3FB9A

The crystal structure of the protein with unknown function from streptococcus pneumoniae tigr4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
b'GMSDAFTDVAKMKKIKEEIKAHEGQVVEMTLENGRKRQKNRLGKLIEVYPSLFIVEFGDVEGDKQVNVYVESFTYSDILTEKNLIHYLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title The crystal structure of the protein with unknown function from Streptococcus pneumoniae TIGR4
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 22
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06257 VEG Biofilm formation stimulator VEG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fb9A00
2DKGA 5GAOr 1HXDA 1B34B 2RM4A 3SWNB 3JCMV 5GAOq 4WF2A 5LJ3f 3SWNA 2DXTA 4M77D 4M77A 3V8JA 5GAN7 3V7RA 2E65A 5LJ3j 5LJ5h 4M7AE 4M78D 4M78A 1KQ1A 2Y90A 4M7AF 2DTIA 4J6YA 4NOYA 3SWNC 5GMKl 3FIFA 5GANg 4XTXA 4M7DA 4M77C 4M7DD 4PJOB 4EMKA 5GAMf 2YLCA 4PJOG 1WQ7A 2DEQA 2E41A 2E64A 1Y96B 2DJZA 2RA2A 4M78C 4M75B 4N0AA 4OP0A 4XU2A 4M75G 3BFMA 2EJ9A 4M75D 4RCCA 2DZ9A 4NL2A 1WNLA 3SB2A 4C8QE 4X9DA 3HSBA 4M7DC 3QHSA 4HA8A 5LJ5g 3JCMe 3JCMW 3JCMh 5GAN4 1BIBA 4N0AC 2CGHA 1JRIA 3V7SA 1JBMA 5GAN8 4XU0A 4M75C 1U1TA 1N9RA 2EJFA 4XTZA 3JB9H 1I4K1 4XU1A 5GAMd 1U1SA 2HNIA 4M77B 5GAOn 3RKWA 4M77G 5LJ5e 4M77F 5GMKm 4M78B 3JCMQ 2JN0A 2YLBA 1M8VA 4M78G 2DTOA 4M78F 1D3BA 5GAOl 4M7DB 3JCMg 1LOJA 5GANe 4PJOE 4EMKB 3RERA 4M7DG 5GMKj 4HT9A 4M7DF 2VXFA 2DVEA 2EAYA 2ZGWA 5GAMh 4M75E 4JUVA 2QTXA 3JCMP 2DXUA 4F7UB 4MMKA 4A53A 4C92D 4C92A 1I8FA 4F7UG 3BY7A 2EWNA 5LJ3d 4F7UF 2I2LA 2DTHA 4M75F 5GMKi 5GANf 3V8LA 1TH7A 4EMKC 3JCMb 3QSUA 5GANj 4QVCA 3V8KA 4C92C 2VXEA 4QVDA 1I5LA 2E1HA 3HFOA 5LJ3e 4M77E 5GAMg 3RIRA 4J6WA 1LNXA 4X9CA 5LJ3h 4Y91A 4EMGA 5GAN5 4NL3A 1KQ2A 4M7AA 4M78E 3JB9J 4JRIA 3L1AA 4F7UA 3AHUA 4EMHA 4MMLA 1D3BB 4JLIA 5GANd 1X01A 1MGQA 4M7DE 2DZCA 5I21A 5GAOp 1HK9A 4XU3A 3HFNA 5GAMe 4XTWA 4C92B 4F7UE 3JB9D 5GAN3 4A54A 4RCBA 5GAMj 4C92G 1I81A 1N9SA 3RUXA 4PNOA 4C92F 1M5Q1 3FJPA 4C8QA 3JCMf 4C8QD 5LJ3g 2VC8A 5GAN2 2YHTA 5GANh 2K57A 4M7AD 3L2ZA 3GIBA 4XTYA 4PJOF 1H641 1B34A 4C8QC 2E10A 3EFRA 3PGGA 1YCYA 4XTVA 4J5YA 1LJOA 4M7AB 5LJ5f 5GAOm 4M7AG 2RD1A 3JCMX 3JCMJ 3QUIA 4XQ3A 1BIAA 3RESA 3RKXA 5DY9A 5LJ5j 3JCMd 1WQWA 4V2SA 5GMKe 4XTUA 2FB7A 2FYKA 5GMKh 5GAN6 5CAIA 4PJOA 4J6XA 1WPYA 3EFSA 4PJOD 3QO3A 4M7AC 4C92E 3BDUA 4M75A 3V7CA 1Y96A 4JRKA 4DQ2A 3JB9G 3JB9I 3FB9A 4C8QB 3JB9F 5LJ5d 3BW1A 3JCMc 4C8QG 3INZA 4C8QF 3VU3C 2RB6A 4HT8A 3M4GA 4PJOC 2EJGA 3RKYA
chains in the Genus database with same CATH superfamily
3UDCA 1WXBA 3CCQA 3MP8A 2VGNA 2Y90A 4PJNA 2QDYB 4M7DD 5KCOA 2A3LA 1WXUA 3SHWA 3J80E 4OF1A 2M02A 3NHNA 4CRIA 3L2WA 3JCMh 2DERA 1OU9A 5D6XA 1UGSB 5KE2A 1YJ9Q 1N9RA 3X28B 2LJ1A 2CT4A 5FU6B 4AFUC 2M0YA 4EDUA 1BI1A 1V1CA 3CCVA 2M9UA 5GAOl 2HZYA 2L3PA 1M30A 1Q81U 4C92A 1NLOC 5I2SA 2V8KA 2QDLA 5GMKi 4JS4A 4DOWA 3QIIA 1GFCA 2QYZA 4OGEA 3OS2A 4BE0A 1R0BG 1GCPA 1VQ4A 1CKBA 3VV0A 2A37A 4EMHA 1ZQ1A 1D0YA 1MGQA 5IH2A 3VUZA 5GAMe 2LJ0A 3GBQA 1QVFS 1F1BB 4C0FA 3CCQT 4DOVA 1M3BA 2QTVA 3A8MB 2E70A 4FSXA 3CCUA 2K9GA 1J3TA 4E2FB 3JCMd 2NUZA 2QG9B 1GL5A 1M2OA 3TQ7P 4JRQA 1TUGB 3FJ5A 2OJ2A 5HKCA 2XMFA 3CCVQ 3CCVT 2VKNA 2RQUA 1Q82C 3OBYA 2KYBA 4FSSA 4DEXA 4P5NA 2P0QA 1Y71A 1Q82R 1EFNA 1U06A 2DX1A 3M56A 1Y96B 1K9MC 3H41A 8AT1B 4ELZC 3FDRA 4NL2A 4A4EA 2ECZA 2HQEA 1VQ4Q 1VQ4T 3TEEA 1MNDA 2A36A 2DL7A 1WDXA 2NLUA 1K9MR 4AFZC 5GJVB 4QQ6A 4R0KA 2KMTA 3HP9A 4M77F 3L2UA 2JN0A 1SEMA 1VIFA 4L59A 4TVRA 2KAFA 2ZGWA 3A98A 4GY5A 3JCMP 4YTLA 1UUEA 2RHUA 1PRLC 1ZSZB 4RTUA 4F7UF 1OX8A 2DTHA 3CCUQ 1NYGA 4J7IA 3CCUT 1TH7A 2AKKA 3OYLA 1X2KA 5C0MA 3M0SA 5I2MA 4D6WA 1UHFA 2KT1A 3HFOA 4EPCA 4ZTFA 2DXCA 4EIKA 2DRKA 1LNXA 3O5ZA 3JB9J 1RAFB 4JLIA 5GANd 1X01A 2DZCA 2DILA 1XOVA 2IPOB 3HTRA 2Z0WA 4C8QA 5LJ3g 2DBMA 3VUBA 3OYKA 2LMJA 2YWWA 4Z89A 1BI2A 2KBTA 3VS3A 5CK9A 1JO8A 1OZ2A 2X4XA 4J8OA 9ATCB 2RI5A 4IUVA 2R5AA 5GAOm 3EG0A 2DL3A 1X6OA 5GMKh 3EHQA 1OQKA 4J6XA 5D6WA 5CO7A 2YSQA 1TG0A 3UATA 3ME9A 1UDLA 3INZA 2EJGA 3D7SB 1N6AA 1B34B 1P92A 4II1A 4B9WA 1B3QA 2ZPFB 4MDXA 5LJ3f 2P4TA 3V7RA 2O2OA 1AT1B 4DBQA 3EGXA 2P0PA 4M77C 2ROLA 1WHJA 4EMKA 1VQKA 4OMQA 2ROTA 3A1PA 3BFMA 3VS5A 3M58A 1AEYA 4PL6A 1VQ6Q 1KSWA 2CGHA 2M51A 3CCLA 4AG1C 5HK0A 1WI7A 2KROA 4UC4A 4FU6A 2LQ8A 4M77G 3OS5A 2BKDN 2I0NA 2KY9A 4N4GA 2DTOA 2XI9A 1LOJA 1NLPC 1G5VA 5ECAA 1D0ZA 1PD0A 2VGMA 4F7UG 2I2LA 2BUDA 2LX7A 3QSUA 2RNAA 2FG0A 4NS5A 2HBPA 3MEVA 1Y07A 2OX7A 3OSSC 1Q95G 2E1HA 2PUKB 1KD1C 1RUWA 2EQMA 3SDZA 2DK3A 1SF9A 1N8RC 2PZ1A 1ZX6A 2DVJA 1SRLA 1KD1R 4OB2B 4E7HA 3FJPA 1N8RR 1WHKA 3ASKA 3HL8A 4PLIA 4A4KA 4HCBA 1QKXA 4ZN1A 1YNZA 2ZPBB 1K9AA 1VIEA 3LH5A 1VQKQ 1VQKT 2MWOA 1MMGA 1K9MU 2LZ6B 1MMNA 5DY9A 1GFDA 2HKNA 4LDVA 2FYKA 2JOYA 2LCCA 3CCLT 3A5ZB 3JB9F 3BW1A 3E2UA 3VU3C 1VQPA 1VOMA 4JPBW 1M90C 3S3MA 5GAOq 4XK8E 1RACB 1ZUKA 4E7JA 1E6GA 1FXXA 3S3OA 2DTIA 4NOYA 1M90R 2RQVA 3CCMA 4PJOB 1WQ7A 1AZEA 1K76A 1SHGA 4BE1A 1VQLA 3PMTA 3DLLA 3CBOA 2MF2A 2KRSA 2EFIA 5IHKA 2HMAA 3J81E 4GBQA 3L2QA 4F04B 5GAMd 1ZHIA 1PCXA 2RHIA 1VQ9A 1Z9ZA 1PWTA 4PJOE 2F5KA 2JMAA 4RTWA 3EH2A 3MEWA 2DXUA 4MMKA 2XKOC 1OZ3A 4KRTA 4F16A 1YI2Q 2MK5A 3MEAA 1WJQA 2H8HA 2K6DA 4CC3A 1NBEB 1TOVA 3VS0A 4X9CA 2PNIA 3CCSQ 4OMOA 1VQPT 3QBYA 1E6HA 4QW2A 4C92B 3JSCA 4RCBA 2LX9A 1ZBJA 2VC8A 4FT4A 1UHCA 4C0DB 4RG2A 1IHVA 4QQDA 3CCMQ 3CCMT 3I55Q 3E1SA 1PM3A 4JLGA 4M7AG 5LJ5j 5CKHA 1VQLQ 1VQLT 2K3YA 2RN8A 2C06A 1U8RA 1WPYA 2ZPIB 3MHXA 1M9SA 1G3TA 1T0HA 4C92E 1RI0A 2COWA 2KVQG 3JB9G 5IHNA 5AYFA 1UE9A 2KRMA 1VQ9Q 1VQ9T 2Y4YA 1JXOA 2DKGA 3AT1B 4E7ZA 1V29B 4BI4A 3TVTA 2LQKA 2JVVA 4OVAA 4A4FA 1Q81C 2QGGA 2A08A 3MO8A 4FYWB 4M77A 1AVZC 3UA6A 1Y7XA 3DB4A 4JJBA 3OW2S 2K7AA 2X35A 2EYZA 4CI0C 1Q81R 1T3LA 2K2MA 1VQMA 2R57A 1X75C 2DJZA 1CKAA 2AK5A 4RCCA 1TS9A 4EMGA 4F7UA 4OB3B 5LJ5g 1KD1U 2ZPHB 2MYSA 2CDTA 2GF7A 1U1TA 4BY6C 3JB9H 3A8LB 1ABQA 3PMIA 1FMKA 5GMKm 3JCMQ 5CIUA 1U5SA 2P84A 5KYUA 3CPWS 1YHQA 1S72A 2B86A 3VYGA 1S1NA 5A2QE 1OULA 4AG2C 1QWEA 4KGVB 1ZA1B 1MMDA 4ME7A 2VV5A 5LJ3e 4OGCA 4LE9A 1IZ6A 4JRIA 1QP2A 3G71A 1WZOA 3H0IA 5GAOp 1H8KA 2OAUA 4XU3A 5HK3A 1YCSB 4LD6A 2J7IA 2E6ZA 3JRZA 1B7TA 3RUXA 4Z88A 2AZVA 1VQNA 1C6VX 2CZ0B 3HRTA 1QVGA 3C12A 1D1AA 3QG1A 3CQTA 3PNWC 3QXEB 3FC3A 1VQ8A 1VQMQ 1VQMT 3PVLA 2BIVA 3JCMJ 1QVGS 3LYIA 1KQSP 2JNGA 2DA9A 1KHIA 4PJOD 4C8QB 1RABB 1G3WA 1G3YA 1RADB 4LUDA 1IREB 5GAOr 4E7LA 1WA7A 1QQJA 1PD1A 1YHQT 1S72Q 1S72T 2JS0A 4FM4B 5FROA 2EYXA 4AT1B 2AT1B 2JM9A 2L3RA 3QJYA 4IKFA 5CQYA 4M75D 4C8QE 3CC2Q 3DLMA 2X4WA 2LVMA 3S6WA 1M1KC 3G4SA 3G71T 4XU0A 2PTKA 1JJ2S 5A0GA 4XTZA 2FZGB 2GQIA 4IUPA 1KC8C 2FZKB 1M1KR 2BTTA 1WIEA 2AHJB 2LCLA 4M78F 2QGFB 3EGXB 5EC7A 5J3BA 1VQNQ 3OYGA 1VQNT 2CKKA 4EMKB 1KK7A 1KC8R 2L3QA 2DD5A 4C92D 1VQ8T 3BY7A 2QQBA 4EMKC 1NG2A 1UEBA 1PRMC 2FRWA 5DLQE 2PQWA 2ZAEA 1VYVA 1NYFA 1KQ2A 4M7AA 1SSHA 2RK1A 4MZTA 4HCKA 3ZEHA 1AZGB 2BE9B 4FIBA 2W0ZA 2H3JA 1SSFA 2MCNA 5FU7C 2DO3A 3QJ6A 4DEYA 2OTJA 1FMVA 1QLYA 1TWBA 3FRNA 4E7SA 1JU5C 1HSQA 2LC4A 5M9OA 1RAEB 3CCRA 2O01E 4MDWA 1HJDA 1NPPA 2OTLA 1FYNA 5FW9A 2KT8A 1D1CA 4PFPA 2DFUA 3I56A 3WXMB 1G8XA 5KH6A 2JUFA 4KULA 3NMZC 4DBHA 3GLXA 3G4ST 2C0TA 3C95A 3HPWA 1VYTA 3RKYA 2RHXA 3NTIA 3VJPA 4JDSA 3CCQQ 2F69A 2LDMA 1KIKA 2ED1A 3VRZA 1UG1A 1BU1A 1O75A 3Q1JA 2NUTA 1M2VA 1A0NB 3ULRB 4QT7A 1DJ7B 3M53A 1TUCA 4M78C 2GGRA 2DZ9A 3MKDA 4FW1A 3QZ9B 1B07A 2E6NA 5GAN4 2RJDA 4HKEA 3JV3A 3CXCP 3V7SA 2EJFA 3I5RA 3QPHA 2J6OA 2P4RA 3DKMA 2DBKA 1UGQB 1D0XA 2OTJQ 2OTJT 2XICA 4M78G 2DNUA 4LNPA 3CPFA 3CCRQ 3CCRT 2X9HA 1SHFA 4FL6A 4KBMB 4AFQC 2OTLT 4BDYA 2DL5A 4ZNXA 1QCOA 1QCNA 2NUPA 3I56Q 3I56T 5GANj 2D6FA 3SFMA 3OS0A 4FT2A 4PK4A 3C0CA 4Z02A 3GF5A 5LJ3h 2K2VA 1NEGA 1W6XA 2PVDB 2FPDA 2BZYA 1Y57A 2E5QA 5CVIA 2K5LA 3OA6A 4BD3A 4KH1B 5A0LA 3I35A 2OAWA 3QWXX 4Q5WA 4C8QD 1OYXA 1KG1A 4R56A 3HKSA 2EQKA 2RF0A 3OYAA 3E9GA 3ER0A 3QUIA 3RESA 4ZGDB 4V2SA 1WQWA 2HBWA 2PVGB 1M1KU 1W2BP 1BKBA 4WCIA 3KFVA 4DQ2A 3S3NA 3OB9A 4OMFB 1NZ9A 1KC8U 1FMWA 2RQWA 4J83A 3JCMV 3CMEA 3QKJA 1YITA 2E65A 2RI3A 5KCHA 4IUTA 1O9SA 1KQSA 1KJWA 4XTXA 1WHGA 4CC2A 3WVDB 2DEQA 2RA2A 3EAEA 3G7ZA 3OYDA 1WNLA 3HSBA 4X9DA 2RJCA 1YP5A 4N0AC 2HEQA 2CP0A 4BI8B 1RAAB 1R0CB 5GAN8 1JQQA 2QI2A 1C0MA 1I4K1 4M77B 1X27A 4RTXA 4HCCA 2LP5A 2QK0A 4BE2A 3VRYA 5GMKj 2DVEA 4FW2A 4F7UB 1YN8A 3EGUA 3EG9A 2F2WA 4AMCA 3CPWP 3OYYA 4E7IA 4Y28E 3TSZA 1Q7YC 3PVQA 1I5LA 4M77E 1OI1A 4MMLA 2DLPA 3TCJA 1Q7YR 2CUDA 5KYUB 3QWYA 1UJYA 3FEOA 5IHIA 1I07A 2IIMA 3OSVA 4OMNA 4F7UE 3E9FA 5CKBA 1GXIE 4RTZA 4FCYA 3CMEQ 3CMET 1YITQ 1YITT 2VVKA 3CMAA 5CKDA 4JJCA 1VQOA 3RKXA 1IRXA 1VA7A 3OYHA 2QQAA 2QA4A 2KEAA 5DLOA 2HKQB 2V8JA 5D7UA 2QQRA 4J9DA 2DRMA 2F5TX 5CKEA 2Y4XA 1JB0E 1HXDA 3GNFB 4O6JA 2YRVA 1AHJB 3MCAB 3UPUA 1Z9QA 2F2XA 1IO6A 4M78A 4M7AF 3L42A 2RJEA 3M0QA 5GMKl 2WSFE 1UGVA 2L8DA 2AIRB 4IIOA 5GAMj 3CCLQ 3QHSA 1I0CA 4C0ZA 4J9FA 1BIBA 3EGDA 2KRNA 3JAME 1FWZA 2J05A 2YUPA 3UA7A 4PJMA 2EQIA 4R55A 2RK2A 2F1LA 2RQRA 3M0TA 3OYJA 1JJ2P 4ESRA 2KXCA 3RERA 4M7DF 2CREA 3H8ZA 2QTXA 3CMAQ 3CMAT 5DM7R 2KSSA 1I8FA 1QP3A 1N27A 1VQOQ 1VQOT 1AOJA 2KQWA 1K0XA 2X3XD 3QDFA 5GAMg 2QA4Q 2QA4T 2IVWA 2ATCB 3OMGA 2NYSA 3NTKA 3THKA 3CCJA 6AT1B 2DIGA 2DPPB 2YUNA 2HCKA 3NTHA 2KYMA 3HFNA 1IGQA 4A54A 1N9SA 3PFSA 1M5Q1 5KYNA 1OEBA 2YHTA 1IHWA 2MOXA 4QKUA 2ZZDA 3HHTB 3L2VA 2O88A 4J9CA 1TXQA 5KYWA 2L2PA 4XTVA 2DXBA 4J5YA 1ZUYA 4X34A 4M7AB 3SEMA 3C94A 3JCMX 2DL8A 4XQ3A 1AD5A 1WJSA 2KXDA 4XTUA 2FB7A 2GTJA 4FYVB 5GAN6 5CAIA 1VQPQ 2V1RA 3F70A 4M7AC 3EFOA 3BDUA 2XDBA 5AT1B 1HD3A 2DEUA 2C0IA 3A8OB 2KE9A 1V76A 2RM4A 3SWNB 2QEXA 2CP2A 2EKHA 4M77D 4M7AE 5LJ5h 1QVFP 3BE3A 2HL3A 3SWNC 4KH0B 5C6SA 1OPKA 2FRYA 1W2BA 4N0AA 2CH4W 1Q7YU 3G1JA 4ANJA 4M75G 3SB2A 1RI9A 4M7DC 1OX9A 1MV3A 1SKUB 1ZLMA 3CCJQ 3CCJT 1U1SA 2HNIA 3REBB 2NUTB 1T3SA 1M2VB 4IURA 1BBZA 2ESWA 2EKOA 2A7YA 1W70A 4KGZB 4M7DG 4LDYA 1I1JA 1BCMA 2FL7A 4RMOA 4BY6B 1YJNA 4QVCA 2X4YA 5IN1A 3OY9A 1XQHA 1LCKA 3M0RA 1WGSA 4WTOB 3RIRA 1OV3A 2G3RA 3L1AA 4C5GA 1IGUA 1ZUUA 4CC4B 3RNJA 1M3AA 2YXYA 1K1ZA 3P8HA 2LJ3A 3X25B 2PU9B 2QEXQ 2QEXT 2HL5C 5FRNA 4KGXB 1X6GA 2NUPB 2M1HA 4M4ZA 3GIBA 3LWHA 1YIJA 2XD0A 1NM7A 3M4YA 3M55A 5KE3A 5LJ5f 1OOTA 4HVVA 2EGAA 1MMAA 4OMPA 3T9NA 3VS2A 1UGPB 4JRKA 2O4XA 1IB8A 3GPLA 2NWMA 2BE7D 1UB4A 1MUZA 1H92A 4PFZA 3I5SA 2DF6A 4B9XA 2O31A 4RTVA 3QDRB 2L0AA 2G6FX 2XHCA 4J6YA 1YJNQ 1YJNT 4JZ4A 2OI3A 2EPDA 4ZGEB 2YLCA 2WSCE 5EG2A 2KDSA 1R8OB 1X69A 4B6MA 4BACA 2R58A 3P8BB 4OB1B 3SD4A 1QCFA 1YHQQ 3TREA 1AWOA 2YLBA 1YJ9A 1D3BA 1EIFA 4GLKA 1WHLA 3L2RA 1G83A 2VASA 3PIOA 2RQTA 1YIJQ 1YIJT 2DETA 3FLGA 3DB3A 4A53A 1X43A 2DM1A 2YUOA 4Y92A 2MPXC 4L6V5 3G71Q 1PSEA 4BDZA 1ZBXA 2ZCFB 3MP6A 5IXFA 4NL3A 4CC7A 4LUEA 3H0FA 1QVPA 1ZA2B 2QXFA 3JB9D 1MV0B 2GBQA 3VS7A 3EG9B 1VQ8Q 5GAN2 1TUDA 2CT3A 2GQVA 2K57A 1MNEA 1X6BA 2D0QB 1VQ5A 1LVKA 1NPRA 1YCYA 4J9IA 2PUOB 5FU7B 4ZGJB 1XJWB 4J7FA 1PSFA 2K3BA 5HY6A 2JJ9A 1E7OA 2RJFA 2CYZB 2K3XA 4M75A 1PNJA 2L5QA 4HCZA 4PFOA 3EH1A 5IXBA 5KYYA 3H9NA 4HT8A 1XNIA 2RB6A 2KI7A 3MJXA 2MI6A 1YJ9T 4ORZA 3UT1A 2M16A 1TSFA 1UJ0A 3SWNA 4ZTJA 2RHZA 3V8JA 3RBBB 1KFZA 2D0NA 5FU6C 2JM8A 4M7DA 1BI3A 5KYXA 5D6YA 3G4SQ 5FWCA 3M54A 4DBRA 4F17A 3VS4A 4HA8A 3PE0A 5CCAA 2XK0A 1K73U 5CR2A 5A0DA 2SRCA 1ARKA 4M78B 1QVFA 4LDUA 2CH4A 2XU8A 3JCMg 3OQ5A 1TU0B 1EZZB 2K5FA 4HT9A 1VQ7A 2HQXA 1W4SA 2LCSA 1VQ5Q 1VQ5T 2DE0X 3U23A 2FVUA 3JCMb 2JTMA 3EGDB 3V8KA 4QVDA 1UGRB 4JJDA 4RKUE 2HSEB 3QZ5B 5I11A 2DAQA 4RTYA 2CS7A 2JW4A 3OYIA 4M78E 4JS5A 3OBWA 3R6NA 2D8HA 2XDDA 4C5IA 1UFFA 3CD6A 3I9QA 1HK9A 1K8AC 1WYXA 3OYFA 4PKCC 1YWOA 1I81A 3JCMf 2OTLQ 5GANh 1PG5B 2E3HA 3VS1A 1K8AR 1YJWA 2FZCB 1ABOA 2QQ9A 1H641 4LD9K 2VB6A 3EFRA 1OPLA 2LNHB 2DL4A 1M1FA 2K79A 3RMSA 2D9TA 4LDWA 2CSQA 5J39A 2YDLA 3EFSA 4A4GA 2QASA 2RPNA 1WHHA 4JZ3A 4RG8A 3LLRA 4J9EA 1G3SA 1PHTA 1EX4A 4HVUA 2CP3A 1BK2A 5KYWB 3OYNA 2EGCA 1VQ7Q 2X51A 1VQ7T 5LJ3j 1GCQC 4L5GA 1GBQA 2K5IA 5GANg 2KR3A 2LRQA 3PT9A 3OYMA 3EFOB 3ZFJA 4XU2A 1N5ZA 2JTFA 3O8VA 4N4IA 1Q86U 3JCMW 3URGA 2RHYA 3M59A 3CD6Q 3CD6T 1ZSZC 3H0HA 3GOXA 1VQ6A 3GNGA 3RKWA 5LJ5e 3CBMA 4K11A 2VWFA 2DIQA 2VXFA 2EAYA 1YJWQ 1YJWT 1WJRA 2K4YA 4ATOA 5LJ3d 5GANf 3OW2P 2AKLA 1KQSS 3KUFA 2LT1A 2KNBB 2EVRA 2EYYA 4D8KA 1GRIA 2QQSA 2O9VA 5L23A 5GAN5 2CSIA 3KXTA 1WHMA 2CP5A 2J06A 2CP7A 1U3OA 2HAXA 4FYYB 4MZPA 3RMQA 4BB7A 3UF4A 3M57A 2LQWA 4KUDK 2MAMA 3L2ZA 3IQLA 2XG8D 4XAXB 1GBRA 4E7KA 1VYUA 2X3WD 2JMCA 2V1QA 1NJIC 3REAB 2X4JA 3QYHB 1RLQC 2XDPA 3G6EA 2CZ6B 1VQ6T 2D8JA 1NJIR 3LGLA 2EQUA 3QYGB 4RTTA 3KBGA 3TSWA 3X20B 2MMPA 2O9SA 2PVOB 2EQJA 1HYOA 3EG1A 2DXTA 4N4HA 5GAN7 2RI2A 4M78D 2RO0A 1KQ1A 2FPEA 3MP1A 1BI0A 3TU4K 2E41A 2E64A 4PJOF 2O4XB 5J26A 3NGPA 2E5KA 2EJ9A 1YWPA 1QVGP 2FHDA 1D1BA 2E12A 2ED0A 2E4HA 2JS2A 4XU1A 1K8AU 2SEMA 1M8VA 4MZMA 3M0PA 3X24B 2A0FB 2LTOA 5GAMh 1Q82U 4VUBA 3CCEA 1H3HA 2HDAA 4LXCA 1UTIA 2EWNA 4M75F 3X26B 3V8LA 3LH0A 2XIDA 4IIMA 3MEUA 2W10A 2KK4A 1AWXA 3HRSA 2R5MA 1YI2A 4J6WA 1R77A 2C0OA 2V8IA 1PKSA 3VYHB 3VS6A 3G6EQ 5IAYA 4ZN3A 1D3BB 3G6ET 3AHUA 4KT0E 4J9HA 3RDVA 2KGTA 3OYEA 3NFCA 1D09B 2ENMA 1OU8A 3CCSA 1BB9A 1QMCA 3C4SA 2GFAA 4PNOA 5CQXA 4C92F 2J6FA 2CZ1B 1UECA 1PC0A 1KHCA 2ZPGB 5CKFA 3HRUA 3CXCA 2EBPA 2E10A 3PGGA 3N5BB 2DYBA 2COYA 2RD1A 7AT1B 3M5AA 4LN2A 3EHRA 4IUUA 2YRCA 3I55A 1WXTA 4JRPA 3CXCS 3CC7A 4RUGA 1QWFA 2EIFA 1XTDA 1AWWA 3V7CA 1Y96A 2RMOA 4QVZA 4DBFA 3R6OA 3FB9A 2LQNA 4PJOC 2LT4A 3M4GA 1RAHB 2CZ7B 3EG2A 1GCQA 2L89A 4OMMA 2EGEA 4WF2A 3OYBA 3CC4A 2DYIA 3CCEQ 3CCET 4D8DA 3META 2M0OA 3FIFA 2YRDA 5GAMf 2E3IA 1SRMA 4PJOG 4C5EA 4M75B 1G2BA 1ZSZA 5KYYB 3JCMe 1YI2T 1QW1A 2FO0A 2QAZA 1JBMA 4BUGA 4M75C 3ZL7C 2B8AA 3BDLA 4QQGA 3OYCA 3CCST 2ABLA 4M7DB 1SG5A 4HXJA 1I5OB 1W1FA 1YBYA 5KYXB 1K0SA 4M75E 4JUVA 4AFSC 1ACMB 3GP8A 3CBPA 3VKIA 1NEBA 4E6RA 5I22A 4HVWA 4GLMA 4C92C 3EG3A 3I55T 1W2BS 1NJIU 2DD4A 2VYTA 3NPFA 3CC7T 3CC7Q 3A8HB 3PIPA 4C5HA 3MPUB 4C0DC 4M7DE 1RLPC 5I21A 2FPFA 2A28A 2COZA 1IXDA 5GAN3 4C92G 2HQHA 3CC4Q 2P0KA 3CC4T 3OW2A 1VUBA 2V26A 4E47A 4J9BA 4DA4A 1B34A 1AWJA 2L3SA 3H6ZA 8ATCB 3RR6A 3M9QA 1TTHB 2HD0A 1Y0MA 5L8RE 3M0UA 2JXBA 1K73C 2MWPA 3QO3A 1MHNA 3PTAA 3JB9I 3E19A 2FEIA 1M1GA 2DMOA 5LJ5d 4Z8AA 2YT6A 1X2QA 4C8QF 5GANe 1K73R 2AZSA 1N8RU 3CPWA 4PLLA 2IG0A 3OMCA 1JEGA 1JXMA 3UWNA 1C1AA 1K4US 4A63B 4PJJA 1PKTA 5FWBA 1BYMA 2MIOA 1ZSGA 2YUQA 4OP0A 1NE8A 3LGFA 4LDXA 1JRIA 2JT4A 2LNVA 3CC2A 1CSKA 1QKWA 5GAOn 1FX7A 2F2VA 1WFWA 2JTEA 2EW3A 2WSEE 1M4ZA 1M27C 4JJNK 1BCOA 1M90U 4BI3A 4OMLA 2JZ2A 2EYWA 3J7AF 5IT9E 2GTOA 2DJQA 2VXEA 5GJWB 2BZ8A 1YFNA 2VUBA 2GFUA 2RH2A 4X1VA 1M3CA 3A8GB 4Y91A 3OS1A 4C0GA 3LX7A 3ZBDA 1WLPB 2D1XA 5FRMA 1T0JA 4OB0B 4ELYC 4XTWA 3LWIA 3WVEB 1WX6A 4IUQA 1H3ZA 4FYXB 4J9GA 2H3EB 4KUIA 1RAIB 2HSPA 2WACA 4XTYA 5FLXE 4C8QC 2BZXA 1M8MA 5LL6S 1RAGB 3CEYA 1LJOA 1Q86C 1LPLA 4M7AD 2J6KA 1BIAA 4A4HA 1SPKA 5GMKe 4O5VA 2CUBA 5HCKA 2CP6A 2ZPEB 1JJ2A 4F14A 4PJOA 2GNCA 3P8DA 2GCXA 1Q86R 3CC2T 3JCMc 4PJLA 4C8QG 1RL2A 2EYQA 3LW5E
chains in the Genus database with same CATH topology
1G3SA 2DKGA 2F5TX 1V29B 5CKEA 4BI4A 2Y4XA 2LQKA 1JB0E 1HXDA 3UDCA 2JVVA 4OVAA 4A4FA 3OYNA 1Q81C 3GNFB 4O6JA 3MO8A 2YRVA 1AHJB 3MCAB 3UPUA 4M77A 1VQ7T 5LJ3j 3CCQA 3MP8A 2VGNA 4L5GA 4M78A 1Y7XA 2Y90A 3DB4A 4M7AF 3OW2S 3L42A 2RJEA 2X35A 4CI0C 2QDYB 2K5IA 5GMKl 2WSFE 5GANg 1VQMA 4M7DD 3PT9A 2L8DA 2LRQA 5KCOA 3OYMA 2A3LA 2R57A 1X75C 4XU2A 2DJZA 2JTFA 3ZFJA 4OF1A 3J80E 5GAMj 4EMGA 4RCCA 4F7UA 3O8VA 4N4IA 4CRIA 1Q86U 3QHSA 4OB3B 5LJ5g 3L2WA 4C0ZA 1KD1U 3JCMW 2ZPHB 3JCMh 1BIBA 5D6XA 1UGSB 3URGA 5KE2A 2GF7A 2RHYA 1U1TA 3M59A 3JAME 1N9RA 1FWZA 3CD6T 3X28B 4BY6C 5FU6B 3JB9H 3A8LB 3GOXA 4EDUA 1VQ6A 3GNGA 3PMIA 3RKWA 4R55A 2RK2A 5LJ5e 5GMKm 3JCMQ 5CIUA 3CBMA 1BI1A 3CCVA 2M9UA 3OYJA 5GAOl 3RERA 3CPWS 1YHQA 2DIQA 4M7DF 2VXFA 3H8ZA 2EAYA 1YJWT 1S72A 1WJRA 3VYGA 2QTXA 2K4YA 1Q81U 3CMAT 4C92A 5I2SA 2KSSA 5DM7R 2V8KA 1I8FA 4ATOA 5LJ3d 5GMKi 5GANf 5A2QE 4JS4A 1QP3A 1N27A 4DOWA 1KQSS 3QIIA 1VQOT 3KUFA 2LT1A 4OGEA 2KQWA 3OS2A 4BE0A 4ME7A 2VV5A 5LJ3e 2QQSA 5GAMg 2QA4T 2IVWA 1VQ4A 3OMGA 4OGCA 5GAN5 3KXTA 1IZ6A 4JRIA 3NTKA 1QP2A 3VV0A 4EMHA 3G71A 3CCJA 2DIGA 2DPPB 1ZQ1A 1MGQA 5GAOp 3NTHA 3VUZA 2OAUA 4XU3A 5HK3A 3HFNA 5GAMe 4LD6A 2HAXA 4MZPA 3JRZA 2E6ZA 3RMQA 4A54A 4BB7A 1N9SA 3PFSA 3RUXA 1M5Q1 3M57A 1VQNA 2YHTA 3HRTA 2CZ0B 1QVFS 1QVGA 3C12A 4KUDK 4C0FA 3CCQT 2MAMA 3L2ZA 3QG1A 4DOVA 2ZZDA 3HHTB 3L2VA 3A8MB 3PNWC 3QXEB 3FC3A 1VQ8A 2E70A 4FSXA 1VQMT 2XG8D 4XTVA 2DXBA 4XAXB 3CCUA 4J5YA 4X34A 4M7AB 2BIVA 3C94A 3JCMX 3JCMJ 4XQ3A 1QVGS 3LYIA 3JCMd 4E7KA 2JNGA 1WJSA 1NJIC 4XTUA 2FB7A 1KHIA 2X4JA 5GAN6 5CAIA 4PJOD 3QYHB 3F70A 4M7AC 2XDPA 3BDUA 4JRQA 2XDBA 3G6EA 4C8QB 1G3WA 2CZ6B 1VQ6T 1G3YA 3LGLA 5HKCA 2EQUA 3QYGB 3A8OB 3KBGA 1IREB 3X20B 3CCVT 5GAOr 2MMPA 2PVOB 2RM4A 3SWNB 4E7LA 2EQJA 2QEXA 1Q82C 4IKFA 3OBYA 1YHQT 2DXTA 4M77D 4N4HA 5GAN7 1S72T 4M7AE 5LJ5h 2RI2A 4M78D 2RO0A 1KQ1A 4P5NA 2P0QA 1Y71A 4FM4B 3MP1A 5FROA 3SWNC 5C6SA 1BI0A 3TU4K 1W2BA 2L3RA 2E41A 2E64A 3M56A 1Y96B 3QJYA 4N0AA 2O4XB 5CQYA 4PJOF 5J26A 1Q7YU 4M75G 1K9MC 2EJ9A 4M75D 4C8QE 3FDRA 3DLMA 4NL2A 3SB2A 4ELZC 4A4EA 4M7DC 3CC7T 2X4WA 2FHDA 2HQEA 2LVMA 2E12A 3S6WA 1VQ4T 3TEEA 1M1KC 3G4SA 3G71T 4XU0A 3CCJT 1JJ2S 2NLUA 5A0GA 4XTZA 4XU1A 4IUPA 1U1SA 2HNIA 1K8AU 4QQ6A 1KC8C 2KMTA 4IURA 3HP9A 4M77F 3L2UA 2JN0A 1M8VA 4MZMA 2AHJB 2A7YA 2EKOA 2LCLA 4M78F 1VIFA 5J3BA 3OYGA 4L59A 1VQNT 2CKKA 4EMKB 3X24B 4M7DG 4TVRA 2KAFA 2ZGWA 2LTOA 5GAMh 4GY5A 4LDYA 3JCMP 1Q82U 4VUBA 4YTLA 3CCEA 2DD5A 4C92D 2FL7A 2RHUA 4RMOA 1VQ8T 3BY7A 2EWNA 4BY6B 4F7UF 4M75F 2DTHA 2QQBA 3X26B 1YJNA 3CCUT 4J7IA 3V8LA 1TH7A 3LH0A 2XIDA 4EMKC 3MEUA 4QVCA 2X4YA 1UEBA 3OYLA 5IN1A 3OY9A 5C0MA 2KK4A 5I2MA 5DLQE 1XQHA 2PQWA 3HRSA 3HFOA 4D6WA 4EPCA 4ZTFA 1WGSA 2DXCA 2R5MA 1YI2A 3RIRA 4J6WA 1LNXA 1KQ2A 2G3RA 4M7AA 3JB9J 2V8IA 2RK1A 3L1AA 4MZTA 3VYHB 4C5GA 3AHUA 5IAYA 4ZN3A 1D3BB 4JLIA 3ZEHA 3G6ET 5GANd 1X01A 4FIBA 4KT0E 2DZCA 2H3JA 1SSFA 3P8HA 3OYEA 1XOVA 5FU7C 3NFCA 2DO3A 3QJ6A 2OTJA 3X25B 2PU9B 2QEXT 3CCSA 3C4SA 4PNOA 2GFAA 3FRNA 5CQXA 4C8QA 4C92F 5LJ3g 3VUBA 2CZ1B 3OYKA 5FRNA 2LC4A 2M1HA 5M9OA 3GIBA 1BI2A 3LWHA 1YIJA 3CCRA 2XD0A 2O01E 1KHCA 2ZPGB 4MDWA 3HRUA 5CKFA 3CXCA 5CK9A 3M4YA 2E10A 1OZ2A 3M55A 3PGGA 2X4XA 5KE3A 1NPPA 3N5BB 2OTLA 4J8OA 2RI5A 4IUVA 5LJ5f 2R5AA 5GAOm 2RD1A 3I56A 3WXMB 3M5AA 5KH6A 4IUUA 3I55A 2JUFA 4KULA 1X6OA 4JRPA 5GMKh 3CXCS 3CC7A 4J6XA 5D6WA 3GLXA 5CO7A 3G4ST 3T9NA 2EIFA 1UGPB 1XTDA 3V7CA 1Y96A 4JRKA 4QVZA 2O4XA 3R6OA 3C95A 3FB9A 3HPWA 3ME9A 3GPLA 4PJOC 3INZA 2LT4A 3M4GA 2EJGA 3RKYA 2RHXA 3NTIA 3VJPA 2CZ7B 4JDSA 2F69A 2LDMA 2L89A 1UB4A 1N6AA 1B34B 1P92A 4II1A 4B9WA 2ZPFB 4MDXA 4WF2A 3OYBA 5LJ3f 2P4TA 3Q1JA 1O75A 3CC4A 3V7RA 4B9XA 3CCET 3META 3QDRB 2M0OA 2XHCA 4J6YA 1YJNT 1DJ7B 2P0PA 3FIFA 4M77C 3M53A 4EMKA 5GAMf 4ZGEB 1VQKA 2YLCA 4PJOG 4C5EA 2WSCE 4M75B 4M78C 5EG2A 3BFMA 3M58A 2DZ9A 2KDSA 3JCMe 3QZ9B 1YI2T 1R8OB 4PL6A 2E6NA 5GAN4 2RJDA 4HKEA 1QW1A 2CGHA 3V7SA 4BACA 1JBMA 2R58A 4BUGA 3CCLA 4M75C 2EJFA 3P8BB 3QPHA 4OB1B 5HK0A 3SD4A 4UC4A 2B8AA 3DKMA 4FU6A 2LQ8A 3BDLA 1UGQB 4M77G 3OS5A 4QQGA 2BKDN 3TREA 2KY9A 2YLBA 1YJ9A 3OYCA 2OTJT 4N4GA 2XICA 4M78G 3CCST 2DTOA 2XI9A 1D3BA 1EIFA 4GLKA 4M7DB 1LOJA 3L2RA 1G5VA 3CPFA 1YBYA 3PIOA 4M75E 4JUVA 3CCRT 1YIJT 3FLGA 3DB3A 4A53A 4FL6A 4KBMB 3GP8A 2VGMA 4F7UG 3CBPA 3VKIA 2I2LA 2OTLT 4BDYA 2BUDA 3QSUA 5GANj 3I56T 2D6FA 4C92C 4L6V5 4NS5A 2HBPA 1PSEA 3MEVA 3SFMA 3OS0A 3I55T 1Y07A 2DD4A 4BDZA 2VYTA 1ZBXA 2E1HA 3OSSC 2PUKB 3A8HB 4FT2A 2ZCFB 3MP6A 4Z02A 3GF5A 5LJ3h 4C5HA 4NL3A 3PIPA 1KD1C 2K2VA 2EQMA 2PVDB 3SDZA 2DK3A 4C0DC 1N8RC 2E5QA 4M7DE 5CVIA 2K5LA 5I21A 3OA6A 1QVPA 4BD3A 2QXFA 5A0LA 3JB9D 5GAN3 4OB2B 4C92G 4E7HA 4Q5WA 4C8QD 3FJPA 2P0KA 5GAN2 3CC4T 3ASKA 3HL8A 4PLIA 2GQVA 2K57A 3OW2A 4A4KA 4HCBA 1VUBA 1OYXA 1KG1A 4ZN1A 4E47A 4R56A 3HKSA 2EQKA 4DA4A 1B34A 2D0QB 1VQ5A 2ZPBB 1NPRA 1VIEA 1YCYA 2PUOB 5FU7B 1VQKT 3H6ZA 4ZGJB 3OYAA 2MWOA 1K9MU 3E9GA 3ER0A 3QUIA 3M9QA 4J7FA 3RESA 2HD0A 5DY9A 4ZGDB 4V2SA 1WQWA 2PVGB 5L8RE 1PSFA 4LDVA 5HY6A 1M1KU 2FYKA 2JOYA 1K73C 2RJFA 2MWPA 2CYZB 1BKBA 2LCCA 2K3XA 3QO3A 3CCLT 1MHNA 4M75A 2L5QA 4HCZA 3PTAA 4DQ2A 3A5ZB 3JB9I 3OB9A 3S3NA 3JB9F 4OMFB 1NZ9A 3E19A 1M1GA 5LJ5d 3BW1A 4C8QF 3VU3C 2RB6A 1XNIA 5GANe 1VQPA 1KC8U 4HT8A 4J83A 2MI6A 1YJ9T 1N8RU 3UT1A 3CPWA 3S3MA 2M16A 1M90C 3JCMV 5GAOq 4XK8E 4PLLA 2IG0A 3OMCA 3SWNA 3CMEA 3QKJA 4ZTJA 2RHZA 3UWNA 3V8JA 1YITA 4E7JA 2E65A 2RI3A 5KCHA 4IUTA 1O9SA 1FXXA 3S3OA 2DTIA 4NOYA 3CCMA 5FU6C 1KQSA 1BYMA 4M7DA 4XTXA 4PJOB 1BI3A 3WVDB 1WQ7A 5D6YA 2DEQA 2RA2A 3EAEA 4OP0A 3G7ZA 3OYDA 3M54A 4BE1A 1NE8A 1VQLA 3LGFA 1WNLA 3HSBA 4X9DA 4LDXA 3PMTA 2RJCA 4HA8A 3DLLA 3CBOA 5CCAA 2MF2A 4N0AC 1JRIA 4BI8B 2EFIA 2XK0A 5GAN8 2LNVA 2QI2A 3CC2A 3J81E 3L2QA 1K73U 1I4K1 5GAMd 5CR2A 4M77B 5A0DA 5GAOn 1ZHIA 1FX7A 2RHIA 1VQ9A 4M78B 4HCCA 1QVFA 4LDUA 4BE2A 2WSEE 2XU8A 1M4ZA 3JCMg 4JJNK 4PJOE 3OQ5A 2K5FA 5GMKj 2F5KA 4HT9A 1M90U 2DVEA 1VQ7A 3MEWA 2DXUA 4BI3A 4F7UB 4MMKA 2HQXA 2XKOC 1W4SA 1OZ3A 2JZ2A 1VQ5T 3J7AF 5IT9E 2FVUA 3JCMb 2JTMA 3MEAA 1WJQA 3OYYA 4E7IA 4Y28E 3V8KA 2VXEA 1Q7YC 4QVDA 1UGRB 1I5LA 2VUBA 2GFUA 3QZ5B 4RKUE 2DAQA 2RH2A 4M77E 3A8GB 2CS7A 1OI1A 4X9CA 4Y91A 3OS1A 3OYIA 4M78E 4JS5A 4C0GA 3OBWA 4MMLA 2XDDA 3TCJA 4C5IA 3CD6A 3LX7A 3ZBDA 1VQPT 1HK9A 5FRMA 3FEOA 1W2BS 1NJIU 4OB0B 1K8AC 3QBYA 4ELYC 3OSVA 4QW2A 3OYFA 4XTWA 4PKCC 4C92B 3WVEB 4F7UE 3JSCA 3LWIA 3E9FA 4RCBA 4IUQA 1I81A 5CKBA 1H3ZA 1GXIE 2LX9A 3JCMf 3CMET 2VC8A 4FT4A 1YITT 5GANh 4KUIA 1YJWA 4C0DB 2WACA 4RG2A 4XTYA 3CMAA 4QQDA 2QQ9A 5FLXE 1H641 4C8QC 5CKDA 3CCMT 4LD9K 3EFRA 5LL6S 3E1SA 4JLGA 3CEYA 1LJOA 1M1FA 1Q86C 4M7AG 4M7AD 5LJ5j 1VQOA 1BIAA 5CKHA 3RKXA 4A4HA 3RMSA 1VQLT 2K3YA 5GMKe 2D9TA 3OYHA 4LDWA 2QQAA 4O5VA 2ZPEB 5J39A 2QA4A 1JJ2A 2C06A 1U8RA 4PJOA 1WPYA 2ZPIB 3EFSA 3MHXA 1M9SA 1G3TA 2GCXA 3P8DA 4A4GA 4C92E 5DLOA 1RI0A 2KVQG 3JB9G 3CC2T 2V8JA 5AYFA 4RG8A 3JCMc 3LLRA 4C8QG 1RL2A 2QQRA 2EYQA 3LW5E 1VQ9T 2Y4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKG A;  5GAO r;  1HXD A;  1B34 B;  2RM4 A;  3SWN B;  3JCM V;  5GAO q;  4WF2 A;  5LJ3 f;  3SWN A;  2DXT A;  4M77 D;  4M77 A;  3V8J A;  5GAN 7;  3V7R A;  2E65 A;  5LJ3 j;  5LJ5 h;  4M7A E;  4M78 D;  4M78 A;  1KQ1 A;  2Y90 A;  4M7A F;  2DTI A;  4J6Y A;  4NOY A;  3SWN C;  5GMK l;  3FIF A;  5GAN g;  4XTX A;  4M7D A;  4M77 C;  4M7D D;  4PJO B;  4EMK A;  5GAM f;  2YLC A;  4PJO G;  1WQ7 A;  2DEQ A;  2E41 A;  2E64 A;  1Y96 B;  2DJZ A;  2RA2 A;  4M78 C;  4M75 B;  4N0A A;  4OP0 A;  4XU2 A;  4M75 G;  3BFM A;  2EJ9 A;  4M75 D;  4RCC A;  2DZ9 A;  4NL2 A;  1WNL A;  3SB2 A;  4C8Q E;  4X9D A;  3HSB A;  4M7D C;  3QHS A;  4HA8 A;  5LJ5 g;  3JCM e;  3JCM W;  3JCM h;  5GAN 4;  1BIB A;  4N0A C;  2CGH A;  1JRI A;  3V7S A;  1JBM A;  5GAN 8;  4XU0 A;  4M75 C;  1U1T A;  1N9R A;  2EJF A;  4XTZ A;  3JB9 H;  1I4K 1;  4XU1 A;  5GAM d;  1U1S A;  2HNI A;  4M77 B;  5GAO n;  3RKW A;  4M77 G;  5LJ5 e;  4M77 F;  5GMK m;  4M78 B;  3JCM Q;  2JN0 A;  2YLB A;  1M8V A;  4M78 G;  2DTO A;  4M78 F;  1D3B A;  5GAO l;  4M7D B;  3JCM g;  1LOJ A;  5GAN e;  4PJO E;  4EMK B;  3RER A;  4M7D G;  5GMK j;  4HT9 A;  4M7D F;  2VXF A;  2DVE A;  2EAY A;  2ZGW A;  5GAM h;  4M75 E;  4JUV A;  2QTX A;  3JCM P;  2DXU A;  4F7U B;  4MMK A;  4A53 A;  4C92 D;  4C92 A;  1I8F A;  4F7U G;  3BY7 A;  2EWN A;  5LJ3 d;  4F7U F;  2I2L A;  2DTH A;  4M75 F;  5GMK i;  5GAN f;  3V8L A;  1TH7 A;  4EMK C;  3JCM b;  3QSU A;  5GAN j;  4QVC A;  3V8K A;  4C92 C;  2VXE A;  4QVD A;  1I5L A;  2E1H A;  3HFO A;  5LJ3 e;  4M77 E;  5GAM g;  3RIR A;  4J6W A;  1LNX A;  4X9C A;  5LJ3 h;  4Y91 A;  4EMG A;  5GAN 5;  4NL3 A;  1KQ2 A;  4M7A A;  4M78 E;  3JB9 J;  4JRI A;  3L1A A;  4F7U A;  3AHU A;  4EMH A;  4MML A;  1D3B B;  4JLI A;  5GAN d;  1X01 A;  1MGQ A;  4M7D E;  2DZC A;  5I21 A;  5GAO p;  1HK9 A;  4XU3 A;  3HFN A;  5GAM e;  4XTW A;  4C92 B;  4F7U E;  3JB9 D;  5GAN 3;  4A54 A;  4RCB A;  5GAM j;  4C92 G;  1I81 A;  1N9S A;  3RUX A;  4PNO A;  4C92 F;  1M5Q 1;  3FJP A;  4C8Q A;  3JCM f;  4C8Q D;  5LJ3 g;  2VC8 A;  5GAN 2;  2YHT A;  5GAN h;  2K57 A;  4M7A D;  3L2Z A;  3GIB A;  4XTY A;  4PJO F;  1H64 1;  1B34 A;  4C8Q C;  2E10 A;  3EFR A;  3PGG A;  1YCY A;  4XTV A;  4J5Y A;  1LJO A;  4M7A B;  5LJ5 f;  5GAO m;  4M7A G;  2RD1 A;  3JCM X;  3JCM J;  3QUI A;  4XQ3 A;  1BIA A;  3RES A;  3RKX A;  5DY9 A;  5LJ5 j;  3JCM d;  1WQW A;  4V2S A;  5GMK e;  4XTU A;  2FB7 A;  2FYK A;  5GMK h;  5GAN 6;  5CAI A;  4PJO A;  4J6X A;  1WPY A;  3EFS A;  4PJO D;  3QO3 A;  4M7A C;  4C92 E;  3BDU A;  4M75 A;  3V7C A;  1Y96 A;  4JRK A;  4DQ2 A;  3JB9 G;  3JB9 I;  3FB9 A;  4C8Q B;  3JB9 F;  5LJ5 d;  3BW1 A;  3JCM c;  4C8Q G;  3INZ A;  4C8Q F;  3VU3 C;  2RB6 A;  4HT8 A;  3M4G A;  4PJO C;  2EJG A;  3RKY A; 
#chains in the Genus database with same CATH topology
 3UDC A;  1WXB A;  3CCQ A;  3MP8 A;  2VGN A;  2Y90 A;  4PJN A;  2QDY B;  4M7D D;  5KCO A;  2A3L A;  1WXU A;  3SHW A;  3J80 E;  4OF1 A;  2M02 A;  3NHN A;  4CRI A;  3L2W A;  3JCM h;  2DER A;  1OU9 A;  5D6X A;  1UGS B;  5KE2 A;  1YJ9 Q;  1N9R A;  3X28 B;  2LJ1 A;  2CT4 A;  5FU6 B;  4AFU C;  2M0Y A;  4EDU A;  1BI1 A;  1V1C A;  3CCV A;  2M9U A;  5GAO l;  2HZY A;  2L3P A;  1M30 A;  1Q81 U;  4C92 A;  1NLO C;  5I2S A;  2V8K A;  2QDL A;  5GMK i;  4JS4 A;  4DOW A;  3QII A;  1GFC A;  2QYZ A;  4OGE A;  3OS2 A;  4BE0 A;  1R0B G;  1GCP A;  1VQ4 A;  1CKB A;  3VV0 A;  2A37 A;  4EMH A;  1ZQ1 A;  1D0Y A;  1MGQ A;  5IH2 A;  3VUZ A;  5GAM e;  2LJ0 A;  3GBQ A;  1QVF S;  1F1B B;  4C0F A;  3CCQ T;  4DOV A;  1M3B A;  2QTV A;  3A8M B;  2E70 A;  4FSX A;  3CCU A;  2K9G A;  1J3T A;  4E2F B;  3JCM d;  2NUZ A;  2QG9 B;  1GL5 A;  1M2O A;  3TQ7 P;  4JRQ A;  1TUG B;  3FJ5 A;  2OJ2 A;  5HKC A;  2XMF A;  3CCV Q;  3CCV T;  2VKN A;  2RQU A;  1Q82 C;  3OBY A;  2KYB A;  4FSS A;  4DEX A;  4P5N A;  2P0Q A;  1Y71 A;  1Q82 R;  1EFN A;  1U06 A;  2DX1 A;  3M56 A;  1Y96 B;  1K9M C;  3H41 A;  8AT1 B;  4ELZ C;  3FDR A;  4NL2 A;  4A4E A;  2ECZ A;  2HQE A;  1VQ4 Q;  1VQ4 T;  3TEE A;  1MND A;  2A36 A;  2DL7 A;  1WDX A;  2NLU A;  1K9M R;  4AFZ C;  5GJV B;  4QQ6 A;  4R0K A;  2KMT A;  3HP9 A;  4M77 F;  3L2U A;  2JN0 A;  1SEM A;  1VIF A;  4L59 A;  4TVR A;  2KAF A;  2ZGW A;  3A98 A;  4GY5 A;  3JCM P;  4YTL A;  1UUE A;  2RHU A;  1PRL C;  1ZSZ B;  4RTU A;  4F7U F;  1OX8 A;  2DTH A;  3CCU Q;  1NYG A;  4J7I A;  3CCU T;  1TH7 A;  2AKK A;  3OYL A;  1X2K A;  5C0M A;  3M0S A;  5I2M A;  4D6W A;  1UHF A;  2KT1 A;  3HFO A;  4EPC A;  4ZTF A;  2DXC A;  4EIK A;  2DRK A;  1LNX A;  3O5Z A;  3JB9 J;  1RAF B;  4JLI A;  5GAN d;  1X01 A;  2DZC A;  2DIL A;  1XOV A;  2IPO B;  3HTR A;  2Z0W A;  4C8Q A;  5LJ3 g;  2DBM A;  3VUB A;  3OYK A;  2LMJ A;  2YWW A;  4Z89 A;  1BI2 A;  2KBT A;  3VS3 A;  5CK9 A;  1JO8 A;  1OZ2 A;  2X4X A;  4J8O A;  9ATC B;  2RI5 A;  4IUV A;  2R5A A;  5GAO m;  3EG0 A;  2DL3 A;  1X6O A;  5GMK h;  3EHQ A;  1OQK A;  4J6X A;  5D6W A;  5CO7 A;  2YSQ A;  1TG0 A;  3UAT A;  3ME9 A;  1UDL A;  3INZ A;  2EJG A;  3D7S B;  1N6A A;  1B34 B;  1P92 A;  4II1 A;  4B9W A;  1B3Q A;  2ZPF B;  4MDX A;  5LJ3 f;  2P4T A;  3V7R A;  2O2O A;  1AT1 B;  4DBQ A;  3EGX A;  2P0P A;  4M77 C;  2ROL A;  1WHJ A;  4EMK A;  1VQK A;  4OMQ A;  2ROT A;  3A1P A;  3BFM A;  3VS5 A;  3M58 A;  1AEY A;  4PL6 A;  1VQ6 Q;  1KSW A;  2CGH A;  2M51 A;  3CCL A;  4AG1 C;  5HK0 A;  1WI7 A;  2KRO A;  4UC4 A;  4FU6 A;  2LQ8 A;  4M77 G;  3OS5 A;  2BKD N;  2I0N A;  2KY9 A;  4N4G A;  2DTO A;  2XI9 A;  1LOJ A;  1NLP C;  1G5V A;  5ECA A;  1D0Z A;  1PD0 A;  2VGM A;  4F7U G;  2I2L A;  2BUD A;  2LX7 A;  3QSU A;  2RNA A;  2FG0 A;  4NS5 A;  2HBP A;  3MEV A;  1Y07 A;  2OX7 A;  3OSS C;  1Q95 G;  2E1H A;  2PUK B;  1KD1 C;  1RUW A;  2EQM A;  3SDZ A;  2DK3 A;  1SF9 A;  1N8R C;  2PZ1 A;  1ZX6 A;  2DVJ A;  1SRL A;  1KD1 R;  4OB2 B;  4E7H A;  3FJP A;  1N8R R;  1WHK A;  3ASK A;  3HL8 A;  4PLI A;  4A4K A;  4HCB A;  1QKX A;  4ZN1 A;  1YNZ A;  2ZPB B;  1K9A A;  1VIE A;  3LH5 A;  1VQK Q;  1VQK T;  2MWO A;  1MMG A;  1K9M U;  2LZ6 B;  1MMN A;  5DY9 A;  1GFD A;  2HKN A;  4LDV A;  2FYK A;  2JOY A;  2LCC A;  3CCL T;  3A5Z B;  3JB9 F;  3BW1 A;  3E2U A;  3VU3 C;  1VQP A;  1VOM A;  4JPB W;  1M90 C;  3S3M A;  5GAO q;  4XK8 E;  1RAC B;  1ZUK A;  4E7J A;  1E6G A;  1FXX A;  3S3O A;  2DTI A;  4NOY A;  1M90 R;  2RQV A;  3CCM A;  4PJO B;  1WQ7 A;  1AZE A;  1K76 A;  1SHG A;  4BE1 A;  1VQL A;  3PMT A;  3DLL A;  3CBO A;  2MF2 A;  2KRS A;  2EFI A;  5IHK A;  2HMA A;  3J81 E;  4GBQ A;  3L2Q A;  4F04 B;  5GAM d;  1ZHI A;  1PCX A;  2RHI A;  1VQ9 A;  1Z9Z A;  1PWT A;  4PJO E;  2F5K A;  2JMA A;  4RTW A;  3EH2 A;  3MEW A;  2DXU A;  4MMK A;  2XKO C;  1OZ3 A;  4KRT A;  4F16 A;  1YI2 Q;  2MK5 A;  3MEA A;  1WJQ A;  2H8H A;  2K6D A;  4CC3 A;  1NBE B;  1TOV A;  3VS0 A;  4X9C A;  2PNI A;  3CCS Q;  4OMO A;  1VQP T;  3QBY A;  1E6H A;  4QW2 A;  4C92 B;  3JSC A;  4RCB A;  2LX9 A;  1ZBJ A;  2VC8 A;  4FT4 A;  1UHC A;  4C0D B;  4RG2 A;  1IHV A;  4QQD A;  3CCM Q;  3CCM T;  3I55 Q;  3E1S A;  1PM3 A;  4JLG A;  4M7A G;  5LJ5 j;  5CKH A;  1VQL Q;  1VQL T;  2K3Y A;  2RN8 A;  2C06 A;  1U8R A;  1WPY A;  2ZPI B;  3MHX A;  1M9S A;  1G3T A;  1T0H A;  4C92 E;  1RI0 A;  2COW A;  2KVQ G;  3JB9 G;  5IHN A;  5AYF A;  1UE9 A;  2KRM A;  1VQ9 Q;  1VQ9 T;  2Y4Y A;  1JXO A;  2DKG A;  3AT1 B;  4E7Z A;  1V29 B;  4BI4 A;  3TVT A;  2LQK A;  2JVV A;  4OVA A;  4A4F A;  1Q81 C;  2QGG A;  2A08 A;  3MO8 A;  4FYW B;  4M77 A;  1AVZ C;  3UA6 A;  1Y7X A;  3DB4 A;  4JJB A;  3OW2 S;  2K7A A;  2X35 A;  2EYZ A;  4CI0 C;  1Q81 R;  1T3L A;  2K2M A;  1VQM A;  2R57 A;  1X75 C;  2DJZ A;  1CKA A;  2AK5 A;  4RCC A;  1TS9 A;  4EMG A;  4F7U A;  4OB3 B;  5LJ5 g;  1KD1 U;  2ZPH B;  2MYS A;  2CDT A;  2GF7 A;  1U1T A;  4BY6 C;  3JB9 H;  3A8L B;  1ABQ A;  3PMI A;  1FMK A;  5GMK m;  3JCM Q;  5CIU A;  1U5S A;  2P84 A;  5KYU A;  3CPW S;  1YHQ A;  1S72 A;  2B86 A;  3VYG A;  1S1N A;  5A2Q E;  1OUL A;  4AG2 C;  1QWE A;  4KGV B;  1ZA1 B;  1MMD A;  4ME7 A;  2VV5 A;  5LJ3 e;  4OGC A;  4LE9 A;  1IZ6 A;  4JRI A;  1QP2 A;  3G71 A;  1WZO A;  3H0I A;  5GAO p;  1H8K A;  2OAU A;  4XU3 A;  5HK3 A;  1YCS B;  4LD6 A;  2J7I A;  2E6Z A;  3JRZ A;  1B7T A;  3RUX A;  4Z88 A;  2AZV A;  1VQN A;  1C6V X;  2CZ0 B;  3HRT A;  1QVG A;  3C12 A;  1D1A A;  3QG1 A;  3CQT A;  3PNW C;  3QXE B;  3FC3 A;  1VQ8 A;  1VQM Q;  1VQM T;  3PVL A;  2BIV A;  3JCM J;  1QVG S;  3LYI A;  1KQS P;  2JNG A;  2DA9 A;  1KHI A;  4PJO D;  4C8Q B;  1RAB B;  1G3W A;  1G3Y A;  1RAD B;  4LUD A;  1IRE B;  5GAO r;  4E7L A;  1WA7 A;  1QQJ A;  1PD1 A;  1YHQ T;  1S72 Q;  1S72 T;  2JS0 A;  4FM4 B;  5FRO A;  2EYX A;  4AT1 B;  2AT1 B;  2JM9 A;  2L3R A;  3QJY A;  4IKF A;  5CQY A;  4M75 D;  4C8Q E;  3CC2 Q;  3DLM A;  2X4W A;  2LVM A;  3S6W A;  1M1K C;  3G4S A;  3G71 T;  4XU0 A;  2PTK A;  1JJ2 S;  5A0G A;  4XTZ A;  2FZG B;  2GQI A;  4IUP A;  1KC8 C;  2FZK B;  1M1K R;  2BTT A;  1WIE A;  2AHJ B;  2LCL A;  4M78 F;  2QGF B;  3EGX B;  5EC7 A;  5J3B A;  1VQN Q;  3OYG A;  1VQN T;  2CKK A;  4EMK B;  1KK7 A;  1KC8 R;  2L3Q A;  2DD5 A;  4C92 D;  1VQ8 T;  3BY7 A;  2QQB A;  4EMK C;  1NG2 A;  1UEB A;  1PRM C;  2FRW A;  5DLQ E;  2PQW A;  2ZAE A;  1VYV A;  1NYF A;  1KQ2 A;  4M7A A;  1SSH A;  2RK1 A;  4MZT A;  4HCK A;  3ZEH A;  1AZG B;  2BE9 B;  4FIB A;  2W0Z A;  2H3J A;  1SSF A;  2MCN A;  5FU7 C;  2DO3 A;  3QJ6 A;  4DEY A;  2OTJ A;  1FMV A;  1QLY A;  1TWB A;  3FRN A;  4E7S A;  1JU5 C;  1HSQ A;  2LC4 A;  5M9O A;  1RAE B;  3CCR A;  2O01 E;  4MDW A;  1HJD A;  1NPP A;  2OTL A;  1FYN A;  5FW9 A;  2KT8 A;  1D1C A;  4PFP A;  2DFU A;  3I56 A;  3WXM B;  1G8X A;  5KH6 A;  2JUF A;  4KUL A;  3NMZ C;  4DBH A;  3GLX A;  3G4S T;  2C0T A;  3C95 A;  3HPW A;  1VYT A;  3RKY A;  2RHX A;  3NTI A;  3VJP A;  4JDS A;  3CCQ Q;  2F69 A;  2LDM A;  1KIK A;  2ED1 A;  3VRZ A;  1UG1 A;  1BU1 A;  1O75 A;  3Q1J A;  2NUT A;  1M2V A;  1A0N B;  3ULR B;  4QT7 A;  1DJ7 B;  3M53 A;  1TUC A;  4M78 C;  2GGR A;  2DZ9 A;  3MKD A;  4FW1 A;  3QZ9 B;  1B07 A;  2E6N A;  5GAN 4;  2RJD A;  4HKE A;  3JV3 A;  3CXC P;  3V7S A;  2EJF A;  3I5R A;  3QPH A;  2J6O A;  2P4R A;  3DKM A;  2DBK A;  1UGQ B;  1D0X A;  2OTJ Q;  2OTJ T;  2XIC A;  4M78 G;  2DNU A;  4LNP A;  3CPF A;  3CCR Q;  3CCR T;  2X9H A;  1SHF A;  4FL6 A;  4KBM B;  4AFQ C;  2OTL T;  4BDY A;  2DL5 A;  4ZNX A;  1QCO A;  1QCN A;  2NUP A;  3I56 Q;  3I56 T;  5GAN j;  2D6F A;  3SFM A;  3OS0 A;  4FT2 A;  4PK4 A;  3C0C A;  4Z02 A;  3GF5 A;  5LJ3 h;  2K2V A;  1NEG A;  1W6X A;  2PVD B;  2FPD A;  2BZY A;  1Y57 A;  2E5Q A;  5CVI A;  2K5L A;  3OA6 A;  4BD3 A;  4KH1 B;  5A0L A;  3I35 A;  2OAW A;  3QWX X;  4Q5W A;  4C8Q D;  1OYX A;  1KG1 A;  4R56 A;  3HKS A;  2EQK A;  2RF0 A;  3OYA A;  3E9G A;  3ER0 A;  3QUI A;  3RES A;  4ZGD B;  4V2S A;  1WQW A;  2HBW A;  2PVG B;  1M1K U;  1W2B P;  1BKB A;  4WCI A;  3KFV A;  4DQ2 A;  3S3N A;  3OB9 A;  4OMF B;  1NZ9 A;  1KC8 U;  1FMW A;  2RQW A;  4J83 A;  3JCM V;  3CME A;  3QKJ A;  1YIT A;  2E65 A;  2RI3 A;  5KCH A;  4IUT A;  1O9S A;  1KQS A;  1KJW A;  4XTX A;  1WHG A;  4CC2 A;  3WVD B;  2DEQ A;  2RA2 A;  3EAE A;  3G7Z A;  3OYD A;  1WNL A;  3HSB A;  4X9D A;  2RJC A;  1YP5 A;  4N0A C;  2HEQ A;  2CP0 A;  4BI8 B;  1RAA B;  1R0C B;  5GAN 8;  1JQQ A;  2QI2 A;  1C0M A;  1I4K 1;  4M77 B;  1X27 A;  4RTX A;  4HCC A;  2LP5 A;  2QK0 A;  4BE2 A;  3VRY A;  5GMK j;  2DVE A;  4FW2 A;  4F7U B;  1YN8 A;  3EGU A;  3EG9 A;  2F2W A;  4AMC A;  3CPW P;  3OYY A;  4E7I A;  4Y28 E;  3TSZ A;  1Q7Y C;  3PVQ A;  1I5L A;  4M77 E;  1OI1 A;  4MML A;  2DLP A;  3TCJ A;  1Q7Y R;  2CUD A;  5KYU B;  3QWY A;  1UJY A;  3FEO A;  5IHI A;  1I07 A;  2IIM A;  3OSV A;  4OMN A;  4F7U E;  3E9F A;  5CKB A;  1GXI E;  4RTZ A;  4FCY A;  3CME Q;  3CME T;  1YIT Q;  1YIT T;  2VVK A;  3CMA A;  5CKD A;  4JJC A;  1VQO A;  3RKX A;  1IRX A;  1VA7 A;  3OYH A;  2QQA A;  2QA4 A;  2KEA A;  5DLO A;  2HKQ B;  2V8J A;  5D7U A;  2QQR A;  4J9D A;  2DRM A;  2F5T X;  5CKE A;  2Y4X A;  1JB0 E;  1HXD A;  3GNF B;  4O6J A;  2YRV A;  1AHJ B;  3MCA B;  3UPU A;  1Z9Q A;  2F2X A;  1IO6 A;  4M78 A;  4M7A F;  3L42 A;  2RJE A;  3M0Q A;  5GMK l;  2WSF E;  1UGV A;  2L8D A;  2AIR B;  4IIO A;  5GAM j;  3CCL Q;  3QHS A;  1I0C A;  4C0Z A;  4J9F A;  1BIB A;  3EGD A;  2KRN A;  3JAM E;  1FWZ A;  2J05 A;  2YUP A;  3UA7 A;  4PJM A;  2EQI A;  4R55 A;  2RK2 A;  2F1L A;  2RQR A;  3M0T A;  3OYJ A;  1JJ2 P;  4ESR A;  2KXC A;  3RER A;  4M7D F;  2CRE A;  3H8Z A;  2QTX A;  3CMA Q;  3CMA T;  5DM7 R;  2KSS A;  1I8F A;  1QP3 A;  1N27 A;  1VQO Q;  1VQO T;  1AOJ A;  2KQW A;  1K0X A;  2X3X D;  3QDF A;  5GAM g;  2QA4 Q;  2QA4 T;  2IVW A;  2ATC B;  3OMG A;  2NYS A;  3NTK A;  3THK A;  3CCJ A;  6AT1 B;  2DIG A;  2DPP B;  2YUN A;  2HCK A;  3NTH A;  2KYM A;  3HFN A;  1IGQ A;  4A54 A;  1N9S A;  3PFS A;  1M5Q 1;  5KYN A;  1OEB A;  2YHT A;  1IHW A;  2MOX A;  4QKU A;  2ZZD A;  3HHT B;  3L2V A;  2O88 A;  4J9C A;  1TXQ A;  5KYW A;  2L2P A;  4XTV A;  2DXB A;  4J5Y A;  1ZUY A;  4X34 A;  4M7A B;  3SEM A;  3C94 A;  3JCM X;  2DL8 A;  4XQ3 A;  1AD5 A;  1WJS A;  2KXD A;  4XTU A;  2FB7 A;  2GTJ A;  4FYV B;  5GAN 6;  5CAI A;  1VQP Q;  2V1R A;  3F70 A;  4M7A C;  3EFO A;  3BDU A;  2XDB A;  5AT1 B;  1HD3 A;  2DEU A;  2C0I A;  3A8O B;  2KE9 A;  1V76 A;  2RM4 A;  3SWN B;  2QEX A;  2CP2 A;  2EKH A;  4M77 D;  4M7A E;  5LJ5 h;  1QVF P;  3BE3 A;  2HL3 A;  3SWN C;  4KH0 B;  5C6S A;  1OPK A;  2FRY A;  1W2B A;  4N0A A;  2CH4 W;  1Q7Y U;  3G1J A;  4ANJ A;  4M75 G;  3SB2 A;  1RI9 A;  4M7D C;  1OX9 A;  1MV3 A;  1SKU B;  1ZLM A;  3CCJ Q;  3CCJ T;  1U1S A;  2HNI A;  3REB B;  2NUT B;  1T3S A;  1M2V B;  4IUR A;  1BBZ A;  2ESW A;  2EKO A;  2A7Y A;  1W70 A;  4KGZ B;  4M7D G;  4LDY A;  1I1J A;  1BCM A;  2FL7 A;  4RMO A;  4BY6 B;  1YJN A;  4QVC A;  2X4Y A;  5IN1 A;  3OY9 A;  1XQH A;  1LCK A;  3M0R A;  1WGS A;  4WTO B;  3RIR A;  1OV3 A;  2G3R A;  3L1A A;  4C5G A;  1IGU A;  1ZUU A;  4CC4 B;  3RNJ A;  1M3A A;  2YXY A;  1K1Z A;  3P8H A;  2LJ3 A;  3X25 B;  2PU9 B;  2QEX Q;  2QEX T;  2HL5 C;  5FRN A;  4KGX B;  1X6G A;  2NUP B;  2M1H A;  4M4Z A;  3GIB A;  3LWH A;  1YIJ A;  2XD0 A;  1NM7 A;  3M4Y A;  3M55 A;  5KE3 A;  5LJ5 f;  1OOT A;  4HVV A;  2EGA A;  1MMA A;  4OMP A;  3T9N A;  3VS2 A;  1UGP B;  4JRK A;  2O4X A;  1IB8 A;  3GPL A;  2NWM A;  2BE7 D;  1UB4 A;  1MUZ A;  1H92 A;  4PFZ A;  3I5S A;  2DF6 A;  4B9X A;  2O31 A;  4RTV A;  3QDR B;  2L0A A;  2G6F X;  2XHC A;  4J6Y A;  1YJN Q;  1YJN T;  4JZ4 A;  2OI3 A;  2EPD A;  4ZGE B;  2YLC A;  2WSC E;  5EG2 A;  2KDS A;  1R8O B;  1X69 A;  4B6M A;  4BAC A;  2R58 A;  3P8B B;  4OB1 B;  3SD4 A;  1QCF A;  1YHQ Q;  3TRE A;  1AWO A;  2YLB A;  1YJ9 A;  1D3B A;  1EIF A;  4GLK A;  1WHL A;  3L2R A;  1G83 A;  2VAS A;  3PIO A;  2RQT A;  1YIJ Q;  1YIJ T;  2DET A;  3FLG A;  3DB3 A;  4A53 A;  1X43 A;  2DM1 A;  2YUO A;  4Y92 A;  2MPX C;  4L6V 5;  3G71 Q;  1PSE A;  4BDZ A;  1ZBX A;  2ZCF B;  3MP6 A;  5IXF A;  4NL3 A;  4CC7 A;  4LUE A;  3H0F A;  1QVP A;  1ZA2 B;  2QXF A;  3JB9 D;  1MV0 B;  2GBQ A;  3VS7 A;  3EG9 B;  1VQ8 Q;  5GAN 2;  1TUD A;  2CT3 A;  2GQV A;  2K57 A;  1MNE A;  1X6B A;  2D0Q B;  1VQ5 A;  1LVK A;  1NPR A;  1YCY A;  4J9I A;  2PUO B;  5FU7 B;  4ZGJ B;  1XJW B;  4J7F A;  1PSF A;  2K3B A;  5HY6 A;  2JJ9 A;  1E7O A;  2RJF A;  2CYZ B;  2K3X A;  4M75 A;  1PNJ A;  2L5Q A;  4HCZ A;  4PFO A;  3EH1 A;  5IXB A;  5KYY A;  3H9N A;  4HT8 A;  1XNI A;  2RB6 A;  2KI7 A;  3MJX A;  2MI6 A;  1YJ9 T;  4ORZ A;  3UT1 A;  2M16 A;  1TSF A;  1UJ0 A;  3SWN A;  4ZTJ A;  2RHZ A;  3V8J A;  3RBB B;  1KFZ A;  2D0N A;  5FU6 C;  2JM8 A;  4M7D A;  1BI3 A;  5KYX A;  5D6Y A;  3G4S Q;  5FWC A;  3M54 A;  4DBR A;  4F17 A;  3VS4 A;  4HA8 A;  3PE0 A;  5CCA A;  2XK0 A;  1K73 U;  5CR2 A;  5A0D A;  2SRC A;  1ARK A;  4M78 B;  1QVF A;  4LDU A;  2CH4 A;  2XU8 A;  3JCM g;  3OQ5 A;  1TU0 B;  1EZZ B;  2K5F A;  4HT9 A;  1VQ7 A;  2HQX A;  1W4S A;  2LCS A;  1VQ5 Q;  1VQ5 T;  2DE0 X;  3U23 A;  2FVU A;  3JCM b;  2JTM A;  3EGD B;  3V8K A;  4QVD A;  1UGR B;  4JJD A;  4RKU E;  2HSE B;  3QZ5 B;  5I11 A;  2DAQ A;  4RTY A;  2CS7 A;  2JW4 A;  3OYI A;  4M78 E;  4JS5 A;  3OBW A;  3R6N A;  2D8H A;  2XDD A;  4C5I A;  1UFF A;  3CD6 A;  3I9Q A;  1HK9 A;  1K8A C;  1WYX A;  3OYF A;  4PKC C;  1YWO A;  1I81 A;  3JCM f;  2OTL Q;  5GAN h;  1PG5 B;  2E3H A;  3VS1 A;  1K8A R;  1YJW A;  2FZC B;  1ABO A;  2QQ9 A;  1H64 1;  4LD9 K;  2VB6 A;  3EFR A;  1OPL A;  2LNH B;  2DL4 A;  1M1F A;  2K79 A;  3RMS A;  2D9T A;  4LDW A;  2CSQ A;  5J39 A;  2YDL A;  3EFS A;  4A4G A;  2QAS A;  2RPN A;  1WHH A;  4JZ3 A;  4RG8 A;  3LLR A;  4J9E A;  1G3S A;  1PHT A;  1EX4 A;  4HVU A;  2CP3 A;  1BK2 A;  5KYW B;  3OYN A;  2EGC A;  1VQ7 Q;  2X51 A;  1VQ7 T;  5LJ3 j;  1GCQ C;  4L5G A;  1GBQ A;  2K5I A;  5GAN g;  2KR3 A;  2LRQ A;  3PT9 A;  3OYM A;  3EFO B;  3ZFJ A;  4XU2 A;  1N5Z A;  2JTF A;  3O8V A;  4N4I A;  1Q86 U;  3JCM W;  3URG A;  2RHY A;  3M59 A;  3CD6 Q;  3CD6 T;  1ZSZ C;  3H0H A;  3GOX A;  1VQ6 A;  3GNG A;  3RKW A;  5LJ5 e;  3CBM A;  4K11 A;  2VWF A;  2DIQ A;  2VXF A;  2EAY A;  1YJW Q;  1YJW T;  1WJR A;  2K4Y A;  4ATO A;  5LJ3 d;  5GAN f;  3OW2 P;  2AKL A;  1KQS S;  3KUF A;  2LT1 A;  2KNB B;  2EVR A;  2EYY A;  4D8K A;  1GRI A;  2QQS A;  2O9V A;  5L23 A;  5GAN 5;  2CSI A;  3KXT A;  1WHM A;  2CP5 A;  2J06 A;  2CP7 A;  1U3O A;  2HAX A;  4FYY B;  4MZP A;  3RMQ A;  4BB7 A;  3UF4 A;  3M57 A;  2LQW A;  4KUD K;  2MAM A;  3L2Z A;  3IQL A;  2XG8 D;  4XAX B;  1GBR A;  4E7K A;  1VYU A;  2X3W D;  2JMC A;  2V1Q A;  1NJI C;  3REA B;  2X4J A;  3QYH B;  1RLQ C;  2XDP A;  3G6E A;  2CZ6 B;  1VQ6 T;  2D8J A;  1NJI R;  3LGL A;  2EQU A;  3QYG B;  4RTT A;  3KBG A;  3TSW A;  3X20 B;  2MMP A;  2O9S A;  2PVO B;  2EQJ A;  1HYO A;  3EG1 A;  2DXT A;  4N4H A;  5GAN 7;  2RI2 A;  4M78 D;  2RO0 A;  1KQ1 A;  2FPE A;  3MP1 A;  1BI0 A;  3TU4 K;  2E41 A;  2E64 A;  4PJO F;  2O4X B;  5J26 A;  3NGP A;  2E5K A;  2EJ9 A;  1YWP A;  1QVG P;  2FHD A;  1D1B A;  2E12 A;  2ED0 A;  2E4H A;  2JS2 A;  4XU1 A;  1K8A U;  2SEM A;  1M8V A;  4MZM A;  3M0P A;  3X24 B;  2A0F B;  2LTO A;  5GAM h;  1Q82 U;  4VUB A;  3CCE A;  1H3H A;  2HDA A;  4LXC A;  1UTI A;  2EWN A;  4M75 F;  3X26 B;  3V8L A;  3LH0 A;  2XID A;  4IIM A;  3MEU A;  2W10 A;  2KK4 A;  1AWX A;  3HRS A;  2R5M A;  1YI2 A;  4J6W A;  1R77 A;  2C0O A;  2V8I A;  1PKS A;  3VYH B;  3VS6 A;  3G6E Q;  5IAY A;  4ZN3 A;  1D3B B;  3G6E T;  3AHU A;  4KT0 E;  4J9H A;  3RDV A;  2KGT A;  3OYE A;  3NFC A;  1D09 B;  2ENM A;  1OU8 A;  3CCS A;  1BB9 A;  1QMC A;  3C4S A;  2GFA A;  4PNO A;  5CQX A;  4C92 F;  2J6F A;  2CZ1 B;  1UEC A;  1PC0 A;  1KHC A;  2ZPG B;  5CKF A;  3HRU A;  3CXC A;  2EBP A;  2E10 A;  3PGG A;  3N5B B;  2DYB A;  2COY A;  2RD1 A;  7AT1 B;  3M5A A;  4LN2 A;  3EHR A;  4IUU A;  2YRC A;  3I55 A;  1WXT A;  4JRP A;  3CXC S;  3CC7 A;  4RUG A;  1QWF A;  2EIF A;  1XTD A;  1AWW A;  3V7C A;  1Y96 A;  2RMO A;  4QVZ A;  4DBF A;  3R6O A;  3FB9 A;  2LQN A;  4PJO C;  2LT4 A;  3M4G A;  1RAH B;  2CZ7 B;  3EG2 A;  1GCQ A;  2L89 A;  4OMM A;  2EGE A;  4WF2 A;  3OYB A;  3CC4 A;  2DYI A;  3CCE Q;  3CCE T;  4D8D A;  3MET A;  2M0O A;  3FIF A;  2YRD A;  5GAM f;  2E3I A;  1SRM A;  4PJO G;  4C5E A;  4M75 B;  1G2B A;  1ZSZ A;  5KYY B;  3JCM e;  1YI2 T;  1QW1 A;  2FO0 A;  2QAZ A;  1JBM A;  4BUG A;  4M75 C;  3ZL7 C;  2B8A A;  3BDL A;  4QQG A;  3OYC A;  3CCS T;  2ABL A;  4M7D B;  1SG5 A;  4HXJ A;  1I5O B;  1W1F A;  1YBY A;  5KYX B;  1K0S A;  4M75 E;  4JUV A;  4AFS C;  1ACM B;  3GP8 A;  3CBP A;  3VKI A;  1NEB A;  4E6R A;  5I22 A;  4HVW A;  4GLM A;  4C92 C;  3EG3 A;  3I55 T;  1W2B S;  1NJI U;  2DD4 A;  2VYT A;  3NPF A;  3CC7 T;  3CC7 Q;  3A8H B;  3PIP A;  4C5H A;  3MPU B;  4C0D C;  4M7D E;  1RLP C;  5I21 A;  2FPF A;  2A28 A;  2COZ A;  1IXD A;  5GAN 3;  4C92 G;  2HQH A;  3CC4 Q;  2P0K A;  3CC4 T;  3OW2 A;  1VUB A;  2V26 A;  4E47 A;  4J9B A;  4DA4 A;  1B34 A;  1AWJ A;  2L3S A;  3H6Z A;  8ATC B;  3RR6 A;  3M9Q A;  1TTH B;  2HD0 A;  1Y0M A;  5L8R E;  3M0U A;  2JXB A;  1K73 C;  2MWP A;  3QO3 A;  1MHN A;  3PTA A;  3JB9 I;  3E19 A;  2FEI A;  1M1G A;  2DMO A;  5LJ5 d;  4Z8A A;  2YT6 A;  1X2Q A;  4C8Q F;  5GAN e;  1K73 R;  2AZS A;  1N8R U;  3CPW A;  4PLL A;  2IG0 A;  3OMC A;  1JEG A;  1JXM A;  3UWN A;  1C1A A;  1K4U S;  4A63 B;  4PJJ A;  1PKT A;  5FWB A;  1BYM A;  2MIO A;  1ZSG A;  2YUQ A;  4OP0 A;  1NE8 A;  3LGF A;  4LDX A;  1JRI A;  2JT4 A;  2LNV A;  3CC2 A;  1CSK A;  1QKW A;  5GAO n;  1FX7 A;  2F2V A;  1WFW A;  2JTE A;  2EW3 A;  2WSE E;  1M4Z A;  1M27 C;  4JJN K;  1BCO A;  1M90 U;  4BI3 A;  4OML A;  2JZ2 A;  2EYW A;  3J7A F;  5IT9 E;  2GTO A;  2DJQ A;  2VXE A;  5GJW B;  2BZ8 A;  1YFN A;  2VUB A;  2GFU A;  2RH2 A;  4X1V A;  1M3C A;  3A8G B;  4Y91 A;  3OS1 A;  4C0G A;  3LX7 A;  3ZBD A;  1WLP B;  2D1X A;  5FRM A;  1T0J A;  4OB0 B;  4ELY C;  4XTW A;  3LWI A;  3WVE B;  1WX6 A;  4IUQ A;  1H3Z A;  4FYX B;  4J9G A;  2H3E B;  4KUI A;  1RAI B;  2HSP A;  2WAC A;  4XTY A;  5FLX E;  4C8Q C;  2BZX A;  1M8M A;  5LL6 S;  1RAG B;  3CEY A;  1LJO A;  1Q86 C;  1LPL A;  4M7A D;  2J6K A;  1BIA A;  4A4H A;  1SPK A;  5GMK e;  4O5V A;  2CUB A;  5HCK A;  2CP6 A;  2ZPE B;  1JJ2 A;  4F14 A;  4PJO A;  2GNC A;  3P8D A;  2GCX A;  1Q86 R;  3CC2 T;  3JCM c;  4PJL A;  4C8Q G;  1RL2 A;  2EYQ A;  3LW5 E; 
#chains in the Genus database with same CATH homology
 1G3S A;  2DKG A;  2F5T X;  1V29 B;  5CKE A;  4BI4 A;  2Y4X A;  2LQK A;  1JB0 E;  1HXD A;  3UDC A;  2JVV A;  4OVA A;  4A4F A;  3OYN A;  1Q81 C;  3GNF B;  4O6J A;  3MO8 A;  2YRV A;  1AHJ B;  3MCA B;  3UPU A;  4M77 A;  1VQ7 T;  5LJ3 j;  3CCQ A;  3MP8 A;  2VGN A;  4L5G A;  4M78 A;  1Y7X A;  2Y90 A;  3DB4 A;  4M7A F;  3OW2 S;  3L42 A;  2RJE A;  2X35 A;  4CI0 C;  2QDY B;  2K5I A;  5GMK l;  2WSF E;  5GAN g;  1VQM A;  4M7D D;  3PT9 A;  2L8D A;  2LRQ A;  5KCO A;  3OYM A;  2A3L A;  2R57 A;  1X75 C;  4XU2 A;  2DJZ A;  2JTF A;  3ZFJ A;  4OF1 A;  3J80 E;  5GAM j;  4EMG A;  4RCC A;  4F7U A;  3O8V A;  4N4I A;  4CRI A;  1Q86 U;  3QHS A;  4OB3 B;  5LJ5 g;  3L2W A;  4C0Z A;  1KD1 U;  3JCM W;  2ZPH B;  3JCM h;  1BIB A;  5D6X A;  1UGS B;  3URG A;  5KE2 A;  2GF7 A;  2RHY A;  1U1T A;  3M59 A;  3JAM E;  1N9R A;  1FWZ A;  3CD6 T;  3X28 B;  4BY6 C;  5FU6 B;  3JB9 H;  3A8L B;  3GOX A;  4EDU A;  1VQ6 A;  3GNG A;  3PMI A;  3RKW A;  4R55 A;  2RK2 A;  5LJ5 e;  5GMK m;  3JCM Q;  5CIU A;  3CBM A;  1BI1 A;  3CCV A;  2M9U A;  3OYJ A;  5GAO l;  3RER A;  3CPW S;  1YHQ A;  2DIQ A;  4M7D F;  2VXF A;  3H8Z A;  2EAY A;  1YJW T;  1S72 A;  1WJR A;  3VYG A;  2QTX A;  2K4Y A;  1Q81 U;  3CMA T;  4C92 A;  5I2S A;  2KSS A;  5DM7 R;  2V8K A;  1I8F A;  4ATO A;  5LJ3 d;  5GMK i;  5GAN f;  5A2Q E;  4JS4 A;  1QP3 A;  1N27 A;  4DOW A;  1KQS S;  3QII A;  1VQO T;  3KUF A;  2LT1 A;  4OGE A;  2KQW A;  3OS2 A;  4BE0 A;  4ME7 A;  2VV5 A;  5LJ3 e;  2QQS A;  5GAM g;  2QA4 T;  2IVW A;  1VQ4 A;  3OMG A;  4OGC A;  5GAN 5;  3KXT A;  1IZ6 A;  4JRI A;  3NTK A;  1QP2 A;  3VV0 A;  4EMH A;  3G71 A;  3CCJ A;  2DIG A;  2DPP B;  1ZQ1 A;  1MGQ A;  5GAO p;  3NTH A;  3VUZ A;  2OAU A;  4XU3 A;  5HK3 A;  3HFN A;  5GAM e;  4LD6 A;  2HAX A;  4MZP A;  3JRZ A;  2E6Z A;  3RMQ A;  4A54 A;  4BB7 A;  1N9S A;  3PFS A;  3RUX A;  1M5Q 1;  3M57 A;  1VQN A;  2YHT A;  3HRT A;  2CZ0 B;  1QVF S;  1QVG A;  3C12 A;  4KUD K;  4C0F A;  3CCQ T;  2MAM A;  3L2Z A;  3QG1 A;  4DOV A;  2ZZD A;  3HHT B;  3L2V A;  3A8M B;  3PNW C;  3QXE B;  3FC3 A;  1VQ8 A;  2E70 A;  4FSX A;  1VQM T;  2XG8 D;  4XTV A;  2DXB A;  4XAX B;  3CCU A;  4J5Y A;  4X34 A;  4M7A B;  2BIV A;  3C94 A;  3JCM X;  3JCM J;  4XQ3 A;  1QVG S;  3LYI A;  3JCM d;  4E7K A;  2JNG A;  1WJS A;  1NJI C;  4XTU A;  2FB7 A;  1KHI A;  2X4J A;  5GAN 6;  5CAI A;  4PJO D;  3QYH B;  3F70 A;  4M7A C;  2XDP A;  3BDU A;  4JRQ A;  2XDB A;  3G6E A;  4C8Q B;  1G3W A;  2CZ6 B;  1VQ6 T;  1G3Y A;  3LGL A;  5HKC A;  2EQU A;  3QYG B;  3A8O B;  3KBG A;  1IRE B;  3X20 B;  3CCV T;  5GAO r;  2MMP A;  2PVO B;  2RM4 A;  3SWN B;  4E7L A;  2EQJ A;  2QEX A;  1Q82 C;  4IKF A;  3OBY A;  1YHQ T;  2DXT A;  4M77 D;  4N4H A;  5GAN 7;  1S72 T;  4M7A E;  5LJ5 h;  2RI2 A;  4M78 D;  2RO0 A;  1KQ1 A;  4P5N A;  2P0Q A;  1Y71 A;  4FM4 B;  3MP1 A;  5FRO A;  3SWN C;  5C6S A;  1BI0 A;  3TU4 K;  1W2B A;  2L3R A;  2E41 A;  2E64 A;  3M56 A;  1Y96 B;  3QJY A;  4N0A A;  2O4X B;  5CQY A;  4PJO F;  5J26 A;  1Q7Y U;  4M75 G;  1K9M C;  2EJ9 A;  4M75 D;  4C8Q E;  3FDR A;  3DLM A;  4NL2 A;  3SB2 A;  4ELZ C;  4A4E A;  4M7D C;  3CC7 T;  2X4W A;  2FHD A;  2HQE A;  2LVM A;  2E12 A;  3S6W A;  1VQ4 T;  3TEE A;  1M1K C;  3G4S A;  3G71 T;  4XU0 A;  3CCJ T;  1JJ2 S;  2NLU A;  5A0G A;  4XTZ A;  4XU1 A;  4IUP A;  1U1S A;  2HNI A;  1K8A U;  4QQ6 A;  1KC8 C;  2KMT A;  4IUR A;  3HP9 A;  4M77 F;  3L2U A;  2JN0 A;  1M8V A;  4MZM A;  2AHJ B;  2A7Y A;  2EKO A;  2LCL A;  4M78 F;  1VIF A;  5J3B A;  3OYG A;  4L59 A;  1VQN T;  2CKK A;  4EMK B;  3X24 B;  4M7D G;  4TVR A;  2KAF A;  2ZGW A;  2LTO A;  5GAM h;  4GY5 A;  4LDY A;  3JCM P;  1Q82 U;  4VUB A;  4YTL A;  3CCE A;  2DD5 A;  4C92 D;  2FL7 A;  2RHU A;  4RMO A;  1VQ8 T;  3BY7 A;  2EWN A;  4BY6 B;  4F7U F;  4M75 F;  2DTH A;  2QQB A;  3X26 B;  1YJN A;  3CCU T;  4J7I A;  3V8L A;  1TH7 A;  3LH0 A;  2XID A;  4EMK C;  3MEU A;  4QVC A;  2X4Y A;  1UEB A;  3OYL A;  5IN1 A;  3OY9 A;  5C0M A;  2KK4 A;  5I2M A;  5DLQ E;  1XQH A;  2PQW A;  3HRS A;  3HFO A;  4D6W A;  4EPC A;  4ZTF A;  1WGS A;  2DXC A;  2R5M A;  1YI2 A;  3RIR A;  4J6W A;  1LNX A;  1KQ2 A;  2G3R A;  4M7A A;  3JB9 J;  2V8I A;  2RK1 A;  3L1A A;  4MZT A;  3VYH B;  4C5G A;  3AHU A;  5IAY A;  4ZN3 A;  1D3B B;  4JLI A;  3ZEH A;  3G6E T;  5GAN d;  1X01 A;  4FIB A;  4KT0 E;  2DZC A;  2H3J A;  1SSF A;  3P8H A;  3OYE A;  1XOV A;  5FU7 C;  3NFC A;  2DO3 A;  3QJ6 A;  2OTJ A;  3X25 B;  2PU9 B;  2QEX T;  3CCS A;  3C4S A;  4PNO A;  2GFA A;  3FRN A;  5CQX A;  4C8Q A;  4C92 F;  5LJ3 g;  3VUB A;  2CZ1 B;  3OYK A;  5FRN A;  2LC4 A;  2M1H A;  5M9O A;  3GIB A;  1BI2 A;  3LWH A;  1YIJ A;  3CCR A;  2XD0 A;  2O01 E;  1KHC A;  2ZPG B;  4MDW A;  3HRU A;  5CKF A;  3CXC A;  5CK9 A;  3M4Y A;  2E10 A;  1OZ2 A;  3M55 A;  3PGG A;  2X4X A;  5KE3 A;  1NPP A;  3N5B B;  2OTL A;  4J8O A;  2RI5 A;  4IUV A;  5LJ5 f;  2R5A A;  5GAO m;  2RD1 A;  3I56 A;  3WXM B;  3M5A A;  5KH6 A;  4IUU A;  3I55 A;  2JUF A;  4KUL A;  1X6O A;  4JRP A;  5GMK h;  3CXC S;  3CC7 A;  4J6X A;  5D6W A;  3GLX A;  5CO7 A;  3G4S T;  3T9N A;  2EIF A;  1UGP B;  1XTD A;  3V7C A;  1Y96 A;  4JRK A;  4QVZ A;  2O4X A;  3R6O A;  3C95 A;  3FB9 A;  3HPW A;  3ME9 A;  3GPL A;  4PJO C;  3INZ A;  2LT4 A;  3M4G A;  2EJG A;  3RKY A;  2RHX A;  3NTI A;  3VJP A;  2CZ7 B;  4JDS A;  2F69 A;  2LDM A;  2L89 A;  1UB4 A;  1N6A A;  1B34 B;  1P92 A;  4II1 A;  4B9W A;  2ZPF B;  4MDX A;  4WF2 A;  3OYB A;  5LJ3 f;  2P4T A;  3Q1J A;  1O75 A;  3CC4 A;  3V7R A;  4B9X A;  3CCE T;  3MET A;  3QDR B;  2M0O A;  2XHC A;  4J6Y A;  1YJN T;  1DJ7 B;  2P0P A;  3FIF A;  4M77 C;  3M53 A;  4EMK A;  5GAM f;  4ZGE B;  1VQK A;  2YLC A;  4PJO G;  4C5E A;  2WSC E;  4M75 B;  4M78 C;  5EG2 A;  3BFM A;  3M58 A;  2DZ9 A;  2KDS A;  3JCM e;  3QZ9 B;  1YI2 T;  1R8O B;  4PL6 A;  2E6N A;  5GAN 4;  2RJD A;  4HKE A;  1QW1 A;  2CGH A;  3V7S A;  4BAC A;  1JBM A;  2R58 A;  4BUG A;  3CCL A;  4M75 C;  2EJF A;  3P8B B;  3QPH A;  4OB1 B;  5HK0 A;  3SD4 A;  4UC4 A;  2B8A A;  3DKM A;  4FU6 A;  2LQ8 A;  3BDL A;  1UGQ B;  4M77 G;  3OS5 A;  4QQG A;  2BKD N;  3TRE A;  2KY9 A;  2YLB A;  1YJ9 A;  3OYC A;  2OTJ T;  4N4G A;  2XIC A;  4M78 G;  3CCS T;  2DTO A;  2XI9 A;  1D3B A;  1EIF A;  4GLK A;  4M7D B;  1LOJ A;  3L2R A;  1G5V A;  3CPF A;  1YBY A;  3PIO A;  4M75 E;  4JUV A;  3CCR T;  1YIJ T;  3FLG A;  3DB3 A;  4A53 A;  4FL6 A;  4KBM B;  3GP8 A;  2VGM A;  4F7U G;  3CBP A;  3VKI A;  2I2L A;  2OTL T;  4BDY A;  2BUD A;  3QSU A;  5GAN j;  3I56 T;  2D6F A;  4C92 C;  4L6V 5;  4NS5 A;  2HBP A;  1PSE A;  3MEV A;  3SFM A;  3OS0 A;  3I55 T;  1Y07 A;  2DD4 A;  4BDZ A;  2VYT A;  1ZBX A;  2E1H A;  3OSS C;  2PUK B;  3A8H B;  4FT2 A;  2ZCF B;  3MP6 A;  4Z02 A;  3GF5 A;  5LJ3 h;  4C5H A;  4NL3 A;  3PIP A;  1KD1 C;  2K2V A;  2EQM A;  2PVD B;  3SDZ A;  2DK3 A;  4C0D C;  1N8R C;  2E5Q A;  4M7D E;  5CVI A;  2K5L A;  5I21 A;  3OA6 A;  1QVP A;  4BD3 A;  2QXF A;  5A0L A;  3JB9 D;  5GAN 3;  4OB2 B;  4C92 G;  4E7H A;  4Q5W A;  4C8Q D;  3FJP A;  2P0K A;  5GAN 2;  3CC4 T;  3ASK A;  3HL8 A;  4PLI A;  2GQV A;  2K57 A;  3OW2 A;  4A4K A;  4HCB A;  1VUB A;  1OYX A;  1KG1 A;  4ZN1 A;  4E47 A;  4R56 A;  3HKS A;  2EQK A;  4DA4 A;  1B34 A;  2D0Q B;  1VQ5 A;  2ZPB B;  1NPR A;  1VIE A;  1YCY A;  2PUO B;  5FU7 B;  1VQK T;  3H6Z A;  4ZGJ B;  3OYA A;  2MWO A;  1K9M U;  3E9G A;  3ER0 A;  3QUI A;  3M9Q A;  4J7F A;  3RES A;  2HD0 A;  5DY9 A;  4ZGD B;  4V2S A;  1WQW A;  2PVG B;  5L8R E;  1PSF A;  4LDV A;  5HY6 A;  1M1K U;  2FYK A;  2JOY A;  1K73 C;  2RJF A;  2MWP A;  2CYZ B;  1BKB A;  2LCC A;  2K3X A;  3QO3 A;  3CCL T;  1MHN A;  4M75 A;  2L5Q A;  4HCZ A;  3PTA A;  4DQ2 A;  3A5Z B;  3JB9 I;  3OB9 A;  3S3N A;  3JB9 F;  4OMF B;  1NZ9 A;  3E19 A;  1M1G A;  5LJ5 d;  3BW1 A;  4C8Q F;  3VU3 C;  2RB6 A;  1XNI A;  5GAN e;  1VQP A;  1KC8 U;  4HT8 A;  4J83 A;  2MI6 A;  1YJ9 T;  1N8R U;  3UT1 A;  3CPW A;  3S3M A;  2M16 A;  1M90 C;  3JCM V;  5GAO q;  4XK8 E;  4PLL A;  2IG0 A;  3OMC A;  3SWN A;  3CME A;  3QKJ A;  4ZTJ A;  2RHZ A;  3UWN A;  3V8J A;  1YIT A;  4E7J A;  2E65 A;  2RI3 A;  5KCH A;  4IUT A;  1O9S A;  1FXX A;  3S3O A;  2DTI A;  4NOY A;  3CCM A;  5FU6 C;  1KQS A;  1BYM A;  4M7D A;  4XTX A;  4PJO B;  1BI3 A;  3WVD B;  1WQ7 A;  5D6Y A;  2DEQ A;  2RA2 A;  3EAE A;  4OP0 A;  3G7Z A;  3OYD A;  3M54 A;  4BE1 A;  1NE8 A;  1VQL A;  3LGF A;  1WNL A;  3HSB A;  4X9D A;  4LDX A;  3PMT A;  2RJC A;  4HA8 A;  3DLL A;  3CBO A;  5CCA A;  2MF2 A;  4N0A C;  1JRI A;  4BI8 B;  2EFI A;  2XK0 A;  5GAN 8;  2LNV A;  2QI2 A;  3CC2 A;  3J81 E;  3L2Q A;  1K73 U;  1I4K 1;  5GAM d;  5CR2 A;  4M77 B;  5A0D A;  5GAO n;  1ZHI A;  1FX7 A;  2RHI A;  1VQ9 A;  4M78 B;  4HCC A;  1QVF A;  4LDU A;  4BE2 A;  2WSE E;  2XU8 A;  1M4Z A;  3JCM g;  4JJN K;  4PJO E;  3OQ5 A;  2K5F A;  5GMK j;  2F5K A;  4HT9 A;  1M90 U;  2DVE A;  1VQ7 A;  3MEW A;  2DXU A;  4BI3 A;  4F7U B;  4MMK A;  2HQX A;  2XKO C;  1W4S A;  1OZ3 A;  2JZ2 A;  1VQ5 T;  3J7A F;  5IT9 E;  2FVU A;  3JCM b;  2JTM A;  3MEA A;  1WJQ A;  3OYY A;  4E7I A;  4Y28 E;  3V8K A;  2VXE A;  1Q7Y C;  4QVD A;  1UGR B;  1I5L A;  2VUB A;  2GFU A;  3QZ5 B;  4RKU E;  2DAQ A;  2RH2 A;  4M77 E;  3A8G B;  2CS7 A;  1OI1 A;  4X9C A;  4Y91 A;  3OS1 A;  3OYI A;  4M78 E;  4JS5 A;  4C0G A;  3OBW A;  4MML A;  2XDD A;  3TCJ A;  4C5I A;  3CD6 A;  3LX7 A;  3ZBD A;  1VQP T;  1HK9 A;  5FRM A;  3FEO A;  1W2B S;  1NJI U;  4OB0 B;  1K8A C;  3QBY A;  4ELY C;  3OSV A;  4QW2 A;  3OYF A;  4XTW A;  4PKC C;  4C92 B;  3WVE B;  4F7U E;  3JSC A;  3LWI A;  3E9F A;  4RCB A;  4IUQ A;  1I81 A;  5CKB A;  1H3Z A;  1GXI E;  2LX9 A;  3JCM f;  3CME T;  2VC8 A;  4FT4 A;  1YIT T;  5GAN h;  4KUI A;  1YJW A;  4C0D B;  2WAC A;  4RG2 A;  4XTY A;  3CMA A;  4QQD A;  2QQ9 A;  5FLX E;  1H64 1;  4C8Q C;  5CKD A;  3CCM T;  4LD9 K;  3EFR A;  5LL6 S;  3E1S A;  4JLG A;  3CEY A;  1LJO A;  1M1F A;  1Q86 C;  4M7A G;  4M7A D;  5LJ5 j;  1VQO A;  1BIA A;  5CKH A;  3RKX A;  4A4H A;  3RMS A;  1VQL T;  2K3Y A;  5GMK e;  2D9T A;  3OYH A;  4LDW A;  2QQA A;  4O5V A;  2ZPE B;  5J39 A;  2QA4 A;  1JJ2 A;  2C06 A;  1U8R A;  4PJO A;  1WPY A;  2ZPI B;  3EFS A;  3MHX A;  1M9S A;  1G3T A;  2GCX A;  3P8D A;  4A4G A;  4C92 E;  5DLO A;  1RI0 A;  2KVQ G;  3JB9 G;  3CC2 T;  2V8J A;  5AYF A;  4RG8 A;  3JCM c;  3LLR A;  4C8Q G;  1RL2 A;  2QQR A;  2EYQ A;  3LW5 E;  1VQ9 T;  2Y4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...