3FB9A

The crystal structure of the protein with unknown function from streptococcus pneumoniae tigr4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
GMSDAFTDVAKMKKIKEEIKAHEGQVVEMTLENGRKRQKNRLGKLIEVYPSLFIVEFGDVEGDKQVNVYVESFTYSDILTEKNLIHYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the protein with unknown function from Streptococcus pneumoniae TIGR4
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 22
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06257 VEG Biofilm formation stimulator VEG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fb9A00
3HSBA 3JCMh 5GMKh 5GAN8 4A53A 2RD1A 3JB9H 1HXDA 3SWNB 2VXEA 4EMGA 1JRIA 1YCYA 3QUIA 4M75A 4C92D 2EJGA 4C92C 4M78F 4C8QE 4M75B 3V7SA 5GANe 4JRIA 2K57A 4OP0A 3JCMf 2E1HA 3BW1A 3VU3C 4PJOC 2FYKA 2RM4A 4M78E 4RCCA 3RKXA 5GAMg 4NL3A 2E41A 4M77D 3JB9G 4NOYA 4N0AA 4M78A 3JCMV 4PJOG 5GAN6 5CAIA 3GIBA 2HNIA 4M77C 1LOJA 4XTZA 5GAN5 4M75G 2DJZA 5DY9A 3QSUA 1M5Q1 1MGQA 4M7DB 5LJ5h 5GMKe 1I4K1 4X9DA 5GAMe 2EAYA 4C92G 4XTWA 1TH7A 3JB9D 4HT9A 2EJFA 4J6XA 4QVDA 3JCMb 5GMKj 1U1SA 5GAOq 2RB6A 1B34A 5GAMf 1U1TA 4M78D 3JCMc 5LJ3g 5GAN3 3V8LA 4C8QG 1BIAA 3M4GA 3V8KA 1B34B 1WQWA 4JRKA 4EMKC 3L1AA 3V7RA 4M7AD 1LNXA 1WQ7A 4J5YA 4C8QD 5GAMd 4HA8A 4V2SA 5LJ5g 4M75F 4M77A 3EFRA 2EJ9A 4M7DC 2YLCA 4M7DA 4M78C 3BY7A 5GAMh 3HFNA 5GANf 4M75E 4J6WA 4XU3A 4XTVA 2DEQA 5LJ3d 4F7UG 1N9SA 2DVEA 2Y90A 4EMKA 1D3BA 3HFOA 4M78B 3QHSA 1KQ1A 1WNLA 4M7DF 3V7CA 5GMKi 4XU0A 3JCMP 4M75C 4WF2A 4EMKB 3RKYA 4J6YA 4M7AF 3V8JA 3L2ZA 3AHUA 3BDUA 4M7DE 4PJOD 4A54A 2ZGWA 4XTXA 3SB2A 1I81A 3RIRA 4C92B 5GANj 5LJ5f 4JLIA 1X01A 2DTOA 4F7UE 3RERA 3JCMW 5GANg 2DZCA 4HT8A 2VXFA 3JCMJ 1Y96B 2YHTA 1JBMA 5GAOm 1M8VA 3RUXA 2CGHA 1WPYA 5LJ3f 4M7AB 4N0AC 4PJOB 4RCBA 2E65A 2RA2A 3JB9J 1Y96A 4M75D 4M78G 3JCMd 4PJOA 4M77B 4X9CA 5GAN7 4XTYA 1HK9A 4NL2A 5I21A 5GMKm 4M77F 5GAN2 5LJ3j 3JCMQ 5GANd 1N9RA 4MMLA 4C92A 3JCMe 1BIBA 2E10A 5GAOl 1D3BB 2E64A 4PJOF 2I2LA 5GANh 3QO3A 3SWNC 4JUVA 2DZ9A 4XQ3A 5LJ3e 5GAN4 3JB9I 2FB7A 3PGGA 1I8FA 4C8QB 3JCMX 4C92F 3SWNA 2YLBA 3JCMg 5GAOn 1KQ2A 1LJOA 5GAOr 5GMKl 4M7AA 4C8QA 3INZA 3RKWA 4C92E 2JN0A 4XU2A 4F7UF 4Y91A 2DXUA 2DKGA 5LJ5d 4F7UB 5GAMj 5LJ5j 1H641 2EWNA 4M77G 5GAOp 4C8QF 1I5LA 4M7DG 3EFSA 4XU1A 5LJ5e 4EMHA 2DXTA 4F7UA 4M7AG 2DTIA 4M7DD 4M7AE 4PJOE 3BFMA 2VC8A 4PNOA 2QTXA 3FJPA 4MMKA 4XTUA 5LJ3h 3JB9F 4DQ2A 3FB9A 4C8QC 4M7AC 4M77E 4QVCA 2DTHA 3FIFA 3RESA
chains in the Genus database with same CATH superfamily
3A8HB 1OULA 2JTFA 1GL5A 2HQXA 4CC4B 1GCQA 3RR6A 2CDTA 3P8HA 4M75B 4OF1A 3BW1A 5IHKA 3CC2Q 3FC3A 1YIJT 4XK8E 3JB9D 3JCMb 2LVMA 2P0QA 3RNJA 1G2BA 4MZTA 2ATCB 3M0RA 3UWNA 1B34B 2JOYA 4F14A 3GPLA 4UC4A 4M78C 2LCLA 3VKIA 1WHGA 3LH5A 2DVEA 1K73U 1VQ5A 2XICA 3X28B 1FYNA 9ATCB 3O8VA 2RQRA 4M7AF 4FYVB 4LD9K 2FPEA 2V8IA 3AHUA 2LX9A 1BYMA 1PM3A 4FW1A 5GANg 1RAEB 3VS4A 2A36A 1Y7XA 3MEAA 1M8VA 4M7AB 4PJOB 1PKSA 3IQLA 1X27A 2KQWA 2MK5A 5KYXB 4BE1A 5HY6A 1VQ9T 1RLPC 4ZNXA 3C95A 1YITA 3M59A 2ZPHB 1MMAA 3CCST 4HCCA 1KQ2A 2W0ZA 4DEXA 3CC2A 3JV3A 2K3BA 1IGQA 5CIUA 1R0BG 1AWXA 3MJXA 1M30A 1VQ9A 1H8KA 2CH4W 2HL3A 5LJ5j 2DF6A 2CUDA 1HD3A 5KYUB 2RN8A 1K4US 2CS7A 1HXDA 1UGVA 1C1AA 2XU8A 1CKBA 5HKCA 4KULA 2QQAA 2RMOA 3GBQA 3G4SA 1QQJA 3EAEA 4C0ZA 4PJJA 3OYFA 1VQ5T 3D7SB 5IN1A 1VQKQ 2YUQA 3PTAA 5I2SA 4NOYA 2L3SA 1T3LA 4FYXB 4C5EA 1X2QA 4XTWA 4HT9A 4DBRA 4F04B 2YSQA 1TS9A 4JS4A 1CSKA 1Q81R 2LRQA 5KE2A 4A63B 1MMNA 4WCIA 3OYIA 2X3WD 4CC7A 1WQ7A 4HVVA 1UJ0A 3P8BB 4NS5A 1G3WA 2O88A 1VQ8T 2LCCA 2X4XA 2VGNA 3CXCA 4ZGDB 2ZPGB 2DTOA 2RHUA 4F7UE 1NPRA 1QWFA 1U06A 1JJ2S 3SD4A 2LJ0A 3CCET 1AWOA 1FMWA 4IIMA 2YT6A 4CC2A 4X34A 8ATCB 3QBYA 4LDYA 1AD5A 1D3BB 1XJWB 4AT1B 4E7ZA 1EX4A 1Y57A 1KC8U 1KFZA 1I8FA 1I07A 2C0TA 2KYMA 4C8QA 1Q86R 1ACMB 2CP2A 5IH2A 5D6XA 2ENMA 4GY5A 4OMLA 1C0MA 4M7DG 1GFDA 5LJ5e 2ZPIB 4A4KA 4M7DD 1TUCA 1W2BP 2MWOA 5HK3A 4CRIA 2EGEA 1NPPA 3J80E 3HSBA 1X43A 2RQWA 1Q95G 4D8DA 2LTOA 4RTVA 5IAYA 3PVLA 2EJGA 1PKTA 1VYVA 1NM7A 5FU7B 3CCLA 4OP0A 2EQKA 5GJWB 3CMAQ 3CCUQ 5GAMg 2E41A 4M77D 2RI3A 2KT1A 3MP1A 4PJOG 5CCAA 2DYBA 2RH2A 1PCXA 2FRYA 3C12A 5FU6B 2QQRA 4C92G 5KYUA 4E7KA 1YJWQ 4EDUA 1VQ8A 5A2QE 2J06A 2LCSA 4MZMA 4M78D 3V8LA 4HCBA 3M4GA 1VQ6A 4C0DB 1Y0MA 1ZLMA 3LWHA 5GAMd 4MDWA 1N8RR 3BY7A 3CPWA 4J7FA 2LZ6B 1UFFA 3LH0A 4M78B 1KQ1A 1PRLC 1ZSZB 4FU6A 2GTJA 4HXJA 4F16A 2YRVA 3E1SA 3V8JA 4A54A 3SB2A 1I81A 1VQNQ 4J9IA 4AFUC 4P5NA 1FX7A 4RTYA 1JBMA 4J7IA 4JJCA 3GP8A 1M90U 2CGHA 2QGGA 4ELZC 4QQGA 2RQVA 4NL2A 1MUZA 5GANd 1N9RA 2WSEE 1TG0A 3CPWS 2F1LA 4PJOF 5LL6S 3GOXA 4FCYA 3JCMX 4C92F 3OBWA 3JCMg 3OYAA 1VQMQ 2NWMA 1AWWA 3INZA 2JN0A 2L3RA 1K9MC 3LGFA 1BCOA 4JDSA 5A0LA 3EFSA 2LC4A 4XAXB 1W2BA 4C0FA 2OJ2A 4F7UA 5FW9A 4OB3B 3FJPA 3JB9F 4IUPA 2FEIA 1E6GA 3SWNB 3X20B 1WXUA 2EYYA 1AOJA 2QASA 2RD1A 2LJ1A 2QDLA 4M75A 2DL4A 2E5KA 3PMIA 4AFSC 3G6EQ 3E19A 2GGRA 4RCCA 4B9XA 3FLGA 1UTIA 4N0AA 1P92A 1LOJA 1MGQA 4RTZA 3CBMA 4QW2A 5GAMe 4J8OA 1Q81U 4OB0B 1WHHA 3CMEA 2JMAA 5I2MA 3F70A 1ABQA 1OZ3A 4LE9A 4FT2A 3V7RA 5KCHA 2M16A 3CPWP 3C4SA 2KGTA 4GBQA 1QVFP 3OYBA 3DKMA 5DLOA 2A0FB 3CEYA 4J9FA 4B6MA 1VQMA 1S72Q 2V8JA 2WSFE 1T3SA 1K0SA 1N5ZA 3VUZA 1BI2A 4DBHA 5FWBA 4ME7A 3VS0A 3MKDA 3HRSA 1OZ2A 1NEBA 1OYXA 4C0GA 1QCFA 1WPYA 3X26B 4BUGA 1MNDA 1BKBA 2RA2A 3JB9J 2WSCE 1NE8A 2QTVA 3EG9B 5I21A 3PIOA 1H3ZA 3OS2A 4C5HA 2EKHA 2KT8A 2COYA 2ROTA 1YBYA 4JZ4A 2ED1A 1U3OA 2L0AA 2DZ9A 3PGGA 2L2PA 4KGXB 2KRNA 1B3QA 3CC7A 1X69A 4XU2A 2OAWA 1D1AA 1W4SA 1UB4A 2EWNA 2Y4YA 3QIIA 1KHIA 2DTIA 3REBB 2VUBA 4R0KA 2KAFA 1VQLQ 2DILA 3SDZA 3A98A 3M0QA 3L2WA 4IURA 3GNGA 2NLUA 2CZ1B 4KUDK 2PNIA 3V7SA 4E2FB 2DL7A 3VUBA 3VU3C 3RKXA 1VIFA 3GF5A 2BKDN 3LX7A 3EG3A 1Y71A 4M7DB 1VQKA 3L2VA 2GTOA 5GAOq 2K79A 4GLKA 3FRNA 2LMJA 1EFNA 3FDRA 6AT1B 5C6SA 1BK2A 2CT4A 2RJFA 1KD1C 4DOVA 2HAXA 2K7AA 3A8LB 2M0YA 1BCMA 2PUKB 1K73C 4K11A 5LJ3d 4F7UG 1TTHB 3M58A 3CC7Q 3EH2A 1O75A 4C92B 2ZGWA 1VQPQ 1Q82R 4JLIA 1ZUUA 2K2VA 1GFCA 4PK4A 3PMTA 4N0AC 3ZFJA 1IGUA 3CCQA 4M75D 1NBEB 2RK1A 2VGMA 3MO8A 5KCOA 2QQ9A 1OU8A 1UJYA 4L5GA 2X3XD 2I2LA 1Q86C 2CP0A 3CCJQ 1YI2A 4ZN1A 2OAUA 2RJDA 1MV0B 2PVGB 2DO3A 3EG2A 2ESWA 2F2XA 3HRTA 3CD6A 5AT1B 1D1CA 3NTKA 3HL8A 2E6NA 2JJ9A 2L89A 2DXTA 3WVDB 2EGAA 3OQ5A 1M27C 3QZ9B 2A37A 2QTXA 3QJYA 5KYXA 1D0YA 5KYNA 2FPDA 3CCRA 3JB9H 2VXEA 4KGZB 1M1GA 3OY9A 3QDFA 5CO7A 4C92C 2EVRA 1M2VB 2IG0A 1IZ6A 2MIOA 4PJOC 3OBYA 2RM4A 3LWIA 4A4GA 4NL3A 1NJIR 3OW2P 3ZEHA 3CCMT 1NLPC 3A8GB 5LJ5h 2AT1B 3MEUA 4KBMB 1M1KR 1JO8A 1WJSA 1B34A 1MNEA 4D8KA 4FM4B 3X24B 1H3HA 1IHVA 1SRLA 1WXTA 1YIJA 4ZGEB 2ROLA 3DLMA 4C0DC 1LVKA 5IXFA 1W1FA 2Y90A 3L2RA 5CKDA 3FJ5A 1ZA1B 4PLLA 3OA6A 1T0HA 1G3TA 4ELYC 3M0UA 1ZBXA 2K2MA 2D1XA 2A08A 4E47A 4M7DE 1VUBA 2RK2A 5FRMA 3CD6Q 5GANj 4BE0A 3RIRA 4J9GA 1VQ4A 3VJPA 1QW1A 2VXFA 1JQQA 1YWOA 3SFMA 1FMVA 5D6WA 2QEXT 5L23A 3CCLT 1NG2A 4J9CA 3I56Q 2JW4A 1KQSS 1FWZA 2H8HA 2O4XA 1PSEA 2DPPB 4FYYB 2XD0A 1AVZC 4FSSA 4LDWA 3VS2A 2C06A 2PQWA 4M4ZA 4PLIA 3OW2A 2LX7A 5LJ5d 2L8DA 4QQDA 5GAMj 2FL7A 3OYCA 3M9QA 2YRCA 3PNWC 3H0IA 1NYFA 2JZ2A 2R5MA 2OI3A 1N6AA 1WHMA 1UUEA 5GMKh 1Q81C 4GLMA 1W2BS 2AZVA 1RI0A 2R57A 2YUNA 3WXMB 2CSQA 2HD0A 3VS1A 2QXFA 3N5BB 2COZA 2K57A 2M51A 4KRTA 3QPHA 3CCEA 2XI9A 3H41A 1V1CA 3JCMV 4M75G 2P84A 4LXCA 2KSSA 2EAYA 1TH7A 2HSPA 3J7AF 1QVGS 4KGVB 2RB6A 1H92A 1KK7A 1UGPB 1OPKA 4C8QG 3CCSQ 2JM8A 3V8KA 1JXOA 4C8QD 2AHJB 5GAMh 3HFNA 3EFOA 4XU3A 2KYBA 2DEQA 2O01E 2EPDA 3WVEB 3TSWA 2B86A 3EGXB 1JJ2A 3NPFA 3V7CA 5GMKi 1GCQC 2L3QA 5KE3A 4EPCA 2YWWA 3ME9A 1TXQA 2QA4T 1S72A 3CCMA 5LJ3f 1Q82C 1JXMA 4TVRA 3JCMd 2L3PA 2BE9B 2EIFA 1UG1A 2MPXC 3A5ZB 2AKKA 4QQ6A 3CC4T 5LJ3e 1YNZA 1KHCA 4ZGJB 2ECZA 3EG0A 1K9MR 2NUPB 4M7AA 4OMOA 4PJMA 2HZYA 1M3CA 3GLXA 2COWA 1SHFA 2KY9A 4E7LA 4C8QF 2FZCB 4A4EA 5I11A 2MOXA 4EMHA 5IT9E 3OYNA 4M7AE 5DM7R 1AT1B 2DXCA 1YHQA 2DX1A 1XTDA 2EYQA 3CCSA 1YI2T 3QKJA 1VQ6Q 3TQ7P 2DMOA 3VYHB 1M2VA 5D6YA 1JRIA 2EFIA 1YN8A 2J6OA 1VQ7Q 1OI1A 2HQHA 3LYIA 4FT4A 1JJ2P 2RQUA 4R56A 1A0NB 4IKFA 2HNIA 2XIDA 3PE0A 4J9BA 4LUDA 4AMCA 1WHLA 1RAHB 4LUEA 2A28A 2QGFB 3HKSA 1K73R 3G71Q 1R77A 1PD0A 1BIAA 1AHJB 1WQWA 4EMKC 3GNFB 1LNXA 3OYLA 2NUTB 3G6ET 4MDXA 1EZZB 1VYUA 2JS2A 3J81E 3HFOA 2EYZA 3QYHB 1VA7A 1YJNA 1MHNA 1K0XA 1TU0B 2F5TX 1NEGA 2D0QB 3RBBB 4Z89A 2JS0A 1X75C 3META 3CXCP 5GAOm 3OYEA 4PJLA 1RUWA 4ANJA 4L6V5 3NFCA 2J05A 1WHJA 4KUIA 1D0ZA 4FSXA 5KYYA 1KSWA 2CZ6B 4WTOB 2CZ0B 2RJEA 1F1BB 2BTTA 2V1RA 4LNPA 1ZX6A 4C8QB 1VQ7T 2OTJT 4AG1C 2DETA 2JMCA 2GCXA 1EIFA 1Q7YC 1BB9A 2XK0A 4F7UB 3CCJA 1JU5C 2XHCA 2KROA 4JLGA 1X2KA 2MMPA 3VS5A 1VQ9Q 1K8AC 1VQOQ 1SPKA 2DAQA 1VQOT 3QUIA 2E12A 3I9QA 1YJ9Q 1M3AA 5KYWB 4JJDA 3JCMf 2V26A 2KRSA 4II1A 5CAIA 4XTZA 4J9HA 4BDYA 1D0XA 3S3OA 2F5KA 4DBFA 3OS1A 2CYZB 1VQLA 3C0CA 2MCNA 2K3YA 5GAN3 1VQNT 1WFWA 1Y07A 2DFUA 1O9SA 4KH0B 1SSFA 3TU4K 4M77A 1RAGB 2EJ9A 2JM9A 1WX6A 1RADB 2DXBA 4IUUA 3PFSA 4OGEA 3UT1A 3NTHA 3G4ST 1G3SA 5CKFA 1QP3A 3RKYA 4LDXA 4ATOA 3L2ZA 2AIRB 3M0SA 4DOWA 3OYYA 5LJ5f 2E6ZA 4CI0C 1KC8R 2QI2A 3M54A 3I5RA 1HK9A 1WXBA 2EBPA 5D7UA 4BI8B 3JCMQ 1BI1A 3CD6T 5GAOl 3I55Q 4FW2A 2B8AA 4C5GA 3UA7A 2DE0X 1NLOC 2BZ8A 4JUVA 4Z8AA 5FWCA 5J26A 2JVVA 1BBZA 2DM1A 2PUOB 2QEXQ 1M3BA 2M0OA 4QKUA 1YITT 2ZPFB 1M1FA 3P8DA 4M77G 2KVQG 5GAOp 1I5LA 3MPUB 5A0DA 4RG2A 3SHWA 2A7YA 2GFUA 2FZGB 3UDCA 3OSSC 3TVTA 4M7AC 3A8OB 5CQXA 5C0MA 1VQ8Q 4A53A 1M90C 2RPNA 1YITQ 5CVIA 2RO0A 1B7TA 3THKA 2JT4A 2J6KA 4M78F 2X35A 3H0HA 3CCVA 5GANe 2GQIA 2PVOB 4LD6A 4RTTA 3I56T 4J9EA 2P0PA 1WGSA 2OX7A 5DY9A 5HK0A 3QSUA 1I4K1 3CCLQ 2EJFA 4J6XA 3BDLA 5CQYA 2K6DA 1GXIE 1ZSZA 3L42A 2LDMA 1VQLT 5LJ3g 4BI3A 1UGQB 2AZSA 4V2SA 5KH6A 1UHCA 4IUVA 4ZTFA 4XTVA 2RNAA 2NUZA 4XU0A 2XDPA 2EGCA 1ABOA 3L2QA 3LLRA 2KBTA 3ER0A 3RUXA 2JTEA 4RTWA 2CP3A 2RQTA 4RCBA 4F17A 3UF4A 4OMQA 1N27A 3QYGB 2EQMA 4OGCA 4Z02A 3VS7A 4PJNA 2X4YA 5GAN2 2DBKA 3CCMQ 3CCJT 2K5LA 1UECA 2CKKA 1QWEA 2VV5A 2QQSA 3JB9I 1WYXA 1OPLA 4BD3A 1VQPA 1QCOA 4ORZA 1ZSGA 1YCSB 3OYJA 2L5QA 1HJDA 3CCUA 3MEVA 1I5OB 3JSCA 1IO6A 2K5IA 1PRMC 2E5QA 4RTXA 1G8XA 4PJOE 2VC8A 5LJ3h 1WJRA 3OYHA 1NJIU 4QVCA 3RMQA 3FEOA 5AYFA 1RAAB 4RMOA 2O4XB 2RHXA 1ZBJA 5J3BA 4A4HA 2DD4A 2D9TA 2E1HA 2HL5C 3HRUA 2EW3A 2DIQA 3GIBA 1HSQA 4Z88A 1YJWT 2OTLQ 1VQ4Q 5CKEA 1K8AR 1VQ4T 4BY6B 4JRQA 3VYGA 2K9GA 4BY6C 3S3NA 4LN2A 1GRIA 1OV3A 4OMNA 1KC8C 3BE3A 1RAIB 4J5YA 2QA4Q 3PVQA 3I35A 1KIKA 1OOTA 1OX9A 2LQ8A 2JXBA 5FU7C 3M53A 1SHGA 1WZOA 1N9SA 4J9DA 3QHSA 2OTLT 4M7DF 3JCMP 3UATA 3VS3A 1YFNA 2K3XA 1QMCA 3BDUA 2BE7D 2RI2A 1SF9A 3QWXX 5GJVB 3S3MA 1QVGA 3EGDB 1IREB 1R8OB 1Y96B 1MMDA 1Q82U 2HQEA 2XDBA 2CZ7B 2CH4A 3M55A 2LQKA 2DLPA 1C6VX 2KDSA 2Z0WA 1IB8A 4KT0E 3CCVT 3OMGA 1KQSA 5GMKm 2C0IA 1QVFA 3JCMe 1VIEA 1Z9ZA 3CQTA 5CKHA 2DBMA 3CCRT 2CUBA 2J7IA 2E70A 2YLBA 2EQJA 5GAOr 3CCEQ 1IHWA 3CC4A 1ZUYA 2PU9B 2P4RA 3R6OA 2LNVA 3EHRA 1GBRA 1G83A 4E7JA 2D0NA 1UHFA 3URGA 1Q86U 4C5IA 3FIFA 4IUTA 3VV0A 4CC3A 1S72T 2QA4A 5CKBA 3CXCS 3ASKA 2HEQA 2HMAA 3QJ6A 2FYKA 1K76A 2VVKA 3ZBDA 5GAN6 3HPWA 1VQ5Q 2RHZA 2MYSA 2KEAA 2DL5A 1QVGP 4QVDA 3JRZA 1U8RA 2PZ1A 1MMGA 2GNCA 1R0CB 3EHQA 4HCZA 2F69A 1ZUKA 2GQVA 3VRZA 4M7AD 4HA8A 1SSHA 1BU1A 1K8AU 2YLCA 2DL3A 1M9SA 5GANf 4J6WA 1N8RC 2JNGA 2DK3A 3OYMA 1WJQA 2E3IA 4M75C 1M4ZA 1E6HA 1CKAA 1YI2Q 3LGLA 2ABLA 3E9FA 5FU6C 1X01A 2RJCA 2FHDA 1V76A 4E6RA 1RABB 4DEYA 1Y96A 1SG5A 3CBOA 5GAN7 4ZTJA 3E2UA 4JPBW 4MMLA 2FG0A 1QLYA 2FRWA 4N4GA 3TEEA 5GAN4 3M0PA 5GAOn 4OB1B 5GMKl 2SEMA 1NZ9A 3I55A 3M5AA 1UEBA 3DLLA 4Y91A 2XMFA 5J39A 2PVDB 2GF7A 2HKNA 3UPUA 4OMFB 2O9SA 3OS0A 1DJ7B 3I55T 2QEXA 1ZQ1A 3G71A 4PNOA 3FB9A 2OTJA 1AZGB 2DTHA 3DB4A 3MP8A 1BI0A 1YCYA 4JJNK 2EKOA 4C92D 1XQHA 1RL2A 1X6BA 2DA9A 1M2OA 2F2VA 4J83A 4JZ3A 2MI6A 5L8RE 4FYWB 1KG1A 4PFOA 5HCKA 1U1SA 4HCKA 2GBQA 2XDDA 5GAMf 1N8RU 3G7ZA 4N4HA 3A1PA 4O6JA 2KMTA 4EIKA 3HP9A 3G6EA 3EFOB 1UGSB 4EMKA 3TSZA 3MHXA 4L59A 2ZPEB 1I1JA 3ZL7C 4MZPA 3T9NA 4JRPA 2HBWA 3CMEQ 3KFVA 4N4IA 4PL6A 4OVAA 2DRMA 4JJBA 3JCMW 2DZCA 5M9OA 1NYGA 2V1QA 2ED0A 3QXEB 2E65A 1G3YA 2KXCA 1OQKA 2KR3A 1T0JA 1YJ9A 3QO3A 2QG9B 2QDYB 3OMCA 2RHYA 3SWNC 4XQ3A 1AWJA 1FXXA 1LCKA 1PC0A 2DJQA 3Q1JA 2J6FA 3SWNA 4LDVA 1YHQT 4KH1B 2XG8D 3RKWA 1RACB 1SRMA 3CMAA 1H641 2VKNA 3CCQQ 3H8ZA 7AT1B 1PWTA 2KE9A 3BFMA 3CCQT 1PHTA 2RHIA 3CPFA 2HKQB 2QYZA 1E7OA 4M77E 5EG2A 3OYKA 5GAN8 1ZHIA 2JUFA 4EMGA 4BACA 2R58A 2CT3A 4M78E 2BUDA 3OB9A 4PFPA 3JB9G 2ZCFB 4M77C 3PT9A 5IXBA 2DJZA 1M5Q1 4JS5A 3M56A 1WDXA 2GFAA 4OMPA 5DLQE 2VWFA 3I5SA 1VQNA 2X9HA 4BDZA 4FIBA 3EGXA 2QK0A 2K4YA 1ZSZC 2OTLA 3JAME 3JCMc 1WIEA 1D1BA 4RUGA 1VQKT 2IIMA 4JRKA 1K9AA 3TREA 1W70A 4LDUA 1J3TA 4HKEA 2PTKA 2BZXA 1OX8A 4M7DC 4M7DA 3NHNA 3KBGA 3MEWA 3VRYA 3H0FA 1VQ6T 3DB3A 2C0OA 2YXYA 1D3BA 1WNLA 3HTRA 2P4TA 3O5ZA 4EMKB 2X51A 3MP6A 3OYGA 2DNUA 4J6YA 4PJOD 2AKLA 2E3HA 3EGDA 1PG5B 1S1NA 2M9UA 3JCMJ 1YJWA 2YHTA 2G3RA 4PFZA 1K9MU 1KQSP 4M78G 4PJOA 3TCJA 1AEYA 2QQBA 5EC7A 1M1KC 5ECAA 4C92A 1AZEA 3QWYA 1UE9A 2EQUA 1UGRB 3VS6A 1M90R 2KXDA 2Y4XA 2FB7A 4PKCC 2X4JA 2FZKB 1LJOA 3LW5E 5FRNA 1TUGB 3SEMA 4C92E 1KJWA 1QVFS 2KNBB 4F7UF 2YUPA 3A8MB 3M0TA 4QVZA 1ARKA 5KYYB 4XU1A 3HHTB 3CCUT 5A0GA 5CR2A 2HDAA 1QCNA 2D6FA 1UDLA 2M1HA 2MF2A 4IIOA 4X1VA 4C8QC 1VQPT 1Q7YR 2CP6A 1OU9A 1G5VA 4M75F 3G4SQ 1ZA2B 1Z9QA 3JCMh 1NJIC 1HYOA 3M4YA 3H6ZA 2NYSA 3KXTA 2EYWA 2HCKA 2VYTA 2QAZA 1KD1R 2CREA 2DVJA 4IUQA 1W6XA 2EYXA 4C8QE 3QZ5B 4E7IA 1VQMT 1YJNT 3NMZC 1KD1U 3H9NA 4M78A 4O5VA 2YRDA 2HSEB 2MAMA 2NUTA 2DD5A 5GMKe 2VASA 3NGPA 2CSIA 1YIJQ 2ZZDA 2XKOC 3CCRQ 3CMET 3CCVQ 5LJ5g 2KI7A 1MV3A 4RTUA 4M75E 4DA4A 5IHNA 2LT1A 2BZYA 2H3EB 3RDVA 2F2WA 2W10A 1PSFA 4WF2A 1IRXA 3M57A 3QDRB 2D8JA 4OB2B 2LQNA 1QVPA 3PIPA 3RERA 2FPFA 4HVUA 2LT4A 1GCPA 1TSFA 2HBPA 1B07A 4B9WA 2DIGA 3I56A 1K1ZA 4ZN3A 3L2UA 1RLQC 2R5AA 2YDLA 4M77F 5LJ3j 3OW2S 2LQWA 2O31A 2K5FA 1BIBA 1PNJA 2E10A 1OEBA 1QKWA 3QG1A 2M02A 2O2OA 2RF0A 5GANh 2DEUA 1TOVA 4FL6A 4QT7A 1X6GA 4Q5WA 4HVWA 3R6NA 1RAFB 1PD1A 4OMMA 3UA6A 4A4FA 2NUPA 5I22A 2JTMA 4ESRA 1XNIA 3CMAT 1LPLA 4RKUE 5IHIA 2YUOA 3CC2T 4MMKA 4XTUA 1D09B 4BE2A 4R55A 4D6WA 4AFZC 3X25B 2CP7A 3RESA 2RI5A 2FO0A 2IPOB 1YJ9T 4DBQA 1WI7A 2OTJQ 2MWPA 3C94A 4JRIA 1YWPA 1RI9A 1X6OA 2KRMA 4E7SA 1YP5A 2D8HA 1WA7A 1IXDA 1YJNQ 1M1KU 8AT1B 5GAN5 1QP2A 3S6WA 1QKXA 4AFQC 4X9DA 2DRKA 1VYTA 5GMKj 2A3LA 1JEGA 1WLPB 2DERA 3U23A 1VOMA 2FVUA 1U1TA 2LNHB 3EH1A 2E4HA 3L1AA 2SRCA 1SEMA 3EFRA 5KYWA 3EG9A 4YTLA 2LJ3A 2BIVA 1BI3A 5FROA 1XOVA 4BB7A 1M8MA 2IVWA 4Y28E 3OS5A 2WACA 3NTIA 1FMKA 3CC4Q 2LP5A 2X4WA 4XTXA 2ZAEA 2P0KA 3ULRB 3OSVA 4VUBA 4HT8A 1JB0E 3KUFA 1V29B 1SKUB 2O9VA 1WHKA 2G6FX 4M77B 2KK4A 3AT1B 4X9CA 4XTYA 2V8KA 2VB6A 5CK9A 2CP5A 3G1JA 1VQOA 3OYDA 2DYIA 2EQIA 2E64A 4AG2C 2ZPBB 3MCAB 3RMSA 4E7HA 1I0CA 3G71T 3EG1A 1YHQQ 3EGUA 3E9GA 2DXUA 2DKGA 4BI4A 1TWBA 3REAB 2I0NA 1Q7YU 4RG8A 2H3JA 1TUDA 4M7AG 3CC7T 4Y92A 2AK5A 5FLXE 1U5SA 4DQ2A 2DL8A 1VQ7A 1GBQA 3CBPA
chains in the Genus database with same CATH topology
3DB4A 3SDZA 3MP8A 1BI0A 2DAQA 2JTFA 3A8HB 1YCYA 3L2WA 4IURA 2HQXA 3QUIA 4JJNK 1VQOT 2E12A 2EKOA 4C92D 3GNGA 2NLUA 1XQHA 1RL2A 2CZ1B 3P8HA 4KUDK 4M75B 3V7SA 3JCMf 4OF1A 3VUBA 3BW1A 3VU3C 3RKXA 1VIFA 3GF5A 4II1A 4J83A 5CAIA 2BKDN 4XTZA 3LX7A 3FC3A 1Y71A 4BDYA 4M7DB 1YIJT 2MI6A 1Q86U 4XK8E 5L8RE 3S3OA 3JB9D 2F5KA 1KG1A 3JCMb 1VQKA 3L2VA 1U1SA 2LVMA 5GAOq 2P0QA 4GLKA 3OS1A 2CYZB 1VQLA 3FRNA 2XDDA 4MZTA 5GAMf 2K3YA 5GAN3 3FDRA 1N8RU 3UWNA 5C6SA 1VQNT 1Y07A 2RJFA 3G7ZA 1B34B 1O9SA 2JOYA 4N4HA 1KD1C 4O6JA 2KMTA 4DOVA 1SSFA 3HP9A 3TU4K 3G6EA 2HAXA 3GPLA 4UC4A 4M77A 3A8LB 2EJ9A 4M78C 1UGSB 2PUKB 1K73C 2LCLA 5LJ3d 4F7UG 3VKIA 2DVEA 2DXBA 4IUUA 3PFSA 4OGEA 3UT1A 3MHXA 4EMKA 1K73U 4L59A 1VQ5A 2XICA 3NTHA 3M58A 3G4ST 2ZPEB 3X28B 1G3SA 3O8VA 1QP3A 1O75A 5CKFA 3RKYA 4LDXA 4ATOA 4M7AF 3L2ZA 4LD9K 3AHUA 2V8IA 4MZPA 3T9NA 4C92B 2LX9A 2ZGWA 4DOWA 3OYYA 4JRPA 4N4IA 1BYMA 4PL6A 4OVAA 4JLIA 5LJ5f 3JCMW 5GANg 2DZCA 2K2VA 5M9OA 1Y7XA 2E6ZA 3MEAA 1M8VA 4CI0C 3PMTA 3QXEB 2QI2A 4N0AC 4M7AB 2E65A 3M54A 3ZFJA 1G3YA 3CCQA 4PJOB 4M75D 2VGMA 2RK1A 3MO8A 1HK9A 5KCOA 2KQWA 2QQ9A 4BI8B 3JCMQ 1BI1A 3CD6T 4BE1A 5GAOl 4L5GA 1YJ9A 4C5GA 2B8AA 5HY6A 1VQ9T 2I2LA 3C95A 3QO3A 1YITA 1Q86C 3M59A 2QDYB 3OMCA 2RHYA 3SWNC 4JUVA 4XQ3A 1FXXA 3Q1JA 2ZPHB 1YI2A 3CCST 4HCCA 5J26A 3SWNA 1KQ2A 4LDVA 4ZN1A 1YHQT 2OAUA 3CC2A 2JVVA 2RJDA 2XG8D 2PUOB 5CIUA 2M0OA 3RKWA 1YITT 1VQ9A 2PVGB 2ZPFB 1M1FA 3CMAA 2DO3A 3CD6A 3P8DA 3HRTA 5LJ5j 1H641 4M77G 2KVQG 3NTKA 5GAOp 1I5LA 5A0DA 3HL8A 2E6NA 2L89A 2DXTA 3H8ZA 4RG2A 3WVDB 3OQ5A 3BFMA 3QZ9B 3CCQT 2QTXA 2A7YA 2GFUA 2RHIA 3UDCA 3CPFA 3OSSC 3QJYA 4M7AC 4M77E 3A8OB 5EG2A 3OYKA 5CQXA 5C0MA 5GAN8 2CS7A 4A53A 1M90C 3CCRA 3JB9H 1HXDA 1ZHIA 2XU8A 2JUFA 2VXEA 4EMGA 1M1GA 5HKCA 4KULA 5CVIA 2RO0A 3OY9A 2QQAA 5CO7A 4C92C 4M78F 4BACA 2R58A 2X35A 3CCVA 2IG0A 5GANe 3G4SA 1IZ6A 3EAEA 3OBYA 4C0ZA 2RM4A 4M78E 2BUDA 3OYFA 2PVOB 5IN1A 3OB9A 4A4GA 4NL3A 4LD6A 5I2SA 3PTAA 3JB9G 4NOYA 3ZEHA 3I56T 2ZCFB 3CCMT 4M77C 2P0PA 3PT9A 1WGSA 2DJZA 5DY9A 3A8GB 1M5Q1 5HK0A 3QSUA 4JS5A 3M56A 5LJ5h 1I4K1 4C5EA 3MEUA 4XTWA 1VQ5T 4HT9A 2EJFA 4KBMB 2GFAA 4J6XA 1WJSA 5DLQE 3BDLA 5CQYA 1GXIE 1VQNA 4JS4A 4FIBA 4BDZA 3L42A 1B34A 2K4YA 2OTLA 2LDMA 2LRQA 5KE2A 3JAME 3JCMc 5LJ3g 1VQLT 4BI3A 4FM4B 3X24B 1UGQB 1VQKT 3LWIA 3OYIA 4JRKA 3TREA 4V2SA 1WQ7A 4LDUA 5KH6A 4HKEA 1YIJA 4ZGEB 4IUVA 4M7DA 4M7DC 4ZTFA 3DLMA 3P8BB 4C0DC 3KBGA 3MEWA 4XTVA 1VQ6T 3DB3A 2Y90A 4NS5A 3L2RA 1D3BA 1G3WA 5CKDA 1WNLA 4PLLA 3OA6A 4XU0A 1G3TA 4ELYC 2P4TA 1ZBXA 1VQ8T 4EMKB 3MP6A 3OYGA 2LCCA 4J6YA 4E47A 2X4XA 2XDPA 4M7DE 4PJOD 1VUBA 2RK2A 2VGNA 5FRMA 5GANj 3CXCA 3RIRA 4ZGDB 4BE0A 3L2QA 1VQ4A 2ZPGB 3LLRA 2DTOA 2RHUA 4F7UE 3VJPA 1QW1A 2M9UA 3ER0A 2VXFA 1NPRA 3JCMJ 1YJWA 2YHTA 2G3RA 3RUXA 3SFMA 1JJ2S 3SD4A 3CCET 4RCBA 5D6WA 2QEXT 1K9MU 1N27A 3QYGB 4M78G 3CCLT 4PJOA 2EQMA 4OGCA 4Z02A 3TCJA 2QQBA 2X4YA 5GAN2 4X34A 1M1KC 3CCJT 2K5LA 3QBYA 4C92A 2CKKA 4LDYA 1D3BB 2VV5A 2EQUA 1KQSS 1UGRB 1FWZA 2O4XA 2QQSA 1PSEA 1KC8U 2DPPB 3JB9I 2XD0A 2Y4XA 2FB7A 1I8FA 4PKCC 4LDWA 2X4JA 4BD3A 1VQPA 1LJOA 2C06A 2PQWA 3LW5E 4C8QA 4PLIA 3OYJA 5FRNA 3OW2A 2L5QA 4C92E 1QVFS 4F7UF 5D6XA 3CCUA 3MEVA 5LJ5d 2L8DA 4QQDA 5GAMj 3A8MB 4GY5A 3JSCA 2FL7A 4QVZA 3OYCA 4M7DG 3M9QA 2K5IA 4XU1A 3PNWC 3HHTB 5LJ5e 2E5QA 3CCUT 2ZPIB 4A4KA 5A0GA 2JZ2A 5CR2A 2D6FA 2VC8A 4M7DD 4PJOE 2R5MA 2MWOA 5LJ3h 2M1HA 2MF2A 1WJRA 3CBPA 5HK3A 3OYHA 4C8QC 4CRIA 1VQPT 1NPPA 3J80E 4QVCA 1NJIU 4M75F 3FEOA 3RMQA 1N6AA 1G5VA 3HSBA 5AYFA 3JCMh 5GMKh 1Q81C 1NJIC 3M4YA 3H6ZA 4RMOA 2O4XB 3KXTA 1W2BS 2LTOA 2VYTA 2RHXA 5IAYA 1RI0A 2EJGA 2R57A 4IUQA 3WXMB 4C8QE 5FU7B 2HD0A 3QZ5B 5J3BA 2QXFA 3N5BB 4A4HA 3CCLA 2DD4A 2K57A 4OP0A 2D9TA 2E1HA 2EQKA 4E7IA 1VQMT 1YJNT 5GAMg 1KD1U 3HRUA 2E41A 3QPHA 4M77D 2RI3A 3CCEA 2XI9A 3MP1A 4M78A 4O5VA 4PJOG 3JCMV 2DIQA 5CCAA 3GIBA 1YJWT 2RH2A 2MAMA 4M75G 2DD5A 3C12A 2KSSA 5CKEA 5FU6B 5GMKe 2QQRA 2EAYA 4C92G 1TH7A 1VQ4T 4BY6B 4E7KA 3J7AF 4JRQA 3VYGA 1QVGS 2ZZDA 4BY6C 4EDUA 3S3NA 2RB6A 1VQ8A 2XKOC 5A2QE 4MZMA 1UGPB 4M78D 3CMET 3V8LA 4C8QG 4HCBA 3M4GA 3V8KA 1VQ6A 4C0DB 1KC8C 4J5YA 4C8QD 3LWHA 5GAMd 4MDWA 5LJ5g 2AHJB 2LQ8A 3BY7A 5FU7C 5GAMh 3CPWA 3HFNA 4M75E 4XU3A 4DA4A 3M53A 2DEQA 4J7FA 1N9SA 2LT1A 2O01E 3LH0A 4M78B 3QHSA 1KQ1A 3WVEB 4FU6A 2OTLT 1JJ2A 3V7CA 4M7DF 5GMKi 3JCMP 1PSFA 4WF2A 2YRVA 3E1SA 3M57A 3QDRB 4OB2B 2K3XA 3V8JA 3BDUA 4A54A 1QVPA 1I81A 3SB2A 3PIPA 2RI2A 5KE3A 4EPCA 2QA4T 3ME9A 1FX7A 4P5NA 3RERA 2LT4A 3S3MA 1S72A 1QVGA 1IREB 1R8OB 2HBPA 1Y96B 1JBMA 4J7IA 4B9WA 3GP8A 3CCMA 2HQEA 2CGHA 2DIGA 3I56A 2CZ7B 1Q82U 1M90U 2XDBA 5LJ3f 3M55A 2LQKA 1Q82C 4ELZC 2KDSA 4TVRA 4ZN3A 3JCMd 4KT0E 4QQGA 3L2UA 3CCVT 2R5AA 3OMGA 1KQSA 4NL2A 5GMKm 4M77F 2EIFA 5LJ3j 3OW2S 5GANd 1N9RA 1QVFA 2K5FA 3JCMe 1BIBA 2E10A 2WSEE 3A5ZB 1VIEA 3QG1A 5CKHA 3CPWS 4PJOF 3CCRT 5GANh 5LL6S 4QQ6A 3GOXA 3CC4T 5LJ3e 2E70A 1KHCA 4FL6A 3JCMX 4ZGJB 4C92F 3OBWA 2YLBA 3JCMg 4PJOC 2EQJA 3OYAA 5GAOr 4M7AA 3CC4A 4Q5WA 3INZA 2PU9B 2JN0A 2L3RA 3GLXA 3R6OA 4A4FA 1K9MC 3LGFA 2LNVA 4JDSA 2JTMA 2KY9A 4E7LA 4C8QF 4A4EA 5A0LA 3EFSA 1XNIA 2LC4A 4XAXB 4C0FA 4EMHA 4RKUE 5IT9E 1W2BA 3CMAT 4F7UA 3OYNA 4M7AE 5DM7R 4OB3B 2DXCA 4E7JA 4MMKA 3FJPA 4XTUA 4BE2A 1YHQA 3CC2T 4R55A 4IUPA 3JB9F 4D6WA 3URGA 2EYQA 1XTDA 3CCSA 4C5IA 3X25B 1YI2T 3QKJA 3FIFA 3RESA 4IUTA 3SWNB 3VV0A 2RI5A 3X20B 1S72T 2QA4A 2RD1A 3VYHB 5D6YA 5CKBA 1YJ9T 3CXCS 1JRIA 3ASKA 2EFIA 4M75A 1OI1A 2MWPA 3C94A 3PMIA 3QJ6A 4JRIA 3LYIA 4FT4A 2FYKA 3E19A 4RCCA 4B9XA 1X6OA 3FLGA 3ZBDA 4R56A 4N0AA 5GAN6 1P92A 3HPWA 2RHZA 2HNIA 1M1KU 1LOJA 2XIDA 5GAN5 4IKFA 1QP2A 3S6WA 1MGQA 3CBMA 4QW2A 4X9DA 5GAMe 4J8OA 1Q81U 4QVDA 5GMKj 2A3LA 4OB0B 3CMEA 3HKSA 5I2MA 3JRZA 1U8RA 2FVUA 1U1TA 3F70A 4HCZA 1BIAA 1AHJB 1OZ3A 1WQWA 4EMKC 2F69A 2GQVA 3GNFB 3L1AA 4FT2A 1LNXA 3V7RA 5KCHA 3OYLA 2M16A 4HA8A 4M7AD 3C4SA 3EFRA 1K8AU 3G6ET 2YLCA 4MDXA 1M9SA 4YTLA 5GANf 2BIVA 4J6WA 3OYBA 3J81E 1BI3A 3DKMA 5FROA 5DLOA 1N8RC 1XOVA 2JNGA 3HFOA 4BB7A 3CEYA 2IVWA 3QYHB 4Y28E 1YJNA 2DK3A 1MHNA 2WACA 3OS5A 3NTIA 3OYMA 1VQMA 2V8JA 1WJQA 2WSFE 2F5TX 2X4WA 4M75C 1M4ZA 3VUZA 1BI2A 2D0QB 4ME7A 4XTXA 3LGLA 2P0KA 3E9FA 5FU6C 1X01A 3OSVA 4VUBA 4HT8A 2RJCA 3META 1X75C 2FHDA 1OZ2A 1JB0E 3HRSA 5GAOm 1OYXA 4C0GA 3OYEA 1WPYA 3X26B 4BUGA 3KUFA 1BKBA 1V29B 2RA2A 3JB9J 1Y96A 2WSCE 1NE8A 3CBOA 4M77B 2KK4A 4X9CA 4L6V5 5GAN7 4XTYA 4ZTJA 2V8KA 5CK9A 3NFCA 5I21A 3PIOA 1H3ZA 4KUIA 4MMLA 4FSXA 4C5HA 3OS2A 1VQOA 3OYDA 2CZ6B 2E64A 2CZ0B 2RJEA 1YBYA 2ZPBB 2DZ9A 4N4GA 3TEEA 5GAN4 3PGGA 4C8QB 1VQ7T 2OTJT 5GAOn 4OB1B 3MCAB 3RMSA 5GMKl 4E7HA 2GCXA 1NZ9A 3G71T 3CC7A 3I55A 3M5AA 1EIFA 1UEBA 4XU2A 3DLLA 1Q7YC 3E9GA 2DXUA 2DKGA 4Y91A 4BI4A 1W4SA 2XK0A 4F7UB 5J39A 1UB4A 3CCJA 2PVDB 2EWNA 2XHCA 2GF7A 1Q7YU 4RG8A 3UPUA 2H3JA 2Y4YA 4JLGA 3QIIA 4OMFB 1KHIA 2MMPA 3OS0A 1DJ7B 2DTIA 3I55T 2QEXA 1ZQ1A 3G71A 3CC7T 4PNOA 4M7AG 2VUBA 5FLXE 1K8AC 4DQ2A 3FB9A 2OTJA 1VQ7A 2DTHA 2KAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSB A;  3JCM h;  5GMK h;  5GAN 8;  4A53 A;  2RD1 A;  3JB9 H;  1HXD A;  3SWN B;  2VXE A;  4EMG A;  1JRI A;  1YCY A;  3QUI A;  4M75 A;  4C92 D;  2EJG A;  4C92 C;  4M78 F;  4C8Q E;  4M75 B;  3V7S A;  5GAN e;  4JRI A;  2K57 A;  4OP0 A;  3JCM f;  2E1H A;  3BW1 A;  3VU3 C;  4PJO C;  2FYK A;  2RM4 A;  4M78 E;  4RCC A;  3RKX A;  5GAM g;  4NL3 A;  2E41 A;  4M77 D;  3JB9 G;  4NOY A;  4N0A A;  4M78 A;  3JCM V;  4PJO G;  5GAN 6;  5CAI A;  3GIB A;  2HNI A;  4M77 C;  1LOJ A;  4XTZ A;  5GAN 5;  4M75 G;  2DJZ A;  5DY9 A;  3QSU A;  1M5Q 1;  1MGQ A;  4M7D B;  5LJ5 h;  5GMK e;  1I4K 1;  4X9D A;  5GAM e;  2EAY A;  4C92 G;  4XTW A;  1TH7 A;  3JB9 D;  4HT9 A;  2EJF A;  4J6X A;  4QVD A;  3JCM b;  5GMK j;  1U1S A;  5GAO q;  2RB6 A;  1B34 A;  5GAM f;  1U1T A;  4M78 D;  3JCM c;  5LJ3 g;  5GAN 3;  3V8L A;  4C8Q G;  1BIA A;  3M4G A;  3V8K A;  1B34 B;  1WQW A;  4JRK A;  4EMK C;  3L1A A;  3V7R A;  4M7A D;  1LNX A;  1WQ7 A;  4J5Y A;  4C8Q D;  5GAM d;  4HA8 A;  4V2S A;  5LJ5 g;  4M75 F;  4M77 A;  3EFR A;  2EJ9 A;  4M7D C;  2YLC A;  4M7D A;  4M78 C;  3BY7 A;  5GAM h;  3HFN A;  5GAN f;  4M75 E;  4J6W A;  4XU3 A;  4XTV A;  2DEQ A;  5LJ3 d;  4F7U G;  1N9S A;  2DVE A;  2Y90 A;  4EMK A;  1D3B A;  3HFO A;  4M78 B;  3QHS A;  1KQ1 A;  1WNL A;  4M7D F;  3V7C A;  5GMK i;  4XU0 A;  3JCM P;  4M75 C;  4WF2 A;  4EMK B;  3RKY A;  4J6Y A;  4M7A F;  3V8J A;  3L2Z A;  3AHU A;  3BDU A;  4M7D E;  4PJO D;  4A54 A;  2ZGW A;  4XTX A;  3SB2 A;  1I81 A;  3RIR A;  4C92 B;  5GAN j;  5LJ5 f;  4JLI A;  1X01 A;  2DTO A;  4F7U E;  3RER A;  3JCM W;  5GAN g;  2DZC A;  4HT8 A;  2VXF A;  3JCM J;  1Y96 B;  2YHT A;  1JBM A;  5GAO m;  1M8V A;  3RUX A;  2CGH A;  1WPY A;  5LJ3 f;  4M7A B;  4N0A C;  4PJO B;  4RCB A;  2E65 A;  2RA2 A;  3JB9 J;  1Y96 A;  4M75 D;  4M78 G;  3JCM d;  4PJO A;  4M77 B;  4X9C A;  5GAN 7;  4XTY A;  1HK9 A;  4NL2 A;  5I21 A;  5GMK m;  4M77 F;  5GAN 2;  5LJ3 j;  3JCM Q;  5GAN d;  1N9R A;  4MML A;  4C92 A;  3JCM e;  1BIB A;  2E10 A;  5GAO l;  1D3B B;  2E64 A;  4PJO F;  2I2L A;  5GAN h;  3QO3 A;  3SWN C;  4JUV A;  2DZ9 A;  4XQ3 A;  5LJ3 e;  5GAN 4;  3JB9 I;  2FB7 A;  3PGG A;  1I8F A;  4C8Q B;  3JCM X;  4C92 F;  3SWN A;  2YLB A;  3JCM g;  5GAO n;  1KQ2 A;  1LJO A;  5GAO r;  5GMK l;  4M7A A;  4C8Q A;  3INZ A;  3RKW A;  4C92 E;  2JN0 A;  4XU2 A;  4F7U F;  4Y91 A;  2DXU A;  2DKG A;  5LJ5 d;  4F7U B;  5GAM j;  5LJ5 j;  1H64 1;  2EWN A;  4M77 G;  5GAO p;  4C8Q F;  1I5L A;  4M7D G;  3EFS A;  4XU1 A;  5LJ5 e;  4EMH A;  2DXT A;  4F7U A;  4M7A G;  2DTI A;  4M7D D;  4M7A E;  4PJO E;  3BFM A;  2VC8 A;  4PNO A;  2QTX A;  3FJP A;  4MMK A;  4XTU A;  5LJ3 h;  3JB9 F;  4DQ2 A;  3FB9 A;  4C8Q C;  4M7A C;  4M77 E;  4QVC A;  2DTH A;  3FIF A;  3RES A; 
#chains in the Genus database with same CATH topology
 3A8H B;  1OUL A;  2JTF A;  1GL5 A;  2HQX A;  4CC4 B;  1GCQ A;  3RR6 A;  2CDT A;  3P8H A;  4M75 B;  4OF1 A;  3BW1 A;  5IHK A;  3CC2 Q;  3FC3 A;  1YIJ T;  4XK8 E;  3JB9 D;  3JCM b;  2LVM A;  2P0Q A;  3RNJ A;  1G2B A;  4MZT A;  2ATC B;  3M0R A;  3UWN A;  1B34 B;  2JOY A;  4F14 A;  3GPL A;  4UC4 A;  4M78 C;  2LCL A;  3VKI A;  1WHG A;  3LH5 A;  2DVE A;  1K73 U;  1VQ5 A;  2XIC A;  3X28 B;  1FYN A;  9ATC B;  3O8V A;  2RQR A;  4M7A F;  4FYV B;  4LD9 K;  2FPE A;  2V8I A;  3AHU A;  2LX9 A;  1BYM A;  1PM3 A;  4FW1 A;  5GAN g;  1RAE B;  3VS4 A;  2A36 A;  1Y7X A;  3MEA A;  1M8V A;  4M7A B;  4PJO B;  1PKS A;  3IQL A;  1X27 A;  2KQW A;  2MK5 A;  5KYX B;  4BE1 A;  5HY6 A;  1VQ9 T;  1RLP C;  4ZNX A;  3C95 A;  1YIT A;  3M59 A;  2ZPH B;  1MMA A;  3CCS T;  4HCC A;  1KQ2 A;  2W0Z A;  4DEX A;  3CC2 A;  3JV3 A;  2K3B A;  1IGQ A;  5CIU A;  1R0B G;  1AWX A;  3MJX A;  1M30 A;  1VQ9 A;  1H8K A;  2CH4 W;  2HL3 A;  5LJ5 j;  2DF6 A;  2CUD A;  1HD3 A;  5KYU B;  2RN8 A;  1K4U S;  2CS7 A;  1HXD A;  1UGV A;  1C1A A;  2XU8 A;  1CKB A;  5HKC A;  4KUL A;  2QQA A;  2RMO A;  3GBQ A;  3G4S A;  1QQJ A;  3EAE A;  4C0Z A;  4PJJ A;  3OYF A;  1VQ5 T;  3D7S B;  5IN1 A;  1VQK Q;  2YUQ A;  3PTA A;  5I2S A;  4NOY A;  2L3S A;  1T3L A;  4FYX B;  4C5E A;  1X2Q A;  4XTW A;  4HT9 A;  4DBR A;  4F04 B;  2YSQ A;  1TS9 A;  4JS4 A;  1CSK A;  1Q81 R;  2LRQ A;  5KE2 A;  4A63 B;  1MMN A;  4WCI A;  3OYI A;  2X3W D;  4CC7 A;  1WQ7 A;  4HVV A;  1UJ0 A;  3P8B B;  4NS5 A;  1G3W A;  2O88 A;  1VQ8 T;  2LCC A;  2X4X A;  2VGN A;  3CXC A;  4ZGD B;  2ZPG B;  2DTO A;  2RHU A;  4F7U E;  1NPR A;  1QWF A;  1U06 A;  1JJ2 S;  3SD4 A;  2LJ0 A;  3CCE T;  1AWO A;  1FMW A;  4IIM A;  2YT6 A;  4CC2 A;  4X34 A;  8ATC B;  3QBY A;  4LDY A;  1AD5 A;  1D3B B;  1XJW B;  4AT1 B;  4E7Z A;  1EX4 A;  1Y57 A;  1KC8 U;  1KFZ A;  1I8F A;  1I07 A;  2C0T A;  2KYM A;  4C8Q A;  1Q86 R;  1ACM B;  2CP2 A;  5IH2 A;  5D6X A;  2ENM A;  4GY5 A;  4OML A;  1C0M A;  4M7D G;  1GFD A;  5LJ5 e;  2ZPI B;  4A4K A;  4M7D D;  1TUC A;  1W2B P;  2MWO A;  5HK3 A;  4CRI A;  2EGE A;  1NPP A;  3J80 E;  3HSB A;  1X43 A;  2RQW A;  1Q95 G;  4D8D A;  2LTO A;  4RTV A;  5IAY A;  3PVL A;  2EJG A;  1PKT A;  1VYV A;  1NM7 A;  5FU7 B;  3CCL A;  4OP0 A;  2EQK A;  5GJW B;  3CMA Q;  3CCU Q;  5GAM g;  2E41 A;  4M77 D;  2RI3 A;  2KT1 A;  3MP1 A;  4PJO G;  5CCA A;  2DYB A;  2RH2 A;  1PCX A;  2FRY A;  3C12 A;  5FU6 B;  2QQR A;  4C92 G;  5KYU A;  4E7K A;  1YJW Q;  4EDU A;  1VQ8 A;  5A2Q E;  2J06 A;  2LCS A;  4MZM A;  4M78 D;  3V8L A;  4HCB A;  3M4G A;  1VQ6 A;  4C0D B;  1Y0M A;  1ZLM A;  3LWH A;  5GAM d;  4MDW A;  1N8R R;  3BY7 A;  3CPW A;  4J7F A;  2LZ6 B;  1UFF A;  3LH0 A;  4M78 B;  1KQ1 A;  1PRL C;  1ZSZ B;  4FU6 A;  2GTJ A;  4HXJ A;  4F16 A;  2YRV A;  3E1S A;  3V8J A;  4A54 A;  3SB2 A;  1I81 A;  1VQN Q;  4J9I A;  4AFU C;  4P5N A;  1FX7 A;  4RTY A;  1JBM A;  4J7I A;  4JJC A;  3GP8 A;  1M90 U;  2CGH A;  2QGG A;  4ELZ C;  4QQG A;  2RQV A;  4NL2 A;  1MUZ A;  5GAN d;  1N9R A;  2WSE E;  1TG0 A;  3CPW S;  2F1L A;  4PJO F;  5LL6 S;  3GOX A;  4FCY A;  3JCM X;  4C92 F;  3OBW A;  3JCM g;  3OYA A;  1VQM Q;  2NWM A;  1AWW A;  3INZ A;  2JN0 A;  2L3R A;  1K9M C;  3LGF A;  1BCO A;  4JDS A;  5A0L A;  3EFS A;  2LC4 A;  4XAX B;  1W2B A;  4C0F A;  2OJ2 A;  4F7U A;  5FW9 A;  4OB3 B;  3FJP A;  3JB9 F;  4IUP A;  2FEI A;  1E6G A;  3SWN B;  3X20 B;  1WXU A;  2EYY A;  1AOJ A;  2QAS A;  2RD1 A;  2LJ1 A;  2QDL A;  4M75 A;  2DL4 A;  2E5K A;  3PMI A;  4AFS C;  3G6E Q;  3E19 A;  2GGR A;  4RCC A;  4B9X A;  3FLG A;  1UTI A;  4N0A A;  1P92 A;  1LOJ A;  1MGQ A;  4RTZ A;  3CBM A;  4QW2 A;  5GAM e;  4J8O A;  1Q81 U;  4OB0 B;  1WHH A;  3CME A;  2JMA A;  5I2M A;  3F70 A;  1ABQ A;  1OZ3 A;  4LE9 A;  4FT2 A;  3V7R A;  5KCH A;  2M16 A;  3CPW P;  3C4S A;  2KGT A;  4GBQ A;  1QVF P;  3OYB A;  3DKM A;  5DLO A;  2A0F B;  3CEY A;  4J9F A;  4B6M A;  1VQM A;  1S72 Q;  2V8J A;  2WSF E;  1T3S A;  1K0S A;  1N5Z A;  3VUZ A;  1BI2 A;  4DBH A;  5FWB A;  4ME7 A;  3VS0 A;  3MKD A;  3HRS A;  1OZ2 A;  1NEB A;  1OYX A;  4C0G A;  1QCF A;  1WPY A;  3X26 B;  4BUG A;  1MND A;  1BKB A;  2RA2 A;  3JB9 J;  2WSC E;  1NE8 A;  2QTV A;  3EG9 B;  5I21 A;  3PIO A;  1H3Z A;  3OS2 A;  4C5H A;  2EKH A;  2KT8 A;  2COY A;  2ROT A;  1YBY A;  4JZ4 A;  2ED1 A;  1U3O A;  2L0A A;  2DZ9 A;  3PGG A;  2L2P A;  4KGX B;  2KRN A;  1B3Q A;  3CC7 A;  1X69 A;  4XU2 A;  2OAW A;  1D1A A;  1W4S A;  1UB4 A;  2EWN A;  2Y4Y A;  3QII A;  1KHI A;  2DTI A;  3REB B;  2VUB A;  4R0K A;  2KAF A;  1VQL Q;  2DIL A;  3SDZ A;  3A98 A;  3M0Q A;  3L2W A;  4IUR A;  3GNG A;  2NLU A;  2CZ1 B;  4KUD K;  2PNI A;  3V7S A;  4E2F B;  2DL7 A;  3VUB A;  3VU3 C;  3RKX A;  1VIF A;  3GF5 A;  2BKD N;  3LX7 A;  3EG3 A;  1Y71 A;  4M7D B;  1VQK A;  3L2V A;  2GTO A;  5GAO q;  2K79 A;  4GLK A;  3FRN A;  2LMJ A;  1EFN A;  3FDR A;  6AT1 B;  5C6S A;  1BK2 A;  2CT4 A;  2RJF A;  1KD1 C;  4DOV A;  2HAX A;  2K7A A;  3A8L B;  2M0Y A;  1BCM A;  2PUK B;  1K73 C;  4K11 A;  5LJ3 d;  4F7U G;  1TTH B;  3M58 A;  3CC7 Q;  3EH2 A;  1O75 A;  4C92 B;  2ZGW A;  1VQP Q;  1Q82 R;  4JLI A;  1ZUU A;  2K2V A;  1GFC A;  4PK4 A;  3PMT A;  4N0A C;  3ZFJ A;  1IGU A;  3CCQ A;  4M75 D;  1NBE B;  2RK1 A;  2VGM A;  3MO8 A;  5KCO A;  2QQ9 A;  1OU8 A;  1UJY A;  4L5G A;  2X3X D;  2I2L A;  1Q86 C;  2CP0 A;  3CCJ Q;  1YI2 A;  4ZN1 A;  2OAU A;  2RJD A;  1MV0 B;  2PVG B;  2DO3 A;  3EG2 A;  2ESW A;  2F2X A;  3HRT A;  3CD6 A;  5AT1 B;  1D1C A;  3NTK A;  3HL8 A;  2E6N A;  2JJ9 A;  2L89 A;  2DXT A;  3WVD B;  2EGA A;  3OQ5 A;  1M27 C;  3QZ9 B;  2A37 A;  2QTX A;  3QJY A;  5KYX A;  1D0Y A;  5KYN A;  2FPD A;  3CCR A;  3JB9 H;  2VXE A;  4KGZ B;  1M1G A;  3OY9 A;  3QDF A;  5CO7 A;  4C92 C;  2EVR A;  1M2V B;  2IG0 A;  1IZ6 A;  2MIO A;  4PJO C;  3OBY A;  2RM4 A;  3LWI A;  4A4G A;  4NL3 A;  1NJI R;  3OW2 P;  3ZEH A;  3CCM T;  1NLP C;  3A8G B;  5LJ5 h;  2AT1 B;  3MEU A;  4KBM B;  1M1K R;  1JO8 A;  1WJS A;  1B34 A;  1MNE A;  4D8K A;  4FM4 B;  3X24 B;  1H3H A;  1IHV A;  1SRL A;  1WXT A;  1YIJ A;  4ZGE B;  2ROL A;  3DLM A;  4C0D C;  1LVK A;  5IXF A;  1W1F A;  2Y90 A;  3L2R A;  5CKD A;  3FJ5 A;  1ZA1 B;  4PLL A;  3OA6 A;  1T0H A;  1G3T A;  4ELY C;  3M0U A;  1ZBX A;  2K2M A;  2D1X A;  2A08 A;  4E47 A;  4M7D E;  1VUB A;  2RK2 A;  5FRM A;  3CD6 Q;  5GAN j;  4BE0 A;  3RIR A;  4J9G A;  1VQ4 A;  3VJP A;  1QW1 A;  2VXF A;  1JQQ A;  1YWO A;  3SFM A;  1FMV A;  5D6W A;  2QEX T;  5L23 A;  3CCL T;  1NG2 A;  4J9C A;  3I56 Q;  2JW4 A;  1KQS S;  1FWZ A;  2H8H A;  2O4X A;  1PSE A;  2DPP B;  4FYY B;  2XD0 A;  1AVZ C;  4FSS A;  4LDW A;  3VS2 A;  2C06 A;  2PQW A;  4M4Z A;  4PLI A;  3OW2 A;  2LX7 A;  5LJ5 d;  2L8D A;  4QQD A;  5GAM j;  2FL7 A;  3OYC A;  3M9Q A;  2YRC A;  3PNW C;  3H0I A;  1NYF A;  2JZ2 A;  2R5M A;  2OI3 A;  1N6A A;  1WHM A;  1UUE A;  5GMK h;  1Q81 C;  4GLM A;  1W2B S;  2AZV A;  1RI0 A;  2R57 A;  2YUN A;  3WXM B;  2CSQ A;  2HD0 A;  3VS1 A;  2QXF A;  3N5B B;  2COZ A;  2K57 A;  2M51 A;  4KRT A;  3QPH A;  3CCE A;  2XI9 A;  3H41 A;  1V1C A;  3JCM V;  4M75 G;  2P84 A;  4LXC A;  2KSS A;  2EAY A;  1TH7 A;  2HSP A;  3J7A F;  1QVG S;  4KGV B;  2RB6 A;  1H92 A;  1KK7 A;  1UGP B;  1OPK A;  4C8Q G;  3CCS Q;  2JM8 A;  3V8K A;  1JXO A;  4C8Q D;  2AHJ B;  5GAM h;  3HFN A;  3EFO A;  4XU3 A;  2KYB A;  2DEQ A;  2O01 E;  2EPD A;  3WVE B;  3TSW A;  2B86 A;  3EGX B;  1JJ2 A;  3NPF A;  3V7C A;  5GMK i;  1GCQ C;  2L3Q A;  5KE3 A;  4EPC A;  2YWW A;  3ME9 A;  1TXQ A;  2QA4 T;  1S72 A;  3CCM A;  5LJ3 f;  1Q82 C;  1JXM A;  4TVR A;  3JCM d;  2L3P A;  2BE9 B;  2EIF A;  1UG1 A;  2MPX C;  3A5Z B;  2AKK A;  4QQ6 A;  3CC4 T;  5LJ3 e;  1YNZ A;  1KHC A;  4ZGJ B;  2ECZ A;  3EG0 A;  1K9M R;  2NUP B;  4M7A A;  4OMO A;  4PJM A;  2HZY A;  1M3C A;  3GLX A;  2COW A;  1SHF A;  2KY9 A;  4E7L A;  4C8Q F;  2FZC B;  4A4E A;  5I11 A;  2MOX A;  4EMH A;  5IT9 E;  3OYN A;  4M7A E;  5DM7 R;  1AT1 B;  2DXC A;  1YHQ A;  2DX1 A;  1XTD A;  2EYQ A;  3CCS A;  1YI2 T;  3QKJ A;  1VQ6 Q;  3TQ7 P;  2DMO A;  3VYH B;  1M2V A;  5D6Y A;  1JRI A;  2EFI A;  1YN8 A;  2J6O A;  1VQ7 Q;  1OI1 A;  2HQH A;  3LYI A;  4FT4 A;  1JJ2 P;  2RQU A;  4R56 A;  1A0N B;  4IKF A;  2HNI A;  2XID A;  3PE0 A;  4J9B A;  4LUD A;  4AMC A;  1WHL A;  1RAH B;  4LUE A;  2A28 A;  2QGF B;  3HKS A;  1K73 R;  3G71 Q;  1R77 A;  1PD0 A;  1BIA A;  1AHJ B;  1WQW A;  4EMK C;  3GNF B;  1LNX A;  3OYL A;  2NUT B;  3G6E T;  4MDX A;  1EZZ B;  1VYU A;  2JS2 A;  3J81 E;  3HFO A;  2EYZ A;  3QYH B;  1VA7 A;  1YJN A;  1MHN A;  1K0X A;  1TU0 B;  2F5T X;  1NEG A;  2D0Q B;  3RBB B;  4Z89 A;  2JS0 A;  1X75 C;  3MET A;  3CXC P;  5GAO m;  3OYE A;  4PJL A;  1RUW A;  4ANJ A;  4L6V 5;  3NFC A;  2J05 A;  1WHJ A;  4KUI A;  1D0Z A;  4FSX A;  5KYY A;  1KSW A;  2CZ6 B;  4WTO B;  2CZ0 B;  2RJE A;  1F1B B;  2BTT A;  2V1R A;  4LNP A;  1ZX6 A;  4C8Q B;  1VQ7 T;  2OTJ T;  4AG1 C;  2DET A;  2JMC A;  2GCX A;  1EIF A;  1Q7Y C;  1BB9 A;  2XK0 A;  4F7U B;  3CCJ A;  1JU5 C;  2XHC A;  2KRO A;  4JLG A;  1X2K A;  2MMP A;  3VS5 A;  1VQ9 Q;  1K8A C;  1VQO Q;  1SPK A;  2DAQ A;  1VQO T;  3QUI A;  2E12 A;  3I9Q A;  1YJ9 Q;  1M3A A;  5KYW B;  4JJD A;  3JCM f;  2V26 A;  2KRS A;  4II1 A;  5CAI A;  4XTZ A;  4J9H A;  4BDY A;  1D0X A;  3S3O A;  2F5K A;  4DBF A;  3OS1 A;  2CYZ B;  1VQL A;  3C0C A;  2MCN A;  2K3Y A;  5GAN 3;  1VQN T;  1WFW A;  1Y07 A;  2DFU A;  1O9S A;  4KH0 B;  1SSF A;  3TU4 K;  4M77 A;  1RAG B;  2EJ9 A;  2JM9 A;  1WX6 A;  1RAD B;  2DXB A;  4IUU A;  3PFS A;  4OGE A;  3UT1 A;  3NTH A;  3G4S T;  1G3S A;  5CKF A;  1QP3 A;  3RKY A;  4LDX A;  4ATO A;  3L2Z A;  2AIR B;  3M0S A;  4DOW A;  3OYY A;  5LJ5 f;  2E6Z A;  4CI0 C;  1KC8 R;  2QI2 A;  3M54 A;  3I5R A;  1HK9 A;  1WXB A;  2EBP A;  5D7U A;  4BI8 B;  3JCM Q;  1BI1 A;  3CD6 T;  5GAO l;  3I55 Q;  4FW2 A;  2B8A A;  4C5G A;  3UA7 A;  2DE0 X;  1NLO C;  2BZ8 A;  4JUV A;  4Z8A A;  5FWC A;  5J26 A;  2JVV A;  1BBZ A;  2DM1 A;  2PUO B;  2QEX Q;  1M3B A;  2M0O A;  4QKU A;  1YIT T;  2ZPF B;  1M1F A;  3P8D A;  4M77 G;  2KVQ G;  5GAO p;  1I5L A;  3MPU B;  5A0D A;  4RG2 A;  3SHW A;  2A7Y A;  2GFU A;  2FZG B;  3UDC A;  3OSS C;  3TVT A;  4M7A C;  3A8O B;  5CQX A;  5C0M A;  1VQ8 Q;  4A53 A;  1M90 C;  2RPN A;  1YIT Q;  5CVI A;  2RO0 A;  1B7T A;  3THK A;  2JT4 A;  2J6K A;  4M78 F;  2X35 A;  3H0H A;  3CCV A;  5GAN e;  2GQI A;  2PVO B;  4LD6 A;  4RTT A;  3I56 T;  4J9E A;  2P0P A;  1WGS A;  2OX7 A;  5DY9 A;  5HK0 A;  3QSU A;  1I4K 1;  3CCL Q;  2EJF A;  4J6X A;  3BDL A;  5CQY A;  2K6D A;  1GXI E;  1ZSZ A;  3L42 A;  2LDM A;  1VQL T;  5LJ3 g;  4BI3 A;  1UGQ B;  2AZS A;  4V2S A;  5KH6 A;  1UHC A;  4IUV A;  4ZTF A;  4XTV A;  2RNA A;  2NUZ A;  4XU0 A;  2XDP A;  2EGC A;  1ABO A;  3L2Q A;  3LLR A;  2KBT A;  3ER0 A;  3RUX A;  2JTE A;  4RTW A;  2CP3 A;  2RQT A;  4RCB A;  4F17 A;  3UF4 A;  4OMQ A;  1N27 A;  3QYG B;  2EQM A;  4OGC A;  4Z02 A;  3VS7 A;  4PJN A;  2X4Y A;  5GAN 2;  2DBK A;  3CCM Q;  3CCJ T;  2K5L A;  1UEC A;  2CKK A;  1QWE A;  2VV5 A;  2QQS A;  3JB9 I;  1WYX A;  1OPL A;  4BD3 A;  1VQP A;  1QCO A;  4ORZ A;  1ZSG A;  1YCS B;  3OYJ A;  2L5Q A;  1HJD A;  3CCU A;  3MEV A;  1I5O B;  3JSC A;  1IO6 A;  2K5I A;  1PRM C;  2E5Q A;  4RTX A;  1G8X A;  4PJO E;  2VC8 A;  5LJ3 h;  1WJR A;  3OYH A;  1NJI U;  4QVC A;  3RMQ A;  3FEO A;  5AYF A;  1RAA B;  4RMO A;  2O4X B;  2RHX A;  1ZBJ A;  5J3B A;  4A4H A;  2DD4 A;  2D9T A;  2E1H A;  2HL5 C;  3HRU A;  2EW3 A;  2DIQ A;  3GIB A;  1HSQ A;  4Z88 A;  1YJW T;  2OTL Q;  1VQ4 Q;  5CKE A;  1K8A R;  1VQ4 T;  4BY6 B;  4JRQ A;  3VYG A;  2K9G A;  4BY6 C;  3S3N A;  4LN2 A;  1GRI A;  1OV3 A;  4OMN A;  1KC8 C;  3BE3 A;  1RAI B;  4J5Y A;  2QA4 Q;  3PVQ A;  3I35 A;  1KIK A;  1OOT A;  1OX9 A;  2LQ8 A;  2JXB A;  5FU7 C;  3M53 A;  1SHG A;  1WZO A;  1N9S A;  4J9D A;  3QHS A;  2OTL T;  4M7D F;  3JCM P;  3UAT A;  3VS3 A;  1YFN A;  2K3X A;  1QMC A;  3BDU A;  2BE7 D;  2RI2 A;  1SF9 A;  3QWX X;  5GJV B;  3S3M A;  1QVG A;  3EGD B;  1IRE B;  1R8O B;  1Y96 B;  1MMD A;  1Q82 U;  2HQE A;  2XDB A;  2CZ7 B;  2CH4 A;  3M55 A;  2LQK A;  2DLP A;  1C6V X;  2KDS A;  2Z0W A;  1IB8 A;  4KT0 E;  3CCV T;  3OMG A;  1KQS A;  5GMK m;  2C0I A;  1QVF A;  3JCM e;  1VIE A;  1Z9Z A;  3CQT A;  5CKH A;  2DBM A;  3CCR T;  2CUB A;  2J7I A;  2E70 A;  2YLB A;  2EQJ A;  5GAO r;  3CCE Q;  1IHW A;  3CC4 A;  1ZUY A;  2PU9 B;  2P4R A;  3R6O A;  2LNV A;  3EHR A;  1GBR A;  1G83 A;  4E7J A;  2D0N A;  1UHF A;  3URG A;  1Q86 U;  4C5I A;  3FIF A;  4IUT A;  3VV0 A;  4CC3 A;  1S72 T;  2QA4 A;  5CKB A;  3CXC S;  3ASK A;  2HEQ A;  2HMA A;  3QJ6 A;  2FYK A;  1K76 A;  2VVK A;  3ZBD A;  5GAN 6;  3HPW A;  1VQ5 Q;  2RHZ A;  2MYS A;  2KEA A;  2DL5 A;  1QVG P;  4QVD A;  3JRZ A;  1U8R A;  2PZ1 A;  1MMG A;  2GNC A;  1R0C B;  3EHQ A;  4HCZ A;  2F69 A;  1ZUK A;  2GQV A;  3VRZ A;  4M7A D;  4HA8 A;  1SSH A;  1BU1 A;  1K8A U;  2YLC A;  2DL3 A;  1M9S A;  5GAN f;  4J6W A;  1N8R C;  2JNG A;  2DK3 A;  3OYM A;  1WJQ A;  2E3I A;  4M75 C;  1M4Z A;  1E6H A;  1CKA A;  1YI2 Q;  3LGL A;  2ABL A;  3E9F A;  5FU6 C;  1X01 A;  2RJC A;  2FHD A;  1V76 A;  4E6R A;  1RAB B;  4DEY A;  1Y96 A;  1SG5 A;  3CBO A;  5GAN 7;  4ZTJ A;  3E2U A;  4JPB W;  4MML A;  2FG0 A;  1QLY A;  2FRW A;  4N4G A;  3TEE A;  5GAN 4;  3M0P A;  5GAO n;  4OB1 B;  5GMK l;  2SEM A;  1NZ9 A;  3I55 A;  3M5A A;  1UEB A;  3DLL A;  4Y91 A;  2XMF A;  5J39 A;  2PVD B;  2GF7 A;  2HKN A;  3UPU A;  4OMF B;  2O9S A;  3OS0 A;  1DJ7 B;  3I55 T;  2QEX A;  1ZQ1 A;  3G71 A;  4PNO A;  3FB9 A;  2OTJ A;  1AZG B;  2DTH A;  3DB4 A;  3MP8 A;  1BI0 A;  1YCY A;  4JJN K;  2EKO A;  4C92 D;  1XQH A;  1RL2 A;  1X6B A;  2DA9 A;  1M2O A;  2F2V A;  4J83 A;  4JZ3 A;  2MI6 A;  5L8R E;  4FYW B;  1KG1 A;  4PFO A;  5HCK A;  1U1S A;  4HCK A;  2GBQ A;  2XDD A;  5GAM f;  1N8R U;  3G7Z A;  4N4H A;  3A1P A;  4O6J A;  2KMT A;  4EIK A;  3HP9 A;  3G6E A;  3EFO B;  1UGS B;  4EMK A;  3TSZ A;  3MHX A;  4L59 A;  2ZPE B;  1I1J A;  3ZL7 C;  4MZP A;  3T9N A;  4JRP A;  2HBW A;  3CME Q;  3KFV A;  4N4I A;  4PL6 A;  4OVA A;  2DRM A;  4JJB A;  3JCM W;  2DZC A;  5M9O A;  1NYG A;  2V1Q A;  2ED0 A;  3QXE B;  2E65 A;  1G3Y A;  2KXC A;  1OQK A;  2KR3 A;  1T0J A;  1YJ9 A;  3QO3 A;  2QG9 B;  2QDY B;  3OMC A;  2RHY A;  3SWN C;  4XQ3 A;  1AWJ A;  1FXX A;  1LCK A;  1PC0 A;  2DJQ A;  3Q1J A;  2J6F A;  3SWN A;  4LDV A;  1YHQ T;  4KH1 B;  2XG8 D;  3RKW A;  1RAC B;  1SRM A;  3CMA A;  1H64 1;  2VKN A;  3CCQ Q;  3H8Z A;  7AT1 B;  1PWT A;  2KE9 A;  3BFM A;  3CCQ T;  1PHT A;  2RHI A;  3CPF A;  2HKQ B;  2QYZ A;  1E7O A;  4M77 E;  5EG2 A;  3OYK A;  5GAN 8;  1ZHI A;  2JUF A;  4EMG A;  4BAC A;  2R58 A;  2CT3 A;  4M78 E;  2BUD A;  3OB9 A;  4PFP A;  3JB9 G;  2ZCF B;  4M77 C;  3PT9 A;  5IXB A;  2DJZ A;  1M5Q 1;  4JS5 A;  3M56 A;  1WDX A;  2GFA A;  4OMP A;  5DLQ E;  2VWF A;  3I5S A;  1VQN A;  2X9H A;  4BDZ A;  4FIB A;  3EGX A;  2QK0 A;  2K4Y A;  1ZSZ C;  2OTL A;  3JAM E;  3JCM c;  1WIE A;  1D1B A;  4RUG A;  1VQK T;  2IIM A;  4JRK A;  1K9A A;  3TRE A;  1W70 A;  4LDU A;  1J3T A;  4HKE A;  2PTK A;  2BZX A;  1OX8 A;  4M7D C;  4M7D A;  3NHN A;  3KBG A;  3MEW A;  3VRY A;  3H0F A;  1VQ6 T;  3DB3 A;  2C0O A;  2YXY A;  1D3B A;  1WNL A;  3HTR A;  2P4T A;  3O5Z A;  4EMK B;  2X51 A;  3MP6 A;  3OYG A;  2DNU A;  4J6Y A;  4PJO D;  2AKL A;  2E3H A;  3EGD A;  1PG5 B;  1S1N A;  2M9U A;  3JCM J;  1YJW A;  2YHT A;  2G3R A;  4PFZ A;  1K9M U;  1KQS P;  4M78 G;  4PJO A;  3TCJ A;  1AEY A;  2QQB A;  5EC7 A;  1M1K C;  5ECA A;  4C92 A;  1AZE A;  3QWY A;  1UE9 A;  2EQU A;  1UGR B;  3VS6 A;  1M90 R;  2KXD A;  2Y4X A;  2FB7 A;  4PKC C;  2X4J A;  2FZK B;  1LJO A;  3LW5 E;  5FRN A;  1TUG B;  3SEM A;  4C92 E;  1KJW A;  1QVF S;  2KNB B;  4F7U F;  2YUP A;  3A8M B;  3M0T A;  4QVZ A;  1ARK A;  5KYY B;  4XU1 A;  3HHT B;  3CCU T;  5A0G A;  5CR2 A;  2HDA A;  1QCN A;  2D6F A;  1UDL A;  2M1H A;  2MF2 A;  4IIO A;  4X1V A;  4C8Q C;  1VQP T;  1Q7Y R;  2CP6 A;  1OU9 A;  1G5V A;  4M75 F;  3G4S Q;  1ZA2 B;  1Z9Q A;  3JCM h;  1NJI C;  1HYO A;  3M4Y A;  3H6Z A;  2NYS A;  3KXT A;  2EYW A;  2HCK A;  2VYT A;  2QAZ A;  1KD1 R;  2CRE A;  2DVJ A;  4IUQ A;  1W6X A;  2EYX A;  4C8Q E;  3QZ5 B;  4E7I A;  1VQM T;  1YJN T;  3NMZ C;  1KD1 U;  3H9N A;  4M78 A;  4O5V A;  2YRD A;  2HSE B;  2MAM A;  2NUT A;  2DD5 A;  5GMK e;  2VAS A;  3NGP A;  2CSI A;  1YIJ Q;  2ZZD A;  2XKO C;  3CCR Q;  3CME T;  3CCV Q;  5LJ5 g;  2KI7 A;  1MV3 A;  4RTU A;  4M75 E;  4DA4 A;  5IHN A;  2LT1 A;  2BZY A;  2H3E B;  3RDV A;  2F2W A;  2W10 A;  1PSF A;  4WF2 A;  1IRX A;  3M57 A;  3QDR B;  2D8J A;  4OB2 B;  2LQN A;  1QVP A;  3PIP A;  3RER A;  2FPF A;  4HVU A;  2LT4 A;  1GCP A;  1TSF A;  2HBP A;  1B07 A;  4B9W A;  2DIG A;  3I56 A;  1K1Z A;  4ZN3 A;  3L2U A;  1RLQ C;  2R5A A;  2YDL A;  4M77 F;  5LJ3 j;  3OW2 S;  2LQW A;  2O31 A;  2K5F A;  1BIB A;  1PNJ A;  2E10 A;  1OEB A;  1QKW A;  3QG1 A;  2M02 A;  2O2O A;  2RF0 A;  5GAN h;  2DEU A;  1TOV A;  4FL6 A;  4QT7 A;  1X6G A;  4Q5W A;  4HVW A;  3R6N A;  1RAF B;  1PD1 A;  4OMM A;  3UA6 A;  4A4F A;  2NUP A;  5I22 A;  2JTM A;  4ESR A;  1XNI A;  3CMA T;  1LPL A;  4RKU E;  5IHI A;  2YUO A;  3CC2 T;  4MMK A;  4XTU A;  1D09 B;  4BE2 A;  4R55 A;  4D6W A;  4AFZ C;  3X25 B;  2CP7 A;  3RES A;  2RI5 A;  2FO0 A;  2IPO B;  1YJ9 T;  4DBQ A;  1WI7 A;  2OTJ Q;  2MWP A;  3C94 A;  4JRI A;  1YWP A;  1RI9 A;  1X6O A;  2KRM A;  4E7S A;  1YP5 A;  2D8H A;  1WA7 A;  1IXD A;  1YJN Q;  1M1K U;  8AT1 B;  5GAN 5;  1QP2 A;  3S6W A;  1QKX A;  4AFQ C;  4X9D A;  2DRK A;  1VYT A;  5GMK j;  2A3L A;  1JEG A;  1WLP B;  2DER A;  3U23 A;  1VOM A;  2FVU A;  1U1T A;  2LNH B;  3EH1 A;  2E4H A;  3L1A A;  2SRC A;  1SEM A;  3EFR A;  5KYW A;  3EG9 A;  4YTL A;  2LJ3 A;  2BIV A;  1BI3 A;  5FRO A;  1XOV A;  4BB7 A;  1M8M A;  2IVW A;  4Y28 E;  3OS5 A;  2WAC A;  3NTI A;  1FMK A;  3CC4 Q;  2LP5 A;  2X4W A;  4XTX A;  2ZAE A;  2P0K A;  3ULR B;  3OSV A;  4VUB A;  4HT8 A;  1JB0 E;  3KUF A;  1V29 B;  1SKU B;  2O9V A;  1WHK A;  2G6F X;  4M77 B;  2KK4 A;  3AT1 B;  4X9C A;  4XTY A;  2V8K A;  2VB6 A;  5CK9 A;  2CP5 A;  3G1J A;  1VQO A;  3OYD A;  2DYI A;  2EQI A;  2E64 A;  4AG2 C;  2ZPB B;  3MCA B;  3RMS A;  4E7H A;  1I0C A;  3G71 T;  3EG1 A;  1YHQ Q;  3EGU A;  3E9G A;  2DXU A;  2DKG A;  4BI4 A;  1TWB A;  3REA B;  2I0N A;  1Q7Y U;  4RG8 A;  2H3J A;  1TUD A;  4M7A G;  3CC7 T;  4Y92 A;  2AK5 A;  5FLX E;  1U5S A;  4DQ2 A;  2DL8 A;  1VQ7 A;  1GBQ A;  3CBP A; 
#chains in the Genus database with same CATH homology
 3DB4 A;  3SDZ A;  3MP8 A;  1BI0 A;  2DAQ A;  2JTF A;  3A8H B;  1YCY A;  3L2W A;  4IUR A;  2HQX A;  3QUI A;  4JJN K;  1VQO T;  2E12 A;  2EKO A;  4C92 D;  3GNG A;  2NLU A;  1XQH A;  1RL2 A;  2CZ1 B;  3P8H A;  4KUD K;  4M75 B;  3V7S A;  3JCM f;  4OF1 A;  3VUB A;  3BW1 A;  3VU3 C;  3RKX A;  1VIF A;  3GF5 A;  4II1 A;  4J83 A;  5CAI A;  2BKD N;  4XTZ A;  3LX7 A;  3FC3 A;  1Y71 A;  4BDY A;  4M7D B;  1YIJ T;  2MI6 A;  1Q86 U;  4XK8 E;  5L8R E;  3S3O A;  3JB9 D;  2F5K A;  1KG1 A;  3JCM b;  1VQK A;  3L2V A;  1U1S A;  2LVM A;  5GAO q;  2P0Q A;  4GLK A;  3OS1 A;  2CYZ B;  1VQL A;  3FRN A;  2XDD A;  4MZT A;  5GAM f;  2K3Y A;  5GAN 3;  3FDR A;  1N8R U;  3UWN A;  5C6S A;  1VQN T;  1Y07 A;  2RJF A;  3G7Z A;  1B34 B;  1O9S A;  2JOY A;  4N4H A;  1KD1 C;  4O6J A;  2KMT A;  4DOV A;  1SSF A;  3HP9 A;  3TU4 K;  3G6E A;  2HAX A;  3GPL A;  4UC4 A;  4M77 A;  3A8L B;  2EJ9 A;  4M78 C;  1UGS B;  2PUK B;  1K73 C;  2LCL A;  5LJ3 d;  4F7U G;  3VKI A;  2DVE A;  2DXB A;  4IUU A;  3PFS A;  4OGE A;  3UT1 A;  3MHX A;  4EMK A;  1K73 U;  4L59 A;  1VQ5 A;  2XIC A;  3NTH A;  3M58 A;  3G4S T;  2ZPE B;  3X28 B;  1G3S A;  3O8V A;  1QP3 A;  1O75 A;  5CKF A;  3RKY A;  4LDX A;  4ATO A;  4M7A F;  3L2Z A;  4LD9 K;  3AHU A;  2V8I A;  4MZP A;  3T9N A;  4C92 B;  2LX9 A;  2ZGW A;  4DOW A;  3OYY A;  4JRP A;  4N4I A;  1BYM A;  4PL6 A;  4OVA A;  4JLI A;  5LJ5 f;  3JCM W;  5GAN g;  2DZC A;  2K2V A;  5M9O A;  1Y7X A;  2E6Z A;  3MEA A;  1M8V A;  4CI0 C;  3PMT A;  3QXE B;  2QI2 A;  4N0A C;  4M7A B;  2E65 A;  3M54 A;  3ZFJ A;  1G3Y A;  3CCQ A;  4PJO B;  4M75 D;  2VGM A;  2RK1 A;  3MO8 A;  1HK9 A;  5KCO A;  2KQW A;  2QQ9 A;  4BI8 B;  3JCM Q;  1BI1 A;  3CD6 T;  4BE1 A;  5GAO l;  4L5G A;  1YJ9 A;  4C5G A;  2B8A A;  5HY6 A;  1VQ9 T;  2I2L A;  3C95 A;  3QO3 A;  1YIT A;  1Q86 C;  3M59 A;  2QDY B;  3OMC A;  2RHY A;  3SWN C;  4JUV A;  4XQ3 A;  1FXX A;  3Q1J A;  2ZPH B;  1YI2 A;  3CCS T;  4HCC A;  5J26 A;  3SWN A;  1KQ2 A;  4LDV A;  4ZN1 A;  1YHQ T;  2OAU A;  3CC2 A;  2JVV A;  2RJD A;  2XG8 D;  2PUO B;  5CIU A;  2M0O A;  3RKW A;  1YIT T;  1VQ9 A;  2PVG B;  2ZPF B;  1M1F A;  3CMA A;  2DO3 A;  3CD6 A;  3P8D A;  3HRT A;  5LJ5 j;  1H64 1;  4M77 G;  2KVQ G;  3NTK A;  5GAO p;  1I5L A;  5A0D A;  3HL8 A;  2E6N A;  2L89 A;  2DXT A;  3H8Z A;  4RG2 A;  3WVD B;  3OQ5 A;  3BFM A;  3QZ9 B;  3CCQ T;  2QTX A;  2A7Y A;  2GFU A;  2RHI A;  3UDC A;  3CPF A;  3OSS C;  3QJY A;  4M7A C;  4M77 E;  3A8O B;  5EG2 A;  3OYK A;  5CQX A;  5C0M A;  5GAN 8;  2CS7 A;  4A53 A;  1M90 C;  3CCR A;  3JB9 H;  1HXD A;  1ZHI A;  2XU8 A;  2JUF A;  2VXE A;  4EMG A;  1M1G A;  5HKC A;  4KUL A;  5CVI A;  2RO0 A;  3OY9 A;  2QQA A;  5CO7 A;  4C92 C;  4M78 F;  4BAC A;  2R58 A;  2X35 A;  3CCV A;  2IG0 A;  5GAN e;  3G4S A;  1IZ6 A;  3EAE A;  3OBY A;  4C0Z A;  2RM4 A;  4M78 E;  2BUD A;  3OYF A;  2PVO B;  5IN1 A;  3OB9 A;  4A4G A;  4NL3 A;  4LD6 A;  5I2S A;  3PTA A;  3JB9 G;  4NOY A;  3ZEH A;  3I56 T;  2ZCF B;  3CCM T;  4M77 C;  2P0P A;  3PT9 A;  1WGS A;  2DJZ A;  5DY9 A;  3A8G B;  1M5Q 1;  5HK0 A;  3QSU A;  4JS5 A;  3M56 A;  5LJ5 h;  1I4K 1;  4C5E A;  3MEU A;  4XTW A;  1VQ5 T;  4HT9 A;  2EJF A;  4KBM B;  2GFA A;  4J6X A;  1WJS A;  5DLQ E;  3BDL A;  5CQY A;  1GXI E;  1VQN A;  4JS4 A;  4FIB A;  4BDZ A;  3L42 A;  1B34 A;  2K4Y A;  2OTL A;  2LDM A;  2LRQ A;  5KE2 A;  3JAM E;  3JCM c;  5LJ3 g;  1VQL T;  4BI3 A;  4FM4 B;  3X24 B;  1UGQ B;  1VQK T;  3LWI A;  3OYI A;  4JRK A;  3TRE A;  4V2S A;  1WQ7 A;  4LDU A;  5KH6 A;  4HKE A;  1YIJ A;  4ZGE B;  4IUV A;  4M7D A;  4M7D C;  4ZTF A;  3DLM A;  3P8B B;  4C0D C;  3KBG A;  3MEW A;  4XTV A;  1VQ6 T;  3DB3 A;  2Y90 A;  4NS5 A;  3L2R A;  1D3B A;  1G3W A;  5CKD A;  1WNL A;  4PLL A;  3OA6 A;  4XU0 A;  1G3T A;  4ELY C;  2P4T A;  1ZBX A;  1VQ8 T;  4EMK B;  3MP6 A;  3OYG A;  2LCC A;  4J6Y A;  4E47 A;  2X4X A;  2XDP A;  4M7D E;  4PJO D;  1VUB A;  2RK2 A;  2VGN A;  5FRM A;  5GAN j;  3CXC A;  3RIR A;  4ZGD B;  4BE0 A;  3L2Q A;  1VQ4 A;  2ZPG B;  3LLR A;  2DTO A;  2RHU A;  4F7U E;  3VJP A;  1QW1 A;  2M9U A;  3ER0 A;  2VXF A;  1NPR A;  3JCM J;  1YJW A;  2YHT A;  2G3R A;  3RUX A;  3SFM A;  1JJ2 S;  3SD4 A;  3CCE T;  4RCB A;  5D6W A;  2QEX T;  1K9M U;  1N27 A;  3QYG B;  4M78 G;  3CCL T;  4PJO A;  2EQM A;  4OGC A;  4Z02 A;  3TCJ A;  2QQB A;  2X4Y A;  5GAN 2;  4X34 A;  1M1K C;  3CCJ T;  2K5L A;  3QBY A;  4C92 A;  2CKK A;  4LDY A;  1D3B B;  2VV5 A;  2EQU A;  1KQS S;  1UGR B;  1FWZ A;  2O4X A;  2QQS A;  1PSE A;  1KC8 U;  2DPP B;  3JB9 I;  2XD0 A;  2Y4X A;  2FB7 A;  1I8F A;  4PKC C;  4LDW A;  2X4J A;  4BD3 A;  1VQP A;  1LJO A;  2C06 A;  2PQW A;  3LW5 E;  4C8Q A;  4PLI A;  3OYJ A;  5FRN A;  3OW2 A;  2L5Q A;  4C92 E;  1QVF S;  4F7U F;  5D6X A;  3CCU A;  3MEV A;  5LJ5 d;  2L8D A;  4QQD A;  5GAM j;  3A8M B;  4GY5 A;  3JSC A;  2FL7 A;  4QVZ A;  3OYC A;  4M7D G;  3M9Q A;  2K5I A;  4XU1 A;  3PNW C;  3HHT B;  5LJ5 e;  2E5Q A;  3CCU T;  2ZPI B;  4A4K A;  5A0G A;  2JZ2 A;  5CR2 A;  2D6F A;  2VC8 A;  4M7D D;  4PJO E;  2R5M A;  2MWO A;  5LJ3 h;  2M1H A;  2MF2 A;  1WJR A;  3CBP A;  5HK3 A;  3OYH A;  4C8Q C;  4CRI A;  1VQP T;  1NPP A;  3J80 E;  4QVC A;  1NJI U;  4M75 F;  3FEO A;  3RMQ A;  1N6A A;  1G5V A;  3HSB A;  5AYF A;  3JCM h;  5GMK h;  1Q81 C;  1NJI C;  3M4Y A;  3H6Z A;  4RMO A;  2O4X B;  3KXT A;  1W2B S;  2LTO A;  2VYT A;  2RHX A;  5IAY A;  1RI0 A;  2EJG A;  2R57 A;  4IUQ A;  3WXM B;  4C8Q E;  5FU7 B;  2HD0 A;  3QZ5 B;  5J3B A;  2QXF A;  3N5B B;  4A4H A;  3CCL A;  2DD4 A;  2K57 A;  4OP0 A;  2D9T A;  2E1H A;  2EQK A;  4E7I A;  1VQM T;  1YJN T;  5GAM g;  1KD1 U;  3HRU A;  2E41 A;  3QPH A;  4M77 D;  2RI3 A;  3CCE A;  2XI9 A;  3MP1 A;  4M78 A;  4O5V A;  4PJO G;  3JCM V;  2DIQ A;  5CCA A;  3GIB A;  1YJW T;  2RH2 A;  2MAM A;  4M75 G;  2DD5 A;  3C12 A;  2KSS A;  5CKE A;  5FU6 B;  5GMK e;  2QQR A;  2EAY A;  4C92 G;  1TH7 A;  1VQ4 T;  4BY6 B;  4E7K A;  3J7A F;  4JRQ A;  3VYG A;  1QVG S;  2ZZD A;  4BY6 C;  4EDU A;  3S3N A;  2RB6 A;  1VQ8 A;  2XKO C;  5A2Q E;  4MZM A;  1UGP B;  4M78 D;  3CME T;  3V8L A;  4C8Q G;  4HCB A;  3M4G A;  3V8K A;  1VQ6 A;  4C0D B;  1KC8 C;  4J5Y A;  4C8Q D;  3LWH A;  5GAM d;  4MDW A;  5LJ5 g;  2AHJ B;  2LQ8 A;  3BY7 A;  5FU7 C;  5GAM h;  3CPW A;  3HFN A;  4M75 E;  4XU3 A;  4DA4 A;  3M53 A;  2DEQ A;  4J7F A;  1N9S A;  2LT1 A;  2O01 E;  3LH0 A;  4M78 B;  3QHS A;  1KQ1 A;  3WVE B;  4FU6 A;  2OTL T;  1JJ2 A;  3V7C A;  4M7D F;  5GMK i;  3JCM P;  1PSF A;  4WF2 A;  2YRV A;  3E1S A;  3M57 A;  3QDR B;  4OB2 B;  2K3X A;  3V8J A;  3BDU A;  4A54 A;  1QVP A;  1I81 A;  3SB2 A;  3PIP A;  2RI2 A;  5KE3 A;  4EPC A;  2QA4 T;  3ME9 A;  1FX7 A;  4P5N A;  3RER A;  2LT4 A;  3S3M A;  1S72 A;  1QVG A;  1IRE B;  1R8O B;  2HBP A;  1Y96 B;  1JBM A;  4J7I A;  4B9W A;  3GP8 A;  3CCM A;  2HQE A;  2CGH A;  2DIG A;  3I56 A;  2CZ7 B;  1Q82 U;  1M90 U;  2XDB A;  5LJ3 f;  3M55 A;  2LQK A;  1Q82 C;  4ELZ C;  2KDS A;  4TVR A;  4ZN3 A;  3JCM d;  4KT0 E;  4QQG A;  3L2U A;  3CCV T;  2R5A A;  3OMG A;  1KQS A;  4NL2 A;  5GMK m;  4M77 F;  2EIF A;  5LJ3 j;  3OW2 S;  5GAN d;  1N9R A;  1QVF A;  2K5F A;  3JCM e;  1BIB A;  2E10 A;  2WSE E;  3A5Z B;  1VIE A;  3QG1 A;  5CKH A;  3CPW S;  4PJO F;  3CCR T;  5GAN h;  5LL6 S;  4QQ6 A;  3GOX A;  3CC4 T;  5LJ3 e;  2E70 A;  1KHC A;  4FL6 A;  3JCM X;  4ZGJ B;  4C92 F;  3OBW A;  2YLB A;  3JCM g;  4PJO C;  2EQJ A;  3OYA A;  5GAO r;  4M7A A;  3CC4 A;  4Q5W A;  3INZ A;  2PU9 B;  2JN0 A;  2L3R A;  3GLX A;  3R6O A;  4A4F A;  1K9M C;  3LGF A;  2LNV A;  4JDS A;  2JTM A;  2KY9 A;  4E7L A;  4C8Q F;  4A4E A;  5A0L A;  3EFS A;  1XNI A;  2LC4 A;  4XAX B;  4C0F A;  4EMH A;  4RKU E;  5IT9 E;  1W2B A;  3CMA T;  4F7U A;  3OYN A;  4M7A E;  5DM7 R;  4OB3 B;  2DXC A;  4E7J A;  4MMK A;  3FJP A;  4XTU A;  4BE2 A;  1YHQ A;  3CC2 T;  4R55 A;  4IUP A;  3JB9 F;  4D6W A;  3URG A;  2EYQ A;  1XTD A;  3CCS A;  4C5I A;  3X25 B;  1YI2 T;  3QKJ A;  3FIF A;  3RES A;  4IUT A;  3SWN B;  3VV0 A;  2RI5 A;  3X20 B;  1S72 T;  2QA4 A;  2RD1 A;  3VYH B;  5D6Y A;  5CKB A;  1YJ9 T;  3CXC S;  1JRI A;  3ASK A;  2EFI A;  4M75 A;  1OI1 A;  2MWP A;  3C94 A;  3PMI A;  3QJ6 A;  4JRI A;  3LYI A;  4FT4 A;  2FYK A;  3E19 A;  4RCC A;  4B9X A;  1X6O A;  3FLG A;  3ZBD A;  4R56 A;  4N0A A;  5GAN 6;  1P92 A;  3HPW A;  2RHZ A;  2HNI A;  1M1K U;  1LOJ A;  2XID A;  5GAN 5;  4IKF A;  1QP2 A;  3S6W A;  1MGQ A;  3CBM A;  4QW2 A;  4X9D A;  5GAM e;  4J8O A;  1Q81 U;  4QVD A;  5GMK j;  2A3L A;  4OB0 B;  3CME A;  3HKS A;  5I2M A;  3JRZ A;  1U8R A;  2FVU A;  1U1T A;  3F70 A;  4HCZ A;  1BIA A;  1AHJ B;  1OZ3 A;  1WQW A;  4EMK C;  2F69 A;  2GQV A;  3GNF B;  3L1A A;  4FT2 A;  1LNX A;  3V7R A;  5KCH A;  3OYL A;  2M16 A;  4HA8 A;  4M7A D;  3C4S A;  3EFR A;  1K8A U;  3G6E T;  2YLC A;  4MDX A;  1M9S A;  4YTL A;  5GAN f;  2BIV A;  4J6W A;  3OYB A;  3J81 E;  1BI3 A;  3DKM A;  5FRO A;  5DLO A;  1N8R C;  1XOV A;  2JNG A;  3HFO A;  4BB7 A;  3CEY A;  2IVW A;  3QYH B;  4Y28 E;  1YJN A;  2DK3 A;  1MHN A;  2WAC A;  3OS5 A;  3NTI A;  3OYM A;  1VQM A;  2V8J A;  1WJQ A;  2WSF E;  2F5T X;  2X4W A;  4M75 C;  1M4Z A;  3VUZ A;  1BI2 A;  2D0Q B;  4ME7 A;  4XTX A;  3LGL A;  2P0K A;  3E9F A;  5FU6 C;  1X01 A;  3OSV A;  4VUB A;  4HT8 A;  2RJC A;  3MET A;  1X75 C;  2FHD A;  1OZ2 A;  1JB0 E;  3HRS A;  5GAO m;  1OYX A;  4C0G A;  3OYE A;  1WPY A;  3X26 B;  4BUG A;  3KUF A;  1BKB A;  1V29 B;  2RA2 A;  3JB9 J;  1Y96 A;  2WSC E;  1NE8 A;  3CBO A;  4M77 B;  2KK4 A;  4X9C A;  4L6V 5;  5GAN 7;  4XTY A;  4ZTJ A;  2V8K A;  5CK9 A;  3NFC A;  5I21 A;  3PIO A;  1H3Z A;  4KUI A;  4MML A;  4FSX A;  4C5H A;  3OS2 A;  1VQO A;  3OYD A;  2CZ6 B;  2E64 A;  2CZ0 B;  2RJE A;  1YBY A;  2ZPB B;  2DZ9 A;  4N4G A;  3TEE A;  5GAN 4;  3PGG A;  4C8Q B;  1VQ7 T;  2OTJ T;  5GAO n;  4OB1 B;  3MCA B;  3RMS A;  5GMK l;  4E7H A;  2GCX A;  1NZ9 A;  3G71 T;  3CC7 A;  3I55 A;  3M5A A;  1EIF A;  1UEB A;  4XU2 A;  3DLL A;  1Q7Y C;  3E9G A;  2DXU A;  2DKG A;  4Y91 A;  4BI4 A;  1W4S A;  2XK0 A;  4F7U B;  5J39 A;  1UB4 A;  3CCJ A;  2PVD B;  2EWN A;  2XHC A;  2GF7 A;  1Q7Y U;  4RG8 A;  3UPU A;  2H3J A;  2Y4Y A;  4JLG A;  3QII A;  4OMF B;  1KHI A;  2MMP A;  3OS0 A;  1DJ7 B;  2DTI A;  3I55 T;  2QEX A;  1ZQ1 A;  3G71 A;  3CC7 T;  4PNO A;  4M7A G;  2VUB A;  5FLX E;  1K8A C;  4DQ2 A;  3FB9 A;  2OTJ A;  1VQ7 A;  2DTH A;  2KAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...