3FBIB

Structure of the mediator submodule med7n/31
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
QNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification, structure, and functional requirement of the Mediator submodule Med7N/31
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Mediator of RNA polymerase II transcription subunit 7
total genus 27
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05669 Med31 SOH1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1340 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3fbiB00
3FBIB 3FBNB
chains in the Genus database with same CATH superfamily
1OYWA 3U1KA 1IXCA 1MBKA 2WADA 4G6DA 1F4KA 4HF0A 5BNGA 1MBFA 1X4OA 4Y52J 2X1EA 5L3GA 2FOKA 3CESA 3R0AA 4BHPA 4AM3A 5DV5A 1IN4A 1PUEE 1FOXA 3BG9A 2XHKA 4KUMA 3CCEI 3V8JA 2NRAC 3DPUA 2KFDA 1FNNA 2E5ZA 1RI7A 4NB5A 5HNFA 4WWCA 1KGSA 3HRSA 1QHHD 3H92A 2QQAA 3H5AA 1QRYA 3CD6I 1SEUA 2BY1A 2ZMEA 2ZSHB 4OMYA 4XRFA 3LL7A 2O5RA 1JJ6C 2FBKA 3R60A 3I4MJ 2PMZN 2EFQA 2RAEA 4C2MJ 1N25A 4LLNA 1RNLA 1Y1VJ 3L2VA 2XAGA 1K4SA 4A3DJ 4ZYHA 1MZBA 3BR0A 3L09A 1U8BA 1ZG5A 4IL6C 4P96A 4N4NB 2XGDA 3VOEA 2K7LA 3FDYA 2IGNA 2VXDA 2IS6A 5K5OA 4BXUA 3O2PE 4RGRA 1D1CA 3GLXA 5K7FA 1WJAA 5JFRA 4OIPF 3DBLB 4PJJA 4S05A 3G6EI 1YFHA 2X6WA 1FC3A 3DBHB 3OOPA 3B6AA 1F43A 1MIJA 1YIOA 2Q2EB 1R5GA 3J81Z 3GVAA 1IXRC 1ZLJA 2AXLA 2P7VB 3FXQA 3MZHA 4BEHA 3DLLF 4M74A 4Q5SF 2YUSA 3SFIA 1XX5A 1VZ0A 4RB2C 1DP7P 3VFZA 2GA2A 3LSRA 4F91B 3GUDA 3IP4B 1G59A 1TBXA 3J80Z 2JA6J 2ZXHA 3WGGA 1MMDA 1B4AA 3ZQQA 1W1WE 3IWFA 2R5YA 1YLFA 2BVLA 1JHFA 2GIVA 3CTAA 3KE2A 3QP5A 4CICA 3HSFA 2MSYA 1LFUP 4DYQA 4B48A 3KP5A 1XC5A 2A6EF 1BJZA 3HM5A 5TISC 1ORKA 2CQQA 4RB0A 3KLNA 4AYBA 2L2OA 1U9OA 4M72A 1HW2A 3KPHA 5LHIA 3LSPA 1VQ8I 3IAS2 4H4KC 3ASOH 2TDXA 2KLOA 3KYCB 4RB3C 1S5LC 2NOGA 2K40A 2ZCWA 4XR6A 4Z6YA 2VJJA 2W57A 2GOMA 2Q8KA 2L7FP 4KT6A 2HTJA 4WK8F 1U5TB 1IN6A 3BTJA 3HTSB 5DDGA 1P2FA 3GO5A 1XCBA 1JTYA 1WKMA 1XB4A 2DMPA 2R7SA 1ZGJA 4NQWB 3BC8A 2HTSA 1UG2A 3BWGA 2OV7A 3V7CA 3F8FA 2VPLA 3QRFF 1JUSA 3A0BC 3W2VA 1EV7A 5FJ8J 1KU2A 1IDZA 2Y0SN 1XPXA 1VQ5I 2BY0A 1I6HJ 3OIQA 3VYRB 1VNDA 2C6YA 3CDLA 2WAEA 3OL4A 2VJ4A 1TWAJ 3OYLA 3KEQA 2RQQA 2X51A 5BOXA 2F48A 1LFPA 4C9YA 1BM9A 4KNYA 3ZQHA 3KP6A 2BYVE 2EZLA 3M1CA 1HW5A 1G3YA 4XSZF 1IW7F 2W24A 2DN0A 3Q3SA 2JA7J 3SEZA 1ZRDA 4Q48A 3CCLI 4IOAF 1MNEA 3ZMVA 2XSDC 1Y0UA 3OIOA 2PG4A 5EF6A 3OS0A 2KRHA 2Z16A 1WPKA 4ENKA 4N4OB 1W36C 2F5EA 2L4MA 4A3MJ 2ELKA 1I3QJ 5F0HA 2RNGA 1B72B 3IHUA 3GFIA 2V4JC 1B8IB 4C3HJ 2IEKA 2WY7Q 4G94A 1K6OA 1MBHA 2EFNA 2MA3A 1TWGJ 1DU6A 2M9HA 2HVRA 5DS9A 3FXRA 2NOJB 4WXCA 4DNCA 3GEZA 3O6BB 1JJ8C 2BW3B 4XBFA 3NQOA 1IGNA 1S3JA 4XOTA 3OYDA 2DQLA 2OPTA 2MGQA 4RA2A 3HOTA 2HKOA 3W6KB 1BIBA 2CS3A 2HFHA 2DO7A 3SEQA 5M5XJ 1QVTA 3S1NJ 3K4KA 3S3MA 2NS7A 1XG1A 1W7PA 3OYHA 2STWA 5B66C 4I0BA 3BJAA 5DYMA 4BJ5C 1IG7A 3ZMSA 1MMNA 2KJBA 2LKPA 2HU9A 2E2JJ 3AG1H 2PMHA 4PK4A 5FO5A 3QYFA 3CO7C 1JTXA 4BQOA 1AWCA 3ECHA 1V4RA 2G0EA 4MEYF 1XSVA 5ILUA 2QA4I 3ZMDA 2HR3A 3X2QH 2JA2A 2QWWA 3BG7A 2GXGA 3COAC 3O3KA 2ECCA 5EZGA 3M8JA 1GT0C 1FX7A 1YIJI 4KIFA 1IO2A 4ESBA 5B1AH 4PDKA 5E1ZB 2A5WA 2EWNA 3HKZN 3MQ0A 4RGSA 1W0UA 2CJJA 1B8IA 4B8XA 4FX4A 1D8KA 1ZG3A 4XONA 4GYGA 2X1DA 2DTRA 2KIFA 1KYWA 5EG0A 1WVRA 2QKMB 1TW2A 1MJBA 2LH9A 2F5FA 1CF7A 2IAIA 4RM3A 1Y39A 2UXXA 4A69C 2GA1A 3RZOJ 3LSGA 3O8HA 1IRGA 2IT0A 3VYTB 1ON1A 4AIJA 1LDDA 2XB5A 5DUIA 1XMKA 1D0YA 1TWHJ 1GUUA 2XV4S 1K78A 2LRDA 2DMQA 2WA0A 3JRGA 5HLTA 1F5TA 2WAQA 4A3LJ 5GP9A 5ILVA 3ZCOA 1SFOJ 3TO6A 5J1YA 1S7EA 1QO0D 3SYTA 2OZUA 1KYZA 4XLHA 4HLYA 4J00A 2M0CA 3P9IA 2FX0A 1TNTA 4IHVA 5LRSA 4A3JJ 3F72A 2ZKZA 3GTKJ 3S2DJ 1WI9A 4S0HB 3REOA 4ZYAA 4IHXA 1OCOH 2CU7A 2Y0SA 3GFJA 3K9TA 1YYVA 1UELB 3GWZA 4JX5A 4BACA 2H09A 2HOSA 4A6EA 2D2WA 1OR7A 2DYRH 2OCEA 3L2RA 1T08B 2JPBA 3OYFA 1TQIA 2OA4A 2IGOA 1V54H 4WXHA 1T0FC 3H36A 2EZIA 3K4CA 4BJ6C 2PJRB 2ZXWH 4MIMA 3CCJI 1H0MA 1RESA 3K70C 2HXIA 2VONA 2FRHA 4A3CJ 4XKVA 2QZ8A 1KU9A 1SAUA 1ETKA 3RJPA 5FRNA 1G8XA 5L3DA 4D9JA 2JVHA 4WF2A 2HOTA 3GYHX 1O7LA 2VC1A 5E17F 5TJJA 4GO1A 2MW8A 1QPIA 1WH7A 2P5LC 1U3EM 2M4KA 2TCTA 4BDYA 4DZPA 1EH6A 2BEOA 5IT9K 3K1MA 1J2XA 1LNWA 2ZJRF 4KDPA 2DPUA 2R3SA 5LGNA 3VSLA 2FQ4A 4S04A 1LFBA 2F2EA 1FOYA 2OBPA 4LOCA 2MLGA 2VKEA 4J01A 2MFZA 4I09A 4IPAA 4HQMA 1K79A 2H6CA 3S32A 2OTLI 3KYDB 4IRIA 5AIQA 2NXNB 3DEUA 4QLCU 4I7HA 5HDGA 3CQZJ 4L5JA 3S2WA 3R61A 5ILSA 2V6EA 1GXQA 1TZLA 3E6BA 4EJWA 2FUG2 2ZC2A 3HHGA 1AU7A 2JT1A 1QQIA 1N78A 1X3ZB 2WWYA 1YITI 5LEJA 2K9SA 5J8FA 5E3OA 1T8IA 4I01A 4XRSG 3CJTB 5J3LA 1C0WA 1HDDC 3AL0B 2X1CA 3CMYA 5GAEJ 3K4LA 3QQAA 4KIBA 4P55A 2R5ZB 5BQTA 2DYSH 1T6SA 4LLGF 3ZR8X 4HLXA 1HQCA 1STZA 1WRJA 1G3TA 5BMZA 5E79C 1VQ6I 3TEDA 1R4NB 2P0WA 3WTVC 3AL0C 5EEAA 1ZK8A 1J5YA 1QPMA 2M45A 3K10A 3PNYA 3PQJA 3IUOA 3KZYA 3KCCA 3EETA 2P6TA 3G2BA 2JTVA 4I99C 4XK4A 2M3AA 4ZYEA 3TO7A 3I0TA 2G7HA 1RUOA 1FTZA 4R8HA 1ULYA 4FETA 1F9NA 2FMYA 1XGOA 2D1HA 3BP8A 1Y1WJ 2G9WA 2CO5A 1WCMJ 2LBFA 1VI0A 2OJED 2STTA 4AU7A 1J75A 4BHCA 2ELJA 3DLAA 3I4NJ 2CQXA 2VL8A 2XPWA 4PZJA 2B0LA 1S6LA 5BS6A 4OIQF 1UAAA 3L2WA 2FQ3A 2Z33A 3DBRB 1W7PD 4F3QA 2DT5A 1ZTRA 2LLKA 3H5RA 2DMTA 2DDAA 1ZKGA 1ERDA 4DIQA 4IHYA 4II3A 4MFDA 4B1RA 4B4CA 2UV1A 1OCRH 2IS2A 1PP8F 2ACJA 4Y33A 4KICA 1ZR2A 4DJAA 2M34A 3CP2A 2L9NA 2DODA 1ZG1A 4A0ZA 1P92A 3Q9SA 4IVNA 3G73A 3GTPJ 1TT5B 5FKNA 5F0FA 2MABA 3HSRA 1E0EA 3AG4H 2NVYJ 5CYVA 5CVIA 2VQGA 3SZTA 3PIPF 1IXSB 1OKRA 4A3GJ 3S93A 3L00A 3W6VA 1Q1HA 2LDUA 3KEYA 2CV0A 1OYYA 4Y7NJ 2Y9YA 3G71I 1I1GA 1PUFB 4LK1F 2K4BA 2LVSA 4CCLA 3I53A 3ZN0A 1MDMB 1MH3A 2V6CA 4W97A 2NNYA 3UNGC 1R6RA 5C4XJ 2CRGA 2K85A 2L54A 3OSGA 3CC7I 5FFZA 1OCZH 3IWZA 2YR2A 3FXKA 3CMAI 3GZ5A 4X1EA 2A6TA 2LK2A 2KIMA 3IL2A 2J5OA 4EJOA 2PFBA 5E18F 1LQ1A 2X85A 5F6FA 2CQ7A 1I6XA 1TC3C 1WZ2A 5FRMA 1OLTA 5HOOA 1VQKI 4GRIA 3FHNA 4U0YA 2OTJI 1YW9A 4XLFA 3EQLF 3A03A 1PVEA 1G6NA 3GTQJ 2CUJA 3CUQC 2R92J 3FMSA 1U2WA 4M6VA 1ETQA 4XSXF 2CW0F 3ZQIA 2HZDA 4B47A 3FXUA 1QNTA 3BOQA 4MGRA 1I27A 5F0CA 2K5CA 2W25A 3RKYA 4RDUA 2PLYA 2NNNA 1HXDA 3F9KA 2IA1A 2GXBA 4XKWA 4CGZA 5CVUA 3WTWC 3L2QA 1O3SA 4G9YA 4BBSJ 2YPRA 2R7UA 3A4CA 2FJ1A 2L7KA 4DZJA 4LG3A 2MBFA 3QAHA 3CUQA 2CGPA 2E1CA 3I56I 2F5VA 4OWRB 1Z05A 1ZYRF 2K9LA 3KZZA 3P9CA 4BQAA 3M7GA 3FM5A 1R49A 3BTCA 4WXDA 1WH5A 4FHTA 3ZP5A 3IH3A 3CLQA 1I3AA 2R4GA 1KQ9A 2DJIA 1DPRA 3F8NA 5FKMA 4FT8A 3VEPA 2W00A 3SJMA 5LRRA 1CGPA 2BXYA 2W48A 2Q1ZB 3PL8A 3BLYA 3IC7A 3JR9A 1R9TJ 3F21A 1D8JA 1Y0NA 4O3MA 3BZKA 4MHGA 3DTKA 1ETWA 1SMTA 3MEXA 5DD4A 3DTIA 2ZMEC 4RAZA 4HG2A 3ISPA 3B02A 3DKYA 3OV8A 5DTDA 4U0VA 2LREA 1K6YA 3PFIA 3TBIA 2L02A 1R23A 3LQRA 2M0MA 3GTJJ 2CG4A 1YW8A 2JK3A 1X4PA 3BZCA 1G3SA 3FXOA 1FEXA 3H3UA 4XOPA 2ID3A 4IO9F 4UY8I 3GCMA 1MBGA 2O8KA 4M73A 4ZYGA 1FMVA 1T33A 3LSIA 3KP4A 1O4XA 2ISZA 3H3VK 4XNFA 5L3EA 4BY7J 2ISYA 4YEJA 3FBNB 1Q1VA 5KCMA 3G1LA 5F1JA 1A04A 1YX5A 3PUFA 4D7MA 4II2A 4A12A 4LITA 2DDBA 1ZGAA 2GOXB 2FF4A 4M3GA 2QEXI 4HV5A 2VLAA 4CCNA 3I5UA 3ELKA 4LJZF 4WCGA 3E5XA 2E1OA 3GZ6A 1X1AA 3HHHA 1A36A 4XRSA 3E3VA 1ETYA 1XDUA 2EQRA 4CCKA 1DGRM 3B6CA 1L0OC 3DFGA 3BJ6A 2FE3A 2HWVA 5F64A 4FX0A 4IRGA 4N9HA 5JLWA 3JW4A 2P6SA 5FROA 3K1NA 2ZFWA 4M3DA 4GDFA 2P81A 4IQJA 2L01A 2R7RA 1YI2I 2XASA 1Z67A 2QKLB 1E3HA 2DAOA 3EDPA 2GWRA 2PMUA 1UB9A 3D5LA 2VUMJ 5K5QA 3C2HA 4A5NA 2DT7B 2WB1A 1AOYA 1BBYA 2VE8A 3K1PA 5JLXA 3PNVA 1HOMA 4RGXA 1GHCA 4ZDLA 1JT0A 1OCTC 2KKOA 2R7FA 2MYSA 1VQMI 4XLEA 1HBXG 4G7HF 4XORA 4BJTA 5E8GA 1U5TC 3E97A 2VIXA 4YRVA 3KZIC 1KU3A 3NAUA 4IRHA 3HOSA 2LF7A 1SD4A 2EFPA 1FP2A 4CCJA 2EINH 4BAYA 3WGIA 1QGPA 1JKQC 4MO7A 3QPTA 2HI3A 4NHJA 1PYVA 5FLMJ 4DYCA 1D0ZA 4AVZA 3I54A 4JOMA 3LSTA 3E5QA 4L9VA 3RQIA 5IYBJ 5EG0B 1NTCA 3PO2J 2CW7A 2ZFUA 2DBBA 3DTEA 2H8WA 5DM6F 1A6QA 2L5QA 2PMZA 3KP3A 3ZQLA 2M30A 2Z2SB 1Z7UA 1FLIA 4KN7X 5J6XA 4CCMA 3FMQA 1IRXA 3RCOA 1YJNI 2LSOA 5J1UA 1AHDP 2BVMA 2VOPA 2A6HF 4G7OF 3FKJA 5DCMB 3RKQA 3OSFA 1RR7A 1WSUA 1KQ0A 1Z6RA 2EH3A 2EIJH 4XICA 4RS8A 1T0FA 1OYIA 3HOWJ 2KL4A 2KP6A 4E7KA 2HOEA 4L18B 2M7AA 1NK3P 4KITB 1YOVB 4UB6C 1JXSA 2KMUA 2EIMH 2GQQA 4OINF 1OFCX 4FE7A 1YG2A 4I02A 1LB2A 5CPRB 2HYGD 1GV5A 4V2GA 4BYYA 1DDNA 4ENNA 3HJEA 3A1YA 2I5UA 2CV2A 3QU6A 4LMYA 2RVCA 1BC7C 2FU4A 2E71A 2RREA 3BDDA 2KDZA 2NYXA 2QSFX 2UUZA 3WODF 1X58A 4U7DA 3HOYJ 4JQFA 5EGOA 1Z0XA 4AD9A 2PBIA 4ZZDA 2HGCA 5AIPA 4UVAA 3S2HJ 2KZGA 1D5VA 3F8CA 1TTYA 3HPGA 2MC3A 1S7OA 1P4XA 5F04A 3CCUI 4MQVA 1IF1A 2MH9A 1EH8A 1JKRC 2X0LA 2E35A 2VI6A 1QA6A 2OUMA 4A0YA 2K27A 2IPQX 3MFKA 3NARA 4KT5C 3ZMTA 1T56A 3ZQFA 2B9SA 1EA3A 4UB8C 5AONA 3QODA 1SFEA 3E6MA 2ZNYA 3E0JB 4C30A 3K2AA 3WTUC 1POGA 3PSIA 2LKXA 4DBRA 1HKSA 2ECBA 4K2EA 3ZMUA 5D5WB 2R7TA 2JA5J 3CMMA 3KFWX 4CCOA 2NVTJ 2KZVA 2COBA 4FISA 3TW6A 5EJCA 1D1BA 4KFCA 3QYBA 4B43A 4ITVA 3LWFA 5J47A 2ZJQF 2ESNA 2A69F 3L2CA 2H94A 5ED4A 3ZQCA 3EUHA 2JA8J 4XIDA 4A93J 1X3WB 3HRMA 2R7DA 5FLXZ 2FNAA 4HEA2 4M3EA 4L9NA 3PM1A 4HDUA 4TV7A 3MVPA 3AG2H 3V4GA 3VYUB 1ITYA 2BY3A 3S14J 1FIPA 1GVDA 4HW0A 5K5RA 2V26A 3ZMZA 2FXAA 2E60A 4CO8A 4I0AA 2M87A 2A05A 4BKXA 2NVUB 2X6XA 4F7ZA 2LY2A 3J7ZI 6PAXA 1IRFA 3ZQ7A 5IT3A 2EFOA 1LUJB 2ZMEB 3OYNA 1ZGWA 2DCEA 5ICEA 1FYLA 2DI3A 2XUBA 4HAMA 4M9SA 3IKTA 3I4PA 5CVJA 2XF6A 1SMYF 2ZO4A 3CUOA 2IJLA 1D0XA 3WG7H 2ETHA 1PDNC 3HG9A 3DCFA 1ONVA 1BOAA 2M2EA 4XLAA 2YX7A 4LG0A 5GPCA 4Y4RA 3CJQB 1YO5C 1DGWY 1FIAA 1ETXA 4EMSA 2DW4A 2H8RA 4D1QA 1I39A 3MD2A 1CQTA 4BQNA 2HDCA 4Q4ZF 3I58A 2V1UA 1B59A 2LTPA 2IS1A 5F27A 1S8NA 4XLPF 5HS9A 2LKSA 3IV5A 1KZHA 1LDKB 2EZHA 4GXOA 3TMOA 1YRNB 4IXAA 3BCBA 2MH2A 1OISA 2VC0A 2ZNZA 2HDDA 3HRTA 4LGWA 2DOEA 3RKXA 4HX4A 4E6KG 2B63J 4BL0B 1AA7A 4KMUX 3E1SA 1DP3A 3J7YJ 4M9XA 2VKHA 3H9GA 4U88A 4KYWA 3S15J 3LSJA 2XAJA 3BTIA 2E7WA 2E5NA 4EATA 2XKOA 2Y75A 1BR2A 2WB1N 3VDXA 2I10A 5FKKA 4UNOA 3T8TA 1TW3A 3N4MA 3H35A 1P6RA 4IKFA 3ABUA 4HZFA 4BNCA 5J4VA 4I76A 3OYEA 4L9JA 4P5OA 2EZKA 4PUSA 2VBZA 2XAUA 5H20A 2HKXA 4QIWN 3JSOA 5LHGA 1UHWA 4UV9A 1DUXC 3FIWA 5D6EA 1P4AA 1LEBA 2YU3A 5M3MJ 4HDVA 5ERIA 2XIGA 4BE0A 3TL4X 2UWMA 2CMPA 3KYLA 4H0EA 1Z7LA 1Z9CA 1Y6IA 4PSWA 3GTOJ 1USTA 4L0ZB 2IVMA 2R7OA 1W4MA 1U9NA 4IEJA 2XGXA 1ZN2A 2IP2A 1TT0A 3ABLH 3FMRA 5IP9J 1WJFA 5IT9Z 3I64A 1MGTA 4AIDA 1ACIA 1ZLKA 1RKWA 1SVOA 3OMYA 1X1CA 5D5UB 3UKGA 2IBDA 4EGYA 1LPQA 1XGNA 1K83J 4ETSA 3DKWA 4ZH4F 2XAQA 3ESWB 1WJ5A 3ONQA 3DPTA 3IAM2 4L5IA 4JP0A 5LGUA 1WQ2A 2EJRA 2W1OA 5FFXA 5ICCA 5FB2A 3W3CA 1SVMA 3U2RA 2VXZA 4RMNA 1H89C 5GTHC 2KT0A 1ZR4A 1XSDA 2GXAA 4U7BA 4EJTA 3SXYA 3B73A 1I1SA 1BI1A 5DCMA 4A2UA 1JUPA 1HDPA 1RR8C 5HDKA 1A35A 1Y8QB 4EVIA 3OWTA 3BROA 3BPVA 1W7PB 4RAFA 1JKPC 3HL2A 4GYIA 2UXNA 4JBAA 4IZZA 3OR1C 1P9QC 2E19A 4Y17A 3FXLA 2VE9A 1NH3A 1OQYA 3JRFA 2PN6A 3CCRI 4NUBA 5TGTA 4FQGA 3E6CC 1LEAA 3PNTA 4ASNA 3HOXJ 3F6OA 3RIRA 1EH7A 1JT6A 1IN8A 4ZTFA 3K4MA 2W85A 5IYCJ 1MJ9A 2FSWA 2LG4A 4ZDPA 5E20A 2BW3A 3HYIA 4UUSA 2W7NA 5LD2C 2HEOA 3PO3J 1BR1A 4F55A 1HF0A 5M5WJ 4KISA 1TNSA 2CFOA 2OF7A 2AHQA 1YE9A 2ZJ2A 1D5YA 2ZJPF 2K86A 1JUMA 3E7LA 4AIHA 3BR3A 5L3CA 1L3LA 4P9FA 5EYRA 4I2OA 2GZWA 1Z21A 3ABTA 4P1WA 3TDUC 3K4BA 3QPLA 1Z3YA 4CZCA 3WHCA 5BPIA 2R5YB 3P7NA 2ELHA 2QF7A 3LFKA 1TQPA 3C7JA 3ZGKA 3ECOA 3FXJA 1X3UA 1Z6TA 3S16J 3V8LA 2A3SA 1R5HA 5DM7F 4RBOA 2QVOA 3LA3A 3LA7A 1BR4A 3K70D 5HODA 3LMMA 4BU2A 4E7IA 1UJ8A 2HZTA 3OYIA 4UUSB 3JTHA 3DWLE 1LJ9A 2E7XA 2DA3A 1QU3A 1S7AA 2ESHA 2CV1A 3Q0VA 4MFEA 2EPFA 3V7RA 4B44A 3JREA 4HQEA 5M3FJ 5HLIA 2H27A 2QYOA 3PJRA 3W2AA 3Q0UA 1JHHA 2BXZA 3H3ZA 3JCUC 1RUNA 3T0YA 3WE2A 2K9QA 4UHTA 5DUKA 3HXLA 3AG3H 2OQGA 1ZHFA 2P4WA 2M7BA 3D0SA 5K7HA 2VODA 3ZXSA 2R7WA 2RKHA 2X48A 4G6TB 5D5XB 1YJWI 5E3LA 2JVGA 4LIUA 3NRVA 4LB6B 3NEUA 2ZXJA 4F93B 1IUFA 4KN4X 1RKTA 2Z99A 3HPHA 4DBQA 3CCYA 1H8AC 2KIUA 3LSHA 2CWEA 1VF9A 2JSCA 1R22A 1LE8B 4AVPA 4KMFA 5JHFA 3M4OJ 1J9IA 4BBRJ 4XMYA 1USSA 4IJAA 3MMYB 3QYEA 2IS4A 2R7ZJ 2O61A 4UVBA 2FNPA 1RETA 2X6OA 5GAGJ 3G4SI 2JQ7A 3FF5A 4BY1J 2OQRA 2HQ5A 1WJDA 5DCFA 1YX3A 1AKHB 2HYJA 1FY7A 3FBIB 3FKIJ 3K4JA 5LEKA 2K3PA 1H9TA 2DLLA 3HOZJ 2FA5A 4JYKA 3SZPA 1RC9A 1TQMA 4G6QA 3L7WA 3SHFA 5LLQA 1K7AA 1MDMA 4NDLA 2YS9A 3MN2A 2W82A 3CJNA 1EJ9A 3K6GA 3I59A 2D1VA 3HOUJ 4DQ2A 3VSKA 4A3BJ 3JRBA 1P4WA 4HSTA 4MTEA 1S72I 2LNBA 3TKYA 2CUFA 3TW7A 4HNUA 1R1VA 1BC8C 3WTTC 3PUBA 2DU9A 3CZ6A 5ICGA 3F22A 2QBYA 9ANTA 3M1EA 1MBJA 3TGNA 3FHZA 2Z1DA 3OS1A 3F23A 1V5GA 3ZRGA 2A61A 3N97A 2P7CB 2W4SA 3RKWA 3M8EA 4E7HA 1F36A 2H1KA 1YJ9I 2X6YA 4JK1X 1W0TA 3ZPLA 5C44J 1WI3A 2KRCA 1REPC 1SC7A 3CUQB 2VKVA 3T1BA 3WU2C 2VJ5A 1KA8A 1ZRCA 1XD7A 3H9QA 4E7LA 2BHZA 3I71A 1YQAA 2DK5A 4D5CA 2ME6A 2XRLA 2EA2A 4OU0A 1LKXA 1BJAA 2NAZA 1G3WA 4MLOA 4A6DA 4IX7A 3CMEI 2VQHA 4BUPA 1YHQI 4GGGA 3PQKA 2O9LA 5DD8A 3DU6A 3QWLA 1X19A 3CC4I 4LFUA 1XCVA 5LGTA 3OS2A 3P9KA 2LY1A 5IP6A 5HS7A 1MH4A 3H9JA 1IZ1A 1D3YA 3TOBA 2HVSA 5FLVA 5KAFC 4XM3A 2R5ZA 1J7KA 3I3LA 3ASNH 3HOVJ 4MEXF 3TQNA 4M6YA 2KHMA 2L7MP 2ME0A 2IA2A 3ZN1A 1FBQA 3QPHA 5KNLA 1Y56A 3WTXC 3DV8A 4EJUA 3JRHA 3LOCA 1U6GA 1W5TA 4G12A 2DK8A 3KETA 5KK1A 4BXFA 4OAYA 1XMXA 3BCAA 3IRRA 2V9VA 4F52A 5FD5A 1UCRA 1XGSA 1BIAA 3CP8A 3DP7A 2XVCA 5IOYA 5B3SH 3PIOF 1TWCJ 4D0PA 2H6BA 4MQ9F 2CH0A 2QLZA 4C2UA 5KAIC 3BQYA 4M9ZA 1B6AA 2CQKA 1GV2A 5K7ZA 1HSJA 3N05A 4M71A 1O3TA 2DMNA 3MCZA 2RC4A 3QPSA 3WTSC 3F8BA 4V19K 5IY5H 4A3IJ 1A31A 2HXOA 4CXFA 5LHHA 2QCOA 4OOIA 4WX9A 2Z5UA 3GTLJ 3O8GA 1T2KA 5IYDJ 2VQCA 1GVJA 2WY8Q 3GLLA 1AKHA 2VKDA 1MMSA 1DPUA 1P7JA 3MZYA 1UZCA 1SANA 1TLHB 2L4AA 3KIOA 2FBHA 4A3FJ 3AFHA 4AWXB 1R4MB 1QBJA 1X2MA 3WTZA 4ENMA 4B3AA 1M1EB 3EUKL 2JRMA 2K02A 3JAMK 1I50J 1KU7A 2LMDA 3OYAA 3FISA 4UUTA 4LB5A 2QGUA 4EV0A 2IGMA 5TRDA 2MG4A 2VT2A 1IN7A 2DFFA 3ABMH 5CJ9A 4HNVA 4BXXJ 4W1UA 2M4GA 2CYYA 1FSHA 2DFEA 4NNJA 1FMWA 3D5SC 1LVAA 2V1DA 4JX6A 2M1BA 5CVVA 1R71A 2Q2EA 3ERMA 4PGGA 1SD5A 2BY2A 4IF4A 2PX9A 3BR6A 4M3BA 2LC2A 2XAHA 2YU9J 4X0GA 5GPAA 1ZARA 1R36A 3EUHC 5HVQC 5IPAA 3RZDJ 1HKQA 3ABKH 2UZKA 3HIFA 3VPRA 4C3IJ 3DU5A 1FSEA 1DQUA 1VTNC 4CH7A 2RDPA 2OC6A 3CDIA 4PSXA 2DFHA 4GCVA 4AC0A 4FCYA 2NVQJ 1SFXA 1ZELA 3SDBA 5E3MA 1H9GA 2HS5A 3LAJA 4E7ZA 3L9FA 2Y0MA 4QTRA 3BR2A 2M8EA 5J40A 1IUYA 4L0YB 3RPQA 3J7AY 2COMA 2CW8A 1HA8A 2QBYB 2Y2ZA 3WE3A 2K9MA 3J7AO 2L9VA 3PFYA 5CQGA 4OIRF 4CSWA 3WTYC 1Z91A 2ZSIB 1R58A 2A07F 2PJRA 4ZYDA 2XKPA 2Y31A 4Q47A 1BW5A 2KPMA 4R79A 4HOBA 2OD5A 2E2IJ 1HSTA 1N77A 4EEFG 3T8RA 1IAWA 2RNJA 1WFXA 2HDWA 3TOAA 5JI6A 1BA5A 5FD6A 3BG5A 4XN0A 5CKTA 2LOOA 1APLC 1EF4A 1A6IA 2EB7A 3MKYB 4YFKF 5CLSA 2QM3A 5B5EC 4PFOA 1I5ZA 1UHSA 2CUZA 2QSGX 2VBXA 3BTLA 1O3RA 3P5JA 4AUXA 1SVLA 1RPWA 4OAZA 5M5YJ 1BI3A 2QUFA 3CC2I 1F1ZA 3BT9A 1ZAOA 4ESFA 5KHDA 3W6JB 5C4JJ 4QSHA 5JR3A 3BG3A 3WGHA 3FK6A 1MJAA 1XSXA 2L9RA 2F5CA 2XGCA 3V7SA 4UUVA 3A2KA 1MKMA 4E7SA 3CCQI 4DW6A 4XLNF 3LAPA 4ON0A 2V9PA 1NG7A 3S3OA 1FTTA 3F3XA 4BEHB 2DMUA 3S1MJ 4D7NA 1R1UA 1GLNA 3E6DA 1LVKA 4HF2A 2FMLA 3EYYA 4E4HA 3RYRA 3F6VA 1R1TA 4LLLA 2KIQA 2RV8A 1IDYA 3GX4X 2Q0OA 4HBLA 2FOWA 1K61A 1KQ8A 2I8DA 2Y30A 4ZDOA 2FD5A 1J59A 2WBMA 5CQEA 2D5VA 4CYCA 2ZB9A 4ANJA 4CA0A 4N0BA 4CHUA 2DA2A 4HRIA 4NQWA 5GADJ 1FP1D 4XL9A 4IHWA 5EEGA 1RIOH 4M6XA 5F08A 1ZQ3P 1FWZA 4X6AJ 2MC4A 5HLGA 2ADUA 2RGVA 2O6GE 3S8PA 1FYKA 2XB0X 1VQ7I 2DOAA 5F1RA 2R7VA 2AQEA 2P8TA 1OJLA 3R0JA 2XROA 3C1DA 2EIKH 2DA7A 2O8XA 4QPOA 2VJIA 4XN3A 3GFMA 3SZGA 4PJLA 3MAJA 1E3OC 4EM2A 3JRDA 2KJCA 4LIVA 1MD0A 3S3NA 4AIKA 2BOLA 1VQPI 3DKXA 3GXOA 2HQAA 4LD5A 2LFBA 2V7FA 2JUCA 5LBQA 2HPMA 3JRAA 2TRTA 2WV0A 3A0HC 4HNTA 5D4SA 1TP4A 1VQLI 2ICWG 2XC7A 5E3NA 3OOUA 2AS5F 1R00A 1XGMA 3G3ZA 3G1OA 3LSMA 4KJZA 4OMZA 2QENA 2PJPA 1KONA 4RGUA 3CCVI 2F4MB 3C18A 2JN6A 3U1DA 2O0YA 1XS9A 1FT9A 4DYRA 1TWFJ 2K4JA 1WJBA 3LSKA 4ABZA 3HKZA 4BHBA 3C2BA 1J0RA 4P9UA 3WU0A 4YIFA 4XKBA 2IW5A 3OYGA 2Y69H 1QZZA 4BS9A 4XKCA 2Y9ZA 4ZTJA 3JTGA 3HUGB 3HEFA 5HLHA 3EUAA 4A3KJ 3ERED 2DA6A 2LP0A 3FZVA 2QQBA 3Q5FA 2O3FA 2O7OA 1WJEA 4DGWB 3ROUA 2R7QA 4B3XA 2LYCA 2DPDA 1Y8RB 1ETVA 2E2HJ 4HPQA 2OCCH 1PP7U 4BQQA 2K3FA 1E2XA 2AQFA 1X1PA 2X9DA 4XRMA 1UG0A 1MSEC 2BBYA 3BPXA 4XLCA 3HSEA 3M8FA 4CUGA 5D4RA 2W84A 3NWSA 3CCSI 2B7EA 3Q9VA 3LFUA 2VPRA 3BR1A 1FZPB 4ESJA 4LK0F 1SD6A 3JAMZ 2PQ8A 1ZH5A 1QHGA 4NC8A 5L3BA 2M8GX 3S1RJ 2QSHX 4ZJZA 2R93J 3RI4A 3WG9A 4V2FA 1B9NA 1FOWA 3MKLA 2EA4A 2EK5A 5H2FC 1XMAA 2XPUA 1NG6A 3HC7A 5B1BH 1ETOA 3HTUA 1Z3XA 1YTYA 3C3WA 3H5NA 3MKZA 3OY9A 2E34A 3D5RC 4O5VA 3BR5A 2AXTC 3M07A 2XF7A 3CF5F 3R4KA 1YS7A 4C3JJ 4JX4A 1VQ4I 1U78A 5JVTA 3JRCA 2E36A 3FX3A 2X4HA 1S29A 3A01A 2OZ6A 2F4OB 3WHBA 2HNHA 1PJRA 3V8KA 4F92B 3DF8A 3F0CA 1ENHA 1O57A 3SFZA 4HA8A 4BGDA 4L5EA 3W2WA 1P7IA 3H0GJ 2VASA 1T98A 1MSFC 5IP7J 4RB1A 2XSJC 2XGEA 4EM0B 1X1BA 5LFAA 3VWBA 3L1PA 2Y48A 5H6QA 4NC7A 5K1YA 4R1HA 2A68F 2JJ7A 3QU3A 2MLKA 2NVXJ 2LF8A 1IRZA 1J09A 1JKOC 2R7XA 1BI0A 1HKTA 2KRFA 2E1NA 1YRNA 3BJOA 3EPZA 4A0XA 3KEOA 2G7UA 3AKZA 1MNDA 3RYPA 2PEXA 1VQNI 2DT6A 2LR8A 4KA4A 4J19A 1OR7C 1D1AA 2DA1A 5D8LB 3CF2A 4N9IA 2EBIA 3K7AJ 4LG0B 1GXPA 3C2GA 2RN7A 3HB9A 1WJCA 3U21A 1FBUA 2HOAA 1X2NA 3K4NA 2JWTA 1UHMA 4RAGA 2F5DA 4PJNA 4Y15A 1O3QA 5BPDA 1LE8A 1MMGA 4BH9A 1NHAA 1G2HA 1FBSA 2V1XA 5D6FA 2IRFG 1E17A 1YS6A 2VBYA 1W5CC 3DXJF 2EV0A 3AAFA 3GF2A 3RPUD 3GZNB 3KP2A 4HX8A 4EM1A 3MWMA 2V79A 5EZHA 3ZQGA 4ENJA 3LQQA 2D45A 4PJMA 3TP0A 1O7FA 2JPCA 4MNUA 4PCQA 3S1QJ 4I6ZA 1ON2A 2WAFA 2IA0A 2MD0A 3OYJA 3OYBA 1IC8A 4C2TA 1V3FA 3MZ8A 2CFXA 2L0KA 1FOKA 2JSPA 5GAHJ 1ZRFA 1OCCH 1OMIA 3L2UA 5DEQA 3OYMA 1B1BA 4FE4A 1ZREA 3GFLA 1HW1A 4Y3OA 3A02A 4M3FA 5J8CA 3RDIA 1U0JA 2L9SA 4IOCF 1XTAA 1OPCA 2GAUA 3DEEA 1XN7A 2O03A 1W36D 1PUFA 5EDNA 3IKVA 3QOEA 1T38A 4RM2A 1Z1DA 2XDVA 3OL3A 2DFIA 2EILH 4HYEA 2HQNA 5E1WA 3OYCA 2GLOA 3HDDA 3RQ4A 5A2QK 2RQPA 2XRNA 3K69A 2DQRA 2LY9A 3D1NI 3CDHA 5FGMA 5FLXK 1V55H 4NBQA 3RSNA 2NS0A 2OAZA 3FM3A 3H1CA 1IV6A 3V42A 3GTGJ 5GTIC 4CZZA 5HS8A 1JE8A 1UMQA 2QQ8A 2XPVA 2XF5A 1S9HA 4A3EJ 3TO9A 4RLFA 5IOZA 1B72A 3HZJA 2CUEA 1R7JA 1NK2P 2A5YB 3H0DA 4U0WA 1QZEA 4EJVA 4EQQA 1N75A 4O6JA 1IV8A 4IQ4A 2KISA 4MTDA 1FJLA 2VB6A 4IHSA 3HUGA 4HV6A 1QZYA 4IHTA 3KX2A 1YW7A 2F4IA 3OIPA 3Q0WA 5J4YA 3FWEA 3M9AA 3JRIA 5H6RA 3JSPA 4YELA 2LBFB 2BE5F 2N8GA 1DU0A 3RPUA 4B09A 5KVRA 5C3EJ 2BV6A 4UVCA 5L3FA 1BOBA 1SAXA 1JI8A 5E8IA 2CQNA 1BI2A 2BHYA 4RLQA 3KLOA 5JHUA 4NC6A 3GMEA 2BGCA 2DA4A 3I9V2 1A5JA 2OU2A 1RRJA 1HC8A 1CF7B 3BZ6A 2HPIA 5EGOB 4G8XA 1E3PA 4Y13A 2F6CA 4UXNA 1IJWC 5HNHA 3M3YJ 2VT3A 2H1LA 1T95A 2DTZA 1VQOI 4CYDA 5A2QZ 5EEHA 3J81K 3IH4A 1K78B 4Z2YA 2HYFA 1BW6A 2HVQA 3GW2A 1ODDA 3I55I 2IGKA 4E7JA 3E5UA 2J5PA 1Z77A 4CYCB 3HRUA 1VFCA 1UFMA 4U87A 1GDTA 1HLVA 4HSRA 1K4TA 2FBIA 2WTEA 3PSFA 5D5VB 1BL0A 1WWXA 3CJRB 4EGZA 1SFUA 4BDZA 1MMAA 4YG2F 2QQ9A 3IH2A 2ID6A 3QOPA 1LDJA 3BY6A 3RTRA 4I98B 3K0LA 2R0QC 1H88C 3TDZC 3CO6C 2YSRA 3DPLC 2E1MB 2M5WA 2KDOA 3CLOA 2LD5A 3VYSB 2Z3YA 4BE2A 1IN5A 1MW7A 4YFNF 4ZC3A 2DJNA 2GM4A 2NS8A 2XAFA 4G7ZF 1SD7A 1V5FA 2EFWA 2P5VA 1U5TA 3CCMI 1JGSA 4ZZLA 1V5EA 1SFKA 2FEZA 2L3DA 2K9NA 5FKOA 3G1MA 4OIOF 4KIGA 3ULQB 4XQFA 1U8RA 1OCPA 3KP7A 2DXIA 1VQ9I 4E70A 3R6SA 5J1RA 4HX7A 3DEWA 3BQZA 2VN2A 1XDSA 3MKWB 3LA2A 4PGHA 2JRTA 5JVGF 1TL8A 3FK7A 1HCRA 1X1DA 2V1NA 3HGYA 3GBGA 2GIZA 2HQRA 4YIIA 1R5ID 3SDGA 3UR3C 4CDGA 4L9TA 3SQNA 4AYBN 2WV1A 2VQLA 2IXSA 1JGGA 2EV6A 4PJ0C 2EV5A 3QP6A 3TP3A 3FXMA 3OR2C 4GFBA 2JZYA 2VBWA 2WAQN 4UV8A 3J80K 1MBEA 5ICFA 4PFPA 4DOZA 3DQVC 3ML6A 1WGXA 1B9MA 4QWQA 1MNMC 1BN5A 3VODA 5D8KB 2KQRA 5HDNA 2Z9OA 4BE1A 1RZ4A 2YX4A 3OYKA 2JMWA 5FKLA 1WHUA 3WU1B 4HF1A 2L7ZA 4FASD 3HGGA 3U9GA 5CVRA 1FYMA 4FTHA 3LNQA 1QVUA 2VOOA 2ZBKA 2E1MC 2DOFA 3K2ZA 4YIRX 3EYIA 2WC2A 2CSOA 4A5MA 3VB2A 3ZOBA 1EKEA 2BZTA 3T5XA 2ZXIA 1T39A 3IRQA 3F8MA 1FPQA 2V9KA 2GBYA 5E1XA 2DA5A 2P5KA 3NWTA 3A01B 3BG6A 4RAYA 3I59B 3HBLA 3S17J 2PI0A 2MD5A 1G4DA 4QPQA 3GTMJ 2AO9A 1W5SA 4D5FA 4YFXF 2JUGA
chains in the Genus database with same CATH topology
3CP2A 2L9NA 3S8PA 2R7VA 2WADA 4U7BA 2DOAA 2AQEA 1X4OA 2X1EA 2MABA 3CESA 3OWTA 1E0EA 2VQGA 4QPOA 2VJIA 4XN3A 3HL2A 3S93A 3SZGA 4PJLA 3OR1C 1P9QC 4IZZA 3DPUA 5HNFA 2E5ZA 3KEYA 2CV0A 4LIVA 4NUBA 1QHHD 5TGTA 3S3NA 2BOLA 3H5AA 3PNTA 4CCLA 3DKXA 2HQAA 3UNGC 2ZSHB 1R6RA 2V7FA 3LL7A 2HPMA 4ZTFA 2O5RA 3K4MA 4HNTA 2LG4A 4ZDPA 2BW3A 2XC7A 3OOUA 2W7NA 5LD2C 2A6TA 1BR1A 4F55A 3LSMA 4KISA 2CFOA 1YE9A 4KJZA 2X85A 3L2VA 1KONA 5FRMA 1OLTA 5HOOA 4GRIA 3FHNA 4N4NB 4XLFA 1WJBA 3LSKA 3HKZA 1Z21A 3FDYA 2IGNA 2VXDA 4P1WA 2IS6A 2CUJA 3OYGA 3K4BA 4XKBA 1D1CA 1Z3YA 4BS9A 1WJAA 4CZCA 2HZDA 4XKCA 4B47A 4PJJA 4ZTJA 2X6WA 3HUGB 3ZGKA 2K5CA 3EUAA 2Q2EB 3F9KA 4XKWA 3L2QA 1BR4A 3K70D 2R7UA 3A4CA 1WJEA 3LMMA 4BU2A 4E7IA 3OYIA 4DGWB 4BEHA 2R7QA 4B3XA 2L7KA 2LYCA 3DWLE 4HPQA 4LG3A 4BQQA 1QU3A 1VZ0A 2F5VA 2AQFA 4OWRB 2CV1A 4F91B 4B44A 1UG0A 3IP4B 1G59A 3PJRA 2K9LA 3W2AA 4XLCA 2ZXHA 4CUGA 1MMDA 3NWSA 3ZQQA 2R4GA 3LFUA 2BVLA 3HXLA 2DJIA 2M7BA 3ZXSA 2R7WA 1QHGA 4NC8A 4G6TB 2W00A 4ZJZA 2JVGA 4B48A 4LIUA 2Q1ZB 3PL8A 3BLYA 4F93B 4AYBA 1NG6A 3HC7A 2L2OA 3DTKA 3HPHA 3DTIA 1Z3XA 4HG2A 4DBQA 3H5NA 3MKZA 3OY9A 3D5RC 3DKYA 3IAS2 4H4KC 2XF7A 3LSHA 2KLOA 2LREA 1K6YA 4XR6A 3TBIA 2VJJA 2M0MA 2GOMA 4KT6A 5JHFA 1X4PA 4XMYA 2HNHA 1PJRA 3MMYB 3QYEA 4F92B 4XOPA 2IS4A 2R7SA 4NQWB 3BC8A 4BGDA 3W2WA 1FMVA 2OV7A 3LSIA 2VASA 2VPLA 4XNFA 4YEJA 1WJDA 3FBNB 3W2VA 1YX3A 5KCMA 1YX5A 2XSJC 1X1BA 3FBIB 4II2A 5LFAA 3VWBA 3K4JA 3OIQA 3VYRB 4LITA 2WAEA 3OL4A 4NC7A 2GOXB 2K3PA 2VJ4A 3OYLA 2VLAA 4CCNA 2RQQA 1J09A 2X51A 1X1AA 2W82A 2R7XA 1LFPA 4C9YA 3K6GA 4CCKA 1DGRM 3EPZA 3VSKA 3AKZA 1MNDA 3M1CA 4HSTA 2DT6A 4HNUA 3SEZA 3PUBA 3CZ6A 1OR7C 1D1AA 1MNEA 2Z1DA 3CF2A 5FROA 3OS1A 1V5GA 4IQJA 3ZRGA 3OS0A 2R7RA 3C2GA 2KRHA 2W4SA 2Z16A 4E7HA 1WJCA 2X6YA 3U21A 4N4OB 1W36C 2QKLB 2KRCA 3K4NA 4PJNA 2RNGA 2VJ5A 3D5LA 1MMGA 3C2HA 3H9QA 4E7LA 2DT7B 2V4JC 2WB1A 2WY7Q 3PNVA 1LKXA 3RPUD 4ZDLA 4MLOA 4IX7A 2VQHA 2MYSA 4BUPA 4XLEA 2HVRA 2NOJB 3DU6A 4PJMA 4XORA 1X19A 4BJTA 2VIXA 4YRVA 2BW3B 3OS2A 2LY1A 2WAFA 2MD0A 3OYJA 3OYBA 3H9JA 3HOSA 4C2TA 4XOTA 2JSPA 3OYDA 4CCJA 2HVSA 3L2UA 4XM3A 3HOTA 3OYMA 3I3LA 2CS3A 3SEQA 2KHMA 4Y3OA 3K4KA 3S3MA 1PYVA 1U0JA 2L9SA 1D0ZA 4AVZA 4JOMA 3OYHA 5KNLA 1Y56A 3DEEA 4BJ5C 1W36D 1MMNA 2CW7A 2ZFUA 2HU9A 3QOEA 4PK4A 3DTEA 3QYFA 2L5QA 4RM2A 2PMZA 2XDVA 3OL3A 4OAYA 4BQOA 4BXFA 3BCAA 2Z2SB 4F52A 3OYCA 3CP8A 3RQ4A 4CCMA 1IRXA 3RCOA 2JA2A 3BG7A 2BVMA 3M8JA 3FKJA 3RSNA 2CH0A 4C2UA 3V42A 2A5WA 2KL4A 3N05A 2KP6A 4E7KA 2XF5A 2M7AA 1S9HA 4KITB 4RLFA 2KMUA 4XONA 2X1DA 5CPRB 3H0DA 3A1YA 2CV2A 2QKMB 1N75A 2LH9A 4IQ4A 2RREA 4RM3A 3LSGA 2UUZA 2VB6A 3KX2A 3VYTB 2F4IA 3OIPA 4JQFA 2VQCA 2WY8Q 2VKDA 1D0YA 4YELA 3HPGA 2LBFB 2LRDA 2WA0A 5HLTA 3AFHA 2WAQA 3ZCOA 2OUMA 3EUKL 1BOBA 3SYTA 4XLHA 1JI8A 4J00A 1EA3A 3QODA 3OYAA 3E0JB 4RLQA 4C30A 2IGMA 3PSIA 4DBRA 4ZYAA 2R7TA 3I9V2 2Y0SA 3CMMA 4CCOA 2KZVA 2M4GA 1UELB 4BACA 1D1BA 2HPIA 4NNJA 1FMWA 3D5SC 3L2RA 3QYBA 4B43A 3OYFA 4ITVA 2F6CA 5HNHA 2IGOA 2LC2A 1T95A 1T0FC 3K4CA 4X0GA 4HEA2 4BJ6C 2PJRB 3EUHC 2HVQA 3VYUB 5HVQC 3K70C 4E7JA 2IGKA 4XKVA 2V26A 1SAUA 2E60A 4U87A 5FRNA 3DU5A 4HSRA 1G8XA 3PSFA 1DQUA 4D9JA 2JVHA 4CH7A 3CJRB 2X6XA 2LY2A 2OC6A 4PSXA 4BDZA 1MMAA 1ZELA 3SDBA 3OYNA 4E7ZA 2M4KA 2DCEA 4BDYA 2XF6A 3J7AY 2CW8A 3RTRA 1HA8A 3VSLA 1D0XA 2K9MA 3PFYA 5CQGA 4CSWA 3HG9A 2ZSIB 4XLAA 3DPLC 2E1MB 4J01A 2KDOA 3VYSB 2PJRA 2MFZA 2KPMA 4Y4RA 4R79A 3CJQB 1DGWY 3S32A 4BE2A 1MW7A 4ZC3A 4D1QA 1N77A 3MD2A 4BQNA 1WFXA 1V5FA 2HDWA 2IS1A 1V5EA 2V6EA 1SFKA 1TZLA 4XN0A 5CKTA 2LOOA 1LDKB 2FUG2 3TMOA 4XQFA 3MKYB 3BCBA 1N78A 2DXIA 4PFOA 4E6KG 2CUZA 3MKWB 4BL0B 1AA7A 3E1SA 3AL0B 1DP3A 2X1CA 2VKHA 3K4LA 3H9GA 3ZR8X 1X1DA 4OAZA 2E5NA 4EATA 2V1NA 3GBGA 1BR2A 3VDXA 2P0WA 3UR3C 3AL0C 2VQLA 3K10A 2IXSA 3PNYA 3H35A 4IKFA 5KHDA 3OYEA 3IUOA 3OR2C 4P5OA 4PUSA 3G2BA 2XAUA 2M3AA 4DOZA 4PFPA 3DQVC 3A2KA 4FETA 4E7SA 2KQRA 4BE1A 4BE0A 1NG7A 3S3OA 3TL4X 2UWMA 2CMPA 4BEHB 3KYLA 3OYKA 2LBFA 1Z7LA 1Y6IA 4PSWA 1GLNA 4AU7A 1LVKA 2R7OA 4FASD 2ELJA 3DLAA 4E4HA 1TT0A 2VL8A 2E1MC 1UAAA 1WJFA 3L2WA 2I8DA 4ZDOA 4F3QA 2WBMA 5CQEA 2ZXIA 3OMYA 1X1CA 2V9KA 3H5RA 4ANJA 3NWTA 4CA0A 3BG6A 1ERDA 4DIQA 1WJ5A 4HRIA 3ONQA 4II3A 3DPTA 3IAM2 4QPQA 4XL9A 2W1OA 2UV1A 3W3CA 2IS2A 2JUGA 2VXZA 4RMNA 4Y33A 4DJAA 2MC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBI B;  3FBN B; 
#chains in the Genus database with same CATH topology
 1OYW A;  3U1K A;  1IXC A;  1MBK A;  2WAD A;  4G6D A;  1F4K A;  4HF0 A;  5BNG A;  1MBF A;  1X4O A;  4Y52 J;  2X1E A;  5L3G A;  2FOK A;  3CES A;  3R0A A;  4BHP A;  4AM3 A;  5DV5 A;  1IN4 A;  1PUE E;  1FOX A;  3BG9 A;  2XHK A;  4KUM A;  3CCE I;  3V8J A;  2NRA C;  3DPU A;  2KFD A;  1FNN A;  2E5Z A;  1RI7 A;  4NB5 A;  5HNF A;  4WWC A;  1KGS A;  3HRS A;  1QHH D;  3H92 A;  2QQA A;  3H5A A;  1QRY A;  3CD6 I;  1SEU A;  2BY1 A;  2ZME A;  2ZSH B;  4OMY A;  4XRF A;  3LL7 A;  2O5R A;  1JJ6 C;  2FBK A;  3R60 A;  3I4M J;  2PMZ N;  2EFQ A;  2RAE A;  4C2M J;  1N25 A;  4LLN A;  1RNL A;  1Y1V J;  3L2V A;  2XAG A;  1K4S A;  4A3D J;  4ZYH A;  1MZB A;  3BR0 A;  3L09 A;  1U8B A;  1ZG5 A;  4IL6 C;  4P96 A;  4N4N B;  2XGD A;  3VOE A;  2K7L A;  3FDY A;  2IGN A;  2VXD A;  2IS6 A;  5K5O A;  4BXU A;  3O2P E;  4RGR A;  1D1C A;  3GLX A;  5K7F A;  1WJA A;  5JFR A;  4OIP F;  3DBL B;  4PJJ A;  4S05 A;  3G6E I;  1YFH A;  2X6W A;  1FC3 A;  3DBH B;  3OOP A;  3B6A A;  1F43 A;  1MIJ A;  1YIO A;  2Q2E B;  1R5G A;  3J81 Z;  3GVA A;  1IXR C;  1ZLJ A;  2AXL A;  2P7V B;  3FXQ A;  3MZH A;  4BEH A;  3DLL F;  4M74 A;  4Q5S F;  2YUS A;  3SFI A;  1XX5 A;  1VZ0 A;  4RB2 C;  1DP7 P;  3VFZ A;  2GA2 A;  3LSR A;  4F91 B;  3GUD A;  3IP4 B;  1G59 A;  1TBX A;  3J80 Z;  2JA6 J;  2ZXH A;  3WGG A;  1MMD A;  1B4A A;  3ZQQ A;  1W1W E;  3IWF A;  2R5Y A;  1YLF A;  2BVL A;  1JHF A;  2GIV A;  3CTA A;  3KE2 A;  3QP5 A;  4CIC A;  3HSF A;  2MSY A;  1LFU P;  4DYQ A;  4B48 A;  3KP5 A;  1XC5 A;  2A6E F;  1BJZ A;  3HM5 A;  5TIS C;  1ORK A;  2CQQ A;  4RB0 A;  3KLN A;  4AYB A;  2L2O A;  1U9O A;  4M72 A;  1HW2 A;  3KPH A;  5LHI A;  3LSP A;  1VQ8 I;  3IAS 2;  4H4K C;  3ASO H;  2TDX A;  2KLO A;  3KYC B;  4RB3 C;  1S5L C;  2NOG A;  2K40 A;  2ZCW A;  4XR6 A;  4Z6Y A;  2VJJ A;  2W57 A;  2GOM A;  2Q8K A;  2L7F P;  4KT6 A;  2HTJ A;  4WK8 F;  1U5T B;  1IN6 A;  3BTJ A;  3HTS B;  5DDG A;  1P2F A;  3GO5 A;  1XCB A;  1JTY A;  1WKM A;  1XB4 A;  2DMP A;  2R7S A;  1ZGJ A;  4NQW B;  3BC8 A;  2HTS A;  1UG2 A;  3BWG A;  2OV7 A;  3V7C A;  3F8F A;  2VPL A;  3QRF F;  1JUS A;  3A0B C;  3W2V A;  1EV7 A;  5FJ8 J;  1KU2 A;  1IDZ A;  2Y0S N;  1XPX A;  1VQ5 I;  2BY0 A;  1I6H J;  3OIQ A;  3VYR B;  1VND A;  2C6Y A;  3CDL A;  2WAE A;  3OL4 A;  2VJ4 A;  1TWA J;  3OYL A;  3KEQ A;  2RQQ A;  2X51 A;  5BOX A;  2F48 A;  1LFP A;  4C9Y A;  1BM9 A;  4KNY A;  3ZQH A;  3KP6 A;  2BYV E;  2EZL A;  3M1C A;  1HW5 A;  1G3Y A;  4XSZ F;  1IW7 F;  2W24 A;  2DN0 A;  3Q3S A;  2JA7 J;  3SEZ A;  1ZRD A;  4Q48 A;  3CCL I;  4IOA F;  1MNE A;  3ZMV A;  2XSD C;  1Y0U A;  3OIO A;  2PG4 A;  5EF6 A;  3OS0 A;  2KRH A;  2Z16 A;  1WPK A;  4ENK A;  4N4O B;  1W36 C;  2F5E A;  2L4M A;  4A3M J;  2ELK A;  1I3Q J;  5F0H A;  2RNG A;  1B72 B;  3IHU A;  3GFI A;  2V4J C;  1B8I B;  4C3H J;  2IEK A;  2WY7 Q;  4G94 A;  1K6O A;  1MBH A;  2EFN A;  2MA3 A;  1TWG J;  1DU6 A;  2M9H A;  2HVR A;  5DS9 A;  3FXR A;  2NOJ B;  4WXC A;  4DNC A;  3GEZ A;  3O6B B;  1JJ8 C;  2BW3 B;  4XBF A;  3NQO A;  1IGN A;  1S3J A;  4XOT A;  3OYD A;  2DQL A;  2OPT A;  2MGQ A;  4RA2 A;  3HOT A;  2HKO A;  3W6K B;  1BIB A;  2CS3 A;  2HFH A;  2DO7 A;  3SEQ A;  5M5X J;  1QVT A;  3S1N J;  3K4K A;  3S3M A;  2NS7 A;  1XG1 A;  1W7P A;  3OYH A;  2STW A;  5B66 C;  4I0B A;  3BJA A;  5DYM A;  4BJ5 C;  1IG7 A;  3ZMS A;  1MMN A;  2KJB A;  2LKP A;  2HU9 A;  2E2J J;  3AG1 H;  2PMH A;  4PK4 A;  5FO5 A;  3QYF A;  3CO7 C;  1JTX A;  4BQO A;  1AWC A;  3ECH A;  1V4R A;  2G0E A;  4MEY F;  1XSV A;  5ILU A;  2QA4 I;  3ZMD A;  2HR3 A;  3X2Q H;  2JA2 A;  2QWW A;  3BG7 A;  2GXG A;  3COA C;  3O3K A;  2ECC A;  5EZG A;  3M8J A;  1GT0 C;  1FX7 A;  1YIJ I;  4KIF A;  1IO2 A;  4ESB A;  5B1A H;  4PDK A;  5E1Z B;  2A5W A;  2EWN A;  3HKZ N;  3MQ0 A;  4RGS A;  1W0U A;  2CJJ A;  1B8I A;  4B8X A;  4FX4 A;  1D8K A;  1ZG3 A;  4XON A;  4GYG A;  2X1D A;  2DTR A;  2KIF A;  1KYW A;  5EG0 A;  1WVR A;  2QKM B;  1TW2 A;  1MJB A;  2LH9 A;  2F5F A;  1CF7 A;  2IAI A;  4RM3 A;  1Y39 A;  2UXX A;  4A69 C;  2GA1 A;  3RZO J;  3LSG A;  3O8H A;  1IRG A;  2IT0 A;  3VYT B;  1ON1 A;  4AIJ A;  1LDD A;  2XB5 A;  5DUI A;  1XMK A;  1D0Y A;  1TWH J;  1GUU A;  2XV4 S;  1K78 A;  2LRD A;  2DMQ A;  2WA0 A;  3JRG A;  5HLT A;  1F5T A;  2WAQ A;  4A3L J;  5GP9 A;  5ILV A;  3ZCO A;  1SFO J;  3TO6 A;  5J1Y A;  1S7E A;  1QO0 D;  3SYT A;  2OZU A;  1KYZ A;  4XLH A;  4HLY A;  4J00 A;  2M0C A;  3P9I A;  2FX0 A;  1TNT A;  4IHV A;  5LRS A;  4A3J J;  3F72 A;  2ZKZ A;  3GTK J;  3S2D J;  1WI9 A;  4S0H B;  3REO A;  4ZYA A;  4IHX A;  1OCO H;  2CU7 A;  2Y0S A;  3GFJ A;  3K9T A;  1YYV A;  1UEL B;  3GWZ A;  4JX5 A;  4BAC A;  2H09 A;  2HOS A;  4A6E A;  2D2W A;  1OR7 A;  2DYR H;  2OCE A;  3L2R A;  1T08 B;  2JPB A;  3OYF A;  1TQI A;  2OA4 A;  2IGO A;  1V54 H;  4WXH A;  1T0F C;  3H36 A;  2EZI A;  3K4C A;  4BJ6 C;  2PJR B;  2ZXW H;  4MIM A;  3CCJ I;  1H0M A;  1RES A;  3K70 C;  2HXI A;  2VON A;  2FRH A;  4A3C J;  4XKV A;  2QZ8 A;  1KU9 A;  1SAU A;  1ETK A;  3RJP A;  5FRN A;  1G8X A;  5L3D A;  4D9J A;  2JVH A;  4WF2 A;  2HOT A;  3GYH X;  1O7L A;  2VC1 A;  5E17 F;  5TJJ A;  4GO1 A;  2MW8 A;  1QPI A;  1WH7 A;  2P5L C;  1U3E M;  2M4K A;  2TCT A;  4BDY A;  4DZP A;  1EH6 A;  2BEO A;  5IT9 K;  3K1M A;  1J2X A;  1LNW A;  2ZJR F;  4KDP A;  2DPU A;  2R3S A;  5LGN A;  3VSL A;  2FQ4 A;  4S04 A;  1LFB A;  2F2E A;  1FOY A;  2OBP A;  4LOC A;  2MLG A;  2VKE A;  4J01 A;  2MFZ A;  4I09 A;  4IPA A;  4HQM A;  1K79 A;  2H6C A;  3S32 A;  2OTL I;  3KYD B;  4IRI A;  5AIQ A;  2NXN B;  3DEU A;  4QLC U;  4I7H A;  5HDG A;  3CQZ J;  4L5J A;  3S2W A;  3R61 A;  5ILS A;  2V6E A;  1GXQ A;  1TZL A;  3E6B A;  4EJW A;  2FUG 2;  2ZC2 A;  3HHG A;  1AU7 A;  2JT1 A;  1QQI A;  1N78 A;  1X3Z B;  2WWY A;  1YIT I;  5LEJ A;  2K9S A;  5J8F A;  5E3O A;  1T8I A;  4I01 A;  4XRS G;  3CJT B;  5J3L A;  1C0W A;  1HDD C;  3AL0 B;  2X1C A;  3CMY A;  5GAE J;  3K4L A;  3QQA A;  4KIB A;  4P55 A;  2R5Z B;  5BQT A;  2DYS H;  1T6S A;  4LLG F;  3ZR8 X;  4HLX A;  1HQC A;  1STZ A;  1WRJ A;  1G3T A;  5BMZ A;  5E79 C;  1VQ6 I;  3TED A;  1R4N B;  2P0W A;  3WTV C;  3AL0 C;  5EEA A;  1ZK8 A;  1J5Y A;  1QPM A;  2M45 A;  3K10 A;  3PNY A;  3PQJ A;  3IUO A;  3KZY A;  3KCC A;  3EET A;  2P6T A;  3G2B A;  2JTV A;  4I99 C;  4XK4 A;  2M3A A;  4ZYE A;  3TO7 A;  3I0T A;  2G7H A;  1RUO A;  1FTZ A;  4R8H A;  1ULY A;  4FET A;  1F9N A;  2FMY A;  1XGO A;  2D1H A;  3BP8 A;  1Y1W J;  2G9W A;  2CO5 A;  1WCM J;  2LBF A;  1VI0 A;  2OJE D;  2STT A;  4AU7 A;  1J75 A;  4BHC A;  2ELJ A;  3DLA A;  3I4N J;  2CQX A;  2VL8 A;  2XPW A;  4PZJ A;  2B0L A;  1S6L A;  5BS6 A;  4OIQ F;  1UAA A;  3L2W A;  2FQ3 A;  2Z33 A;  3DBR B;  1W7P D;  4F3Q A;  2DT5 A;  1ZTR A;  2LLK A;  3H5R A;  2DMT A;  2DDA A;  1ZKG A;  1ERD A;  4DIQ A;  4IHY A;  4II3 A;  4MFD A;  4B1R A;  4B4C A;  2UV1 A;  1OCR H;  2IS2 A;  1PP8 F;  2ACJ A;  4Y33 A;  4KIC A;  1ZR2 A;  4DJA A;  2M34 A;  3CP2 A;  2L9N A;  2DOD A;  1ZG1 A;  4A0Z A;  1P92 A;  3Q9S A;  4IVN A;  3G73 A;  3GTP J;  1TT5 B;  5FKN A;  5F0F A;  2MAB A;  3HSR A;  1E0E A;  3AG4 H;  2NVY J;  5CYV A;  5CVI A;  2VQG A;  3SZT A;  3PIP F;  1IXS B;  1OKR A;  4A3G J;  3S93 A;  3L00 A;  3W6V A;  1Q1H A;  2LDU A;  3KEY A;  2CV0 A;  1OYY A;  4Y7N J;  2Y9Y A;  3G71 I;  1I1G A;  1PUF B;  4LK1 F;  2K4B A;  2LVS A;  4CCL A;  3I53 A;  3ZN0 A;  1MDM B;  1MH3 A;  2V6C A;  4W97 A;  2NNY A;  3UNG C;  1R6R A;  5C4X J;  2CRG A;  2K85 A;  2L54 A;  3OSG A;  3CC7 I;  5FFZ A;  1OCZ H;  3IWZ A;  2YR2 A;  3FXK A;  3CMA I;  3GZ5 A;  4X1E A;  2A6T A;  2LK2 A;  2KIM A;  3IL2 A;  2J5O A;  4EJO A;  2PFB A;  5E18 F;  1LQ1 A;  2X85 A;  5F6F A;  2CQ7 A;  1I6X A;  1TC3 C;  1WZ2 A;  5FRM A;  1OLT A;  5HOO A;  1VQK I;  4GRI A;  3FHN A;  4U0Y A;  2OTJ I;  1YW9 A;  4XLF A;  3EQL F;  3A03 A;  1PVE A;  1G6N A;  3GTQ J;  2CUJ A;  3CUQ C;  2R92 J;  3FMS A;  1U2W A;  4M6V A;  1ETQ A;  4XSX F;  2CW0 F;  3ZQI A;  2HZD A;  4B47 A;  3FXU A;  1QNT A;  3BOQ A;  4MGR A;  1I27 A;  5F0C A;  2K5C A;  2W25 A;  3RKY A;  4RDU A;  2PLY A;  2NNN A;  1HXD A;  3F9K A;  2IA1 A;  2GXB A;  4XKW A;  4CGZ A;  5CVU A;  3WTW C;  3L2Q A;  1O3S A;  4G9Y A;  4BBS J;  2YPR A;  2R7U A;  3A4C A;  2FJ1 A;  2L7K A;  4DZJ A;  4LG3 A;  2MBF A;  3QAH A;  3CUQ A;  2CGP A;  2E1C A;  3I56 I;  2F5V A;  4OWR B;  1Z05 A;  1ZYR F;  2K9L A;  3KZZ A;  3P9C A;  4BQA A;  3M7G A;  3FM5 A;  1R49 A;  3BTC A;  4WXD A;  1WH5 A;  4FHT A;  3ZP5 A;  3IH3 A;  3CLQ A;  1I3A A;  2R4G A;  1KQ9 A;  2DJI A;  1DPR A;  3F8N A;  5FKM A;  4FT8 A;  3VEP A;  2W00 A;  3SJM A;  5LRR A;  1CGP A;  2BXY A;  2W48 A;  2Q1Z B;  3PL8 A;  3BLY A;  3IC7 A;  3JR9 A;  1R9T J;  3F21 A;  1D8J A;  1Y0N A;  4O3M A;  3BZK A;  4MHG A;  3DTK A;  1ETW A;  1SMT A;  3MEX A;  5DD4 A;  3DTI A;  2ZME C;  4RAZ A;  4HG2 A;  3ISP A;  3B02 A;  3DKY A;  3OV8 A;  5DTD A;  4U0V A;  2LRE A;  1K6Y A;  3PFI A;  3TBI A;  2L02 A;  1R23 A;  3LQR A;  2M0M A;  3GTJ J;  2CG4 A;  1YW8 A;  2JK3 A;  1X4P A;  3BZC A;  1G3S A;  3FXO A;  1FEX A;  3H3U A;  4XOP A;  2ID3 A;  4IO9 F;  4UY8 I;  3GCM A;  1MBG A;  2O8K A;  4M73 A;  4ZYG A;  1FMV A;  1T33 A;  3LSI A;  3KP4 A;  1O4X A;  2ISZ A;  3H3V K;  4XNF A;  5L3E A;  4BY7 J;  2ISY A;  4YEJ A;  3FBN B;  1Q1V A;  5KCM A;  3G1L A;  5F1J A;  1A04 A;  1YX5 A;  3PUF A;  4D7M A;  4II2 A;  4A12 A;  4LIT A;  2DDB A;  1ZGA A;  2GOX B;  2FF4 A;  4M3G A;  2QEX I;  4HV5 A;  2VLA A;  4CCN A;  3I5U A;  3ELK A;  4LJZ F;  4WCG A;  3E5X A;  2E1O A;  3GZ6 A;  1X1A A;  3HHH A;  1A36 A;  4XRS A;  3E3V A;  1ETY A;  1XDU A;  2EQR A;  4CCK A;  1DGR M;  3B6C A;  1L0O C;  3DFG A;  3BJ6 A;  2FE3 A;  2HWV A;  5F64 A;  4FX0 A;  4IRG A;  4N9H A;  5JLW A;  3JW4 A;  2P6S A;  5FRO A;  3K1N A;  2ZFW A;  4M3D A;  4GDF A;  2P81 A;  4IQJ A;  2L01 A;  2R7R A;  1YI2 I;  2XAS A;  1Z67 A;  2QKL B;  1E3H A;  2DAO A;  3EDP A;  2GWR A;  2PMU A;  1UB9 A;  3D5L A;  2VUM J;  5K5Q A;  3C2H A;  4A5N A;  2DT7 B;  2WB1 A;  1AOY A;  1BBY A;  2VE8 A;  3K1P A;  5JLX A;  3PNV A;  1HOM A;  4RGX A;  1GHC A;  4ZDL A;  1JT0 A;  1OCT C;  2KKO A;  2R7F A;  2MYS A;  1VQM I;  4XLE A;  1HBX G;  4G7H F;  4XOR A;  4BJT A;  5E8G A;  1U5T C;  3E97 A;  2VIX A;  4YRV A;  3KZI C;  1KU3 A;  3NAU A;  4IRH A;  3HOS A;  2LF7 A;  1SD4 A;  2EFP A;  1FP2 A;  4CCJ A;  2EIN H;  4BAY A;  3WGI A;  1QGP A;  1JKQ C;  4MO7 A;  3QPT A;  2HI3 A;  4NHJ A;  1PYV A;  5FLM J;  4DYC A;  1D0Z A;  4AVZ A;  3I54 A;  4JOM A;  3LST A;  3E5Q A;  4L9V A;  3RQI A;  5IYB J;  5EG0 B;  1NTC A;  3PO2 J;  2CW7 A;  2ZFU A;  2DBB A;  3DTE A;  2H8W A;  5DM6 F;  1A6Q A;  2L5Q A;  2PMZ A;  3KP3 A;  3ZQL A;  2M30 A;  2Z2S B;  1Z7U A;  1FLI A;  4KN7 X;  5J6X A;  4CCM A;  3FMQ A;  1IRX A;  3RCO A;  1YJN I;  2LSO A;  5J1U A;  1AHD P;  2BVM A;  2VOP A;  2A6H F;  4G7O F;  3FKJ A;  5DCM B;  3RKQ A;  3OSF A;  1RR7 A;  1WSU A;  1KQ0 A;  1Z6R A;  2EH3 A;  2EIJ H;  4XIC A;  4RS8 A;  1T0F A;  1OYI A;  3HOW J;  2KL4 A;  2KP6 A;  4E7K A;  2HOE A;  4L18 B;  2M7A A;  1NK3 P;  4KIT B;  1YOV B;  4UB6 C;  1JXS A;  2KMU A;  2EIM H;  2GQQ A;  4OIN F;  1OFC X;  4FE7 A;  1YG2 A;  4I02 A;  1LB2 A;  5CPR B;  2HYG D;  1GV5 A;  4V2G A;  4BYY A;  1DDN A;  4ENN A;  3HJE A;  3A1Y A;  2I5U A;  2CV2 A;  3QU6 A;  4LMY A;  2RVC A;  1BC7 C;  2FU4 A;  2E71 A;  2RRE A;  3BDD A;  2KDZ A;  2NYX A;  2QSF X;  2UUZ A;  3WOD F;  1X58 A;  4U7D A;  3HOY J;  4JQF A;  5EGO A;  1Z0X A;  4AD9 A;  2PBI A;  4ZZD A;  2HGC A;  5AIP A;  4UVA A;  3S2H J;  2KZG A;  1D5V A;  3F8C A;  1TTY A;  3HPG A;  2MC3 A;  1S7O A;  1P4X A;  5F04 A;  3CCU I;  4MQV A;  1IF1 A;  2MH9 A;  1EH8 A;  1JKR C;  2X0L A;  2E35 A;  2VI6 A;  1QA6 A;  2OUM A;  4A0Y A;  2K27 A;  2IPQ X;  3MFK A;  3NAR A;  4KT5 C;  3ZMT A;  1T56 A;  3ZQF A;  2B9S A;  1EA3 A;  4UB8 C;  5AON A;  3QOD A;  1SFE A;  3E6M A;  2ZNY A;  3E0J B;  4C30 A;  3K2A A;  3WTU C;  1POG A;  3PSI A;  2LKX A;  4DBR A;  1HKS A;  2ECB A;  4K2E A;  3ZMU A;  5D5W B;  2R7T A;  2JA5 J;  3CMM A;  3KFW X;  4CCO A;  2NVT J;  2KZV A;  2COB A;  4FIS A;  3TW6 A;  5EJC A;  1D1B A;  4KFC A;  3QYB A;  4B43 A;  4ITV A;  3LWF A;  5J47 A;  2ZJQ F;  2ESN A;  2A69 F;  3L2C A;  2H94 A;  5ED4 A;  3ZQC A;  3EUH A;  2JA8 J;  4XID A;  4A93 J;  1X3W B;  3HRM A;  2R7D A;  5FLX Z;  2FNA A;  4HEA 2;  4M3E A;  4L9N A;  3PM1 A;  4HDU A;  4TV7 A;  3MVP A;  3AG2 H;  3V4G A;  3VYU B;  1ITY A;  2BY3 A;  3S14 J;  1FIP A;  1GVD A;  4HW0 A;  5K5R A;  2V26 A;  3ZMZ A;  2FXA A;  2E60 A;  4CO8 A;  4I0A A;  2M87 A;  2A05 A;  4BKX A;  2NVU B;  2X6X A;  4F7Z A;  2LY2 A;  3J7Z I;  6PAX A;  1IRF A;  3ZQ7 A;  5IT3 A;  2EFO A;  1LUJ B;  2ZME B;  3OYN A;  1ZGW A;  2DCE A;  5ICE A;  1FYL A;  2DI3 A;  2XUB A;  4HAM A;  4M9S A;  3IKT A;  3I4P A;  5CVJ A;  2XF6 A;  1SMY F;  2ZO4 A;  3CUO A;  2IJL A;  1D0X A;  3WG7 H;  2ETH A;  1PDN C;  3HG9 A;  3DCF A;  1ONV A;  1BOA A;  2M2E A;  4XLA A;  2YX7 A;  4LG0 A;  5GPC A;  4Y4R A;  3CJQ B;  1YO5 C;  1DGW Y;  1FIA A;  1ETX A;  4EMS A;  2DW4 A;  2H8R A;  4D1Q A;  1I39 A;  3MD2 A;  1CQT A;  4BQN A;  2HDC A;  4Q4Z F;  3I58 A;  2V1U A;  1B59 A;  2LTP A;  2IS1 A;  5F27 A;  1S8N A;  4XLP F;  5HS9 A;  2LKS A;  3IV5 A;  1KZH A;  1LDK B;  2EZH A;  4GXO A;  3TMO A;  1YRN B;  4IXA A;  3BCB A;  2MH2 A;  1OIS A;  2VC0 A;  2ZNZ A;  2HDD A;  3HRT A;  4LGW A;  2DOE A;  3RKX A;  4HX4 A;  4E6K G;  2B63 J;  4BL0 B;  1AA7 A;  4KMU X;  3E1S A;  1DP3 A;  3J7Y J;  4M9X A;  2VKH A;  3H9G A;  4U88 A;  4KYW A;  3S15 J;  3LSJ A;  2XAJ A;  3BTI A;  2E7W A;  2E5N A;  4EAT A;  2XKO A;  2Y75 A;  1BR2 A;  2WB1 N;  3VDX A;  2I10 A;  5FKK A;  4UNO A;  3T8T A;  1TW3 A;  3N4M A;  3H35 A;  1P6R A;  4IKF A;  3ABU A;  4HZF A;  4BNC A;  5J4V A;  4I76 A;  3OYE A;  4L9J A;  4P5O A;  2EZK A;  4PUS A;  2VBZ A;  2XAU A;  5H20 A;  2HKX A;  4QIW N;  3JSO A;  5LHG A;  1UHW A;  4UV9 A;  1DUX C;  3FIW A;  5D6E A;  1P4A A;  1LEB A;  2YU3 A;  5M3M J;  4HDV A;  5ERI A;  2XIG A;  4BE0 A;  3TL4 X;  2UWM A;  2CMP A;  3KYL A;  4H0E A;  1Z7L A;  1Z9C A;  1Y6I A;  4PSW A;  3GTO J;  1UST A;  4L0Z B;  2IVM A;  2R7O A;  1W4M A;  1U9N A;  4IEJ A;  2XGX A;  1ZN2 A;  2IP2 A;  1TT0 A;  3ABL H;  3FMR A;  5IP9 J;  1WJF A;  5IT9 Z;  3I64 A;  1MGT A;  4AID A;  1ACI A;  1ZLK A;  1RKW A;  1SVO A;  3OMY A;  1X1C A;  5D5U B;  3UKG A;  2IBD A;  4EGY A;  1LPQ A;  1XGN A;  1K83 J;  4ETS A;  3DKW A;  4ZH4 F;  2XAQ A;  3ESW B;  1WJ5 A;  3ONQ A;  3DPT A;  3IAM 2;  4L5I A;  4JP0 A;  5LGU A;  1WQ2 A;  2EJR A;  2W1O A;  5FFX A;  5ICC A;  5FB2 A;  3W3C A;  1SVM A;  3U2R A;  2VXZ A;  4RMN A;  1H89 C;  5GTH C;  2KT0 A;  1ZR4 A;  1XSD A;  2GXA A;  4U7B A;  4EJT A;  3SXY A;  3B73 A;  1I1S A;  1BI1 A;  5DCM A;  4A2U A;  1JUP A;  1HDP A;  1RR8 C;  5HDK A;  1A35 A;  1Y8Q B;  4EVI A;  3OWT A;  3BRO A;  3BPV A;  1W7P B;  4RAF A;  1JKP C;  3HL2 A;  4GYI A;  2UXN A;  4JBA A;  4IZZ A;  3OR1 C;  1P9Q C;  2E19 A;  4Y17 A;  3FXL A;  2VE9 A;  1NH3 A;  1OQY A;  3JRF A;  2PN6 A;  3CCR I;  4NUB A;  5TGT A;  4FQG A;  3E6C C;  1LEA A;  3PNT A;  4ASN A;  3HOX J;  3F6O A;  3RIR A;  1EH7 A;  1JT6 A;  1IN8 A;  4ZTF A;  3K4M A;  2W85 A;  5IYC J;  1MJ9 A;  2FSW A;  2LG4 A;  4ZDP A;  5E20 A;  2BW3 A;  3HYI A;  4UUS A;  2W7N A;  5LD2 C;  2HEO A;  3PO3 J;  1BR1 A;  4F55 A;  1HF0 A;  5M5W J;  4KIS A;  1TNS A;  2CFO A;  2OF7 A;  2AHQ A;  1YE9 A;  2ZJ2 A;  1D5Y A;  2ZJP F;  2K86 A;  1JUM A;  3E7L A;  4AIH A;  3BR3 A;  5L3C A;  1L3L A;  4P9F A;  5EYR A;  4I2O A;  2GZW A;  1Z21 A;  3ABT A;  4P1W A;  3TDU C;  3K4B A;  3QPL A;  1Z3Y A;  4CZC A;  3WHC A;  5BPI A;  2R5Y B;  3P7N A;  2ELH A;  2QF7 A;  3LFK A;  1TQP A;  3C7J A;  3ZGK A;  3ECO A;  3FXJ A;  1X3U A;  1Z6T A;  3S16 J;  3V8L A;  2A3S A;  1R5H A;  5DM7 F;  4RBO A;  2QVO A;  3LA3 A;  3LA7 A;  1BR4 A;  3K70 D;  5HOD A;  3LMM A;  4BU2 A;  4E7I A;  1UJ8 A;  2HZT A;  3OYI A;  4UUS B;  3JTH A;  3DWL E;  1LJ9 A;  2E7X A;  2DA3 A;  1QU3 A;  1S7A A;  2ESH A;  2CV1 A;  3Q0V A;  4MFE A;  2EPF A;  3V7R A;  4B44 A;  3JRE A;  4HQE A;  5M3F J;  5HLI A;  2H27 A;  2QYO A;  3PJR A;  3W2A A;  3Q0U A;  1JHH A;  2BXZ A;  3H3Z A;  3JCU C;  1RUN A;  3T0Y A;  3WE2 A;  2K9Q A;  4UHT A;  5DUK A;  3HXL A;  3AG3 H;  2OQG A;  1ZHF A;  2P4W A;  2M7B A;  3D0S A;  5K7H A;  2VOD A;  3ZXS A;  2R7W A;  2RKH A;  2X48 A;  4G6T B;  5D5X B;  1YJW I;  5E3L A;  2JVG A;  4LIU A;  3NRV A;  4LB6 B;  3NEU A;  2ZXJ A;  4F93 B;  1IUF A;  4KN4 X;  1RKT A;  2Z99 A;  3HPH A;  4DBQ A;  3CCY A;  1H8A C;  2KIU A;  3LSH A;  2CWE A;  1VF9 A;  2JSC A;  1R22 A;  1LE8 B;  4AVP A;  4KMF A;  5JHF A;  3M4O J;  1J9I A;  4BBR J;  4XMY A;  1USS A;  4IJA A;  3MMY B;  3QYE A;  2IS4 A;  2R7Z J;  2O61 A;  4UVB A;  2FNP A;  1RET A;  2X6O A;  5GAG J;  3G4S I;  2JQ7 A;  3FF5 A;  4BY1 J;  2OQR A;  2HQ5 A;  1WJD A;  5DCF A;  1YX3 A;  1AKH B;  2HYJ A;  1FY7 A;  3FBI B;  3FKI J;  3K4J A;  5LEK A;  2K3P A;  1H9T A;  2DLL A;  3HOZ J;  2FA5 A;  4JYK A;  3SZP A;  1RC9 A;  1TQM A;  4G6Q A;  3L7W A;  3SHF A;  5LLQ A;  1K7A A;  1MDM A;  4NDL A;  2YS9 A;  3MN2 A;  2W82 A;  3CJN A;  1EJ9 A;  3K6G A;  3I59 A;  2D1V A;  3HOU J;  4DQ2 A;  3VSK A;  4A3B J;  3JRB A;  1P4W A;  4HST A;  4MTE A;  1S72 I;  2LNB A;  3TKY A;  2CUF A;  3TW7 A;  4HNU A;  1R1V A;  1BC8 C;  3WTT C;  3PUB A;  2DU9 A;  3CZ6 A;  5ICG A;  3F22 A;  2QBY A;  9ANT A;  3M1E A;  1MBJ A;  3TGN A;  3FHZ A;  2Z1D A;  3OS1 A;  3F23 A;  1V5G A;  3ZRG A;  2A61 A;  3N97 A;  2P7C B;  2W4S A;  3RKW A;  3M8E A;  4E7H A;  1F36 A;  2H1K A;  1YJ9 I;  2X6Y A;  4JK1 X;  1W0T A;  3ZPL A;  5C44 J;  1WI3 A;  2KRC A;  1REP C;  1SC7 A;  3CUQ B;  2VKV A;  3T1B A;  3WU2 C;  2VJ5 A;  1KA8 A;  1ZRC A;  1XD7 A;  3H9Q A;  4E7L A;  2BHZ A;  3I71 A;  1YQA A;  2DK5 A;  4D5C A;  2ME6 A;  2XRL A;  2EA2 A;  4OU0 A;  1LKX A;  1BJA A;  2NAZ A;  1G3W A;  4MLO A;  4A6D A;  4IX7 A;  3CME I;  2VQH A;  4BUP A;  1YHQ I;  4GGG A;  3PQK A;  2O9L A;  5DD8 A;  3DU6 A;  3QWL A;  1X19 A;  3CC4 I;  4LFU A;  1XCV A;  5LGT A;  3OS2 A;  3P9K A;  2LY1 A;  5IP6 A;  5HS7 A;  1MH4 A;  3H9J A;  1IZ1 A;  1D3Y A;  3TOB A;  2HVS A;  5FLV A;  5KAF C;  4XM3 A;  2R5Z A;  1J7K A;  3I3L A;  3ASN H;  3HOV J;  4MEX F;  3TQN A;  4M6Y A;  2KHM A;  2L7M P;  2ME0 A;  2IA2 A;  3ZN1 A;  1FBQ A;  3QPH A;  5KNL A;  1Y56 A;  3WTX C;  3DV8 A;  4EJU A;  3JRH A;  3LOC A;  1U6G A;  1W5T A;  4G12 A;  2DK8 A;  3KET A;  5KK1 A;  4BXF A;  4OAY A;  1XMX A;  3BCA A;  3IRR A;  2V9V A;  4F52 A;  5FD5 A;  1UCR A;  1XGS A;  1BIA A;  3CP8 A;  3DP7 A;  2XVC A;  5IOY A;  5B3S H;  3PIO F;  1TWC J;  4D0P A;  2H6B A;  4MQ9 F;  2CH0 A;  2QLZ A;  4C2U A;  5KAI C;  3BQY A;  4M9Z A;  1B6A A;  2CQK A;  1GV2 A;  5K7Z A;  1HSJ A;  3N05 A;  4M71 A;  1O3T A;  2DMN A;  3MCZ A;  2RC4 A;  3QPS A;  3WTS C;  3F8B A;  4V19 K;  5IY5 H;  4A3I J;  1A31 A;  2HXO A;  4CXF A;  5LHH A;  2QCO A;  4OOI A;  4WX9 A;  2Z5U A;  3GTL J;  3O8G A;  1T2K A;  5IYD J;  2VQC A;  1GVJ A;  2WY8 Q;  3GLL A;  1AKH A;  2VKD A;  1MMS A;  1DPU A;  1P7J A;  3MZY A;  1UZC A;  1SAN A;  1TLH B;  2L4A A;  3KIO A;  2FBH A;  4A3F J;  3AFH A;  4AWX B;  1R4M B;  1QBJ A;  1X2M A;  3WTZ A;  4ENM A;  4B3A A;  1M1E B;  3EUK L;  2JRM A;  2K02 A;  3JAM K;  1I50 J;  1KU7 A;  2LMD A;  3OYA A;  3FIS A;  4UUT A;  4LB5 A;  2QGU A;  4EV0 A;  2IGM A;  5TRD A;  2MG4 A;  2VT2 A;  1IN7 A;  2DFF A;  3ABM H;  5CJ9 A;  4HNV A;  4BXX J;  4W1U A;  2M4G A;  2CYY A;  1FSH A;  2DFE A;  4NNJ A;  1FMW A;  3D5S C;  1LVA A;  2V1D A;  4JX6 A;  2M1B A;  5CVV A;  1R71 A;  2Q2E A;  3ERM A;  4PGG A;  1SD5 A;  2BY2 A;  4IF4 A;  2PX9 A;  3BR6 A;  4M3B A;  2LC2 A;  2XAH A;  2YU9 J;  4X0G A;  5GPA A;  1ZAR A;  1R36 A;  3EUH C;  5HVQ C;  5IPA A;  3RZD J;  1HKQ A;  3ABK H;  2UZK A;  3HIF A;  3VPR A;  4C3I J;  3DU5 A;  1FSE A;  1DQU A;  1VTN C;  4CH7 A;  2RDP A;  2OC6 A;  3CDI A;  4PSX A;  2DFH A;  4GCV A;  4AC0 A;  4FCY A;  2NVQ J;  1SFX A;  1ZEL A;  3SDB A;  5E3M A;  1H9G A;  2HS5 A;  3LAJ A;  4E7Z A;  3L9F A;  2Y0M A;  4QTR A;  3BR2 A;  2M8E A;  5J40 A;  1IUY A;  4L0Y B;  3RPQ A;  3J7A Y;  2COM A;  2CW8 A;  1HA8 A;  2QBY B;  2Y2Z A;  3WE3 A;  2K9M A;  3J7A O;  2L9V A;  3PFY A;  5CQG A;  4OIR F;  4CSW A;  3WTY C;  1Z91 A;  2ZSI B;  1R58 A;  2A07 F;  2PJR A;  4ZYD A;  2XKP A;  2Y31 A;  4Q47 A;  1BW5 A;  2KPM A;  4R79 A;  4HOB A;  2OD5 A;  2E2I J;  1HST A;  1N77 A;  4EEF G;  3T8R A;  1IAW A;  2RNJ A;  1WFX A;  2HDW A;  3TOA A;  5JI6 A;  1BA5 A;  5FD6 A;  3BG5 A;  4XN0 A;  5CKT A;  2LOO A;  1APL C;  1EF4 A;  1A6I A;  2EB7 A;  3MKY B;  4YFK F;  5CLS A;  2QM3 A;  5B5E C;  4PFO A;  1I5Z A;  1UHS A;  2CUZ A;  2QSG X;  2VBX A;  3BTL A;  1O3R A;  3P5J A;  4AUX A;  1SVL A;  1RPW A;  4OAZ A;  5M5Y J;  1BI3 A;  2QUF A;  3CC2 I;  1F1Z A;  3BT9 A;  1ZAO A;  4ESF A;  5KHD A;  3W6J B;  5C4J J;  4QSH A;  5JR3 A;  3BG3 A;  3WGH A;  3FK6 A;  1MJA A;  1XSX A;  2L9R A;  2F5C A;  2XGC A;  3V7S A;  4UUV A;  3A2K A;  1MKM A;  4E7S A;  3CCQ I;  4DW6 A;  4XLN F;  3LAP A;  4ON0 A;  2V9P A;  1NG7 A;  3S3O A;  1FTT A;  3F3X A;  4BEH B;  2DMU A;  3S1M J;  4D7N A;  1R1U A;  1GLN A;  3E6D A;  1LVK A;  4HF2 A;  2FML A;  3EYY A;  4E4H A;  3RYR A;  3F6V A;  1R1T A;  4LLL A;  2KIQ A;  2RV8 A;  1IDY A;  3GX4 X;  2Q0O A;  4HBL A;  2FOW A;  1K61 A;  1KQ8 A;  2I8D A;  2Y30 A;  4ZDO A;  2FD5 A;  1J59 A;  2WBM A;  5CQE A;  2D5V A;  4CYC A;  2ZB9 A;  4ANJ A;  4CA0 A;  4N0B A;  4CHU A;  2DA2 A;  4HRI A;  4NQW A;  5GAD J;  1FP1 D;  4XL9 A;  4IHW A;  5EEG A;  1RIO H;  4M6X A;  5F08 A;  1ZQ3 P;  1FWZ A;  4X6A J;  2MC4 A;  5HLG A;  2ADU A;  2RGV A;  2O6G E;  3S8P A;  1FYK A;  2XB0 X;  1VQ7 I;  2DOA A;  5F1R A;  2R7V A;  2AQE A;  2P8T A;  1OJL A;  3R0J A;  2XRO A;  3C1D A;  2EIK H;  2DA7 A;  2O8X A;  4QPO A;  2VJI A;  4XN3 A;  3GFM A;  3SZG A;  4PJL A;  3MAJ A;  1E3O C;  4EM2 A;  3JRD A;  2KJC A;  4LIV A;  1MD0 A;  3S3N A;  4AIK A;  2BOL A;  1VQP I;  3DKX A;  3GXO A;  2HQA A;  4LD5 A;  2LFB A;  2V7F A;  2JUC A;  5LBQ A;  2HPM A;  3JRA A;  2TRT A;  2WV0 A;  3A0H C;  4HNT A;  5D4S A;  1TP4 A;  1VQL I;  2ICW G;  2XC7 A;  5E3N A;  3OOU A;  2AS5 F;  1R00 A;  1XGM A;  3G3Z A;  3G1O A;  3LSM A;  4KJZ A;  4OMZ A;  2QEN A;  2PJP A;  1KON A;  4RGU A;  3CCV I;  2F4M B;  3C18 A;  2JN6 A;  3U1D A;  2O0Y A;  1XS9 A;  1FT9 A;  4DYR A;  1TWF J;  2K4J A;  1WJB A;  3LSK A;  4ABZ A;  3HKZ A;  4BHB A;  3C2B A;  1J0R A;  4P9U A;  3WU0 A;  4YIF A;  4XKB A;  2IW5 A;  3OYG A;  2Y69 H;  1QZZ A;  4BS9 A;  4XKC A;  2Y9Z A;  4ZTJ A;  3JTG A;  3HUG B;  3HEF A;  5HLH A;  3EUA A;  4A3K J;  3ERE D;  2DA6 A;  2LP0 A;  3FZV A;  2QQB A;  3Q5F A;  2O3F A;  2O7O A;  1WJE A;  4DGW B;  3ROU A;  2R7Q A;  4B3X A;  2LYC A;  2DPD A;  1Y8R B;  1ETV A;  2E2H J;  4HPQ A;  2OCC H;  1PP7 U;  4BQQ A;  2K3F A;  1E2X A;  2AQF A;  1X1P A;  2X9D A;  4XRM A;  1UG0 A;  1MSE C;  2BBY A;  3BPX A;  4XLC A;  3HSE A;  3M8F A;  4CUG A;  5D4R A;  2W84 A;  3NWS A;  3CCS I;  2B7E A;  3Q9V A;  3LFU A;  2VPR A;  3BR1 A;  1FZP B;  4ESJ A;  4LK0 F;  1SD6 A;  3JAM Z;  2PQ8 A;  1ZH5 A;  1QHG A;  4NC8 A;  5L3B A;  2M8G X;  3S1R J;  2QSH X;  4ZJZ A;  2R93 J;  3RI4 A;  3WG9 A;  4V2F A;  1B9N A;  1FOW A;  3MKL A;  2EA4 A;  2EK5 A;  5H2F C;  1XMA A;  2XPU A;  1NG6 A;  3HC7 A;  5B1B H;  1ETO A;  3HTU A;  1Z3X A;  1YTY A;  3C3W A;  3H5N A;  3MKZ A;  3OY9 A;  2E34 A;  3D5R C;  4O5V A;  3BR5 A;  2AXT C;  3M07 A;  2XF7 A;  3CF5 F;  3R4K A;  1YS7 A;  4C3J J;  4JX4 A;  1VQ4 I;  1U78 A;  5JVT A;  3JRC A;  2E36 A;  3FX3 A;  2X4H A;  1S29 A;  3A01 A;  2OZ6 A;  2F4O B;  3WHB A;  2HNH A;  1PJR A;  3V8K A;  4F92 B;  3DF8 A;  3F0C A;  1ENH A;  1O57 A;  3SFZ A;  4HA8 A;  4BGD A;  4L5E A;  3W2W A;  1P7I A;  3H0G J;  2VAS A;  1T98 A;  1MSF C;  5IP7 J;  4RB1 A;  2XSJ C;  2XGE A;  4EM0 B;  1X1B A;  5LFA A;  3VWB A;  3L1P A;  2Y48 A;  5H6Q A;  4NC7 A;  5K1Y A;  4R1H A;  2A68 F;  2JJ7 A;  3QU3 A;  2MLK A;  2NVX J;  2LF8 A;  1IRZ A;  1J09 A;  1JKO C;  2R7X A;  1BI0 A;  1HKT A;  2KRF A;  2E1N A;  1YRN A;  3BJO A;  3EPZ A;  4A0X A;  3KEO A;  2G7U A;  3AKZ A;  1MND A;  3RYP A;  2PEX A;  1VQN I;  2DT6 A;  2LR8 A;  4KA4 A;  4J19 A;  1OR7 C;  1D1A A;  2DA1 A;  5D8L B;  3CF2 A;  4N9I A;  2EBI A;  3K7A J;  4LG0 B;  1GXP A;  3C2G A;  2RN7 A;  3HB9 A;  1WJC A;  3U21 A;  1FBU A;  2HOA A;  1X2N A;  3K4N A;  2JWT A;  1UHM A;  4RAG A;  2F5D A;  4PJN A;  4Y15 A;  1O3Q A;  5BPD A;  1LE8 A;  1MMG A;  4BH9 A;  1NHA A;  1G2H A;  1FBS A;  2V1X A;  5D6F A;  2IRF G;  1E17 A;  1YS6 A;  2VBY A;  1W5C C;  3DXJ F;  2EV0 A;  3AAF A;  3GF2 A;  3RPU D;  3GZN B;  3KP2 A;  4HX8 A;  4EM1 A;  3MWM A;  2V79 A;  5EZH A;  3ZQG A;  4ENJ A;  3LQQ A;  2D45 A;  4PJM A;  3TP0 A;  1O7F A;  2JPC A;  4MNU A;  4PCQ A;  3S1Q J;  4I6Z A;  1ON2 A;  2WAF A;  2IA0 A;  2MD0 A;  3OYJ A;  3OYB A;  1IC8 A;  4C2T A;  1V3F A;  3MZ8 A;  2CFX A;  2L0K A;  1FOK A;  2JSP A;  5GAH J;  1ZRF A;  1OCC H;  1OMI A;  3L2U A;  5DEQ A;  3OYM A;  1B1B A;  4FE4 A;  1ZRE A;  3GFL A;  1HW1 A;  4Y3O A;  3A02 A;  4M3F A;  5J8C A;  3RDI A;  1U0J A;  2L9S A;  4IOC F;  1XTA A;  1OPC A;  2GAU A;  3DEE A;  1XN7 A;  2O03 A;  1W36 D;  1PUF A;  5EDN A;  3IKV A;  3QOE A;  1T38 A;  4RM2 A;  1Z1D A;  2XDV A;  3OL3 A;  2DFI A;  2EIL H;  4HYE A;  2HQN A;  5E1W A;  3OYC A;  2GLO A;  3HDD A;  3RQ4 A;  5A2Q K;  2RQP A;  2XRN A;  3K69 A;  2DQR A;  2LY9 A;  3D1N I;  3CDH A;  5FGM A;  5FLX K;  1V55 H;  4NBQ A;  3RSN A;  2NS0 A;  2OAZ A;  3FM3 A;  3H1C A;  1IV6 A;  3V42 A;  3GTG J;  5GTI C;  4CZZ A;  5HS8 A;  1JE8 A;  1UMQ A;  2QQ8 A;  2XPV A;  2XF5 A;  1S9H A;  4A3E J;  3TO9 A;  4RLF A;  5IOZ A;  1B72 A;  3HZJ A;  2CUE A;  1R7J A;  1NK2 P;  2A5Y B;  3H0D A;  4U0W A;  1QZE A;  4EJV A;  4EQQ A;  1N75 A;  4O6J A;  1IV8 A;  4IQ4 A;  2KIS A;  4MTD A;  1FJL A;  2VB6 A;  4IHS A;  3HUG A;  4HV6 A;  1QZY A;  4IHT A;  3KX2 A;  1YW7 A;  2F4I A;  3OIP A;  3Q0W A;  5J4Y A;  3FWE A;  3M9A A;  3JRI A;  5H6R A;  3JSP A;  4YEL A;  2LBF B;  2BE5 F;  2N8G A;  1DU0 A;  3RPU A;  4B09 A;  5KVR A;  5C3E J;  2BV6 A;  4UVC A;  5L3F A;  1BOB A;  1SAX A;  1JI8 A;  5E8I A;  2CQN A;  1BI2 A;  2BHY A;  4RLQ A;  3KLO A;  5JHU A;  4NC6 A;  3GME A;  2BGC A;  2DA4 A;  3I9V 2;  1A5J A;  2OU2 A;  1RRJ A;  1HC8 A;  1CF7 B;  3BZ6 A;  2HPI A;  5EGO B;  4G8X A;  1E3P A;  4Y13 A;  2F6C A;  4UXN A;  1IJW C;  5HNH A;  3M3Y J;  2VT3 A;  2H1L A;  1T95 A;  2DTZ A;  1VQO I;  4CYD A;  5A2Q Z;  5EEH A;  3J81 K;  3IH4 A;  1K78 B;  4Z2Y A;  2HYF A;  1BW6 A;  2HVQ A;  3GW2 A;  1ODD A;  3I55 I;  2IGK A;  4E7J A;  3E5U A;  2J5P A;  1Z77 A;  4CYC B;  3HRU A;  1VFC A;  1UFM A;  4U87 A;  1GDT A;  1HLV A;  4HSR A;  1K4T A;  2FBI A;  2WTE A;  3PSF A;  5D5V B;  1BL0 A;  1WWX A;  3CJR B;  4EGZ A;  1SFU A;  4BDZ A;  1MMA A;  4YG2 F;  2QQ9 A;  3IH2 A;  2ID6 A;  3QOP A;  1LDJ A;  3BY6 A;  3RTR A;  4I98 B;  3K0L A;  2R0Q C;  1H88 C;  3TDZ C;  3CO6 C;  2YSR A;  3DPL C;  2E1M B;  2M5W A;  2KDO A;  3CLO A;  2LD5 A;  3VYS B;  2Z3Y A;  4BE2 A;  1IN5 A;  1MW7 A;  4YFN F;  4ZC3 A;  2DJN A;  2GM4 A;  2NS8 A;  2XAF A;  4G7Z F;  1SD7 A;  1V5F A;  2EFW A;  2P5V A;  1U5T A;  3CCM I;  1JGS A;  4ZZL A;  1V5E A;  1SFK A;  2FEZ A;  2L3D A;  2K9N A;  5FKO A;  3G1M A;  4OIO F;  4KIG A;  3ULQ B;  4XQF A;  1U8R A;  1OCP A;  3KP7 A;  2DXI A;  1VQ9 I;  4E70 A;  3R6S A;  5J1R A;  4HX7 A;  3DEW A;  3BQZ A;  2VN2 A;  1XDS A;  3MKW B;  3LA2 A;  4PGH A;  2JRT A;  5JVG F;  1TL8 A;  3FK7 A;  1HCR A;  1X1D A;  2V1N A;  3HGY A;  3GBG A;  2GIZ A;  2HQR A;  4YII A;  1R5I D;  3SDG A;  3UR3 C;  4CDG A;  4L9T A;  3SQN A;  4AYB N;  2WV1 A;  2VQL A;  2IXS A;  1JGG A;  2EV6 A;  4PJ0 C;  2EV5 A;  3QP6 A;  3TP3 A;  3FXM A;  3OR2 C;  4GFB A;  2JZY A;  2VBW A;  2WAQ N;  4UV8 A;  3J80 K;  1MBE A;  5ICF A;  4PFP A;  4DOZ A;  3DQV C;  3ML6 A;  1WGX A;  1B9M A;  4QWQ A;  1MNM C;  1BN5 A;  3VOD A;  5D8K B;  2KQR A;  5HDN A;  2Z9O A;  4BE1 A;  1RZ4 A;  2YX4 A;  3OYK A;  2JMW A;  5FKL A;  1WHU A;  3WU1 B;  4HF1 A;  2L7Z A;  4FAS D;  3HGG A;  3U9G A;  5CVR A;  1FYM A;  4FTH A;  3LNQ A;  1QVU A;  2VOO A;  2ZBK A;  2E1M C;  2DOF A;  3K2Z A;  4YIR X;  3EYI A;  2WC2 A;  2CSO A;  4A5M A;  3VB2 A;  3ZOB A;  1EKE A;  2BZT A;  3T5X A;  2ZXI A;  1T39 A;  3IRQ A;  3F8M A;  1FPQ A;  2V9K A;  2GBY A;  5E1X A;  2DA5 A;  2P5K A;  3NWT A;  3A01 B;  3BG6 A;  4RAY A;  3I59 B;  3HBL A;  3S17 J;  2PI0 A;  2MD5 A;  1G4D A;  4QPQ A;  3GTM J;  2AO9 A;  1W5S A;  4D5F A;  4YFX F;  2JUG A; 
#chains in the Genus database with same CATH homology
 3CP2 A;  2L9N A;  3S8P A;  2R7V A;  2WAD A;  4U7B A;  2DOA A;  2AQE A;  1X4O A;  2X1E A;  2MAB A;  3CES A;  3OWT A;  1E0E A;  2VQG A;  4QPO A;  2VJI A;  4XN3 A;  3HL2 A;  3S93 A;  3SZG A;  4PJL A;  3OR1 C;  1P9Q C;  4IZZ A;  3DPU A;  5HNF A;  2E5Z A;  3KEY A;  2CV0 A;  4LIV A;  4NUB A;  1QHH D;  5TGT A;  3S3N A;  2BOL A;  3H5A A;  3PNT A;  4CCL A;  3DKX A;  2HQA A;  3UNG C;  2ZSH B;  1R6R A;  2V7F A;  3LL7 A;  2HPM A;  4ZTF A;  2O5R A;  3K4M A;  4HNT A;  2LG4 A;  4ZDP A;  2BW3 A;  2XC7 A;  3OOU A;  2W7N A;  5LD2 C;  2A6T A;  1BR1 A;  4F55 A;  3LSM A;  4KIS A;  2CFO A;  1YE9 A;  4KJZ A;  2X85 A;  3L2V A;  1KON A;  5FRM A;  1OLT A;  5HOO A;  4GRI A;  3FHN A;  4N4N B;  4XLF A;  1WJB A;  3LSK A;  3HKZ A;  1Z21 A;  3FDY A;  2IGN A;  2VXD A;  4P1W A;  2IS6 A;  2CUJ A;  3OYG A;  3K4B A;  4XKB A;  1D1C A;  1Z3Y A;  4BS9 A;  1WJA A;  4CZC A;  2HZD A;  4XKC A;  4B47 A;  4PJJ A;  4ZTJ A;  2X6W A;  3HUG B;  3ZGK A;  2K5C A;  3EUA A;  2Q2E B;  3F9K A;  4XKW A;  3L2Q A;  1BR4 A;  3K70 D;  2R7U A;  3A4C A;  1WJE A;  3LMM A;  4BU2 A;  4E7I A;  3OYI A;  4DGW B;  4BEH A;  2R7Q A;  4B3X A;  2L7K A;  2LYC A;  3DWL E;  4HPQ A;  4LG3 A;  4BQQ A;  1QU3 A;  1VZ0 A;  2F5V A;  2AQF A;  4OWR B;  2CV1 A;  4F91 B;  4B44 A;  1UG0 A;  3IP4 B;  1G59 A;  3PJR A;  2K9L A;  3W2A A;  4XLC A;  2ZXH A;  4CUG A;  1MMD A;  3NWS A;  3ZQQ A;  2R4G A;  3LFU A;  2BVL A;  3HXL A;  2DJI A;  2M7B A;  3ZXS A;  2R7W A;  1QHG A;  4NC8 A;  4G6T B;  2W00 A;  4ZJZ A;  2JVG A;  4B48 A;  4LIU A;  2Q1Z B;  3PL8 A;  3BLY A;  4F93 B;  4AYB A;  1NG6 A;  3HC7 A;  2L2O A;  3DTK A;  3HPH A;  3DTI A;  1Z3X A;  4HG2 A;  4DBQ A;  3H5N A;  3MKZ A;  3OY9 A;  3D5R C;  3DKY A;  3IAS 2;  4H4K C;  2XF7 A;  3LSH A;  2KLO A;  2LRE A;  1K6Y A;  4XR6 A;  3TBI A;  2VJJ A;  2M0M A;  2GOM A;  4KT6 A;  5JHF A;  1X4P A;  4XMY A;  2HNH A;  1PJR A;  3MMY B;  3QYE A;  4F92 B;  4XOP A;  2IS4 A;  2R7S A;  4NQW B;  3BC8 A;  4BGD A;  3W2W A;  1FMV A;  2OV7 A;  3LSI A;  2VAS A;  2VPL A;  4XNF A;  4YEJ A;  1WJD A;  3FBN B;  3W2V A;  1YX3 A;  5KCM A;  1YX5 A;  2XSJ C;  1X1B A;  3FBI B;  4II2 A;  5LFA A;  3VWB A;  3K4J A;  3OIQ A;  3VYR B;  4LIT A;  2WAE A;  3OL4 A;  4NC7 A;  2GOX B;  2K3P A;  2VJ4 A;  3OYL A;  2VLA A;  4CCN A;  2RQQ A;  1J09 A;  2X51 A;  1X1A A;  2W82 A;  2R7X A;  1LFP A;  4C9Y A;  3K6G A;  4CCK A;  1DGR M;  3EPZ A;  3VSK A;  3AKZ A;  1MND A;  3M1C A;  4HST A;  2DT6 A;  4HNU A;  3SEZ A;  3PUB A;  3CZ6 A;  1OR7 C;  1D1A A;  1MNE A;  2Z1D A;  3CF2 A;  5FRO A;  3OS1 A;  1V5G A;  4IQJ A;  3ZRG A;  3OS0 A;  2R7R A;  3C2G A;  2KRH A;  2W4S A;  2Z16 A;  4E7H A;  1WJC A;  2X6Y A;  3U21 A;  4N4O B;  1W36 C;  2QKL B;  2KRC A;  3K4N A;  4PJN A;  2RNG A;  2VJ5 A;  3D5L A;  1MMG A;  3C2H A;  3H9Q A;  4E7L A;  2DT7 B;  2V4J C;  2WB1 A;  2WY7 Q;  3PNV A;  1LKX A;  3RPU D;  4ZDL A;  4MLO A;  4IX7 A;  2VQH A;  2MYS A;  4BUP A;  4XLE A;  2HVR A;  2NOJ B;  3DU6 A;  4PJM A;  4XOR A;  1X19 A;  4BJT A;  2VIX A;  4YRV A;  2BW3 B;  3OS2 A;  2LY1 A;  2WAF A;  2MD0 A;  3OYJ A;  3OYB A;  3H9J A;  3HOS A;  4C2T A;  4XOT A;  2JSP A;  3OYD A;  4CCJ A;  2HVS A;  3L2U A;  4XM3 A;  3HOT A;  3OYM A;  3I3L A;  2CS3 A;  3SEQ A;  2KHM A;  4Y3O A;  3K4K A;  3S3M A;  1PYV A;  1U0J A;  2L9S A;  1D0Z A;  4AVZ A;  4JOM A;  3OYH A;  5KNL A;  1Y56 A;  3DEE A;  4BJ5 C;  1W36 D;  1MMN A;  2CW7 A;  2ZFU A;  2HU9 A;  3QOE A;  4PK4 A;  3DTE A;  3QYF A;  2L5Q A;  4RM2 A;  2PMZ A;  2XDV A;  3OL3 A;  4OAY A;  4BQO A;  4BXF A;  3BCA A;  2Z2S B;  4F52 A;  3OYC A;  3CP8 A;  3RQ4 A;  4CCM A;  1IRX A;  3RCO A;  2JA2 A;  3BG7 A;  2BVM A;  3M8J A;  3FKJ A;  3RSN A;  2CH0 A;  4C2U A;  3V42 A;  2A5W A;  2KL4 A;  3N05 A;  2KP6 A;  4E7K A;  2XF5 A;  2M7A A;  1S9H A;  4KIT B;  4RLF A;  2KMU A;  4XON A;  2X1D A;  5CPR B;  3H0D A;  3A1Y A;  2CV2 A;  2QKM B;  1N75 A;  2LH9 A;  4IQ4 A;  2RRE A;  4RM3 A;  3LSG A;  2UUZ A;  2VB6 A;  3KX2 A;  3VYT B;  2F4I A;  3OIP A;  4JQF A;  2VQC A;  2WY8 Q;  2VKD A;  1D0Y A;  4YEL A;  3HPG A;  2LBF B;  2LRD A;  2WA0 A;  5HLT A;  3AFH A;  2WAQ A;  3ZCO A;  2OUM A;  3EUK L;  1BOB A;  3SYT A;  4XLH A;  1JI8 A;  4J00 A;  1EA3 A;  3QOD A;  3OYA A;  3E0J B;  4RLQ A;  4C30 A;  2IGM A;  3PSI A;  4DBR A;  4ZYA A;  2R7T A;  3I9V 2;  2Y0S A;  3CMM A;  4CCO A;  2KZV A;  2M4G A;  1UEL B;  4BAC A;  1D1B A;  2HPI A;  4NNJ A;  1FMW A;  3D5S C;  3L2R A;  3QYB A;  4B43 A;  3OYF A;  4ITV A;  2F6C A;  5HNH A;  2IGO A;  2LC2 A;  1T95 A;  1T0F C;  3K4C A;  4X0G A;  4HEA 2;  4BJ6 C;  2PJR B;  3EUH C;  2HVQ A;  3VYU B;  5HVQ C;  3K70 C;  4E7J A;  2IGK A;  4XKV A;  2V26 A;  1SAU A;  2E60 A;  4U87 A;  5FRN A;  3DU5 A;  4HSR A;  1G8X A;  3PSF A;  1DQU A;  4D9J A;  2JVH A;  4CH7 A;  3CJR B;  2X6X A;  2LY2 A;  2OC6 A;  4PSX A;  4BDZ A;  1MMA A;  1ZEL A;  3SDB A;  3OYN A;  4E7Z A;  2M4K A;  2DCE A;  4BDY A;  2XF6 A;  3J7A Y;  2CW8 A;  3RTR A;  1HA8 A;  3VSL A;  1D0X A;  2K9M A;  3PFY A;  5CQG A;  4CSW A;  3HG9 A;  2ZSI B;  4XLA A;  3DPL C;  2E1M B;  4J01 A;  2KDO A;  3VYS B;  2PJR A;  2MFZ A;  2KPM A;  4Y4R A;  4R79 A;  3CJQ B;  1DGW Y;  3S32 A;  4BE2 A;  1MW7 A;  4ZC3 A;  4D1Q A;  1N77 A;  3MD2 A;  4BQN A;  1WFX A;  1V5F A;  2HDW A;  2IS1 A;  1V5E A;  2V6E A;  1SFK A;  1TZL A;  4XN0 A;  5CKT A;  2LOO A;  1LDK B;  2FUG 2;  3TMO A;  4XQF A;  3MKY B;  3BCB A;  1N78 A;  2DXI A;  4PFO A;  4E6K G;  2CUZ A;  3MKW B;  4BL0 B;  1AA7 A;  3E1S A;  3AL0 B;  1DP3 A;  2X1C A;  2VKH A;  3K4L A;  3H9G A;  3ZR8 X;  1X1D A;  4OAZ A;  2E5N A;  4EAT A;  2V1N A;  3GBG A;  1BR2 A;  3VDX A;  2P0W A;  3UR3 C;  3AL0 C;  2VQL A;  3K10 A;  2IXS A;  3PNY A;  3H35 A;  4IKF A;  5KHD A;  3OYE A;  3IUO A;  3OR2 C;  4P5O A;  4PUS A;  3G2B A;  2XAU A;  2M3A A;  4DOZ A;  4PFP A;  3DQV C;  3A2K A;  4FET A;  4E7S A;  2KQR A;  4BE1 A;  4BE0 A;  1NG7 A;  3S3O A;  3TL4 X;  2UWM A;  2CMP A;  4BEH B;  3KYL A;  3OYK A;  2LBF A;  1Z7L A;  1Y6I A;  4PSW A;  1GLN A;  4AU7 A;  1LVK A;  2R7O A;  4FAS D;  2ELJ A;  3DLA A;  4E4H A;  1TT0 A;  2VL8 A;  2E1M C;  1UAA A;  1WJF A;  3L2W A;  2I8D A;  4ZDO A;  4F3Q A;  2WBM A;  5CQE A;  2ZXI A;  3OMY A;  1X1C A;  2V9K A;  3H5R A;  4ANJ A;  3NWT A;  4CA0 A;  3BG6 A;  1ERD A;  4DIQ A;  1WJ5 A;  4HRI A;  3ONQ A;  4II3 A;  3DPT A;  3IAM 2;  4QPQ A;  4XL9 A;  2W1O A;  2UV1 A;  3W3C A;  2IS2 A;  2JUG A;  2VXZ A;  4RMN A;  4Y33 A;  4DJA A;  2MC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...