34A 1MGQA 5LJ3f 3JCMf 3V8KA 3INZA 4PJOE 3V8JA 4M7AE 3HFNA 1HXDA 4RCCA 3SWNC 3SWNB 2EAYA 4C92A 4JLIA 5GAOr 4HT9A 3RKYA 2DEQA 4M77A 3RKWA 2YLBA 4F7UB 2DTOA 3FB9A 5I21A 4J5YA 4PNOA 4C8QC 4EMHA 5LJ5j 2Y90A 4M7DD 1N9SA 5GANg 4NOYA 2E64A 3EFSA 5GAN4 4N0AC
chains in the Genus database with same CATH superfamily
2EGCA 4M7AA 3CC4Q 2MI6A 3I9QA 3JCMh 3NGPA 1F1BB 3CCLQ 2ZAEA 3M0PA 5I11A 5KYWB 2CYZB 4M7AB 2YLCA 1IGUA 4J9FA 5LJ5g 2P4RA 2XDDA 1NM7A 1WDXA 1I4K1 4R0KA 1FYNA 1FMVA 1MV0B 1X43A 1UGRB 3OYFA 3TSZA 3DLMA 3OY9A 3RBBB 3EGDB 1U8RA 4QT7A 1RAAB 3F70A 3CCMQ 4D6WA 2JTMA 3M57A 3G6EA 3BY7A 3PIPA 1XQHA 3RESA 2L89A 2GFUA 3G4SQ 2KEAA 4BY6C 4F7UG 3OBYA 2VYTA 4PJOB 2E3HA 3S3NA 1VQPQ 1NYGA 2PQWA 2PVOB 5I22A 1TG0A 5KYWA 4LUDA 3OYMA 3G71Q 1VQ7A 2KQWA 4JZ3A 1UB4A 1M1KC 2NUTA 2RD1A 3MEWA 1HK9A 3L2ZA 5L23A 1Y07A 2FL7A 4ZGDB 3A8OB 3EFRA 1A0NB 4A63B 3KFVA 4QVZA 4C8QB 2LJ0A 5FU7B 2A3LA 1W70A 1HXDA 4DOVA 5GAOr 2ZPGB 1SPKA 2GCXA 4J5YA 4LDVA 4PNOA 1YITQ 2FPEA 3JSCA 4LDWA 5IXFA 1PD1A 1I07A 2M02A 2DE0X 3RERA 3M58A 2B86A 1IXDA 1T0HA 1PG5B 4M78E 5KCHA 2DVJA 4GLMA 1BBZA 5GAOn 3I55Q 1CSKA 1ZX6A 1PKTA 2RQTA 4L5GA 4ZN1A 1C6VX 3VJPA 3CCVA 2VC8A 3RNJA 1NE8A 1VQ5Q 1M90U 4F16A 3G6ET 5GAOp 1VQ8A 2EQKA 2RH2A 4OGEA 2CKKA 2YRDA 2R5MA 2K6DA 2LQNA 5CQYA 1WHKA 2JT4A 1ZA1B 2PNIA 4PJOD 1QW1A 1MMNA 5I2SA 4BUGA 3BW1A 3PE0A 3SDZA 1TSFA 4OMOA 5GANd 2NUZA 5GANh 2HDAA 2KGTA 2CS7A 4XTZA 3GF5A 1RI9A 2PZ1A 3SB2A 1VQ9Q 4DBFA 1WYXA 2ECZA 3VRZA 2DXCA 5GJWB 2C0TA 3URGA 2LZ6B 3CCEQ 1YJ9A 3PFSA 2O9SA 5CO7A 1YJWQ 2W0ZA 4DEXA 1VQMQ 1W1FA 2OTJT 1QWFA 4M77C 4BI8B 2ZPFB 3HP9A 1VQ6A 3QG1A 4ME7A 3IQLA 1DJ7B 5CKFA 3PVLA 2O4XA 5GAOq 4LXCA 1D1BA 2IIMA 2YHTA 2ATCB 5KE2A 4P5NA 1VYVA 2EJFA 5LJ5e 3CC4A 3AHUA 1X01A 3HHTB 1VQLA 4KGZB 5CKBA 5FRNA 3TSWA 4IIOA 3OYJA 2RJDA 3QIIA 3QZ9B 4IUQA 3G71T 3OYIA 3LWHA 3Q1JA 3GNFB 5A0GA 4IURA 2QTXA 2NUPA 3CC2Q 1KG1A 1B3QA 4N4GA 3MP1A 3LLRA 1D3BA 2DLPA 4C0ZA 1JBMA 3CD6A 1JJ2S 4X9CA 3QWXX 2CH4W 3RIRA 2KRNA 5GMKh 4XU2A 2CZ6B 8AT1B 1AEYA 4V2SA 2F5TX 1VQ4T 2D0NA 4IIMA 3TREA 2D0QB 4QKUA 3EG9A 4C92D 3CCVQ 4C0DB 2A36A 2L3QA 2FHDA 2EQJA 3SD4A 1WJSA 3THKA 2SRCA 4KUIA 2MIOA 1GCQC 2YRCA 3JCMb 4PJOF 2RHZA 1ZSZC 2KDSA 1P92A 5LJ5d 1S72T 3CC2T 3CCUA 2J6OA 2HAXA 4LDUA 1HYOA 2RJCA 4FYVB 2ZCFB 3GIBA 1UG1A 2EYQA 4HVUA 1YJNQ 2EQIA 2VWFA 2HCKA 1SSHA 4N4IA 1W2BP 4QVCA 1BCOA 2LNVA 5IAYA 1SEMA 1D0YA 5DY9A 2SEMA 3P8BB 5HK3A 2VGNA 4M75D 1B34A 2QG9B 1YJWA 2G6FX 2MYSA 2LNHB 4PJOE 2H8HA 1IZ6A 4FYYB 1OOTA 1WXBA 1R0CB 2QK0A 5FROA 3H6ZA 1M90R 1PC0A 2CP0A 1ZQ1A 4FSXA 3WVDB 4OVAA 1LVKA 1IHVA 2JZ2A 2WSCE 3L2UA 3VYHB 2MOXA 2IVWA 1YCYA 3CCMA 1AWOA 3EH1A 3JB9H 4NL2A 4D8DA 4WCIA 4RG8A 3JV3A 2XK0A 4J8OA 1YWPA 1KD1R 4JRKA 2A7YA 3M5AA 2ZPEB 1VQ8Q 4B6MA 2HMAA 4Q5WA 1W4SA 2BKDN 5DLQE 3OMCA 4DQ2A 2E4HA 2ROTA 2E3IA 2GF7A 4M7DG 1IHWA 4QQ6A 4YTLA 4OP0A 1AWJA 2DIQA 1Q95G 2PU9B 2DXBA 3X20B 2V1RA 2GGRA 2K79A 2V26A 1MMDA 4IUPA 3CCST 1YIJT 4C8QG 2DL7A 2EKOA 2EJGA 2O31A 3D7SB 3I55T 2RK2A 2ABLA 2F69A 1M1FA 3EG3A 5GAN2 2LX7A 4JJDA 4LN2A 4C92G 3E19A 3OYNA 2AIRB 2HBWA 1VQNT 1YITT 3HSBA 3CCJA 1M1KR 1M8VA 4PJOG 2OTJQ 2AT1B 2LDMA 2NUTB 3VS1A 2AKKA 3OYBA 4FCYA 3S6WA 1UJYA 3J81E 2LT1A 3CCQT 3M0TA 1UGSB 2DYIA 1WHGA 3JCMf 2DRMA 4CC4B 2D1XA 3NFCA 2CZ1B 2JS0A 1IB8A 1NZ9A 3KBGA 4FW2A 2KBTA 1ABOA 2ROLA 1QQJA 1RAGB 3EHQA 1OEBA 3H8ZA 4M7DE 2RHIA 3OS0A 3CMAQ 2J7IA 1QWEA 2LX9A 1WXTA 3JB9F 2IPOB 3I56T 1QMCA 2WSFE 3UA6A 4IUTA 1ZLMA 3G71A 5C6SA 5D6YA 1KHCA 3OYKA 1PKSA 1KFZA 1K73C 1LJOA 2MPXC 1VQ5T 1VQPA 3QPHA 2XD0A 1TUCA 1KK7A 4XTVA 3VUZA 5KYYA 1VQLT 1D3BB 2DRKA 4C8QA 1SSFA 2COYA 9ATCB 4Y91A 2M0YA 4LUEA 2EYYA 3M9QA 4M7AG 3MP6A 4HCBA 3G4SA 2LCCA 1HJDA 1VQ7Q 4XQ3A 3JCMe 2CH4A 2AHJB 1Y96A 3LW5E 4RMOA 3JAME 2E1HA 3OS2A 3OYEA 3PVQA 3WVEB 4E2FB 2E5KA 1RAFB 5HY6A 4XTUA 2LTOA 2OTLT 2E6NA 1KC8U 1SRMA 1YHQA 2YUPA 2CP7A 3G6EQ 4M7AC 3NTIA 3CCLA 4C8QD 4AFZC 2OX7A 4B9WA 1K73U 2RF0A 4JRIA 4JDSA 5KH6A 4XK8E 1G3TA 2DXTA 4IUUA 2QEXT 1VIFA 1UGVA 3ZEHA 3V8KA 5D7UA 1QVFP 4RTTA 1E6HA 1YI2Q 2DEQA 4JJBA 2R58A 2COWA 5GANg 3P8HA 4PK4A 2FZGB 2VASA 2XDPA 4NL3A 3CC7Q 1G2BA 5ECAA 1D0ZA 5LJ3d 2PUKB 1WFWA 2AK5A 2B8AA 4KT0E 1ACMB 1ZBXA 1ZUYA 1LOJA 1OPLA 4JJCA 4M75C 2L3PA 3I5RA 2VXFA 4PJMA 1ZBJA 1NEGA 4OF1A 5IHNA 4X9DA 4Z8AA 1G3SA 2RO0A 2OTLQ 1UHCA 4E7SA 1Q82R 1GCQA 1M5Q1 4A4EA 3V7CA 1AWXA 4LNPA 3QSUA 3GBQA 3SWNA 5CVIA 4CC3A 4XU3A 2JTEA 5FU6C 4PFOA 1OPKA 3DB3A 3JCMQ 1YJNA 5EC7A 4HT8A 2YSQA 3EGDA 4CRIA 1D1CA 2F2VA 4NS5A 3H41A 4FT4A 2FPFA 4M75A 2X4JA 1VOMA 2DK3A 5GMKj 1KSWA 5GAN5 1WHHA 2JN0A 4M77F 3CCUQ 1Y96B 3EG0A 4AMCA 3M59A 5GJVB 4JZ4A 2C0OA 4JRPA 2KROA 2KVQG 3HL8A 3H9NA 1GFDA 4C5EA 1M8MA 1VYUA 4X1VA 1Q86U 3JB9G 3I5SA 2LMJA 5HKCA 1VQOA 2EPDA 1FWZA 4ELZC 4PJOA 2EVRA 2K7AA 1AD5A 3LWIA 3QXEB 1AWWA 2DAQA 1R77A 2CSQA 2JTFA 3HFNA 3QZ5B 3CCSQ 1YIJQ 1Q82U 3CCRT 2DIGA 2YLBA 5LJ5j 3CCRQ 2CSIA 3HPWA 4DBQA 4M77G 2QA4A 4M78D 2DYBA 2L8DA 2EYWA 1UUEA 3JCMd 3LYIA 3EHRA 1N8RU 1OZ2A 1RADB 2QQSA 2DTHA 4II1A 3OW2A 4M78C 5D6WA 3RKXA 5GAN6 2A0FB 4J9BA 2QA4Q 3GOXA 1GBQA 3LGFA 1MMGA 1OX8A 3VS6A 4PJOC 1Q7YC 2GQIA 3DKMA 1BI0A 5GAMf 3JRZA 1KQ1A 1QLYA 2DL5A 2V1QA 3CCUT 1ARKA 1KD1C 2CP2A 3PMTA 1K8AU 5GANe 3EGXB 3MJXA 1M3CA 3VU3C 3VV0A 3LX7A 4N4HA 2D9TA 3CMEQ 2DTIA 1K8AC 3JCMW 3I56A 5GAMd 4C8QE 3FC3A 3HRSA 1VQ9A 1BKBA 4F17A 1W2BA 1BI3A 1VQ8T 4EIKA 1YCSB 1GBRA 1GXIE 2H3JA 4ZN3A 1PRLC 3RR6A 2W10A 2BTTA 1QCFA 1OU8A 3PNWC 2JXBA 4BACA 1ZSZA 2LC4A 5A0DA 3M56A 4HCKA 1PRMC 4BDYA 1I8FA 1XJWB 2RPNA 3M4GA 1JU5C 1OI1A 5CQXA 4A4FA 1XOVA 2M1HA 2OTLA 1ZUUA 1N8RC 1N8RR 3M53A 4HT9A 2X3XD 4J7FA 4M77A 3RKYA 3CPWS 2M9UA 3O8VA 5GAMj 3EFOB 3FIFA 2KNBB 4E7KA 3C95A 3FDRA 3OW2P 2EWNA 5GMKe 5KYYB 4EMKB 2DD5A 2F2XA 2JM8A 3JCMg 3VS7A 3OB9A 2K4YA 2KXCA 4KGXB 1O9SA 2RN8A 1RLQC 3CC2A 4BD3A 1OV3A 2QI2A 1ZHIA 4KH0B 1WQWA 2BUDA 4F14A 1WIEA 1Q81U 1QVFS 3JB9J 4XU0A 3I56Q 1N6AA 3QDFA 3HFOA 2JS2A 2OJ2A 1JJ2P 3CXCP 5AYFA 2C0IA 3REBB 4M77B 2F5KA 1UEBA 2ZPBB 2QDLA 2KR3A 3QUIA 2HL5C 3J7AF 1JQQA 1M3BA 3JCMX 4LDXA 1VQNA 4A54A 1JB0E 2CP6A 3LGLA 5HK0A 5GAN3 2JMCA 2GBQA 5GANf 3A8HB 2FZKB 1Q86C 3CBOA 1YJ9Q 3FJPA 2D6FA 1M1KU 2MK5A 1B7TA 1SF9A 2MCNA 2LP5A 4JJNK 4E7IA 2YUQA 2YDLA 1TH7A 4J6WA 4EMKC 1FMWA 4GBQA 4PFZA 1W6XA 4GLKA 2XG8D 2L5QA 2QTVA 2PUOB 4RTYA 1MGQA 2V8JA 3V8JA 4M7AE 1XNIA 3ZFJA 3RKWA 2GFAA 2LJ3A 3ME9A 3NHNA 2DA9A 4OMQA 2YWWA 1Z9QA 4RTZA 4M7DB 2EQMA 1K73R 3E2UA 3BDLA 5FLXE 1E7OA 4HA8A 4M7DF 5LJ3g 5EG2A 2JOYA 2ENMA 4IUVA 1G3YA 3HKSA 3OSVA 3OBWA 3MP8A 4E7HA 3G4ST 1BIAA 5FU7C 2J6KA 2KAFA 2X4XA 4O6JA 1RAEB 1I81A 3I35A 2KXDA 2I2LA 4J83A 1YNZA 4PJLA 1KQSS 2GNCA 1YITA 1YJWT 3C94A 2LQ8A 2DXUA 4MMLA 2ZPIB 5KYNA 2DO3A 2CZ0B 4J9DA 3G1JA 1B34B 3PGGA 2QA4T 1PNJA 2MWOA 1U3OA 2O2OA 1YN8A 3CCLT 1NYFA 3ASKA 3GNGA 2RA2A 3M0QA 1N27A 3MCAB 3M54A 4M78G 4D8KA 2DFUA 5L8RE 4CC7A 3CC4T 3EGUA 4DA4A 5D6XA 2K3XA 3NTKA 1KHIA 1UDLA 1MMAA 2E10A 2J6FA 1M30A 4CI0C 3ZBDA 3H0IA 2H3EB 2F2WA 1RABB 2CUDA 4OB3B 2LQWA 3X28B 3CXCS 4RTXA 1VQKA 4KH1B 2RQUA 1BI2A 4Z02A 1I0CA 3A1PA 1ZA2B 5LJ3f 3QYHB 2LT4A 2VV5A 2CUBA 2K2MA 4JS4A 4F7UB 1NLPC 2DTOA 4R56A 1EZZB 4EPCA 4NOYA 1MV3A 2DX1A 2E12A 2RHUA 2CT3A 4Z89A 1BCMA 4AG2C 2ZPHB 1RUWA 2QQRA 2DZ9A 4QQGA 1UECA 1WHLA 2CP5A 3VS5A 1Q81C 1PCXA 5C0MA 2K5IA 1YJNT 4BI4A 2I0NA 3OYYA 4RTUA 3KXTA 5LJ5h 3T9NA 2KE9A 3OYCA 2YT6A 2M16A 1M9SA 1WPYA 1M4ZA 2D8HA 1KQSP 1J3TA 3SEMA 4OMPA 4F7UF 2ED0A 4JPBW 2X4YA 1NPPA 1ZSGA 5A2QE 2E41A 2K9GA 3NTHA 2CP3A 4E7ZA 2XICA 2K3YA 1D09B 2P0QA 5IT9E 4ATOA 2K2VA 2VUBA 1OX9A 3AT1B 3MKDA 3JCMc 1Z9ZA 3DB4A 1RAIB 3E9FA 3QJYA 3VRYA 1Q7YR 4M7DA 1QVGA 5AT1B 1X69A 4ANJA 1VQOT 2BZXA 3EG9B 1H92A 3OYGA 1OULA 2FB7A 2QDYB 5GANj 1UHFA 1KD1U 4L59A 1VQ4Q 2A37A 2FEIA 5FRMA 2FPDA 3CC7T 2V8IA 4AFQC 1QVGP 1M3AA 1MUZA 2HD0A 1K8AR 2RI2A 3MPUB 1GFCA 2CGHA 2NYSA 4WF2A 5CAIA 3UA7A 4LDYA 5GAOl 2D8JA 2KI7A 3EFOA 2OI3A 1PM3A 1G8XA 4HKEA 2OAUA 5CK9A 4F7UE 7AT1B 2JM9A 4FYWB 2BE7D 1UGPB 3CD6Q 5IH2A 1C0MA 5I21A 2MF2A 4M7DD 2Y90A 2DL3A 1PWTA 2PVGB 2RI3A 4RKUE 2GTOA 2R57A 2CDTA 3FJ5A 4XTWA 2FG0A 2YUOA 2QQBA 4O5VA 1X6BA 2AZSA 3P8DA 1K9MU 1JJ2A 1WJQA 1S1NA 2DILA 6AT1B 4QVDA 1BI1A 3OS1A 1GRIA 1Y71A 1XTDA 1TTHB 4XTXA 2R5AA 1VQMT 3L1AA 1I5OB 1X6GA 1X27A 2K3BA 2DEUA 3CCVT 4C0GA 3CCSA 1YIJA 1X2KA 2QGGA 3CQTA 1IGQA 1AHJB 1PD0A 1VQLQ 3VS3A 1VQ9T 1NBEB 3MO8A 3X24B 3CEYA 2BZYA 3EAEA 3VYGA 5LJ5f 1ABQA 1U06A 3S3MA 5J3BA 2XMFA 4HVVA 1YI2T 2RJEA 3QWYA 2LRQA 3CCRA 4PJJA 3SHWA 1NLOC 1GCPA 2HNIA 4LE9A 3WXMB 2O9VA 3A98A 4TVRA 2WSEE 2ED1A 2EBPA 1WA7A 2HKQB 2QAZA 5KYUB 3CCEA 1VQKQ 3FLGA 4ELYC 5GAN7 1QP2A 4MDWA 2DVEA 2DD4A 3NPFA 3OQ5A 4FM4B 2KRSA 2V8KA 1WI7A 4FIBA 5GAMe 1X6OA 1K9MC 1VIEA 1K9MR 1PSEA 1IREB 2BZ8A 4OMMA 4LD6A 1R0BG 4C5GA 5GAN8 3L2WA 2QGFB 1VQ6T 4K11A 2FZCB 1H3ZA 5KYXB 2EGEA 2QYZA 2L0AA 2XDBA 3JB9D 1BU1A 2J05A 2EJ9A 1VQ5A 4OB2B 3ZL7C 3S3OA 2JJ9A 1H641 4C0DC 4XAXB 5LJ3h 3QDRB 3PT9A 1VQOQ 5FU6B 2NUPB 3OYLA 4J9GA 2DKGA 1QP3A 3GPLA 1K0XA 4C92B 4MMKA 2HQHA 4BDZA 1M2VB 2P0KA 1VQKT 2QQ9A 3OSSC 4KULA 8ATCB 2HSPA 3KUFA 2JUFA 3SFMA 1TOVA 2HKNA 1QCOA 4FW1A 4ZTFA 1WNLA 2VKNA 2JMAA 2O4XB 1T3LA 1AZGB 3L42A 1O75A 1U5SA 2RJFA 2NWMA 3BE3A 4J9EA 1NEBA 3UT1A 3VS2A 4C92F 3QYGB 1E6GA 4A53A 1JXOA 1UGQB 1YP5A 3L2VA 3CCMT 2GTJA 1YHQQ 1V29B 3MEUA 4C8QF 4OMFB 2K5FA 4HCZA 2EQUA 2DERA 3TU4K 3M0UA 3BDUA 1M2OA 5A0LA 3VS4A 3RDVA 4E6RA 1S72A 1BK2A 2DF6A 2XI9A 3ULRB 5IN1A 2CT4A 2C06A 3CC7A 4FSSA 4BB7A 3M0SA 2YUNA 2DBKA 1AZEA 4E7LA 4OB1B 3ER0A 3UATA 4OMLA 2XHCA 2QXFA 3FRNA 4Y92A 1X2QA 1QKWA 4X34A 4M4ZA 4FU6A 1G3WA 4JRQA 4C5IA 4M78F 2HL3A 5HCKA 4E7JA 5KCOA 4J9HA 2DNUA 1JRIA 4J9CA 4DBHA 3CCQA 4M7AF 2KYBA 2RK1A 2KY9A 5I2MA 3REAB 2COZA 2F1LA 2RQRA 2VVKA 2MWPA 2PTKA 1OQKA 4RCBA 4M77D 3QO3A 2LCSA 4MDXA 4DOWA 4A4GA 5CKDA 3V7RA 1NJIR 2VGMA 2MMPA 1RAHB 1CKAA 2XKOC 1H3HA 3CCJQ 4QW2A 1MNDA 2K57A 2X35A 2DZCA 1VUBA 3X25B 3EG1A 3MHXA 1SHGA 1QVFA 1WLPB 2BIVA 3H0FA 1LCKA 2KMTA 1HSQA 2EYXA 1K1ZA 2E65A 4OGCA 1WXUA 3R6NA 3QHSA 4RTWA 1TXQA 2J06A 3JCMJ 4M75F 1FMKA 3CD6T 1KC8R 3I55A 4J6XA 4F7UA 3OA6A 4KGVB 3CCQQ 3G7ZA 1BB9A 3EH2A 3CCJT 4C92A 1G83A 5M9OA 5FWCA 3PIOA 2X9HA 4C8QC 2DETA 1NPRA 3QJ6A 4AFSC 3EFSA 2DL8A 1VQNQ 4PLLA 4MZMA 4RTVA 2RI5A 1YFNA 4PL6A 3CCET 2IG0A 1TUGB 2OTJA 1YHQT 1OU9A 1KQSA 4KUDK 1BIBA 2O01E 1D1AA 5GMKm 2E70A 1AOJA 3TCJA 2EW3A 5FW9A 2WACA 4AFUC 1Y57A 2KRMA 5KYXA 2JW4A 2Y4XA 2EKHA 2AZVA 4C5HA 1SG5A 4A4KA 1FX7A 1NJIU 1K76A 1Y7XA 1WZOA 2EYZA 3M55A 2FRYA 5CKEA 4ZGEB 2ZGWA 3M0RA 1S72Q 4M7AD 1WJRA 2HQXA 3GP8A 3MEAA 1K9AA 4GY5A 1C1AA 4C0FA 4BE1A 3A8LB 1JO8A 1V1CA 1N5ZA 2DJQA 4FL6A 4LD9K 1NG2A 1EX4A 1KJWA 2DJZA 2EFIA 2DL4A 3E9GA 2AKLA 3L2QA 2BE9B 4ZGJB 5CR2A 3RMSA 5DM7R 3OS5A 1K0SA 4EMGA 1OYXA 2ESWA 2YRVA 4PKCC 2X51A 4A4HA 3OMGA 3HTRA 1VYTA 2CREA 5KYUA 2LCLA 4HVWA 2RB6A 1FXXA 4F04B 1RL2A 1IRXA 2Y4YA 3OW2S 4M78B 1TU0B 3N5BB 1YJ9T 3PMIA 1Q86R 2JNGA 2A28A 3CPWP 3JCMP 2HSEB 2LJ1A 3RMQA 2CZ7B 3NMZC 3INZA 4RCCA 3SWNB 5CKHA 5IHIA 3GLXA 1R8OB 1WGSA 3PTAA 2VXEA 2QEXA 1V76A 1I1JA 3JCMV 3VKIA 3HRTA 3E1SA 4PFPA 1HD3A 2FVUA 4RG2A 3UWNA 3L2RA 3QBYA 2QASA 3CBPA 4M7DC 3EGXA 1MHNA 4PLIA 2KT1A 2RM4A 1H8KA 4ESRA 1QKXA 2RNAA 1KIKA 1M2VA 1Y0MA 3C0CA 4JUVA 4HCCA 2XIDA 1D0XA 1UJ0A 1YBYA 2RQVA 3UF4A 2KK4A 1AVZC 4BI3A 1B07A 2HEQA 1VQ7T 5GAOm 4J9IA 4BY6B 2E5QA 2PVDB 5LJ3j 4B9XA 3C12A 5CIUA 3UDCA 1UE9A 3CBMA 4QQDA 1QVPA 1UFFA 1ZSZB 4J7IA 4KRTA 4RUGA 1OZ3A 2E6ZA 2DM1A 3OYHA 3OYDA 4M77E 3TEEA 3CPFA 1Q82C 1VQ4A 3TVTA 5IXBA 2RHYA 3EG2A 2G3RA 2RMOA 1VQ6Q 1ZUKA 2VB6A 2FYKA 3CMEA 4WTOB 3CMAT 3A5ZB 3C4SA 1QCNA 1SKUB 4C92E 1MNEA 2X4WA 2P84A 2DPPB 3JB9I 4XTYA 1WHMA 5J26A 1VA7A 1W2BS 3UPUA 4M75G 3TQ7P 4BE2A 1G5VA 1U1SA 1LNXA 1N9RA 4JS5A 1X75C 3LH0A 2O88A 1VQPT 1VQMA 1CKBA 2HBPA 1YWOA 3VS0A 1PHTA 4IKFA 1T3SA 3SWNC 2EAYA 3J80E 1AT1B 4JLIA 1JXMA 2L3RA 4Z88A 1PSFA 3FB9A 1N9SA 2E64A 1Q7YU 4EDUA 5GAN4 1WHJA 2L2PA 3CXCA 3U23A 2GQVA 3VUBA 5GMKl 1M27C 2DBMA 1UTIA 4JLGA 3V8LA 4AG1C 4AT1B 4M75B 4E47A 4KBMB 4ORZA 4Y28E 5GAMh 2DMOA 1EIFA 5GAMg 3MEVA 1M90C 3R6OA 2HQEA 3A8MB 4XU1A 2LQKA 1SRLA 5IHKA 1TWBA 2K5LA 1RACB 2YXYA 1WX6A 4C92C 5LL6S 2RQWA 1Q81R 1RI0A 2P4TA 3RUXA 4EMKA 4R55A 3CPWA 4OMNA 2LVMA 3CMAA 3CMET 4M75E 4BE0A 1T0JA 1WQ7A 2RHXA 3H0HA 5DLOA 2EIFA 5J39A 4M78A 3X26B 3HRUA 5LJ3e 5FWBA 1QVGS 1I5LA 4MZPA 2X3WD 2A08A 2MAMA 4ZNXA 4PJNA 2HZYA 3QKJA 4DBRA 1EFNA 2JVVA 1GL5A 4HXJA 3BFMA 5GMKi 2KSSA 1NJIC 3FEOA 2P0PA 2XU8A 4OB0B 1BYMA 2QQAA 2NLUA 1K4US 3META 3O5ZA 5CCAA 4UC4A 3DLLA 1KC8C 4N0AA 3LH5A 1KQ2A 1LPLA 3A8GB 2OAWA 5KE3A 2M0OA 1TUDA 2KT8A 4FT2A 3V7SA 2FRWA 4DEYA 1JEGA 4J6YA 1M1GA 2ZZDA 4MZTA 1U1TA 2Z0WA 2KYMA 2QEXQ 4FYXB 1SHFA 2EGAA 2FO0A 4L6V5 4ZTJA 1RLPC 4CC2A 1YI2A 2L3SA 1TS9A 3M4YA 4EMHA 3OYAA 4VUBA 1IO6A 4N0AC 2M51A
chains in the Genus database with same CATH topology
2EQMA 3FRNA 4M7AA 3BDLA 5FLXE 2MI6A 3H8ZA 4M7DE 2RHIA 3OS0A 4X34A 3JCMh 4HA8A 4FU6A 1G3WA 4JRQA 5LJ3g 4M7DF 5EG2A 2JOYA 2LX9A 4C5IA 4IUVA 1G3YA 3HKSA 3OSVA 3JB9F 3I56T 4M78F 3OBWA 2WSFE 4IUTA 4E7JA 3G71A 5C6SA 3MP8A 1KHCA 5D6YA 1BIAA 2CYZB 5FU7C 5KCOA 4M7AB 3OYKA 3G4ST 2YLCA 4E7HA 2KAFA 2X4XA 1JRIA 1LJOA 4O6JA 5LJ5g 1I81A 2XDDA 1K73C 1VQ5T 2I2LA 3QPHA 1VQPA 4J83A 3VUZA 4XTVA 3CCQA 2XD0A 4M7AF 2RK1A 1KQSS 1D3BB 1I4K1 4C8QA 1YITA 1VQLT 1SSFA 2KY9A 1YJWT 5I2MA 4Y91A 3C94A 1UGRB 2LQ8A 3OYFA 2DXUA 3DLMA 3OY9A 4MMLA 2ZPIB 3M9QA 2MWPA 1U8RA 4RCBA 2DO3A 3MP6A 4M7AG 4M77D 2CZ0B 3F70A 4HCBA 3G4SA 4D6WA 2JTMA 2LCCA 3M57A 3QO3A 4MDXA 3G6EA 3BY7A 1B34B 4A4GA 3PGGA 4XQ3A 3V7RA 4DOWA 5CKDA 3PIPA 2QA4T 1XQHA 3RESA 2MWOA 3JCMe 2L89A 2GFUA 2AHJB 2MMPA 2VGMA 1Y96A 3LW5E 4RMOA 3CCLT 2XKOC 3JAME 2E1HA 3ASKA 3GNGA 4BY6C 2RA2A 4F7UG 3OS2A 3OYEA 3OBYA 4QW2A 1N27A 2K57A 2VYTA 2X35A 3MCAB 3WVEB 2DZCA 3M54A 4M78G 1VUBA 4PJOB 5L8RE 3X25B 5HY6A 3S3NA 3MHXA 1QVFA 4XTUA 3CC4T 2PQWA 2PVOB 4DA4A 2BIVA 5D6XA 2K3XA 2LTOA 3NTKA 1KHIA 2OTLT 2E6NA 2KMTA 1KC8U 3OYMA 2E10A 2E65A 1YHQA 4OGCA 1VQ7A 4M7AC 3NTIA 3CCLA 3QHSA 4C8QD 2KQWA 4B9WA 1K73U 4CI0C 3ZBDA 4JRIA 3JCMJ 1UB4A 1M1KC 4M75F 3CD6T 4JDSA 4OB3B 5KH6A 4XK8E 2RD1A 3I55A 3MEWA 1G3TA 1HK9A 3L2ZA 4J6XA 2DXTA 4IUUA 4F7UA 3OA6A 1Y07A 2QEXT 3X28B 2FL7A 4ZGDB 3CXCS 3A8OB 3EFRA 1VQKA 1VIFA 1BI2A 4Z02A 3G7ZA 4QVZA 4C8QB 3ZEHA 5FU7B 5LJ3f 2A3LA 3QYHB 2LT4A 3V8KA 2VV5A 3CCJT 1HXDA 4DOVA 4C92A 5M9OA 3PIOA 5GAOr 4JS4A 2ZPGB 2DEQA 4F7UB 2DTOA 2GCXA 2R58A 4J5YA 4LDVA 4PNOA 4C8QC 1NPRA 3QJ6A 3JSCA 4EPCA 4LDWA 4NOYA 3P8HA 5GANg 3EFSA 2E12A 2RHUA 4PLLA 2XDPA 3RERA 4NL3A 4MZMA 3M58A 2RI5A 4M78E 5KCHA 5LJ3d 2ZPHB 4PL6A 3CCET 2IG0A 2PUKB 5GAOn 2OTJA 2QQRA 2B8AA 1YHQT 4KT0E 4L5GA 4ZN1A 1KQSA 2DZ9A 4QQGA 3VJPA 2VC8A 1ZBXA 3CCVA 4KUDK 1Q81C 1BIBA 1LOJA 2O01E 5C0MA 5GMKm 1NE8A 2E70A 2K5IA 3TCJA 1YJNT 2WACA 4M75C 4BI4A 3OYYA 2VXFA 3KXTA 5LJ5h 1M90U 4OF1A 3T9NA 3OYCA 3G6ET 5GAOp 4X9DA 2M16A 1VQ8A 2EQKA 1M9SA 2RH2A 1WPYA 1G3SA 2Y4XA 2RO0A 4OGEA 1M4ZA 2CKKA 1M5Q1 4A4EA 4C5HA 3V7CA 4A4KA 1FX7A 2R5MA 1NJIU 3QSUA 1Y7XA 3M55A 4F7UF 3SWNA 5CVIA 5CQYA 4XU3A 5FU6C 5CKEA 3DB3A 4ZGEB 2ZGWA 3JCMQ 4PJOD 1QW1A 1YJNA 5I2SA 2X4YA 1NPPA 4BUGA 3BW1A 4HT8A 4M7AD 1WJRA 2HQXA 4CRIA 3GP8A 3SDZA 5GANd 3MEAA 4NS5A 5A2QE 2E41A 4FT4A 3NTHA 4M75A 2X4JA 4GY5A 4C0FA 5GANh 4BE1A 2DK3A 2XICA 2CS7A 3A8LB 4XTZA 5GMKj 2K3YA 3GF5A 5GAN5 2JN0A 2P0QA 5IT9E 4ATOA 2K2VA 2VUBA 4M77F 3SB2A 4FL6A 4LD9K 3JCMc 3DB4A 3E9FA 3QJYA 1Y96B 4M7DA 2DJZA 3M59A 1QVGA 1VQOT 2DXCA 2EFIA 3E9GA 3URGA 3OYGA 3L2QA 2FB7A 4ZGJB 2QDYB 5CR2A 4JRPA 5GANj 3RMSA 5DM7R 3OS5A 1YJ9A 3PFSA 5CO7A 1KD1U 4L59A 4EMGA 1OYXA 2YRVA 4PKCC 5FRMA 3CC7T 4A4HA 3OMGA 2KVQG 2V8IA 3HL8A 2OTJT 4M77C 4BI8B 2ZPFB 2LCLA 3HP9A 2RB6A 1VQ6A 1FXXA 3QG1A 1RL2A 4ME7A 4C5EA 1Q86U 2HD0A 1DJ7B 5CKFA 3JB9G 2Y4YA 2RI2A 3OW2S 5HKCA 1VQOA 2O4XA 4M78B 1FWZA 4ELZC 5GAOq 2CGHA 3N5BB 2YHTA 4WF2A 5CAIA 4LDYA 5KE2A 5GAOl 4P5NA 1YJ9T 3PMIA 4PJOA 2EJFA 5LJ5e 3CC4A 2JNGA 3AHUA 4HKEA 3JCMP 1X01A 2OAUA 3HHTB 3QXEB 5CK9A 3LWIA 1VQLA 2DAQA 3RMQA 2CZ7B 4F7UE 3INZA 5CKBA 2JTFA 3HFNA 3QZ5B 4RCCA 3SWNB 5CKHA 5FRNA 1Q82U 1UGPB 3OYJA 3CCRT 2DIGA 2YLBA 5I21A 2RJDA 3GLXA 3QIIA 2MF2A 5LJ5j 2Y90A 4N0AC 3QZ9B 1R8OB 1WGSA 3PTAA 4M7DD 4IUQA 3G71T 3OYIA 3HPWA 2PVGB 2RI3A 2VXEA 3Q1JA 3GNFB 4M77G 3LWHA 4RKUE 5A0GA 2QEXA 2QA4A 4M78D 4IURA 2L8DA 3JCMV 3VKIA 3HRTA 3E1SA 2FVUA 2R57A 4RG2A 3JCMd 3UWNA 3LYIA 3L2RA 1N8RU 2QTXA 3QBYA 3CBPA 4XTWA 4M7DC 1OZ2A 1KG1A 1MHNA 4N4GA 3MP1A 4PLIA 2QQBA 3LLRA 4O5VA 2QQSA 1D3BA 2DTHA 2RM4A 3P8DA 4II1A 3OW2A 1K9MU 4M78C 1JJ2A 1WJQA 1JBMA 4C0ZA 3CD6A 1JJ2S 5D6WA 4X9CA 4QVDA 1BI1A 3RKXA 4JUVA 3OS1A 4HCCA 2XIDA 3RIRA 1YBYA 5GAN6 5GMKh 2KK4A 4XU2A 1Y71A 2CZ6B 1XTDA 3LGFA 3GOXA 4XTXA 2R5AA 4BI3A 1VQMT 3L1AA 1VQ7T 4V2SA 1KD1C 2F5TX 5GAOm 1VQ4T 4BY6B 2E5QA 2PVDB 5LJ3j 4B9XA 4PJOC 3CCVT 1Q7YC 3C12A 2D0QB 3TREA 4C0GA 5CIUA 3UDCA 3CCSA 1YIJA 4C92D 3CBMA 1AHJB 3DKMA 4C0DB 4QQDA 1BI0A 5GAMf 1KQ1A 1QVPA 3JRZA 3CCUT 1VQ9T 2FHDA 3MO8A 4J7IA 1OZ3A 2EQJA 1WJSA 3CEYA 3PMTA 3SD4A 3X24B 2E6ZA 3EAEA 5GANe 1K8AU 3VYGA 4KUIA 5LJ5f 3OYHA 3OYDA 3VU3C 3VV0A 3LX7A 4M77E 4N4HA 3TEEA 3CPFA 3JCMb 1Q82C 3S3MA 1VQ4A 4PJOF 2RHZA 5J3BA 2D9TA 2KDSA 1YI2T 2DTIA 2RJEA 1K8AC 1P92A 5LJ5d 2LRQA 2RHYA 3CCRA 3JCMW 1S72T 2G3RA 2HNIA 3I56A 3WXMB 5GAMd 4C8QE 3FC3A 4TVRA 2FYKA 2WSEE 3CC2T 3HRSA 3CCUA 1VQ9A 3CMEA 3CMAT 1BKBA 3A5ZB 2HAXA 1W2BA 4LDUA 1BI3A 1VQ8T 3CCEA 2RJCA 3C4SA 1GXIE 2H3JA 3FLGA 4ELYC 4ZN3A 5GAN7 4C92E 1QP2A 4MDWA 2DVEA 2X4WA 2ZCFB 3GIBA 2DPPB 2DD4A 3JB9I 4XTYA 3OQ5A 2EYQA 4FM4B 3PNWC 4BACA 5J26A 2V8KA 2LC4A 4FIBA 1W2BS 5A0DA 4M75G 3UPUA 3M56A 5GAMe 4BE2A 1X6OA 1G5VA 1U1SA 1LNXA 1N9RA 4N4IA 1K9MC 1VIEA 4BDYA 1I8FA 4JS5A 4QVCA 1X75C 3LH0A 3M4GA 2LNVA 1OI1A 1PSEA 5IAYA 5CQXA 1VQPT 4A4FA 1XOVA 2M1HA 1IREB 1VQMA 5DY9A 2OTLA 3P8BB 4LD6A 4C5GA 2VGNA 2HBPA 4M75D 5HK3A 5GAN8 1B34A 3L2WA 1YJWA 1N8RC 1VQ6T 4PJOE 4IKFA 1H3ZA 3SWNC 1IZ6A 2EAYA 3J80E 4JLIA 3M53A 4HT9A 2L3RA 4J7FA 4M77A 3RKYA 1PSFA 3FB9A 5FROA 3CPWS 1N9SA 2M9UA 3H6ZA 3O8VA 2E64A 2XDBA 1Q7YU 4EDUA 5GAN4 3JB9D 5GAMj 3FIFA 1ZQ1A 3CXCA 4FSXA 3WVDB 2EJ9A 4OVAA 4E7KA 3C95A 2GQVA 3VUBA 3FDRA 1VQ5A 4OB2B 5GMKl 3S3OA 2EWNA 1H641 5GMKe 2JZ2A 2DD5A 4XAXB 4JLGA 5LJ3h 3V8LA 4C0DC 2WSCE 4EMKB 3VYHB 3L2UA 4M75B 3JCMg 4E47A 2IVWA 1YCYA 3OB9A 3PT9A 3QDRB 5FU6B 3CCMA 4KBMB 3OYLA 2K4YA 3JB9H 1O9SA 4NL2A 4Y28E 5GAMh 3CC2A 4BD3A 1EIFA 2DKGA 4RG8A 1QP3A 5GAMg 3GPLA 3MEVA 4J8OA 2XK0A 2QI2A 1M90C 3R6OA 4JRKA 4MMKA 2HQEA 3A8MB 4C92B 1ZHIA 4XU1A 1WQWA 2A7YA 4BDZA 2BUDA 2LQKA 3M5AA 2P0KA 1VQKT 2ZPEB 1Q81U 1QVFS 2K5LA 2QQ9A 4Q5WA 3JB9J 4XU0A 1N6AA 4C92C 1W4SA 3OSSC 4KULA 5LL6S 2BKDN 3KUFA 2JUFA 3SFMA 5DLQE 3HFOA 3OMCA 1RI0A 2P4TA 3RUXA 4EMKA 4R55A 3CPWA 5AYFA 4DQ2A 4M77B 2F5KA 2GF7A 4M7DG 2LVMA 1UEBA 3CMAA 2ZPBB 4M75E 3CMET 1WQ7A 4QQ6A 4YTLA 4BE0A 2RHXA 3QUIA 4OP0A 5DLOA 2EIFA 4ZTFA 1WNLA 5J39A 3J7AF 2O4XB 4M78A 3X26B 2DIQA 3HRUA 5LJ3e 3L42A 1QVGS 1I5LA 4MZPA 2PU9B 1O75A 2RJFA 3UT1A 4C92F 3JCMX 4LDXA 1VQNA 2DXBA 2MAMA 3X20B 3QYGB 4A54A 4A53A 1UGQB 1JB0E 3LGLA 4IUPA 5HK0A 5GAN3 3L2VA 3QKJA 3CCMT 4C8QG 3CCST 1YIJT 2EKOA 2EJGA 5GANf 1V29B 3MEUA 3I55T 2RK2A 3A8HB 4OMFB 2JVVA 4C8QF 4R56A 2F69A 1M1FA 5GAN2 1Q86C 2K5FA 3CBOA 2EQUA 4HCZA 3TU4K 3BFMA 4C92G 5GMKi 3FJPA 2KSSA 1NJIC 3BDUA 3E19A 3OYNA 3FEOA 2P0PA 2XU8A 5A0LA 2D6FA 1M1KU 4OB0B 1VQNT 1BYMA 2QQAA 1YITT 2NLUA 3HSBA 3META 3CCJA 4JJNK 4E7IA 5CCAA 4UC4A 3DLLA 1M8VA 1S72A 4PJOG 1KC8C 4N0AA 1TH7A 4J6WA 4EMKC 1KQ2A 2XI9A 3A8GB 5KE3A 2M0OA 2LDMA 4FT2A 3V7SA 4GLKA 5IN1A 3OYBA 2XG8D 2L5QA 3S6WA 3J81E 4J6YA 2LT1A 1M1GA 2C06A 2ZZDA 3CCQT 3CC7A 4MZTA 2PUOB 1U1TA 4BB7A 1UGSB 3JCMf 1MGQA 2V8JA 3V8JA 4M7AE 4E7LA 1XNIA 4L6V5 4ZTJA 3NFCA 1YI2A 3ZFJA 4OB1B 3ER0A 3RKWA 2CZ1B 2GFAA 3ME9A 1NZ9A 3KBGA 3M4YA 4EMHA 3OYAA 4VUBA 2XHCA 4M7DB 2QXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXE A;  4M77 G;  3JB9 D;  5GAM j;  3FIF A;  4M78 D;  4NL3 A;  3RER A;  3JCM V;  2EJ9 A;  4M7A A;  4M78 E;  5LJ3 d;  5GMK l;  3JCM d;  2EWN A;  1H64 1;  5GMK e;  2QTX A;  4EMK B;  4M7D E;  5LJ3 h;  3JCM h;  3V8L A;  4HA8 A;  4XTW A;  5GAO n;  4M7D C;  4M75 B;  4M7D F;  3JCM g;  5LJ3 g;  1YCY A;  1D3B A;  2DTH A;  2DZ9 A;  2RM4 A;  3JB9 F;  2VC8 A;  3JB9 H;  4M78 F;  1BIB A;  1LOJ A;  4NL2 A;  4M78 C;  5GMK m;  5GAM h;  5GAO p;  1JBM A;  2DKG A;  4M75 C;  5GAM g;  4X9C A;  1BIA A;  2VXF A;  4QVD A;  4M7A B;  3RKX A;  4JUV A;  2YLC A;  5LJ5 h;  3RIR A;  5GAN 6;  4JRK A;  1JRI A;  1LJO A;  4MMK A;  4X9D A;  1I81 A;  4XU2 A;  1WQW A;  4XU1 A;  4C92 B;  5GMK h;  5LJ5 g;  2I2L A;  4XTX A;  1WPY A;  4XTV A;  4M7A F;  3L1A A;  1D3B B;  1I4K 1;  1M5Q 1;  4C8Q A;  3V7C A;  3JB9 J;  4V2S A;  4XU0 A;  5GAO m;  3QSU A;  4Y91 A;  4C92 C;  5LJ3 j;  4PJO C;  4F7U F;  3SWN A;  2DXU A;  4XU3 A;  4MML A;  2ZGW A;  3HFO A;  3JCM Q;  4RCB A;  4C92 D;  4EMK A;  3RUX A;  4PJO D;  4M7A G;  4M77 D;  3BW1 A;  4HT8 A;  4DQ2 A;  4M7A D;  3QO3 A;  4M77 B;  5GAM f;  1KQ1 A;  5GAN d;  4M7D G;  4M75 E;  3BY7 A;  1B34 B;  1WQ7 A;  2E41 A;  3PGG A;  4XQ3 A;  3QUI A;  4M75 A;  4OP0 A;  3V7R A;  5GAN e;  1WNL A;  5LJ5 f;  3RES A;  5GAN h;  4M78 A;  3VU3 C;  5LJ3 e;  4XTZ A;  4M77 E;  5GMK j;  3JCM e;  1I5L A;  5GAN 5;  2JN0 A;  3JCM b;  1Y96 A;  4C92 F;  4PJO F;  3JCM X;  4M77 F;  4A54 A;  3SB2 A;  2DTI A;  4A53 A;  2E1H A;  3JCM c;  5LJ5 d;  5GAN 3;  2RA2 A;  4F7U G;  1Y96 B;  3JCM W;  4M7D A;  4C8Q G;  2DJZ A;  2HNI A;  2K57 A;  2EJG A;  5GAM d;  4C8Q E;  2DZC A;  5GAN f;  2FB7 A;  2FYK A;  4M78 G;  4C8Q F;  4PJO B;  5GAN j;  5GAN 2;  4XTU A;  4EMG A;  3BFM A;  4C92 G;  5GMK i;  3FJP A;  3BDU A;  5GAN 7;  4C92 E;  4M77 C;  2E10 A;  2DVE A;  5CAI A;  2E65 A;  2RB6 A;  3GIB A;  4M7D B;  4M7A C;  3QHS A;  3HSB A;  4C8Q D;  3JB9 I;  4XTY A;  3JB9 G;  1M8V A;  4JRI A;  3JCM J;  4PJO G;  4M75 F;  4N0A A;  4M78 B;  1TH7 A;  4J6W A;  4EMK C;  1KQ2 A;  4M75 G;  5GAO q;  5GAM e;  2CGH A;  2RD1 A;  2YHT A;  4WF2 A;  1U1S A;  1LNX A;  1HK9 A;  1N9R A;  3L2Z A;  4J6X A;  2DXT A;  4F7U A;  5GAO l;  1I8F A;  3V7S A;  4QVC A;  4PJO A;  2EJF A;  3M4G A;  5LJ5 e;  3AHU A;  4J6Y A;  3EFR A;  3JCM P;  1U1T A;  5DY9 A;  1X01 A;  4M75 D;  4C8Q B;  4F7U E;  5GAN 8;  1B34 A;  1MGQ A;  5LJ3 f;  3JCM f;  3V8K A;  3INZ A;  4PJO E;  3V8J A;  4M7A E;  3HFN A;  1HXD A;  4RCC A;  3SWN C;  3SWN B;  2EAY A;  4C92 A;  4JLI A;  5GAO r;  4HT9 A;  3RKY A;  2DEQ A;  4M77 A;  3RKW A;  2YLB A;  4F7U B;  2DTO A;  3FB9 A;  5I21 A;  4J5Y A;  4PNO A;  4C8Q C;  4EMH A;  5LJ5 j;  2Y90 A;  4M7D D;  1N9S A;  5GAN g;  4NOY A;  2E64 A;  3EFS A;  5GAN 4;  4N0A C; 
#chains in the Genus database with same CATH topology
 2EGC A;  4M7A A;  3CC4 Q;  2MI6 A;  3I9Q A;  3JCM h;  3NGP A;  1F1B B;  3CCL Q;  2ZAE A;  3M0P A;  5I11 A;  5KYW B;  2CYZ B;  4M7A B;  2YLC A;  1IGU A;  4J9F A;  5LJ5 g;  2P4R A;  2XDD A;  1NM7 A;  1WDX A;  1I4K 1;  4R0K A;  1FYN A;  1FMV A;  1MV0 B;  1X43 A;  1UGR B;  3OYF A;  3TSZ A;  3DLM A;  3OY9 A;  3RBB B;  3EGD B;  1U8R A;  4QT7 A;  1RAA B;  3F70 A;  3CCM Q;  4D6W A;  2JTM A;  3M57 A;  3G6E A;  3BY7 A;  3PIP A;  1XQH A;  3RES A;  2L89 A;  2GFU A;  3G4S Q;  2KEA A;  4BY6 C;  4F7U G;  3OBY A;  2VYT A;  4PJO B;  2E3H A;  3S3N A;  1VQP Q;  1NYG A;  2PQW A;  2PVO B;  5I22 A;  1TG0 A;  5KYW A;  4LUD A;  3OYM A;  3G71 Q;  1VQ7 A;  2KQW A;  4JZ3 A;  1UB4 A;  1M1K C;  2NUT A;  2RD1 A;  3MEW A;  1HK9 A;  3L2Z A;  5L23 A;  1Y07 A;  2FL7 A;  4ZGD B;  3A8O B;  3EFR A;  1A0N B;  4A63 B;  3KFV A;  4QVZ A;  4C8Q B;  2LJ0 A;  5FU7 B;  2A3L A;  1W70 A;  1HXD A;  4DOV A;  5GAO r;  2ZPG B;  1SPK A;  2GCX A;  4J5Y A;  4LDV A;  4PNO A;  1YIT Q;  2FPE A;  3JSC A;  4LDW A;  5IXF A;  1PD1 A;  1I07 A;  2M02 A;  2DE0 X;  3RER A;  3M58 A;  2B86 A;  1IXD A;  1T0H A;  1PG5 B;  4M78 E;  5KCH A;  2DVJ A;  4GLM A;  1BBZ A;  5GAO n;  3I55 Q;  1CSK A;  1ZX6 A;  1PKT A;  2RQT A;  4L5G A;  4ZN1 A;  1C6V X;  3VJP A;  3CCV A;  2VC8 A;  3RNJ A;  1NE8 A;  1VQ5 Q;  1M90 U;  4F16 A;  3G6E T;  5GAO p;  1VQ8 A;  2EQK A;  2RH2 A;  4OGE A;  2CKK A;  2YRD A;  2R5M A;  2K6D A;  2LQN A;  5CQY A;  1WHK A;  2JT4 A;  1ZA1 B;  2PNI A;  4PJO D;  1QW1 A;  1MMN A;  5I2S A;  4BUG A;  3BW1 A;  3PE0 A;  3SDZ A;  1TSF A;  4OMO A;  5GAN d;  2NUZ A;  5GAN h;  2HDA A;  2KGT A;  2CS7 A;  4XTZ A;  3GF5 A;  1RI9 A;  2PZ1 A;  3SB2 A;  1VQ9 Q;  4DBF A;  1WYX A;  2ECZ A;  3VRZ A;  2DXC A;  5GJW B;  2C0T A;  3URG A;  2LZ6 B;  3CCE Q;  1YJ9 A;  3PFS A;  2O9S A;  5CO7 A;  1YJW Q;  2W0Z A;  4DEX A;  1VQM Q;  1W1F A;  2OTJ T;  1QWF A;  4M77 C;  4BI8 B;  2ZPF B;  3HP9 A;  1VQ6 A;  3QG1 A;  4ME7 A;  3IQL A;  1DJ7 B;  5CKF A;  3PVL A;  2O4X A;  5GAO q;  4LXC A;  1D1B A;  2IIM A;  2YHT A;  2ATC B;  5KE2 A;  4P5N A;  1VYV A;  2EJF A;  5LJ5 e;  3CC4 A;  3AHU A;  1X01 A;  3HHT B;  1VQL A;  4KGZ B;  5CKB A;  5FRN A;  3TSW A;  4IIO A;  3OYJ A;  2RJD A;  3QII A;  3QZ9 B;  4IUQ A;  3G71 T;  3OYI A;  3LWH A;  3Q1J A;  3GNF B;  5A0G A;  4IUR A;  2QTX A;  2NUP A;  3CC2 Q;  1KG1 A;  1B3Q A;  4N4G A;  3MP1 A;  3LLR A;  1D3B A;  2DLP A;  4C0Z A;  1JBM A;  3CD6 A;  1JJ2 S;  4X9C A;  3QWX X;  2CH4 W;  3RIR A;  2KRN A;  5GMK h;  4XU2 A;  2CZ6 B;  8AT1 B;  1AEY A;  4V2S A;  2F5T X;  1VQ4 T;  2D0N A;  4IIM A;  3TRE A;  2D0Q B;  4QKU A;  3EG9 A;  4C92 D;  3CCV Q;  4C0D B;  2A36 A;  2L3Q A;  2FHD A;  2EQJ A;  3SD4 A;  1WJS A;  3THK A;  2SRC A;  4KUI A;  2MIO A;  1GCQ C;  2YRC A;  3JCM b;  4PJO F;  2RHZ A;  1ZSZ C;  2KDS A;  1P92 A;  5LJ5 d;  1S72 T;  3CC2 T;  3CCU A;  2J6O A;  2HAX A;  4LDU A;  1HYO A;  2RJC A;  4FYV B;  2ZCF B;  3GIB A;  1UG1 A;  2EYQ A;  4HVU A;  1YJN Q;  2EQI A;  2VWF A;  2HCK A;  1SSH A;  4N4I A;  1W2B P;  4QVC A;  1BCO A;  2LNV A;  5IAY A;  1SEM A;  1D0Y A;  5DY9 A;  2SEM A;  3P8B B;  5HK3 A;  2VGN A;  4M75 D;  1B34 A;  2QG9 B;  1YJW A;  2G6F X;  2MYS A;  2LNH B;  4PJO E;  2H8H A;  1IZ6 A;  4FYY B;  1OOT A;  1WXB A;  1R0C B;  2QK0 A;  5FRO A;  3H6Z A;  1M90 R;  1PC0 A;  2CP0 A;  1ZQ1 A;  4FSX A;  3WVD B;  4OVA A;  1LVK A;  1IHV A;  2JZ2 A;  2WSC E;  3L2U A;  3VYH B;  2MOX A;  2IVW A;  1YCY A;  3CCM A;  1AWO A;  3EH1 A;  3JB9 H;  4NL2 A;  4D8D A;  4WCI A;  4RG8 A;  3JV3 A;  2XK0 A;  4J8O A;  1YWP A;  1KD1 R;  4JRK A;  2A7Y A;  3M5A A;  2ZPE B;  1VQ8 Q;  4B6M A;  2HMA A;  4Q5W A;  1W4S A;  2BKD N;  5DLQ E;  3OMC A;  4DQ2 A;  2E4H A;  2ROT A;  2E3I A;  2GF7 A;  4M7D G;  1IHW A;  4QQ6 A;  4YTL A;  4OP0 A;  1AWJ A;  2DIQ A;  1Q95 G;  2PU9 B;  2DXB A;  3X20 B;  2V1R A;  2GGR A;  2K79 A;  2V26 A;  1MMD A;  4IUP A;  3CCS T;  1YIJ T;  4C8Q G;  2DL7 A;  2EKO A;  2EJG A;  2O31 A;  3D7S B;  3I55 T;  2RK2 A;  2ABL A;  2F69 A;  1M1F A;  3EG3 A;  5GAN 2;  2LX7 A;  4JJD A;  4LN2 A;  4C92 G;  3E19 A;  3OYN A;  2AIR B;  2HBW A;  1VQN T;  1YIT T;  3HSB A;  3CCJ A;  1M1K R;  1M8V A;  4PJO G;  2OTJ Q;  2AT1 B;  2LDM A;  2NUT B;  3VS1 A;  2AKK A;  3OYB A;  4FCY A;  3S6W A;  1UJY A;  3J81 E;  2LT1 A;  3CCQ T;  3M0T A;  1UGS B;  2DYI A;  1WHG A;  3JCM f;  2DRM A;  4CC4 B;  2D1X A;  3NFC A;  2CZ1 B;  2JS0 A;  1IB8 A;  1NZ9 A;  3KBG A;  4FW2 A;  2KBT A;  1ABO A;  2ROL A;  1QQJ A;  1RAG B;  3EHQ A;  1OEB A;  3H8Z A;  4M7D E;  2RHI A;  3OS0 A;  3CMA Q;  2J7I A;  1QWE A;  2LX9 A;  1WXT A;  3JB9 F;  2IPO B;  3I56 T;  1QMC A;  2WSF E;  3UA6 A;  4IUT A;  1ZLM A;  3G71 A;  5C6S A;  5D6Y A;  1KHC A;  3OYK A;  1PKS A;  1KFZ A;  1K73 C;  1LJO A;  2MPX C;  1VQ5 T;  1VQP A;  3QPH A;  2XD0 A;  1TUC A;  1KK7 A;  4XTV A;  3VUZ A;  5KYY A;  1VQL T;  1D3B B;  2DRK A;  4C8Q A;  1SSF A;  2COY A;  9ATC B;  4Y91 A;  2M0Y A;  4LUE A;  2EYY A;  3M9Q A;  4M7A G;  3MP6 A;  4HCB A;  3G4S A;  2LCC A;  1HJD A;  1VQ7 Q;  4XQ3 A;  3JCM e;  2CH4 A;  2AHJ B;  1Y96 A;  3LW5 E;  4RMO A;  3JAM E;  2E1H A;  3OS2 A;  3OYE A;  3PVQ A;  3WVE B;  4E2F B;  2E5K A;  1RAF B;  5HY6 A;  4XTU A;  2LTO A;  2OTL T;  2E6N A;  1KC8 U;  1SRM A;  1YHQ A;  2YUP A;  2CP7 A;  3G6E Q;  4M7A C;  3NTI A;  3CCL A;  4C8Q D;  4AFZ C;  2OX7 A;  4B9W A;  1K73 U;  2RF0 A;  4JRI A;  4JDS A;  5KH6 A;  4XK8 E;  1G3T A;  2DXT A;  4IUU A;  2QEX T;  1VIF A;  1UGV A;  3ZEH A;  3V8K A;  5D7U A;  1QVF P;  4RTT A;  1E6H A;  1YI2 Q;  2DEQ A;  4JJB A;  2R58 A;  2COW A;  5GAN g;  3P8H A;  4PK4 A;  2FZG B;  2VAS A;  2XDP A;  4NL3 A;  3CC7 Q;  1G2B A;  5ECA A;  1D0Z A;  5LJ3 d;  2PUK B;  1WFW A;  2AK5 A;  2B8A A;  4KT0 E;  1ACM B;  1ZBX A;  1ZUY A;  1LOJ A;  1OPL A;  4JJC A;  4M75 C;  2L3P A;  3I5R A;  2VXF A;  4PJM A;  1ZBJ A;  1NEG A;  4OF1 A;  5IHN A;  4X9D A;  4Z8A A;  1G3S A;  2RO0 A;  2OTL Q;  1UHC A;  4E7S A;  1Q82 R;  1GCQ A;  1M5Q 1;  4A4E A;  3V7C A;  1AWX A;  4LNP A;  3QSU A;  3GBQ A;  3SWN A;  5CVI A;  4CC3 A;  4XU3 A;  2JTE A;  5FU6 C;  4PFO A;  1OPK A;  3DB3 A;  3JCM Q;  1YJN A;  5EC7 A;  4HT8 A;  2YSQ A;  3EGD A;  4CRI A;  1D1C A;  2F2V A;  4NS5 A;  3H41 A;  4FT4 A;  2FPF A;  4M75 A;  2X4J A;  1VOM A;  2DK3 A;  5GMK j;  1KSW A;  5GAN 5;  1WHH A;  2JN0 A;  4M77 F;  3CCU Q;  1Y96 B;  3EG0 A;  4AMC A;  3M59 A;  5GJV B;  4JZ4 A;  2C0O A;  4JRP A;  2KRO A;  2KVQ G;  3HL8 A;  3H9N A;  1GFD A;  4C5E A;  1M8M A;  1VYU A;  4X1V A;  1Q86 U;  3JB9 G;  3I5S A;  2LMJ A;  5HKC A;  1VQO A;  2EPD A;  1FWZ A;  4ELZ C;  4PJO A;  2EVR A;  2K7A A;  1AD5 A;  3LWI A;  3QXE B;  1AWW A;  2DAQ A;  1R77 A;  2CSQ A;  2JTF A;  3HFN A;  3QZ5 B;  3CCS Q;  1YIJ Q;  1Q82 U;  3CCR T;  2DIG A;  2YLB A;  5LJ5 j;  3CCR Q;  2CSI A;  3HPW A;  4DBQ A;  4M77 G;  2QA4 A;  4M78 D;  2DYB A;  2L8D A;  2EYW A;  1UUE A;  3JCM d;  3LYI A;  3EHR A;  1N8R U;  1OZ2 A;  1RAD B;  2QQS A;  2DTH A;  4II1 A;  3OW2 A;  4M78 C;  5D6W A;  3RKX A;  5GAN 6;  2A0F B;  4J9B A;  2QA4 Q;  3GOX A;  1GBQ A;  3LGF A;  1MMG A;  1OX8 A;  3VS6 A;  4PJO C;  1Q7Y C;  2GQI A;  3DKM A;  1BI0 A;  5GAM f;  3JRZ A;  1KQ1 A;  1QLY A;  2DL5 A;  2V1Q A;  3CCU T;  1ARK A;  1KD1 C;  2CP2 A;  3PMT A;  1K8A U;  5GAN e;  3EGX B;  3MJX A;  1M3C A;  3VU3 C;  3VV0 A;  3LX7 A;  4N4H A;  2D9T A;  3CME Q;  2DTI A;  1K8A C;  3JCM W;  3I56 A;  5GAM d;  4C8Q E;  3FC3 A;  3HRS A;  1VQ9 A;  1BKB A;  4F17 A;  1W2B A;  1BI3 A;  1VQ8 T;  4EIK A;  1YCS B;  1GBR A;  1GXI E;  2H3J A;  4ZN3 A;  1PRL C;  3RR6 A;  2W10 A;  2BTT A;  1QCF A;  1OU8 A;  3PNW C;  2JXB A;  4BAC A;  1ZSZ A;  2LC4 A;  5A0D A;  3M56 A;  4HCK A;  1PRM C;  4BDY A;  1I8F A;  1XJW B;  2RPN A;  3M4G A;  1JU5 C;  1OI1 A;  5CQX A;  4A4F A;  1XOV A;  2M1H A;  2OTL A;  1ZUU A;  1N8R C;  1N8R R;  3M53 A;  4HT9 A;  2X3X D;  4J7F A;  4M77 A;  3RKY A;  3CPW S;  2M9U A;  3O8V A;  5GAM j;  3EFO B;  3FIF A;  2KNB B;  4E7K A;  3C95 A;  3FDR A;  3OW2 P;  2EWN A;  5GMK e;  5KYY B;  4EMK B;  2DD5 A;  2F2X A;  2JM8 A;  3JCM g;  3VS7 A;  3OB9 A;  2K4Y A;  2KXC A;  4KGX B;  1O9S A;  2RN8 A;  1RLQ C;  3CC2 A;  4BD3 A;  1OV3 A;  2QI2 A;  1ZHI A;  4KH0 B;  1WQW A;  2BUD A;  4F14 A;  1WIE A;  1Q81 U;  1QVF S;  3JB9 J;  4XU0 A;  3I56 Q;  1N6A A;  3QDF A;  3HFO A;  2JS2 A;  2OJ2 A;  1JJ2 P;  3CXC P;  5AYF A;  2C0I A;  3REB B;  4M77 B;  2F5K A;  1UEB A;  2ZPB B;  2QDL A;  2KR3 A;  3QUI A;  2HL5 C;  3J7A F;  1JQQ A;  1M3B A;  3JCM X;  4LDX A;  1VQN A;  4A54 A;  1JB0 E;  2CP6 A;  3LGL A;  5HK0 A;  5GAN 3;  2JMC A;  2GBQ A;  5GAN f;  3A8H B;  2FZK B;  1Q86 C;  3CBO A;  1YJ9 Q;  3FJP A;  2D6F A;  1M1K U;  2MK5 A;  1B7T A;  1SF9 A;  2MCN A;  2LP5 A;  4JJN K;  4E7I A;  2YUQ A;  2YDL A;  1TH7 A;  4J6W A;  4EMK C;  1FMW A;  4GBQ A;  4PFZ A;  1W6X A;  4GLK A;  2XG8 D;  2L5Q A;  2QTV A;  2PUO B;  4RTY A;  1MGQ A;  2V8J A;  3V8J A;  4M7A E;  1XNI A;  3ZFJ A;  3RKW A;  2GFA A;  2LJ3 A;  3ME9 A;  3NHN A;  2DA9 A;  4OMQ A;  2YWW A;  1Z9Q A;  4RTZ A;  4M7D B;  2EQM A;  1K73 R;  3E2U A;  3BDL A;  5FLX E;  1E7O A;  4HA8 A;  4M7D F;  5LJ3 g;  5EG2 A;  2JOY A;  2ENM A;  4IUV A;  1G3Y A;  3HKS A;  3OSV A;  3OBW A;  3MP8 A;  4E7H A;  3G4S T;  1BIA A;  5FU7 C;  2J6K A;  2KAF A;  2X4X A;  4O6J A;  1RAE B;  1I81 A;  3I35 A;  2KXD A;  2I2L A;  4J83 A;  1YNZ A;  4PJL A;  1KQS S;  2GNC A;  1YIT A;  1YJW T;  3C94 A;  2LQ8 A;  2DXU A;  4MML A;  2ZPI B;  5KYN A;  2DO3 A;  2CZ0 B;  4J9D A;  3G1J A;  1B34 B;  3PGG A;  2QA4 T;  1PNJ A;  2MWO A;  1U3O A;  2O2O A;  1YN8 A;  3CCL T;  1NYF A;  3ASK A;  3GNG A;  2RA2 A;  3M0Q A;  1N27 A;  3MCA B;  3M54 A;  4M78 G;  4D8K A;  2DFU A;  5L8R E;  4CC7 A;  3CC4 T;  3EGU A;  4DA4 A;  5D6X A;  2K3X A;  3NTK A;  1KHI A;  1UDL A;  1MMA A;  2E10 A;  2J6F A;  1M30 A;  4CI0 C;  3ZBD A;  3H0I A;  2H3E B;  2F2W A;  1RAB B;  2CUD A;  4OB3 B;  2LQW A;  3X28 B;  3CXC S;  4RTX A;  1VQK A;  4KH1 B;  2RQU A;  1BI2 A;  4Z02 A;  1I0C A;  3A1P A;  1ZA2 B;  5LJ3 f;  3QYH B;  2LT4 A;  2VV5 A;  2CUB A;  2K2M A;  4JS4 A;  4F7U B;  1NLP C;  2DTO A;  4R56 A;  1EZZ B;  4EPC A;  4NOY A;  1MV3 A;  2DX1 A;  2E12 A;  2RHU A;  2CT3 A;  4Z89 A;  1BCM A;  4AG2 C;  2ZPH B;  1RUW A;  2QQR A;  2DZ9 A;  4QQG A;  1UEC A;  1WHL A;  2CP5 A;  3VS5 A;  1Q81 C;  1PCX A;  5C0M A;  2K5I A;  1YJN T;  4BI4 A;  2I0N A;  3OYY A;  4RTU A;  3KXT A;  5LJ5 h;  3T9N A;  2KE9 A;  3OYC A;  2YT6 A;  2M16 A;  1M9S A;  1WPY A;  1M4Z A;  2D8H A;  1KQS P;  1J3T A;  3SEM A;  4OMP A;  4F7U F;  2ED0 A;  4JPB W;  2X4Y A;  1NPP A;  1ZSG A;  5A2Q E;  2E41 A;  2K9G A;  3NTH A;  2CP3 A;  4E7Z A;  2XIC A;  2K3Y A;  1D09 B;  2P0Q A;  5IT9 E;  4ATO A;  2K2V A;  2VUB A;  1OX9 A;  3AT1 B;  3MKD A;  3JCM c;  1Z9Z A;  3DB4 A;  1RAI B;  3E9F A;  3QJY A;  3VRY A;  1Q7Y R;  4M7D A;  1QVG A;  5AT1 B;  1X69 A;  4ANJ A;  1VQO T;  2BZX A;  3EG9 B;  1H92 A;  3OYG A;  1OUL A;  2FB7 A;  2QDY B;  5GAN j;  1UHF A;  1KD1 U;  4L59 A;  1VQ4 Q;  2A37 A;  2FEI A;  5FRM A;  2FPD A;  3CC7 T;  2V8I A;  4AFQ C;  1QVG P;  1M3A A;  1MUZ A;  2HD0 A;  1K8A R;  2RI2 A;  3MPU B;  1GFC A;  2CGH A;  2NYS A;  4WF2 A;  5CAI A;  3UA7 A;  4LDY A;  5GAO l;  2D8J A;  2KI7 A;  3EFO A;  2OI3 A;  1PM3 A;  1G8X A;  4HKE A;  2OAU A;  5CK9 A;  4F7U E;  7AT1 B;  2JM9 A;  4FYW B;  2BE7 D;  1UGP B;  3CD6 Q;  5IH2 A;  1C0M A;  5I21 A;  2MF2 A;  4M7D D;  2Y90 A;  2DL3 A;  1PWT A;  2PVG B;  2RI3 A;  4RKU E;  2GTO A;  2R57 A;  2CDT A;  3FJ5 A;  4XTW A;  2FG0 A;  2YUO A;  2QQB A;  4O5V A;  1X6B A;  2AZS A;  3P8D A;  1K9M U;  1JJ2 A;  1WJQ A;  1S1N A;  2DIL A;  6AT1 B;  4QVD A;  1BI1 A;  3OS1 A;  1GRI A;  1Y71 A;  1XTD A;  1TTH B;  4XTX A;  2R5A A;  1VQM T;  3L1A A;  1I5O B;  1X6G A;  1X27 A;  2K3B A;  2DEU A;  3CCV T;  4C0G A;  3CCS A;  1YIJ A;  1X2K A;  2QGG A;  3CQT A;  1IGQ A;  1AHJ B;  1PD0 A;  1VQL Q;  3VS3 A;  1VQ9 T;  1NBE B;  3MO8 A;  3X24 B;  3CEY A;  2BZY A;  3EAE A;  3VYG A;  5LJ5 f;  1ABQ A;  1U06 A;  3S3M A;  5J3B A;  2XMF A;  4HVV A;  1YI2 T;  2RJE A;  3QWY A;  2LRQ A;  3CCR A;  4PJJ A;  3SHW A;  1NLO C;  1GCP A;  2HNI A;  4LE9 A;  3WXM B;  2O9V A;  3A98 A;  4TVR A;  2WSE E;  2ED1 A;  2EBP A;  1WA7 A;  2HKQ B;  2QAZ A;  5KYU B;  3CCE A;  1VQK Q;  3FLG A;  4ELY C;  5GAN 7;  1QP2 A;  4MDW A;  2DVE A;  2DD4 A;  3NPF A;  3OQ5 A;  4FM4 B;  2KRS A;  2V8K A;  1WI7 A;  4FIB A;  5GAM e;  1X6O A;  1K9M C;  1VIE A;  1K9M R;  1PSE A;  1IRE B;  2BZ8 A;  4OMM A;  4LD6 A;  1R0B G;  4C5G A;  5GAN 8;  3L2W A;  2QGF B;  1VQ6 T;  4K11 A;  2FZC B;  1H3Z A;  5KYX B;  2EGE A;  2QYZ A;  2L0A A;  2XDB A;  3JB9 D;  1BU1 A;  2J05 A;  2EJ9 A;  1VQ5 A;  4OB2 B;  3ZL7 C;  3S3O A;  2JJ9 A;  1H64 1;  4C0D C;  4XAX B;  5LJ3 h;  3QDR B;  3PT9 A;  1VQO Q;  5FU6 B;  2NUP B;  3OYL A;  4J9G A;  2DKG A;  1QP3 A;  3GPL A;  1K0X A;  4C92 B;  4MMK A;  2HQH A;  4BDZ A;  1M2V B;  2P0K A;  1VQK T;  2QQ9 A;  3OSS C;  4KUL A;  8ATC B;  2HSP A;  3KUF A;  2JUF A;  3SFM A;  1TOV A;  2HKN A;  1QCO A;  4FW1 A;  4ZTF A;  1WNL A;  2VKN A;  2JMA A;  2O4X B;  1T3L A;  1AZG B;  3L42 A;  1O75 A;  1U5S A;  2RJF A;  2NWM A;  3BE3 A;  4J9E A;  1NEB A;  3UT1 A;  3VS2 A;  4C92 F;  3QYG B;  1E6G A;  4A53 A;  1JXO A;  1UGQ B;  1YP5 A;  3L2V A;  3CCM T;  2GTJ A;  1YHQ Q;  1V29 B;  3MEU A;  4C8Q F;  4OMF B;  2K5F A;  4HCZ A;  2EQU A;  2DER A;  3TU4 K;  3M0U A;  3BDU A;  1M2O A;  5A0L A;  3VS4 A;  3RDV A;  4E6R A;  1S72 A;  1BK2 A;  2DF6 A;  2XI9 A;  3ULR B;  5IN1 A;  2CT4 A;  2C06 A;  3CC7 A;  4FSS A;  4BB7 A;  3M0S A;  2YUN A;  2DBK A;  1AZE A;  4E7L A;  4OB1 B;  3ER0 A;  3UAT A;  4OML A;  2XHC A;  2QXF A;  3FRN A;  4Y92 A;  1X2Q A;  1QKW A;  4X34 A;  4M4Z A;  4FU6 A;  1G3W A;  4JRQ A;  4C5I A;  4M78 F;  2HL3 A;  5HCK A;  4E7J A;  5KCO A;  4J9H A;  2DNU A;  1JRI A;  4J9C A;  4DBH A;  3CCQ A;  4M7A F;  2KYB A;  2RK1 A;  2KY9 A;  5I2M A;  3REA B;  2COZ A;  2F1L A;  2RQR A;  2VVK A;  2MWP A;  2PTK A;  1OQK A;  4RCB A;  4M77 D;  3QO3 A;  2LCS A;  4MDX A;  4DOW A;  4A4G A;  5CKD A;  3V7R A;  1NJI R;  2VGM A;  2MMP A;  1RAH B;  1CKA A;  2XKO C;  1H3H A;  3CCJ Q;  4QW2 A;  1MND A;  2K57 A;  2X35 A;  2DZC A;  1VUB A;  3X25 B;  3EG1 A;  3MHX A;  1SHG A;  1QVF A;  1WLP B;  2BIV A;  3H0F A;  1LCK A;  2KMT A;  1HSQ A;  2EYX A;  1K1Z A;  2E65 A;  4OGC A;  1WXU A;  3R6N A;  3QHS A;  4RTW A;  1TXQ A;  2J06 A;  3JCM J;  4M75 F;  1FMK A;  3CD6 T;  1KC8 R;  3I55 A;  4J6X A;  4F7U A;  3OA6 A;  4KGV B;  3CCQ Q;  3G7Z A;  1BB9 A;  3EH2 A;  3CCJ T;  4C92 A;  1G83 A;  5M9O A;  5FWC A;  3PIO A;  2X9H A;  4C8Q C;  2DET A;  1NPR A;  3QJ6 A;  4AFS C;  3EFS A;  2DL8 A;  1VQN Q;  4PLL A;  4MZM A;  4RTV A;  2RI5 A;  1YFN A;  4PL6 A;  3CCE T;  2IG0 A;  1TUG B;  2OTJ A;  1YHQ T;  1OU9 A;  1KQS A;  4KUD K;  1BIB A;  2O01 E;  1D1A A;  5GMK m;  2E70 A;  1AOJ A;  3TCJ A;  2EW3 A;  5FW9 A;  2WAC A;  4AFU C;  1Y57 A;  2KRM A;  5KYX A;  2JW4 A;  2Y4X A;  2EKH A;  2AZV A;  4C5H A;  1SG5 A;  4A4K A;  1FX7 A;  1NJI U;  1K76 A;  1Y7X A;  1WZO A;  2EYZ A;  3M55 A;  2FRY A;  5CKE A;  4ZGE B;  2ZGW A;  3M0R A;  1S72 Q;  4M7A D;  1WJR A;  2HQX A;  3GP8 A;  3MEA A;  1K9A A;  4GY5 A;  1C1A A;  4C0F A;  4BE1 A;  3A8L B;  1JO8 A;  1V1C A;  1N5Z A;  2DJQ A;  4FL6 A;  4LD9 K;  1NG2 A;  1EX4 A;  1KJW A;  2DJZ A;  2EFI A;  2DL4 A;  3E9G A;  2AKL A;  3L2Q A;  2BE9 B;  4ZGJ B;  5CR2 A;  3RMS A;  5DM7 R;  3OS5 A;  1K0S A;  4EMG A;  1OYX A;  2ESW A;  2YRV A;  4PKC C;  2X51 A;  4A4H A;  3OMG A;  3HTR A;  1VYT A;  2CRE A;  5KYU A;  2LCL A;  4HVW A;  2RB6 A;  1FXX A;  4F04 B;  1RL2 A;  1IRX A;  2Y4Y A;  3OW2 S;  4M78 B;  1TU0 B;  3N5B B;  1YJ9 T;  3PMI A;  1Q86 R;  2JNG A;  2A28 A;  3CPW P;  3JCM P;  2HSE B;  2LJ1 A;  3RMQ A;  2CZ7 B;  3NMZ C;  3INZ A;  4RCC A;  3SWN B;  5CKH A;  5IHI A;  3GLX A;  1R8O B;  1WGS A;  3PTA A;  2VXE A;  2QEX A;  1V76 A;  1I1J A;  3JCM V;  3VKI A;  3HRT A;  3E1S A;  4PFP A;  1HD3 A;  2FVU A;  4RG2 A;  3UWN A;  3L2R A;  3QBY A;  2QAS A;  3CBP A;  4M7D C;  3EGX A;  1MHN A;  4PLI A;  2KT1 A;  2RM4 A;  1H8K A;  4ESR A;  1QKX A;  2RNA A;  1KIK A;  1M2V A;  1Y0M A;  3C0C A;  4JUV A;  4HCC A;  2XID A;  1D0X A;  1UJ0 A;  1YBY A;  2RQV A;  3UF4 A;  2KK4 A;  1AVZ C;  4BI3 A;  1B07 A;  2HEQ A;  1VQ7 T;  5GAO m;  4J9I A;  4BY6 B;  2E5Q A;  2PVD B;  5LJ3 j;  4B9X A;  3C12 A;  5CIU A;  3UDC A;  1UE9 A;  3CBM A;  4QQD A;  1QVP A;  1UFF A;  1ZSZ B;  4J7I A;  4KRT A;  4RUG A;  1OZ3 A;  2E6Z A;  2DM1 A;  3OYH A;  3OYD A;  4M77 E;  3TEE A;  3CPF A;  1Q82 C;  1VQ4 A;  3TVT A;  5IXB A;  2RHY A;  3EG2 A;  2G3R A;  2RMO A;  1VQ6 Q;  1ZUK A;  2VB6 A;  2FYK A;  3CME A;  4WTO B;  3CMA T;  3A5Z B;  3C4S A;  1QCN A;  1SKU B;  4C92 E;  1MNE A;  2X4W A;  2P84 A;  2DPP B;  3JB9 I;  4XTY A;  1WHM A;  5J26 A;  1VA7 A;  1W2B S;  3UPU A;  4M75 G;  3TQ7 P;  4BE2 A;  1G5V A;  1U1S A;  1LNX A;  1N9R A;  4JS5 A;  1X75 C;  3LH0 A;  2O88 A;  1VQP T;  1VQM A;  1CKB A;  2HBP A;  1YWO A;  3VS0 A;  1PHT A;  4IKF A;  1T3S A;  3SWN C;  2EAY A;  3J80 E;  1AT1 B;  4JLI A;  1JXM A;  2L3R A;  4Z88 A;  1PSF A;  3FB9 A;  1N9S A;  2E64 A;  1Q7Y U;  4EDU A;  5GAN 4;  1WHJ A;  2L2P A;  3CXC A;  3U23 A;  2GQV A;  3VUB A;  5GMK l;  1M27 C;  2DBM A;  1UTI A;  4JLG A;  3V8L A;  4AG1 C;  4AT1 B;  4M75 B;  4E47 A;  4KBM B;  4ORZ A;  4Y28 E;  5GAM h;  2DMO A;  1EIF A;  5GAM g;  3MEV A;  1M90 C;  3R6O A;  2HQE A;  3A8M B;  4XU1 A;  2LQK A;  1SRL A;  5IHK A;  1TWB A;  2K5L A;  1RAC B;  2YXY A;  1WX6 A;  4C92 C;  5LL6 S;  2RQW A;  1Q81 R;  1RI0 A;  2P4T A;  3RUX A;  4EMK A;  4R55 A;  3CPW A;  4OMN A;  2LVM A;  3CMA A;  3CME T;  4M75 E;  4BE0 A;  1T0J A;  1WQ7 A;  2RHX A;  3H0H A;  5DLO A;  2EIF A;  5J39 A;  4M78 A;  3X26 B;  3HRU A;  5LJ3 e;  5FWB A;  1QVG S;  1I5L A;  4MZP A;  2X3W D;  2A08 A;  2MAM A;  4ZNX A;  4PJN A;  2HZY A;  3QKJ A;  4DBR A;  1EFN A;  2JVV A;  1GL5 A;  4HXJ A;  3BFM A;  5GMK i;  2KSS A;  1NJI C;  3FEO A;  2P0P A;  2XU8 A;  4OB0 B;  1BYM A;  2QQA A;  2NLU A;  1K4U S;  3MET A;  3O5Z A;  5CCA A;  4UC4 A;  3DLL A;  1KC8 C;  4N0A A;  3LH5 A;  1KQ2 A;  1LPL A;  3A8G B;  2OAW A;  5KE3 A;  2M0O A;  1TUD A;  2KT8 A;  4FT2 A;  3V7S A;  2FRW A;  4DEY A;  1JEG A;  4J6Y A;  1M1G A;  2ZZD A;  4MZT A;  1U1T A;  2Z0W A;  2KYM A;  2QEX Q;  4FYX B;  1SHF A;  2EGA A;  2FO0 A;  4L6V 5;  4ZTJ A;  1RLP C;  4CC2 A;  1YI2 A;  2L3S A;  1TS9 A;  3M4Y A;  4EMH A;  3OYA A;  4VUB A;  1IO6 A;  4N0A C;  2M51 A; 
#chains in the Genus database with same CATH homology
 2EQM A;  3FRN A;  4M7A A;  3BDL A;  5FLX E;  2MI6 A;  3H8Z A;  4M7D E;  2RHI A;  3OS0 A;  4X34 A;  3JCM h;  4HA8 A;  4FU6 A;  1G3W A;  4JRQ A;  5LJ3 g;  4M7D F;  5EG2 A;  2JOY A;  2LX9 A;  4C5I A;  4IUV A;  1G3Y A;  3HKS A;  3OSV A;  3JB9 F;  3I56 T;  4M78 F;  3OBW A;  2WSF E;  4IUT A;  4E7J A;  3G71 A;  5C6S A;  3MP8 A;  1KHC A;  5D6Y A;  1BIA A;  2CYZ B;  5FU7 C;  5KCO A;  4M7A B;  3OYK A;  3G4S T;  2YLC A;  4E7H A;  2KAF A;  2X4X A;  1JRI A;  1LJO A;  4O6J A;  5LJ5 g;  1I81 A;  2XDD A;  1K73 C;  1VQ5 T;  2I2L A;  3QPH A;  1VQP A;  4J83 A;  3VUZ A;  4XTV A;  3CCQ A;  2XD0 A;  4M7A F;  2RK1 A;  1KQS S;  1D3B B;  1I4K 1;  4C8Q A;  1YIT A;  1VQL T;  1SSF A;  2KY9 A;  1YJW T;  5I2M A;  4Y91 A;  3C94 A;  1UGR B;  2LQ8 A;  3OYF A;  2DXU A;  3DLM A;  3OY9 A;  4MML A;  2ZPI B;  3M9Q A;  2MWP A;  1U8R A;  4RCB A;  2DO3 A;  3MP6 A;  4M7A G;  4M77 D;  2CZ0 B;  3F70 A;  4HCB A;  3G4S A;  4D6W A;  2JTM A;  2LCC A;  3M57 A;  3QO3 A;  4MDX A;  3G6E A;  3BY7 A;  1B34 B;  4A4G A;  3PGG A;  4XQ3 A;  3V7R A;  4DOW A;  5CKD A;  3PIP A;  2QA4 T;  1XQH A;  3RES A;  2MWO A;  3JCM e;  2L89 A;  2GFU A;  2AHJ B;  2MMP A;  2VGM A;  1Y96 A;  3LW5 E;  4RMO A;  3CCL T;  2XKO C;  3JAM E;  2E1H A;  3ASK A;  3GNG A;  4BY6 C;  2RA2 A;  4F7U G;  3OS2 A;  3OYE A;  3OBY A;  4QW2 A;  1N27 A;  2K57 A;  2VYT A;  2X35 A;  3MCA B;  3WVE B;  2DZC A;  3M54 A;  4M78 G;  1VUB A;  4PJO B;  5L8R E;  3X25 B;  5HY6 A;  3S3N A;  3MHX A;  1QVF A;  4XTU A;  3CC4 T;  2PQW A;  2PVO B;  4DA4 A;  2BIV A;  5D6X A;  2K3X A;  2LTO A;  3NTK A;  1KHI A;  2OTL T;  2E6N A;  2KMT A;  1KC8 U;  3OYM A;  2E10 A;  2E65 A;  1YHQ A;  4OGC A;  1VQ7 A;  4M7A C;  3NTI A;  3CCL A;  3QHS A;  4C8Q D;  2KQW A;  4B9W A;  1K73 U;  4CI0 C;  3ZBD A;  4JRI A;  3JCM J;  1UB4 A;  1M1K C;  4M75 F;  3CD6 T;  4JDS A;  4OB3 B;  5KH6 A;  4XK8 E;  2RD1 A;  3I55 A;  3MEW A;  1G3T A;  1HK9 A;  3L2Z A;  4J6X A;  2DXT A;  4IUU A;  4F7U A;  3OA6 A;  1Y07 A;  2QEX T;  3X28 B;  2FL7 A;  4ZGD B;  3CXC S;  3A8O B;  3EFR A;  1VQK A;  1VIF A;  1BI2 A;  4Z02 A;  3G7Z A;  4QVZ A;  4C8Q B;  3ZEH A;  5FU7 B;  5LJ3 f;  2A3L A;  3QYH B;  2LT4 A;  3V8K A;  2VV5 A;  3CCJ T;  1HXD A;  4DOV A;  4C92 A;  5M9O A;  3PIO A;  5GAO r;  4JS4 A;  2ZPG B;  2DEQ A;  4F7U B;  2DTO A;  2GCX A;  2R58 A;  4J5Y A;  4LDV A;  4PNO A;  4C8Q C;  1NPR A;  3QJ6 A;  3JSC A;  4EPC A;  4LDW A;  4NOY A;  3P8H A;  5GAN g;  3EFS A;  2E12 A;  2RHU A;  4PLL A;  2XDP A;  3RER A;  4NL3 A;  4MZM A;  3M58 A;  2RI5 A;  4M78 E;  5KCH A;  5LJ3 d;  2ZPH B;  4PL6 A;  3CCE T;  2IG0 A;  2PUK B;  5GAO n;  2OTJ A;  2QQR A;  2B8A A;  1YHQ T;  4KT0 E;  4L5G A;  4ZN1 A;  1KQS A;  2DZ9 A;  4QQG A;  3VJP A;  2VC8 A;  1ZBX A;  3CCV A;  4KUD K;  1Q81 C;  1BIB A;  1LOJ A;  2O01 E;  5C0M A;  5GMK m;  1NE8 A;  2E70 A;  2K5I A;  3TCJ A;  1YJN T;  2WAC A;  4M75 C;  4BI4 A;  3OYY A;  2VXF A;  3KXT A;  5LJ5 h;  1M90 U;  4OF1 A;  3T9N A;  3OYC A;  3G6E T;  5GAO p;  4X9D A;  2M16 A;  1VQ8 A;  2EQK A;  1M9S A;  2RH2 A;  1WPY A;  1G3S A;  2Y4X A;  2RO0 A;  4OGE A;  1M4Z A;  2CKK A;  1M5Q 1;  4A4E A;  4C5H A;  3V7C A;  4A4K A;  1FX7 A;  2R5M A;  1NJI U;  3QSU A;  1Y7X A;  3M55 A;  4F7U F;  3SWN A;  5CVI A;  5CQY A;  4XU3 A;  5FU6 C;  5CKE A;  3DB3 A;  4ZGE B;  2ZGW A;  3JCM Q;  4PJO D;  1QW1 A;  1YJN A;  5I2S A;  2X4Y A;  1NPP A;  4BUG A;  3BW1 A;  4HT8 A;  4M7A D;  1WJR A;  2HQX A;  4CRI A;  3GP8 A;  3SDZ A;  5GAN d;  3MEA A;  4NS5 A;  5A2Q E;  2E41 A;  4FT4 A;  3NTH A;  4M75 A;  2X4J A;  4GY5 A;  4C0F A;  5GAN h;  4BE1 A;  2DK3 A;  2XIC A;  2CS7 A;  3A8L B;  4XTZ A;  5GMK j;  2K3Y A;  3GF5 A;  5GAN 5;  2JN0 A;  2P0Q A;  5IT9 E;  4ATO A;  2K2V A;  2VUB A;  4M77 F;  3SB2 A;  4FL6 A;  4LD9 K;  3JCM c;  3DB4 A;  3E9F A;  3QJY A;  1Y96 B;  4M7D A;  2DJZ A;  3M59 A;  1QVG A;  1VQO T;  2DXC A;  2EFI A;  3E9G A;  3URG A;  3OYG A;  3L2Q A;  2FB7 A;  4ZGJ B;  2QDY B;  5CR2 A;  4JRP A;  5GAN j;  3RMS A;  5DM7 R;  3OS5 A;  1YJ9 A;  3PFS A;  5CO7 A;  1KD1 U;  4L59 A;  4EMG A;  1OYX A;  2YRV A;  4PKC C;  5FRM A;  3CC7 T;  4A4H A;  3OMG A;  2KVQ G;  2V8I A;  3HL8 A;  2OTJ T;  4M77 C;  4BI8 B;  2ZPF B;  2LCL A;  3HP9 A;  2RB6 A;  1VQ6 A;  1FXX A;  3QG1 A;  1RL2 A;  4ME7 A;  4C5E A;  1Q86 U;  2HD0 A;  1DJ7 B;  5CKF A;  3JB9 G;  2Y4Y A;  2RI2 A;  3OW2 S;  5HKC A;  1VQO A;  2O4X A;  4M78 B;  1FWZ A;  4ELZ C;  5GAO q;  2CGH A;  3N5B B;  2YHT A;  4WF2 A;  5CAI A;  4LDY A;  5KE2 A;  5GAO l;  4P5N A;  1YJ9 T;  3PMI A;  4PJO A;  2EJF A;  5LJ5 e;  3CC4 A;  2JNG A;  3AHU A;  4HKE A;  3JCM P;  1X01 A;  2OAU A;  3HHT B;  3QXE B;  5CK9 A;  3LWI A;  1VQL A;  2DAQ A;  3RMQ A;  2CZ7 B;  4F7U E;  3INZ A;  5CKB A;  2JTF A;  3HFN A;  3QZ5 B;  4RCC A;  3SWN B;  5CKH A;  5FRN A;  1Q82 U;  1UGP B;  3OYJ A;  3CCR T;  2DIG A;  2YLB A;  5I21 A;  2RJD A;  3GLX A;  3QII A;  2MF2 A;  5LJ5 j;  2Y90 A;  4N0A C;  3QZ9 B;  1R8O B;  1WGS A;  3PTA A;  4M7D D;  4IUQ A;  3G71 T;  3OYI A;  3HPW A;  2PVG B;  2RI3 A;  2VXE A;  3Q1J A;  3GNF B;  4M77 G;  3LWH A;  4RKU E;  5A0G A;  2QEX A;  2QA4 A;  4M78 D;  4IUR A;  2L8D A;  3JCM V;  3VKI A;  3HRT A;  3E1S A;  2FVU A;  2R57 A;  4RG2 A;  3JCM d;  3UWN A;  3LYI A;  3L2R A;  1N8R U;  2QTX A;  3QBY A;  3CBP A;  4XTW A;  4M7D C;  1OZ2 A;  1KG1 A;  1MHN A;  4N4G A;  3MP1 A;  4PLI A;  2QQB A;  3LLR A;  4O5V A;  2QQS A;  1D3B A;  2DTH A;  2RM4 A;  3P8D A;  4II1 A;  3OW2 A;  1K9M U;  4M78 C;  1JJ2 A;  1WJQ A;  1JBM A;  4C0Z A;  3CD6 A;  1JJ2 S;  5D6W A;  4X9C A;  4QVD A;  1BI1 A;  3RKX A;  4JUV A;  3OS1 A;  4HCC A;  2XID A;  3RIR A;  1YBY A;  5GAN 6;  5GMK h;  2KK4 A;  4XU2 A;  1Y71 A;  2CZ6 B;  1XTD A;  3LGF A;  3GOX A;  4XTX A;  2R5A A;  4BI3 A;  1VQM T;  3L1A A;  1VQ7 T;  4V2S A;  1KD1 C;  2F5T X;  5GAO m;  1VQ4 T;  4BY6 B;  2E5Q A;  2PVD B;  5LJ3 j;  4B9X A;  4PJO C;  3CCV T;  1Q7Y C;  3C12 A;  2D0Q B;  3TRE A;  4C0G A;  5CIU A;  3UDC A;  3CCS A;  1YIJ A;  4C92 D;  3CBM A;  1AHJ B;  3DKM A;  4C0D B;  4QQD A;  1BI0 A;  5GAM f;  1KQ1 A;  1QVP A;  3JRZ A;  3CCU T;  1VQ9 T;  2FHD A;  3MO8 A;  4J7I A;  1OZ3 A;  2EQJ A;  1WJS A;  3CEY A;  3PMT A;  3SD4 A;  3X24 B;  2E6Z A;  3EAE A;  5GAN e;  1K8A U;  3VYG A;  4KUI A;  5LJ5 f;  3OYH A;  3OYD A;  3VU3 C;  3VV0 A;  3LX7 A;  4M77 E;  4N4H A;  3TEE A;  3CPF A;  3JCM b;  1Q82 C;  3S3M A;  1VQ4 A;  4PJO F;  2RHZ A;  5J3B A;  2D9T A;  2KDS A;  1YI2 T;  2DTI A;  2RJE A;  1K8A C;  1P92 A;  5LJ5 d;  2LRQ A;  2RHY A;  3CCR A;  3JCM W;  1S72 T;  2G3R A;  2HNI A;  3I56 A;  3WXM B;  5GAM d;  4C8Q E;  3FC3 A;  4TVR A;  2FYK A;  2WSE E;  3CC2 T;  3HRS A;  3CCU A;  1VQ9 A;  3CME A;  3CMA T;  1BKB A;  3A5Z B;  2HAX A;  1W2B A;  4LDU A;  1BI3 A;  1VQ8 T;  3CCE A;  2RJC A;  3C4S A;  1GXI E;  2H3J A;  3FLG A;  4ELY C;  4ZN3 A;  5GAN 7;  4C92 E;  1QP2 A;  4MDW A;  2DVE A;  2X4W A;  2ZCF B;  3GIB A;  2DPP B;  2DD4 A;  3JB9 I;  4XTY A;  3OQ5 A;  2EYQ A;  4FM4 B;  3PNW C;  4BAC A;  5J26 A;  2V8K A;  2LC4 A;  4FIB A;  1W2B S;  5A0D A;  4M75 G;  3UPU A;  3M56 A;  5GAM e;  4BE2 A;  1X6O A;  1G5V A;  1U1S A;  1LNX A;  1N9R A;  4N4I A;  1K9M C;  1VIE A;  4BDY A;  1I8F A;  4JS5 A;  4QVC A;  1X75 C;  3LH0 A;  3M4G A;  2LNV A;  1OI1 A;  1PSE A;  5IAY A;  5CQX A;  1VQP T;  4A4F A;  1XOV A;  2M1H A;  1IRE B;  1VQM A;  5DY9 A;  2OTL A;  3P8B B;  4LD6 A;  4C5G A;  2VGN A;  2HBP A;  4M75 D;  5HK3 A;  5GAN 8;  1B34 A;  3L2W A;  1YJW A;  1N8R C;  1VQ6 T;  4PJO E;  4IKF A;  1H3Z A;  3SWN C;  1IZ6 A;  2EAY A;  3J80 E;  4JLI A;  3M53 A;  4HT9 A;  2L3R A;  4J7F A;  4M77 A;  3RKY A;  1PSF A;  3FB9 A;  5FRO A;  3CPW S;  1N9S A;  2M9U A;  3H6Z A;  3O8V A;  2E64 A;  2XDB A;  1Q7Y U;  4EDU A;  5GAN 4;  3JB9 D;  5GAM j;  3FIF A;  1ZQ1 A;  3CXC A;  4FSX A;  3WVD B;  2EJ9 A;  4OVA A;  4E7K A;  3C95 A;  2GQV A;  3VUB A;  3FDR A;  1VQ5 A;  4OB2 B;  5GMK l;  3S3O A;  2EWN A;  1H64 1;  5GMK e;  2JZ2 A;  2DD5 A;  4XAX B;  4JLG A;  5LJ3 h;  3V8L A;  4C0D C;  2WSC E;  4EMK B;  3VYH B;  3L2U A;  4M75 B;  3JCM g;  4E47 A;  2IVW A;  1YCY A;  3OB9 A;  3PT9 A;  3QDR B;  5FU6 B;  3CCM A;  4KBM B;  3OYL A;  2K4Y A;  3JB9 H;  1O9S A;  4NL2 A;  4Y28 E;  5GAM h;  3CC2 A;  4BD3 A;  1EIF A;  2DKG A;  4RG8 A;  1QP3 A;  5GAM g;  3GPL A;  3MEV A;  4J8O A;  2XK0 A;  2QI2 A;  1M90 C;  3R6O A;  4JRK A;  4MMK A;  2HQE A;  3A8M B;  4C92 B;  1ZHI A;  4XU1 A;  1WQW A;  2A7Y A;  4BDZ A;  2BUD A;  2LQK A;  3M5A A;  2P0K A;  1VQK T;  2ZPE B;  1Q81 U;  1QVF S;  2K5L A;  2QQ9 A;  4Q5W A;  3JB9 J;  4XU0 A;  1N6A A;  4C92 C;  1W4S A;  3OSS C;  4KUL A;  5LL6 S;  2BKD N;  3KUF A;  2JUF A;  3SFM A;  5DLQ E;  3HFO A;  3OMC A;  1RI0 A;  2P4T A;  3RUX A;  4EMK A;  4R55 A;  3CPW A;  5AYF A;  4DQ2 A;  4M77 B;  2F5K A;  2GF7 A;  4M7D G;  2LVM A;  1UEB A;  3CMA A;  2ZPB B;  4M75 E;  3CME T;  1WQ7 A;  4QQ6 A;  4YTL A;  4BE0 A;  2RHX A;  3QUI A;  4OP0 A;  5DLO A;  2EIF A;  4ZTF A;  1WNL A;  5J39 A;  3J7A F;  2O4X B;  4M78 A;  3X26 B;  2DIQ A;  3HRU A;  5LJ3 e;  3L42 A;  1QVG S;  1I5L A;  4MZP A;  2PU9 B;  1O75 A;  2RJF A;  3UT1 A;  4C92 F;  3JCM X;  4LDX A;  1VQN A;  2DXB A;  2MAM A;  3X20 B;  3QYG B;  4A54 A;  4A53 A;  1UGQ B;  1JB0 E;  3LGL A;  4IUP A;  5HK0 A;  5GAN 3;  3L2V A;  3QKJ A;  3CCM T;  4C8Q G;  3CCS T;  1YIJ T;  2EKO A;  2EJG A;  5GAN f;  1V29 B;  3MEU A;  3I55 T;  2RK2 A;  3A8H B;  4OMF B;  2JVV A;  4C8Q F;  4R56 A;  2F69 A;  1M1F A;  5GAN 2;  1Q86 C;  2K5F A;  3CBO A;  2EQU A;  4HCZ A;  3TU4 K;  3BFM A;  4C92 G;  5GMK i;  3FJP A;  2KSS A;  1NJI C;  3BDU A;  3E19 A;  3OYN A;  3FEO A;  2P0P A;  2XU8 A;  5A0L A;  2D6F A;  1M1K U;  4OB0 B;  1VQN T;  1BYM A;  2QQA A;  1YIT T;  2NLU A;  3HSB A;  3MET A;  3CCJ A;  4JJN K;  4E7I A;  5CCA A;  4UC4 A;  3DLL A;  1M8V A;  1S72 A;  4PJO G;  1KC8 C;  4N0A A;  1TH7 A;  4J6W A;  4EMK C;  1KQ2 A;  2XI9 A;  3A8G B;  5KE3 A;  2M0O A;  2LDM A;  4FT2 A;  3V7S A;  4GLK A;  5IN1 A;  3OYB A;  2XG8 D;  2L5Q A;  3S6W A;  3J81 E;  4J6Y A;  2LT1 A;  1M1G A;  2C06 A;  2ZZD A;  3CCQ T;  3CC7 A;  4MZT A;  2PUO B;  1U1T A;  4BB7 A;  1UGS B;  3JCM f;  1MGQ A;  2V8J A;  3V8J A;  4M7A E;  4E7L A;  1XNI A;  4L6V 5;  4ZTJ A;  3NFC A;  1YI2 A;  3ZFJ A;  4OB1 B;  3ER0 A;  3RKW A;  2CZ1 B;  2GFA A;  3ME9 A;  1NZ9 A;  3KBG A;  3M4Y A;  4EMH A;  3OYA A;  4VUB A;  2XHC A;  4M7D B;  2QXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...