3FBIB

Structure of the mediator submodule med7n/31
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
QNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mediator of RNA polymerase II transcription subunit 7
publication title Identification, structure, and functional requirement of the Mediator submodule Med7N/31
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 27
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05669 Med31 SOH1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1340 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3fbiB00
3FBIB 3FBNB
chains in the Genus database with same CATH superfamily
4ZYAA 1E0EA 4XN3A 1BI1A 2L4MA 4CHUA 2EA2A 5E1ZB 2BYVE 1RESA 2NOJB 1HKQA 2WADA 2PJRA 4BQOA 3FZVA 5BPDA 1LDJA 3JRHA 2HGCA 3TO6A 3TO9A 1H88C 1P6RA 2R7WA 1BOBA 4UVCA 4P1WA 4YFNF 3VWBA 2LRDA 2LF7A 2LP0A 4MEYF 2IGOA 4KIFA 4ENJA 5CVVA 1I3AA 1ZLJA 3S2HJ 1MMSA 2E36A 3ABMH 2QCOA 3GTJJ 1QGPA 2MGQA 2HOAA 3CZ6A 4Y4RA 4ZC3A 2ZJQF 5BMZA 1B1BA 4C2TA 2R7XA 1XB4A 1RNLA 3IKTA 1XG1A 2WBMA 2VQGA 2NRAC 4ZTFA 5CQEA 4RMNA 2BY3A 2CH0A 3PUFA 1AHDP 3K4LA 2DT7B 2O7OA 4RAYA 2FE3A 2CUZA 4IX7A 1WJFA 4M3DA 1K79A 5DTDA 2WB1A 2KLOA 5J8FA 4KN7X 1Z9CA 5IYCJ 2KIUA 5E18F 3OS1A 4RB0A 1TQIA 4G12A 4QLCU 3GTOJ 4UXNA 2GM4A 2HEOA 2HPMA 1U5TC 1OCCH 3B6CA 4XM3A 3PIOF 3K70C 1IRGA 1RC9A 3QP5A 4ESBA 5B66C 2X51A 4RAFA 3J80K 1SFXA 1QPMA 1G3WA 3PO2J 4XLNF 1FSEA 3K10A 4B1RA 3OOUA 2OBPA 1IDYA 1ZTRA 5FGMA 1YYVA 1O3QA 1LVKA 4QTRA 4A5NA 2O03A 1EA3A 2Y0MA 1LUJB 5IPAA 1QA6A 3GO5A 2JT1A 2R7QA 4LLLA 1YFHA 4XLEA 1HW2A 2HS5A 5LBQA 2WTEA 2VQLA 2BHYA 2DPUA 2PJRB 4MIMA 2IGKA 5FKNA 3DEEA 2UV1A 1FZPB 1DU0A 4MFDA 1QHGA 5L3GA 4U7BA 2QKMB 2HXOA 2OUMA 2IP2A 3RKWA 3OMYA 2P5LC 1K78A 4CXFA 3Q5FA 3OSGA 2F4IA 4XICA 4HNTA 4UUTA 2Z1DA 4IRHA 5DYMA 3TQNA 1ZQ3P 1LDKB 1QVTA 1R22A 5DS9A 2R7UA 3ZQIA 3LA7A 2B7EA 4BJTA 3Q9VA 1I5ZA 2PX9A 2E2JJ 3QPHA 3BTJA 2M1BA 1S29A 5DCMA 3WTSC 5LGUA 2ME6A 3QYBA 3UR3C 2LMDA 4BNCA 1UAAA 1R1TA 2IEKA 1WKMA 2FRHA 4RM2A 5BOXA 4ZYEA 3S15J 4OIQF 3HBLA 4Y17A 1E3PA 1JE8A 2LVSA 1SMYF 1P2FA 2E7WA 1FEXA 1UELB 3GX4X 1FWZA 4ASNA 1BC8C 2EZKA 2XSDC 2RREA 4HLYA 4IHYA 3M3YJ 2VPLA 4ETSA 4NHJA 1FYMA 4AVPA 2LOOA 3NARA 2D1VA 4PZJA 3R0AA 1S7AA 2V9KA 4CCJA 2EFNA 5HLGA 5IP6A 4Q4ZF 4JX4A 1IXSB 1HF0A 1A5JA 1BR1A 4XRSA 2FNAA 2BY2A 2GAUA 4L5JA 1K6OA 5CKTA 3KEYA 1TWAJ 1IZ1A 1TL8A 1T6SA 1XMKA 4CZCA 2WY7Q 3IRRA 3JSOA 2E60A 1R71A 3CCYA 1SVOA 4B3XA 1FJLA 2K85A 3HDDA 4C3IJ 3I56I 2JPCA 5DV5A 3SZGA 3I0TA 3QWLA 3GZ5A 1BJZA 1BR2A 4ZDLA 4DGWB 4A0YA 2KKOA 2IJLA 5IYBJ 3C1DA 4M72A 2OA4A 2A6EF 3DPUA 3S17J 5E3OA 1K78B 2WAQA 2W57A 2F48A 3CCLI 4BYYA 2OTLI 4V2FA 5JR3A 5D5UB 3BWGA 1Y8QB 3RKQA 1QRYA 3L1PA 2EV5A 1JT0A 2DN0A 5LEKA 1AKHA 4KNYA 5EF6A 3GZNB 5DUKA 1ZARA 4LMYA 4UY8I 2QM3A 3ASNH 3N97A 1BIBA 4RGUA 2W00A 3FF5A 2VE8A 5DCMB 4BBRJ 5HS8A 5DM7F 3JRDA 1X3ZB 1XDSA 2NVXJ 1U5TA 1X1BA 2JUGA 1ORKA 4G6QA 4YELA 3QAHA 1WFXA 3V7CA 2R7SA 5ERIA 3BR5A 1G8XA 4RB2C 4LK0F 1QVUA 4P9UA 2EPFA 3T8RA 2D45A 1UFMA 2P8TA 3K1PA 1TTYA 2FEZA 2L7KA 4HAMA 4Q5SF 2L9SA 3BQZA 2DA1A 2X6XA 2ZBKA 2O61A 1XSVA 4UUVA 3ELKA 3BT9A 4BQNA 4P5OA 4PCQA 2JMWA 4IRGA 4M3EA 4BJ5C 2HOEA 3FXJA 4MQ9F 3CCUI 3K70D 2L9NA 4EM2A 3S2DJ 4PJLA 1JKRC 2WAEA 2BBYA 2VJ5A 3FBIB 1X4PA 3O8GA 2F5CA 2O6GE 3NWTA 5JI6A 4BDZA 1R5HA 2RVCA 4B48A 5HODA 3S16J 3BOQA 3BPXA 1XX5A 2Q2EA 3F0CA 1OCTC 3IUOA 3GXOA 3VOEA 2JJ7A 5LRRA 4DZPA 1HW5A 3PL8A 4F52A 3F8CA 1IC8A 2KRCA 2KPMA 5TISC 3CP8A 3BDDA 3TGNA 5K5QA 4NC6A 2EJRA 2HDCA 1APLC 3F6OA 1AKHB 3G1MA 3CP2A 3OSFA 1RIOH 2YX4A 4EM0B 4DBRA 4QWQA 3A03A 4X1EA 3A01A 3H35A 2JA6J 1U5TB 4LIUA 2QQ9A 1FP2A 5HDKA 2I10A 3CCVI 3MN2A 1S3JA 1XTAA 5JVTA 3W6KB 2ID3A 3OS0A 3CQZJ 4M6VA 2VT2A 3B02A 2Y0SN 3ECOA 2IA0A 3GFLA 2CQXA 4A69C 1JHFA 1S9HA 1W5SA 5E1XA 1GDTA 4KMFA 3M8FA 1BI2A 5L3CA 1YLFA 2IRFG 5GPCA 3O6BB 3I55I 3OYIA 3SEZA 4BEHA 3ZQGA 2QYOA 2JN6A 2DMQA 3DWLE 1JKPC 3OL3A 2DTZA 1G59A 1D1AA 4CO8A 2LDUA 1Y1VJ 2JVGA 1R58A 4EJWA 3LSPA 2G7UA 3J7AO 1WZ2A 1T08B 2MLKA 4X0GA 5DM6F 2HQ5A 2M87A 2CFXA 3V7SA 4HA8A 2LLKA 1RUOA 3BTIA 2QENA 1RKTA 2JPBA 1JXSA 1Y6IA 1H8AC 4KISA 1NG7A 2Q2EB 2VB6A 1W36C 3HUGA 5FLXK 3HRSA 2E7XA 2VC0A 3CMYA 3TL4X 3K7AJ 3GW2A 3WG7H 2H1LA 2L7FP 2GOXB 3IAM2 2Y9YA 1I39A 4A3BJ 3KLOA 3EUHC 1TWFJ 3WTXC 3HOVJ 3TMOA 5JHUA 3ISPA 5GADJ 3PJRA 3OYKA 3HOSA 2BZTA 3J81K 1B59A 1S7EA 2E1MB 2EIKH 4MO7A 2XF7A 4G6TB 4Q47A 4H4KC 4XR6A 1GV5A 1YX5A 1F43A 2K02A 3RPUA 4K2EA 1ZR2A 1QNTA 3M07A 2R7DA 2VQCA 5FLMJ 1PYVA 2IA1A 5LRSA 3ULQB 1L0OC 4IZZA 4M3BA 4PK4A 3QYFA 4CUGA 3TEDA 4NQWA 1ZGAA 4U0WA 2R7ZJ 4M73A 4BEHB 4WCGA 2XGXA 3ZQHA 4WK8F 4XRSG 2G0EA 2GXGA 4A6EA 2P5KA 4F91B 1Z3XA 3OYNA 1FPQA 1FBUA 2FQ3A 4E7JA 1J9IA 5FD6A 3TO7A 1P4XA 5CVRA 3RPUD 3ZGKA 1Y39A 1USTA 4AYBN 2ZFUA 3BY6A 3JAMZ 2N8GA 2NS8A 3VSKA 2GXAA 1IXCA 3W2VA 4E6KG 2OTJI 1ETWA 2VKEA 2FBKA 4BDYA 1KA8A 3E1SA 4UB8C 2EINH 3BJAA 4XLPF 3CDHA 3CCJI 1ZR4A 3S1QJ 2JK3A 3KZIC 5J4VA 2XPVA 1IF1A 2JRMA 2PMUA 3ECHA 2KJCA 3AG4H 3HUGB 4GFBA 2M8EA 3GUDA 3S3OA 2K9QA 2K9MA 2OAZA 2ZXHA 3B73A 3KETA 3G1LA 3RQ4A 5TRDA 1IN4A 5D4RA 1J0RA 1K7AA 1HQCA 2PJPA 2CQ7A 4OAZA 3CO7C 1A31A 2GIZA 3K4MA 3M8EA 4ITVA 1WWXA 4C2UA 3HOWJ 4L5EA 5IP9J 2UUZA 1SC7A 3SDBA 4LFUA 1T33A 4L9JA 2R93J 3CDLA 1ETQA 2AQEA 3RJPA 2MABA 3ONQA 3K4NA 4ZTJA 4OINF 4YFKF 3FHZA 3A0BC 5D5WB 1FYLA 2K40A 3CMMA 1D0YA 3HZJA 2LNBA 4NUBA 1YI2I 1FOXA 2RQQA 1LEBA 1IW7F 1R36A 3E3VA 2LFBA 1S6LA 4GCVA 4NDLA 4IHTA 3IHUA 3FXKA 4NQWB 4Y15A 2Q8KA 5D5XB 4ZJZA 1HOMA 3ABKH 2X1DA 1GLNA 2MD0A 3G3ZA 2DA6A 1VQNI 4I2OA 3ZCOA 4H0EA 4DYCA 2E35A 2CW0F 3BJ6A 3FBNB 3IKVA 1TNTA 5B1BH 4O3MA 3KP6A 2W7NA 3J7YJ 2EA4A 3E5UA 5LGNA 3ZRGA 3KX2A 1XGNA 1QQIA 3FXLA 2LYCA 2Q0OA 4WXHA 4OAYA 3ZMSA 3BTLA 4IJAA 5F1RA 1VTNC 9ANTA 3EUHA 5HS7A 3RKYA 3OYLA 2LY9A 5FKOA 2HR3A 2DFHA 1ODDA 3S1RJ 4PJ0C 4G7OF 3OL4A 3GTKJ 2B0LA 5J8CA 2A05A 4M3FA 2BOLA 2AQFA 2O0YA 3BQYA 2V7FA 1B6AA 4EJOA 1W36D 2M2EA 3S2WA 2CUJA 5A2QZ 1KGSA 3BR0A 4YG2F 2LBFA 1LE8A 3GLXA 4S0HB 4KUMA 1I1GA 2EV0A 4I76A 1ZLKA 1A35A 2VLAA 3JRFA 4GDFA 1B9MA 3P7NA 4ESJA 3VYRB 4XRMA 5EYRA 1D5YA 4BY1J 2VJJA 4ZZDA 1IV8A 2LSOA 4PJNA 2PN6A 3FM3A 3LMMA 4A0ZA 2L9RA 4CH7A 2DFFA 4CCKA 3J7AY 5E3NA 1DGWY 2CQNA 3V4GA 2HOTA 1I1SA 2TDXA 4RB3C 1OQYA 2K7LA 3WGIA 3L00A 1F36A 2KRFA 3F72A 4NBQA 4CCNA 3H0GJ 3OYJA 3IL2A 4PSXA 2H6CA 1E3HA 2L3DA 2P5VA 3HRMA 3I54A 3GTLJ 2ZKZA 2LF8A 2V1UA 3BZKA 4BHCA 3JTHA 4FE7A 3LAJA 4ZYDA 2CSOA 3S93A 4XORA 1X2MA 2DOEA 4HZFA 2JUCA 5HLTA 3ZMVA 4MTDA 1LFPA 1X1AA 4LB5A 2DA3A 1P92A 3FHNA 4A6DA 1ZELA 2HI3A 3LSHA 3ZP5A 4YIFA 4I02A 4XBFA 1EH7A 3OR1C 3LA2A 2DTRA 1AU7A 1YW9A 1EH8A 2GOMA 2XPWA 4OWRB 5IT9K 4RGXA 2P4WA 2KHMA 3H5RA 4L9VA 1J75A 2J5OA 4M9SA 4HF1A 2D1HA 3S3NA 3KYLA 1QHHD 2DW4A 5EEGA 5H20A 3RZDJ 1W1WE 1LDDA 3GEZA 3LSIA 1O4XA 2LBFB 2EH3A 4II3A 1LE8B 5FKKA 3JRBA 4D9JA 1NTCA 2CQKA 1ZG1A 5D6EA 2WV0A 3DTKA 4M74A 5LHHA 4IF4A 1WI3A 2Z16A 5B3SH 3HHGA 1XPXA 4O5VA 1HSTA 3LQRA 4UV8A 4X6AJ 1MMGA 1G3SA 3LSMA 3PUBA 3CC2I 5HS9A 4M6YA 2H1KA 5C4XJ 4A3MJ 3RKXA 4IL6C 1H9TA 4AM3A 1FYKA 2WC2A 4CDGA 4PUSA 3JRAA 4AIKA 4DJAA 5FROA 3ZMZA 2DAOA 4LOCA 5AONA 5LD2C 4BE2A 3MVPA 1HKSA 3QQAA 2MFZA 3WTZA 5BNGA 2F5VA 2M3AA 4EQQA 4LK1F 5C44J 3VEPA 1O7FA 1H9GA 4UHTA 4E7LA 1X1DA 4HRIA 1PJRA 1F4KA 2X4HA 4FCYA 3HKZN 4E7KA 3CLOA 3QYEA 2HOSA 3G71I 4D0PA 1BIAA 2QVOA 2YU3A 1RUNA 2VE9A 1IRXA 5FKMA 1R1VA 2KL4A 1VNDA 1EKEA 3WTTC 2FOKA 3QPSA 3FM5A 3M4OJ 3C2BA 3WHCA 1OISA 2KRHA 1IN8A 4RLQA 5BQTA 2IAIA 4FASD 2OF7A 4B4CA 5ICFA 5FB2A 2LK2A 2H09A 4MNUA 4BXXJ 3BCBA 1WRJA 2RC4A 1U9NA 3HM5A 3AL0C 2YSRA 3H9GA 2EK5A 5CQGA 2BW3B 3D1NI 4YIRX 1IRZA 4YEJA 2XF5A 1X2NA 3CCSI 3BCAA 4A3IJ 1FOKA 1RZ4A 2DLLA 3DPLC 3PNVA 3BR2A 4OMZA 3C18A 5E1WA 3S1MJ 2VC1A 5IY5H 3GMEA 3KP7A 4HF2A 4XONA 5ILSA 1R4NB 2QGUA 1KU3A 1GT0C 4I6ZA 5KCMA 3N4MA 3IC7A 4DYRA 2CUFA 2YS9A 3MKYB 1JT6A 2FXAA 2QQBA 2HVRA 2XV4S 4CICA 3IRQA 4XLFA 5ICGA 4UUSA 2M45A 1Z05A 1IN6A 2EB7A 2E1OA 4XLHA 5F0HA 5CPRB 3I53A 4NC8A 5K5RA 1P7IA 3LSKA 2ECCA 2Y31A 2M0CA 3ZQ7A 2HXIA 3W3CA 2LR8A 4AVZA 1SFUA 1LB2A 5EDNA 2HQAA 4GO1A 1D8JA 2ZC2A 1MBEA 2XHKA 2QEXI 2DYSH 4HDUA 3EYIA 2M9HA 2GLOA 3TW6A 3V8JA 1ZGWA 4QIWN 4D7MA 2NVTJ 3PFIA 1XGSA 4HBLA 1LNWA 3DPTA 3R60A 3QU6A 1HC8A 4ZYGA 1P4AA 3HOZJ 5HLIA 3GLLA 5ICEA 3FKIJ 3WTVC 2V6EA 3CMEI 4LLGF 3L2UA 4JYKA 2ZCWA 1WJCA 2L0KA 3CF5F 1VQOI 3VYUB 2ELHA 3VDXA 1RPWA 3SYTA 3TOAA 1XGOA 2HZTA 4IPAA 3M1EA 4A3CJ 3OYBA 3FDYA 2E1MC 1FIAA 3D5LA 3GFJA 4BBSJ 2E2HJ 5KAIC 4HF0A 5M5XJ 2QSFX 2IPQX 3EETA 2XB0X 4YRVA 3TP0A 3DV8A 2VKDA 1UJ8A 1C0WA 3ZN0A 1JHHA 2STTA 2HKXA 3DKWA 1W0UA 3A2KA 1F5TA 4A3GJ 1SD4A 1T56A 2DQLA 2FBIA 3OY9A 2UWMA 1ETOA 4D5FA 3JR9A 1HDPA 4EGYA 1ZKGA 1XCVA 4UUSB 1OYIA 2XRNA 3COAC 4E7ZA 1ZG3A 3L7WA 4F55A 5H2FC 3FMQA 2WAFA 2DA2A 4QSHA 4PDKA 2XAFA 1O57A 2FX0A 4RGRA 3BP8A 1ONVA 3HTUA 2XRLA 4LD5A 3PNTA 5AIPA 4PJMA 2O3FA 3D0SA 3UNGC 1Z91A 4ON0A 3CMAI 2E71A 4RAZA 2DJIA 3PSFA 2HWVA 1TWGJ 5E8GA 2GQQA 3AG3H 1KYWA 2A5YB 4RB1A 1U8RA 1OCPA 4G6DA 1IDZA 2ZB9A 2KMUA 4A5MA 3V7RA 3OIPA 1X4OA 4OIOF 1QZYA 1MBFA 5D8KB 1SD5A 4XMYA 5L3DA 4IO9F 2DPDA 2IW5A 2QQAA 1YOVB 2V26A 1QU3A 4XKBA 1TT0A 1BR4A 1GV2A 2WY8Q 4BXUA 4A3KJ 4E7SA 1OKRA 4ABZA 5D6FA 3V42A 5LFAA 2R0QC 2CV1A 2NVUB 3K9TA 3I71A 2Y2ZA 2L4AA 1YX3A 2K5CA 3GTMJ 1ZAOA 3OIQA 2F6CA 5H6RA 5F1JA 2COMA 3EUAA 4HV5A 2IS1A 3RYRA 3HOYJ 3ZMDA 1LVAA 1X19A 2P0WA 2JRTA 5K5OA 1WJ5A 1Z3YA 4N9HA 3F8MA 2F4MB 1UMQA 3U1KA 1NG6A 1R4MB 1VF9A 4PGHA 3E6DA 2W25A 4R79A 3SQNA 3E7LA 2M0MA 3T0YA 1Y0NA 2E34A 4HOBA 2DFIA 1ETYA 1YG2A 2X6YA 3TDZC 1IJWC 3RTRA 3GZ6A 2V1DA 3JRGA 3MMYB 4XK4A 4L9NA 3HHHA 1DGRM 1T95A 2P7VB 1U0JA 5JFRA 3U21A 3HPHA 1UG2A 2J5PA 1FOWA 1TW3A 4B3AA 4QPQA 3AL0B 4MGRA 1FMVA 2ZMEB 5F08A 2K9SA 2ESNA 1JJ8C 2WV1A 2XIGA 2YX7A 2XAHA 5TJJA 3WHBA 2AHQA 4XSZF 4EJUA 3PQJA 2X85A 4BQAA 4Y52J 4OIRF 2K4JA 3LNQA 3E6BA 4GYGA 4AYBA 1LKXA 2R7TA 1J59A 1FX7A 2RN7A 3HSEA 5HNFA 2PMZN 3TBIA 3L09A 1YS7A 1TWCJ 2PEXA 3NAUA 3SFZA 1ZG5A 3BG9A 1NH3A 2L7MP 1YJ9I 3N05A 4BAYA 3AG2H 2I5UA 3JTGA 3DBRB 1Q1HA 3F8BA 2JA5J 4RAGA 5M3MJ 1D0ZA 1WPKA 2BE5F 4QPOA 4L18B 1K4TA 2LH9A 2WAQN 4RGSA 1MGTA 1FLIA 2EFQA 2XASA 3SFIA 2EFWA 1WHUA 2BVLA 1IUYA 4HEA2 3FK6A 3AKZA 2DI3A 2A61A 3E5XA 4HW0A 3H92A 2MH2A 3K4JA 4UB6C 1JTXA 1D0XA 2BXZA 1HBXG 5IOYA 4KT5C 1MMAA 4D7NA 1YRNA 4U88A 2EIJH 2P6SA 3RYPA 3HB9A 1TW2A 1Z6RA 5J40A 3E6MA 3MFKA 2OPTA 2K3FA 3FK7A 2DMNA 2FBHA 1VQ7I 2XROA 2F5DA 2LTPA 3H5AA 1ZK8A 2HVSA 5M5WJ 2NOGA 3G1OA 1ON1A 3LFKA 4V2GA 3DKYA 2A68F 1PUEE 2OJED 3NRVA 4DIQA 2K3PA 2CJJA 4ZZLA 4AIJA 2VT3A 3ZN1A 3CCMI 2GBYA 3KEOA 2LKXA 2H8RA 3JW4A 4BUPA 1ZYRF 2XGCA 5L3EA 5LGTA 1R49A 2YU9J 3BR6A 3T8TA 2DK5A 3GF2A 3FXUA 1VQMI 4RA2A 2VXZA 4IHVA 2BY1A 4AU7A 5GAGJ 1U78A 3WGHA 2EWNA 3GYHX 1MNDA 1XGMA 5DD8A 2NAZA 4G9YA 4ZDPA 5DCFA 4RBOA 2K9LA 1USSA 1X1PA 4WWCA 4BXFA 2VPRA 4C30A 1GXPA 4BKXA 2HKOA 3CTAA 2RNGA 2ID6A 2DYRH 2W84A 4D1QA 1KYZA 3IH4A 3VSLA 3Q0VA 3SEQA 3CCEI 2VASA 3ZQCA 2L01A 2VXDA 1OPCA 2L7ZA 1YRNB 2XGEA 2R7VA 4KT6A 1MBGA 1FTZA 1MDMA 5FLVA 2HYJA 1OR7C 2DT5A 3ROUA 2KIQA 3CJQB 4WXDA 1DDNA 1F1ZA 1OFCX 3FISA 3OYHA 1R6RA 3F3XA 2Z2SB 3F21A 3KZYA 1HW1A 1IG7A 2XAQA 2OU2A 2ECBA 4BE1A 2CU7A 3Q0WA 5FD5A 3HGGA 1WQ2A 4LJZF 2VJIA 3HRUA 3DFGA 3E0JB 2AS5F 2NS0A 3GBGA 3O3KA 3F22A 2XUBA 2EZHA 3KZZA 4LG3A 1REPC 3CJRB 4G7HF 2Z5UA 3H0DA 1WJDA 2R5YA 4LGWA 4HNUA 1H89C 3PM1A 2DMTA 2DMUA 4OOIA 1MJBA 2RKHA 1O3TA 4L0ZB 2B9SA 2KJBA 2CYYA 1TNSA 3ZQLA 1BOAA 2XB5A 1LPQA 1B72A 3MQ0A 2JA7J 1MBHA 1N75A 4A12A 1FMWA 3RQIA 2K27A 3MWMA 2B63J 3PIPF 1ZN2A 1YHQI 2HNHA 3BG7A 2K86A 3SZPA 5E8IA 3BC8A 1ZRFA 2QBYA 2HU9A 3DQVC 4MEXF 2R7OA 2DK8A 2FF4A 2W4SA 3IH2A 1TP4A 2DOFA 2IGMA 3FXRA 1OYYA 3BZ6A 1T0FC 4XN0A 1G2HA 2L9VA 4ENNA 4UVAA 1AA7A 2W24A 3K1MA 5GTIC 1XMAA 1X58A 1SFKA 2XKPA 3DBLB 3IWFA 3K2AA 5EGOA 1AWCA 1ITYA 1SMTA 4CSWA 3Q3SA 1YW7A 1MDMB 3RPQA 3VODA 5CJ9A 4AIHA 2AXTC 1Z0XA 2ZNZA 4MQVA 1KU2A 4XOPA 2DA7A 2L54A 3QPLA 1X3UA 2ESHA 2M5WA 1WH5A 1UCRA 2IVMA 3BG6A 3K69A 1ZREA 1HA8A 4WF2A 5J1UA 3FXOA 1O7LA 2ETHA 2V4JC 5CVIA 3P9IA 4KIBA 2CO5A 3JAMK 1O3SA 2YPRA 4I99C 3T1BA 2E1NA 2FU4A 3GVAA 3HKZA 4S05A 5C4JJ 3OYGA 3ASOH 2VBXA 3PNYA 4KJZA 4AUXA 4R8HA 3L2VA 2P6TA 4C3HJ 2R5YB 4AC0A 3H5NA 1TLHB 3V8LA 3IWZA 5D4SA 1SANA 3DTIA 4Y7NJ 1DUXC 3A0HC 1BJAA 3I9V2 5CYVA 3L2WA 1OCRH 4LLNA 1IRFA 1ZGJA 2O9LA 1IO2A 4LG0A 2DU9A 3HG9A 3G73A 1B72B 1EH6A 4RDUA 1SAXA 2DBBA 2JSCA 4BJ6C 2KIFA 4L9TA 3REOA 1I6XA 2VBWA 5F27A 4JX6A 2EQRA 3U2RA 1VQPI 1QPIA 1YO5C 2QBYB 4P55A 1TC3C 5FFXA 3K4CA 1OR7A 3VYTB 1FTTA 4L5IA 4MLOA 2BVMA 3O8HA 2NNYA 3DKXA 3RSNA 1CF7A 1PDNC 2E2IJ 4E4HA 3ESWB 1T39A 1R23A 1JUSA 3GTQJ 1Y0UA 1ZRCA 4R1HA 4M71A 2HFHA 1R00A 5EGOB 2X1CA 2ICWG 4FX4A 5E3LA 6PAXA 4FISA 4Y33A 1T2KA 1ZH5A 1Y1WJ 4B09A 2PI0A 1FSHA 4KA4A 4JX5A 1YJNI 2MC4A 4CCLA 1V5GA 1Z7LA 1ETVA 2XAJA 2Z33A 4HG2A 5J1RA 3WE3A 2R7FA 4BQQA 1XMXA 1XS9A 2H8WA 3RCOA 1VQ9I 3J80Z 2VBYA 3RIRA 5K7HA 3CJTB 2BW3A 4HYEA 4B43A 4F92B 3ERMA 2ELJA 5GTHC 1V5EA 2R3SA 4N4OB 1I6HJ 4IHXA 5GPAA 4JQFA 1S7OA 3RZOJ 2ZSHB 2DA5A 3LAPA 3HGYA 3OYEA 3H3VK 1FT9A 5HVQC 3HYIA 3A4CA 1G3TA 2CS3A 2KP6A 2TCTA 4EV0A 1SFOJ 3R61A 4AWXB 1WCMJ 2RGVA 5LHGA 2ZJPF 3K6GA 1MMDA 2CG4A 3FMSA 2VIXA 4HQEA 3CC7I 4LG0B 2X9DA 4W1UA 5JLXA 1HDDC 2JA8J 2OV7A 2NNNA 4FTHA 1QBJA 1RKWA 3F9KA 4XSXF 4N4NB 3CCQI 3W6VA 1K83J 5J6XA 5A2QK 1E17A 1T0FA 2HPIA 1V54H 3L2QA 3ZMUA 3JCUC 1U6GA 2OD5A 1FY7A 1OCOH 1W0TA 1PP7U 2GXBA 2COBA 4MHGA 4HX8A 1H0MA 1T38A 3F8NA 4M9ZA 2PLYA 4U0VA 1CF7B 1MZBA 1LQ1A 3F8FA 3HSRA 3OV8A 4IQ4A 2DFEA 4RLFA 1TWHJ 3D5SC 2VOPA 3BJOA 1Z1DA 1IUFA 4IHWA 3OYDA 5CVUA 3I4MJ 3ERED 5F0CA 2LKSA 2PQ8A 2VBZA 4RM3A 2CUEA 3EYYA 2V9PA 3BR3A 1LFUP 1LJ9A 2A6TA 2QLZA 3KP3A 5K1YA 1CGPA 1UB9A 2AXLA 2ZMEC 3G2BA 5ILUA 1MSFC 1RRJA 4CGZA 2D5VA 3J7ZI 1G6NA 2XSJC 1YIOA 1ON2A 4ESFA 2MG4A 2PBIA 5DEQA 4E7IA 1OCZH 2VJ4A 1ULYA 3DXJF 1D5VA 5LLQA 4E70A 1QZZA 2XF6A 5GP9A 1WSUA 3CUQC 1BM9A 2KIMA 3F6VA 5DUIA 2IBDA 3OS2A 2H6BA 3I3LA 3C2HA 2VONA 3BTCA 3KYDB 5HNHA 4BE0A 2ISYA 4KFCA 4OMYA 1UZCA 3HC7A 1JUPA 1VQ4I 2MYSA 1Z67A 1PUFA 4KYWA 2ZJRF 4BU2A 1GVJA 2W1OA 3CJNA 4XIDA 3KEQA 3BG5A 2VODA 1JI8A 3KCCA 1YS6A 4HPQA 1V3FA 5ICCA 5FRNA 1O3RA 1BC7C 3QODA 2UXXA 1R7JA 4A3EJ 5KK1A 3WU2C 1NK3P 2FJ1A 2CGPA 4IEJA 3WGGA 2ZJ2A 3VYSB 4N9IA 4DBQA 2CWEA 5F0FA 1XCBA 1STZA 4CYCA 3ABUA 4DYQA 3MZHA 5K7ZA 1WVRA 2ISZA 1W5TA 2LKPA 3H1CA 5GAHJ 2KT0A 1Y56A 5DDGA 2FMYA 3U1DA 2F4OB 2HVQA 5HLHA 2R7RA 2DDBA 2XVCA 4PFOA 4N0BA 3LSRA 1GHCA 1A6QA 4ZH4F 1E3OC 2H94A 2ZSIB 2ZXWH 1Z7UA 2XKOA 4FQGA 5D8LB 4C3JJ 2PG4A 3OIOA 3MCZA 4I0BA 1TT5B 3P9CA 5M3FJ 2FQ4A 4B44A 2OQRA 2W82A 3I5UA 3A02A 3K4KA 3JREA 3WU0A 2W85A 2VQHA 4BL0B 4OU0A 2K9NA 5HOOA 4MTEA 1GUUA 3CUOA 1HCRA 4G8XA 2IXSA 2XPUA 1ZRDA 2NS7A 2RDPA 4XKVA 1GXQA 2DJNA 4ENMA 4J00A 1T98A 1BBYA 1KQ9A 4M6XA 3VFZA 2KDZA 1VQ8I 4NNJA 2E19A 3ZOBA 4IKFA 4JK1X 2RV8A 1YIJI 1IGNA 1HSJA 1WJBA 2W48A 4I7HA 1OYWA 2E1CA 4B47A 3KP4A 2LY1A 2ZNYA 1PUFB 3NWSA 2LY2A 4C2MJ 4U0YA 1SD6A 2MW8A 4CYDA 2OCCH 1VQ6I 4B8XA 3DEWA 3S8PA 1D8KA 2RAEA 4BGDA 1JJ6C 3WTYC 2A07F 2Y0SA 2WB1N 4DW6A 2A5WA 3CD6I 2EFPA 1V5FA 2PMZA 4I0AA 5JHFA 3PQKA 1MIJA 1VQ5I 2A6HF 4KN4X 2L02A 3WODF 4XLCA 3L2CA 4CYCB 1MBKA 3HJEA 2V9VA 3OYFA 4BACA 3K2ZA 3LWFA 3AAFA 1I27A 2WWYA 2ZMEA 4Q48A 2X48A 3H36A 4AD9A 4DZJA 3QU3A 4E7HA 4P96A 3QRFF 5F64A 3KP2A 1PVEA 1VZ0A 5E3MA 1AOYA 2LD5A 2L5QA 2MD5A 2EZLA 5FKLA 1RR8C 5K7FA 2QQ8A 4A3JJ 5EZHA 3CUQA 1POGA 3D5RC 2YR2A 3HTSB 3R4KA 5JVGF 1N78A 1MW7A 2MA3A 3EUKL 4A2UA 3JSPA 3KFWX 1DQUA 3GTPJ 3GTGJ 3KP5A 4BHBA 2ELKA 1W4MA 4NB5A 2NVQJ 3C2GA 3QOPA 2O8KA 4S04A 3B6AA 3TP3A 1FOYA 3OYAA 2FSWA 4A3LJ 5KHDA 2GA2A 4FX0A 1WJAA 4IXAA 4XLAA 1MD0A 1B9NA 3EPZA 2LREA 3DBHB 5HDGA 3BR1A 3MAJA 2KDOA 1IN5A 1S8NA 4XNFA 4WX9A 5FLXZ 4CZZA 4TV7A 4Z2YA 4IVNA 2Y9ZA 4HSTA 2HYGD 5F04A 4Y13A 2GA1A 2QUFA 3PFYA 3U9GA 3MKZA 4IRIA 4PGGA 1XD7A 1E2XA 3K4BA 2PMHA 1RI7A 4M3GA 3O2PE 5EJCA 4BHPA 2DO7A 3HOUJ 2G7HA 2MBFA 3J81Z 3M7GA 4DQ2A 4U87A 2HTJA 3OR2C 3FX3A 2CRGA 1IV6A 2IT0A 1HKTA 1KQ0A 3BG3A 3H9QA 3JRCA 1JGGA 1Z6TA 1P4WA 2DODA 2DOAA 2EZIA 2XAUA 3BPVA 2EIMH 3I59A 1XC5A 3LSGA 4DNCA 4EEFG 1PP8F 1DP3A 2M34A 4F93B 1QZEA 1QO0D 2EFOA 2RQPA 3R6SA 1DPUA 1T8IA 3DLAA 1W7PA 2DQRA 2DCEA 5FFZA 4A3DJ 1S72I 1LFBA 2OZUA 2MSYA 2OC6A 1IAWA 3LSJA 3S3MA 2L2OA 1A36A 1ACIA 3F23A 1A04A 3CUQB 2Q1ZB 1OJLA 4LIVA 1J2XA 2E5NA 1FNNA 3CDIA 1K6YA 1TZLA 2QF7A 4EJVA 5D5VB 3E5QA 1FIPA 3HXLA 2TRTA 4ANJA 3IP4B 3I4NJ 2QSGX 2Y75A 2MLGA 1K61A 2BEOA 3CLQA 2KFDA 1MSEC 2NVYJ 3MD2A 3UKGA 1BN5A 2MH9A 5EG0A 1W7PD 3X2QH 3WG9A 1NK2P 2C6YA 3CC4I 1U3EM 1V55H 3LA3A 4V19K 3LOCA 3AG1H 3NQOA 1BL0A 2FNPA 4I98B 2PFBA 2QWWA 5KAFC 1KQ8A 4HX7A 2STWA 1TBXA 1R9TJ 4KITB 5JLWA 1MJ9A 1OLTA 1ENHA 4PSWA 1R1UA 3FIWA 4II2A 4UNOA 1J09A 1MMNA 1BI0A 5FJ8J 2VI6A 5BS6A 2QSHX 1W5CC 1MKMA 2JA2A 1SVLA 3CF2A 3K0LA 3NEUA 4FETA 5M5YJ 4KICA 3DCFA 2I8DA 2V79A 3LSTA 3H3UA 2V1XA 4AIDA 1BA5A 3I59B 1Z77A 1UHWA 4HNVA 1V4RA 1JTYA 3FXQA 2UXNA 1KZHA 2HQRA 3EQLF 4NC7A 3G4SI 5CVJA 4D5CA 3DP7A 1W7PB 2FA5A 2M4GA 1VFCA 1DU6A 3IAS2 2FD5A 2P81A 2VKHA 3KYCB 1UHMA 3LFUA 3ZXSA 2Y48A 5E17F 4YIIA 2DMPA 4PFPA 1CQTA 4O6JA 3WTUC 1EV7A 1MH4A 2GWRA 5FRMA 3C3WA 3TW7A 1S5LC 4XOTA 3A01B 1MJAA 3G6EI 2IS4A 3CO6C 1SVMA 4HLXA 3QPTA 4GXOA 2RNJA 1B4AA 2FUG2 1KONA 3SJMA 3KE2A 1SAUA 2KZVA 3ZQQA 4CCMA 4Z6YA 1GVDA 3FWEA 3M8JA 2LC2A 1VQKI 1EF4A 2R4GA 1U9OA 5EG0B 4ZYHA 3PSIA 1NHAA 5J3LA 5IOZA 3P5JA 2HYFA 3HOXJ 2VL8A 4ZDOA 2CV2A 4IQJA 1FBSA 3DU6A 3Q9SA 2Y69H 2UZKA 4FT8A 3KPHA 4CCOA 1K4SA 3MZYA 1RETA 3HPGA 4EGZA 3PO3J 4JBAA 3R0JA 2XGDA 2GIVA 5AIQA 2IS2A 2V1NA 2CFOA 4IOCF 4A3FJ 1L3LA 4EATA 1X1CA 3Q0UA 1TQPA 3ABLH 1SD7A 4I09A 2FMLA 2XAGA 1JGSA 2KQRA 3W2WA 3MKLA 1YITI 1XSXA 4A93J 1U2WA 1FBQA 3LQQA 1FP1D 1XSDA 1BI3A 1OMIA 2IGNA 2HDDA 1SFEA 2X0LA 3DTEA 1JKQC 2H27A 3OYCA 3LL7A 3VB2A 4WXCA 1R5GA 3L9FA 4HDVA 3M1CA 4XKCA 5E79C 3OYMA 1R5ID 3GWZA 4GRIA 1B8IA 1X3WB 1BW6A 1P9QC 1VI0A 3GFIA 3TOBA 2CW8A 2CQQA 2JVHA 3ZPLA 3FMRA 2ME0A 3E97A 3RI4A 2NYXA 5B1AH 5LHIA 2VN2A 1MBJA 2KZGA 5EEHA 1RR7A 1N25A 3SHFA 3TKYA 2VKVA 2OZ6A 4XL9A 2D2WA 2LG4A 2Z9OA 3HOTA 3BROA 4ENKA 3QP6A 4EVIA 4XRFA 1YE9A 4BH9A 3CESA 3BLYA 3KIOA 3L2RA 3H3ZA 2X6OA 1P7JA 1XDUA 2F5FA 4P9FA 3IH3A 3ZQFA 3S1NJ 4EM1A 3DEUA 2IS6A 2OQGA 4MFEA 4M9XA 3MZ8A 3I64A 1IN7A 3OWTA 3RDIA 1HXDA 3K1NA 4HQMA 2GZWA 2MC3A 5IT9Z 5IYDJ 2CMPA 1TQMA 5CLSA 3ZR8X 2QA4I 4GYIA 3GFMA 5GAEJ 2DXIA 1MH3A 3OOPA 3HSFA 4U7DA 2ACJA 2F5EA 4FHTA 4KIGA 3TDUC 4F7ZA 2ZO4A 2Z99A 2BV6A 4BS9A 2Z3YA 1F9NA 3SXYA 3QOEA 5L3FA 3W2AA 3ML6A 2XDVA 5C3EJ 2IA2A 5J47A 1I50J 5EZGA 3EDPA 4KMUX 4Y3OA 2JQ7A 1M1EB 5HDNA 3HRTA 3HEFA 3S14J 1IXRC 1Z21A 2O5RA 2BHZA 2G9WA 2M30A 3E6CC 2DT6A 4PJJA 3GCMA 4G7ZF 2JWTA 4W97A 3C7JA 4HSRA 2JSPA 3VPRA 4YFXF 1YJWI 4LITA 1B8IB 4EJTA 1WI9A 5F6FA 1D1CA 2K4BA 4G94A 2EBIA 2VUMJ 3DF8A 1KU7A 2F2EA 1MNMC 3DU5A 1J5YA 4HX4A 2EV6A 1Q1VA 1UHSA 4RS8A 2M8GX 4LB6B 4UV9A 1MNEA 2R92J 4JOMA 2EILH 4IHSA 2JZYA 4OIPF 2R5ZA 1SEUA 1FC3A 4I01A 2V6CA 3WTWC 1YW8A 5E20A 1UG0A 2KISA 5TGTA 3H9JA 3IV5A 3T5XA 3WU1B 3I58A 5L3BA 1DPRA 2VOOA 5H6QA 2BXYA 1WH7A 4F3QA 2M4KA 2ZXJA 2JTVA 4FE4A 2P7CB 1BW5A 1WJEA 2A3SA 3KLNA 4L0YB 4C9YA 5ED4A 3HIFA 5BPIA 1N77A 2X1EA 2QZ8A 3M9AA 4DOZA 5LEJA 3BZCA 3MKWB 2NXNB 5KNLA 1JUMA 2CW7A 4XKWA 2Y30A 1KU9A 1LEAA 2ADUA 2E5ZA 2X6WA 2BY0A 3I4PA 1ETXA 5IP7J 2HQNA 1JKOC 3FKJA 2BGCA 1J7KA 3ZMTA 4GGGA 1VQLI 1WGXA 3JRIA 2M7BA 2CV0A 3FXMA 2ZFWA 2OCEA 1YQAA 2O8XA 2DA4A 3MEXA 1Y8RB 2HDWA 5IT3A 3HL2A 5EEAA 3W6JB 1ERDA 1G4DA 2M7AA 3ABTA 5ILVA 1I3QJ 2XC7A 3DLLF 4XQFA 5B5EC 1HLVA 5DD4A 4J19A 4UVBA 2DDAA 2HTSA 3SDGA 1ETKA 5FO5A 3S32A 2QKLB 1G3YA 1EJ9A 4J01A 2HZDA 2WA0A 4IOAF 4HV6A 1D3YA 1U8BA 3SZTA 1YTYA 4EMSA 5KVRA 2AO9A 5J4YA 3WE2A 1A6IA 2ZXIA 1DP7P 5J1YA 3CCRI 2R5ZB 1ZHFA 2A69F 3AFHA 4A0XA 2YUSA 4KDPA 3A1YA 4JP0A 1D1BA 2FOWA 4CA0A 1XN7A 3P9KA 3V8KA 4BY7J
chains in the Genus database with same CATH topology
4NQWB 4ZYAA 1E0EA 2LY1A 3NWSA 2LY2A 4ZJZA 4XN3A 2BVLA 2X1DA 1GLNA 2MD0A 2NOJB 4HEA2 3AKZA 3S8PA 2WADA 2PJRA 4BQOA 4BGDA 3ZCOA 2Y0SA 3K4JA 1D0XA 2A5WA 2R7WA 1BOBA 3FBNB 1V5FA 2PMZA 5JHFA 4P1WA 1MMAA 2LRDA 2W7NA 2IGOA 4XLCA 3ZRGA 3KX2A 2LYCA 4OAYA 3OYFA 4BACA 3CZ6A 4Y4RA 4ZC3A 3OYLA 4C2TA 2R7XA 4E7HA 3H5AA 2HVSA 3OL4A 2WBMA 2VQGA 1VZ0A 4ZTFA 5CQEA 2BOLA 2L5QA 2CH0A 3DKYA 2AQFA 4RMNA 3K4LA 2DT7B 2CUZA 2V7FA 4IX7A 1WJFA 2WB1A 4DIQA 2KLOA 2K3PA 1W36D 3D5RC 2CUJA 3OS1A 2LBFA 1N78A 1MW7A 3EUKL 1DQUA 2VLAA 4BUPA 2HPMA 4XM3A 3K70C 3VYRB 3C2GA 2X51A 3OYAA 2VJJA 5KHDA 4PJNA 3LMMA 3K10A 1WJAA 2VXZA 3OOUA 4CH7A 4XLAA 4AU7A 3J7AY 3EPZA 4CCKA 2LREA 1DGWY 1LVKA 1MNDA 2KDOA 1EA3A 4XNFA 4ZDPA 2K9LA 2R7QA 4BXFA 4XLEA 4CCNA 3OYJA 4HSTA 4C30A 4PSXA 2VQLA 3PFYA 2RNGA 2PJRB 3MKZA 2IGKA 3DEEA 4D1QA 3VSLA 2UV1A 3K4BA 3SEQA 2VASA 2VXDA 3S93A 2R7VA 1QHGA 4XORA 4KT6A 5HLTA 2QKMB 4U7BA 2OUMA 3OMYA 1OR7C 4U87A 1LFPA 1X1AA 3CJQB 3OR2C 2F4IA 3OYHA 4HNTA 2Z1DA 3FHNA 1R6RA 1ZELA 3LSHA 2Z2SB 1LDKB 3H9QA 3VWBA 2DOAA 2XAUA 3OR1C 4BE1A 3LSGA 2R7UA 1DP3A 4BJTA 2VJIA 4F93B 2GOMA 4OWRB 3E0JB 3DLAA 3GBGA 2KHMA 2DCEA 3H5RA 4LG3A 3QYBA 3UR3C 2OC6A 1UAAA 3CJRB 3S3NA 3KYLA 2L2OA 3S3MA 1QHHD 4RM2A 3H0DA 1WJDA 2Q1ZB 3LSIA 4HNUA 4LIVA 2LBFB 4II3A 2E5NA 1K6YA 4D9JA 1TZLA 1UELB 3DTKA 3HXLA 2RREA 2VPLA 4ANJA 3IP4B 2Z16A 2LOOA 1MMGA 2V9KA 4CCJA 3LSMA 1N75A 3PUBA 1FMWA 3MD2A 1BR1A 5CKTA 3KEYA 2HNHA 3BG7A 4PUSA 4DJAA 5FROA 3BC8A 4CZCA 2WY7Q 4BE2A 5LD2C 2MFZA 2E60A 2F5VA 2HU9A 2M3AA 3DQVC 2R7OA 4B3XA 4KITB 2W4SA 4E7LA 2IGMA 3SZGA 1X1DA 4HRIA 1PJRA 1OLTA 4PSWA 4E7KA 4II2A 1J09A 1MMNA 1T0FC 3QYEA 4XN0A 1AA7A 4ZDLA 1BR2A 4DGWB 1SFKA 1IRXA 2JA2A 3CF2A 3DPUA 4CSWA 2KL4A 4FETA 2WAQA 2KRHA 2I8DA 4RLQA 4XOPA 4FASD 3BG6A 1HA8A 2V4JC 3BCBA 4NC7A 2M4GA 2W00A 3AL0C 3IAS2 2VKHA 3LFUA 3H9GA 3ZXSA 5CQGA 4PFPA 2BW3B 1X1BA 3HKZA 3OYGA 2JUGA 4KJZA 4YEJA 3PNYA 3L2VA 2XF5A 4YELA 1WFXA 3BCAA 2R7SA 5FRMA 1G8XA 4XOTA 3H5NA 2IS4A 3PNVA 3DPLC 3DTIA 2L7KA 2FUG2 2L9SA 3I9V2 3L2WA 1KONA 4XONA 2X6XA 1SAUA 2KZVA 3HG9A 3ZQQA 4CCMA 3M8JA 2LC2A 5KCMA 4BQNA 2R4GA 4P5OA 3MKYB 3PSIA 4ZDOA 2HVRA 4BJ6C 2VL8A 4BJ5C 2CV2A 4IQJA 4XLFA 3DU6A 3K70D 2L9NA 4XLHA 5CPRB 4PJLA 4NC8A 2WAEA 4CCOA 3LSKA 2VJ5A 3FBIB 1X4PA 3K4CA 3VYTB 3HPGA 4MLOA 2BVMA 3W3CA 3NWTA 3DKXA 3RSNA 4BDZA 4E4HA 4AVZA 4B48A 2IS2A 2V1NA 2CFOA 2HQAA 4EATA 1X1CA 2X1CA 3W2WA 3IUOA 2KQRA 4Y33A 3PL8A 4F52A 2MC4A 2KRCA 1V5GA 2KPMA 4CCLA 3CP8A 1Z7LA 3DPTA 4HG2A 2IGNA 4BQQA 3DTEA 3OYCA 3LL7A 3RCOA 2V6EA 2BW3A 3M1CA 4B43A 4F92B 2ELJA 3CP2A 4XKCA 3OYMA 1WJCA 3L2UA 1V5EA 4GRIA 4N4OB 4DBRA 4JQFA 3VYUB 1P9QC 3VDXA 3H35A 2CW8A 2JVHA 2ZSHB 3SYTA 3OYEA 4LIUA 5HVQC 3A4CA 3OYBA 2CS3A 3FDYA 2E1MC 2KP6A 3D5LA 3OS0A 4XL9A 2LG4A 3HOTA 1S9HA 3K6GA 1MMDA 4YRVA 2VIXA 1YE9A 3CESA 2VKDA 3BLYA 3L2RA 2OV7A 3OYIA 3A2KA 3SEZA 4BEHA 3DWLE 3OY9A 2UWMA 3OL3A 3F9KA 2IS6A 4N4NB 1G59A 1D1AA 2HPIA 3OWTA 3L2QA 2JVGA 4E7ZA 4F55A 2WAFA 2CMPA 4X0GA 3ZR8X 2DXIA 4IQ4A 3PNTA 4RLFA 1Y6IA 3D5SC 4PJMA 3UNGC 4BS9A 4KISA 1NG7A 2Q2EB 2VB6A 3OYDA 3QOEA 1W36C 3W2AA 2DJIA 3PSFA 2XDVA 3TL4X 4Y3OA 4RM3A 2KMUA 2GOXB 3IAM2 3OIPA 2A6TA 1Z21A 2O5RA 1X4OA 3EUHC 3G2BA 2DT6A 4PJJA 3TMOA 4XMYA 4HSRA 2JSPA 2XSJC 2V26A 4LITA 1QU3A 1D1CA 4XKBA 1TT0A 3OYKA 3HOSA 4E7IA 3PJRA 2VJ4A 1BR4A 3DU5A 2E1MB 4XR6A 2XF7A 4G6TB 4H4KC 2WY8Q 1YX5A 2XF6A 1MNEA 4E7SA 4JOMA 3V42A 5LFAA 2VQCA 3OS2A 2CV1A 1PYVA 3I3LA 3C2HA 1YX3A 1UG0A 5TGTA 2K5CA 3H9JA 3OIQA 4IZZA 2F6CA 5HNHA 4BE0A 4PK4A 3QYFA 3HC7A 4CUGA 3EUAA 2MYSA 2IS1A 1X19A 2P0WA 4BEHB 4BU2A 1WJ5A 1Z3YA 4F3QA 2W1OA 1JI8A 2M4KA 5FRNA 4HPQA 1NG6A 3QODA 4F91B 1Z3XA 3OYNA 4R79A 1WJEA 2M0MA 4C9YA 4E7JA 1N77A 2X1EA 4DOZA 3RPUD 3ZGKA 3VYSB 3MKWB 2ZFUA 5KNLA 4DBQA 2CW7A 2X6YA 4XKWA 3VSKA 2X6WA 2E5ZA 3RTRA 3W2VA 4E6KG 3MMYB 4BDYA 3E1SA 1DGRM 1T95A 1U0JA 3FKJA 3HUGB 1Y56A 3U21A 3HPHA 3S3OA 2HVQA 2M7BA 2K9MA 2R7RA 2CV0A 4QPQA 3AL0B 2ZXHA 4PFOA 1FMVA 3RQ4A 2HDWA 3HL2A 2ZSIB 1ERDA 2M7AA 4OAZA 2XC7A 4XQFA 3K4MA 4B44A 2W82A 2X85A 3K4KA 4ITVA 4C2UA 4BL0B 2VQHA 3S32A 4AYBA 1LKXA 2UUZA 5HOOA 2QKLB 2R7TA 3SDBA 4J01A 5HNFA 2HZDA 2IXSA 2WA0A 3TBIA 4XKVA 2AQEA 2MABA 3ONQA 3K4NA 3N05A 4ZTJA 2ZXIA 4J00A 3AFHA 3CMMA 1D0YA 3A1YA 4NUBA 1D1BA 4NNJA 2RQQA 4CA0A 4IKFA 1D0ZA 1WJBA 4QPOA 2LH9A 4B47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBI B;  3FBN B; 
#chains in the Genus database with same CATH topology
 4ZYA A;  1E0E A;  4XN3 A;  1BI1 A;  2L4M A;  4CHU A;  2EA2 A;  5E1Z B;  2BYV E;  1RES A;  2NOJ B;  1HKQ A;  2WAD A;  2PJR A;  4BQO A;  3FZV A;  5BPD A;  1LDJ A;  3JRH A;  2HGC A;  3TO6 A;  3TO9 A;  1H88 C;  1P6R A;  2R7W A;  1BOB A;  4UVC A;  4P1W A;  4YFN F;  3VWB A;  2LRD A;  2LF7 A;  2LP0 A;  4MEY F;  2IGO A;  4KIF A;  4ENJ A;  5CVV A;  1I3A A;  1ZLJ A;  3S2H J;  1MMS A;  2E36 A;  3ABM H;  2QCO A;  3GTJ J;  1QGP A;  2MGQ A;  2HOA A;  3CZ6 A;  4Y4R A;  4ZC3 A;  2ZJQ F;  5BMZ A;  1B1B A;  4C2T A;  2R7X A;  1XB4 A;  1RNL A;  3IKT A;  1XG1 A;  2WBM A;  2VQG A;  2NRA C;  4ZTF A;  5CQE A;  4RMN A;  2BY3 A;  2CH0 A;  3PUF A;  1AHD P;  3K4L A;  2DT7 B;  2O7O A;  4RAY A;  2FE3 A;  2CUZ A;  4IX7 A;  1WJF A;  4M3D A;  1K79 A;  5DTD A;  2WB1 A;  2KLO A;  5J8F A;  4KN7 X;  1Z9C A;  5IYC J;  2KIU A;  5E18 F;  3OS1 A;  4RB0 A;  1TQI A;  4G12 A;  4QLC U;  3GTO J;  4UXN A;  2GM4 A;  2HEO A;  2HPM A;  1U5T C;  1OCC H;  3B6C A;  4XM3 A;  3PIO F;  3K70 C;  1IRG A;  1RC9 A;  3QP5 A;  4ESB A;  5B66 C;  2X51 A;  4RAF A;  3J80 K;  1SFX A;  1QPM A;  1G3W A;  3PO2 J;  4XLN F;  1FSE A;  3K10 A;  4B1R A;  3OOU A;  2OBP A;  1IDY A;  1ZTR A;  5FGM A;  1YYV A;  1O3Q A;  1LVK A;  4QTR A;  4A5N A;  2O03 A;  1EA3 A;  2Y0M A;  1LUJ B;  5IPA A;  1QA6 A;  3GO5 A;  2JT1 A;  2R7Q A;  4LLL A;  1YFH A;  4XLE A;  1HW2 A;  2HS5 A;  5LBQ A;  2WTE A;  2VQL A;  2BHY A;  2DPU A;  2PJR B;  4MIM A;  2IGK A;  5FKN A;  3DEE A;  2UV1 A;  1FZP B;  1DU0 A;  4MFD A;  1QHG A;  5L3G A;  4U7B A;  2QKM B;  2HXO A;  2OUM A;  2IP2 A;  3RKW A;  3OMY A;  2P5L C;  1K78 A;  4CXF A;  3Q5F A;  3OSG A;  2F4I A;  4XIC A;  4HNT A;  4UUT A;  2Z1D A;  4IRH A;  5DYM A;  3TQN A;  1ZQ3 P;  1LDK B;  1QVT A;  1R22 A;  5DS9 A;  2R7U A;  3ZQI A;  3LA7 A;  2B7E A;  4BJT A;  3Q9V A;  1I5Z A;  2PX9 A;  2E2J J;  3QPH A;  3BTJ A;  2M1B A;  1S29 A;  5DCM A;  3WTS C;  5LGU A;  2ME6 A;  3QYB A;  3UR3 C;  2LMD A;  4BNC A;  1UAA A;  1R1T A;  2IEK A;  1WKM A;  2FRH A;  4RM2 A;  5BOX A;  4ZYE A;  3S15 J;  4OIQ F;  3HBL A;  4Y17 A;  1E3P A;  1JE8 A;  2LVS A;  1SMY F;  1P2F A;  2E7W A;  1FEX A;  1UEL B;  3GX4 X;  1FWZ A;  4ASN A;  1BC8 C;  2EZK A;  2XSD C;  2RRE A;  4HLY A;  4IHY A;  3M3Y J;  2VPL A;  4ETS A;  4NHJ A;  1FYM A;  4AVP A;  2LOO A;  3NAR A;  2D1V A;  4PZJ A;  3R0A A;  1S7A A;  2V9K A;  4CCJ A;  2EFN A;  5HLG A;  5IP6 A;  4Q4Z F;  4JX4 A;  1IXS B;  1HF0 A;  1A5J A;  1BR1 A;  4XRS A;  2FNA A;  2BY2 A;  2GAU A;  4L5J A;  1K6O A;  5CKT A;  3KEY A;  1TWA J;  1IZ1 A;  1TL8 A;  1T6S A;  1XMK A;  4CZC A;  2WY7 Q;  3IRR A;  3JSO A;  2E60 A;  1R71 A;  3CCY A;  1SVO A;  4B3X A;  1FJL A;  2K85 A;  3HDD A;  4C3I J;  3I56 I;  2JPC A;  5DV5 A;  3SZG A;  3I0T A;  3QWL A;  3GZ5 A;  1BJZ A;  1BR2 A;  4ZDL A;  4DGW B;  4A0Y A;  2KKO A;  2IJL A;  5IYB J;  3C1D A;  4M72 A;  2OA4 A;  2A6E F;  3DPU A;  3S17 J;  5E3O A;  1K78 B;  2WAQ A;  2W57 A;  2F48 A;  3CCL I;  4BYY A;  2OTL I;  4V2F A;  5JR3 A;  5D5U B;  3BWG A;  1Y8Q B;  3RKQ A;  1QRY A;  3L1P A;  2EV5 A;  1JT0 A;  2DN0 A;  5LEK A;  1AKH A;  4KNY A;  5EF6 A;  3GZN B;  5DUK A;  1ZAR A;  4LMY A;  4UY8 I;  2QM3 A;  3ASN H;  3N97 A;  1BIB A;  4RGU A;  2W00 A;  3FF5 A;  2VE8 A;  5DCM B;  4BBR J;  5HS8 A;  5DM7 F;  3JRD A;  1X3Z B;  1XDS A;  2NVX J;  1U5T A;  1X1B A;  2JUG A;  1ORK A;  4G6Q A;  4YEL A;  3QAH A;  1WFX A;  3V7C A;  2R7S A;  5ERI A;  3BR5 A;  1G8X A;  4RB2 C;  4LK0 F;  1QVU A;  4P9U A;  2EPF A;  3T8R A;  2D45 A;  1UFM A;  2P8T A;  3K1P A;  1TTY A;  2FEZ A;  2L7K A;  4HAM A;  4Q5S F;  2L9S A;  3BQZ A;  2DA1 A;  2X6X A;  2ZBK A;  2O61 A;  1XSV A;  4UUV A;  3ELK A;  3BT9 A;  4BQN A;  4P5O A;  4PCQ A;  2JMW A;  4IRG A;  4M3E A;  4BJ5 C;  2HOE A;  3FXJ A;  4MQ9 F;  3CCU I;  3K70 D;  2L9N A;  4EM2 A;  3S2D J;  4PJL A;  1JKR C;  2WAE A;  2BBY A;  2VJ5 A;  3FBI B;  1X4P A;  3O8G A;  2F5C A;  2O6G E;  3NWT A;  5JI6 A;  4BDZ A;  1R5H A;  2RVC A;  4B48 A;  5HOD A;  3S16 J;  3BOQ A;  3BPX A;  1XX5 A;  2Q2E A;  3F0C A;  1OCT C;  3IUO A;  3GXO A;  3VOE A;  2JJ7 A;  5LRR A;  4DZP A;  1HW5 A;  3PL8 A;  4F52 A;  3F8C A;  1IC8 A;  2KRC A;  2KPM A;  5TIS C;  3CP8 A;  3BDD A;  3TGN A;  5K5Q A;  4NC6 A;  2EJR A;  2HDC A;  1APL C;  3F6O A;  1AKH B;  3G1M A;  3CP2 A;  3OSF A;  1RIO H;  2YX4 A;  4EM0 B;  4DBR A;  4QWQ A;  3A03 A;  4X1E A;  3A01 A;  3H35 A;  2JA6 J;  1U5T B;  4LIU A;  2QQ9 A;  1FP2 A;  5HDK A;  2I10 A;  3CCV I;  3MN2 A;  1S3J A;  1XTA A;  5JVT A;  3W6K B;  2ID3 A;  3OS0 A;  3CQZ J;  4M6V A;  2VT2 A;  3B02 A;  2Y0S N;  3ECO A;  2IA0 A;  3GFL A;  2CQX A;  4A69 C;  1JHF A;  1S9H A;  1W5S A;  5E1X A;  1GDT A;  4KMF A;  3M8F A;  1BI2 A;  5L3C A;  1YLF A;  2IRF G;  5GPC A;  3O6B B;  3I55 I;  3OYI A;  3SEZ A;  4BEH A;  3ZQG A;  2QYO A;  2JN6 A;  2DMQ A;  3DWL E;  1JKP C;  3OL3 A;  2DTZ A;  1G59 A;  1D1A A;  4CO8 A;  2LDU A;  1Y1V J;  2JVG A;  1R58 A;  4EJW A;  3LSP A;  2G7U A;  3J7A O;  1WZ2 A;  1T08 B;  2MLK A;  4X0G A;  5DM6 F;  2HQ5 A;  2M87 A;  2CFX A;  3V7S A;  4HA8 A;  2LLK A;  1RUO A;  3BTI A;  2QEN A;  1RKT A;  2JPB A;  1JXS A;  1Y6I A;  1H8A C;  4KIS A;  1NG7 A;  2Q2E B;  2VB6 A;  1W36 C;  3HUG A;  5FLX K;  3HRS A;  2E7X A;  2VC0 A;  3CMY A;  3TL4 X;  3K7A J;  3GW2 A;  3WG7 H;  2H1L A;  2L7F P;  2GOX B;  3IAM 2;  2Y9Y A;  1I39 A;  4A3B J;  3KLO A;  3EUH C;  1TWF J;  3WTX C;  3HOV J;  3TMO A;  5JHU A;  3ISP A;  5GAD J;  3PJR A;  3OYK A;  3HOS A;  2BZT A;  3J81 K;  1B59 A;  1S7E A;  2E1M B;  2EIK H;  4MO7 A;  2XF7 A;  4G6T B;  4Q47 A;  4H4K C;  4XR6 A;  1GV5 A;  1YX5 A;  1F43 A;  2K02 A;  3RPU A;  4K2E A;  1ZR2 A;  1QNT A;  3M07 A;  2R7D A;  2VQC A;  5FLM J;  1PYV A;  2IA1 A;  5LRS A;  3ULQ B;  1L0O C;  4IZZ A;  4M3B A;  4PK4 A;  3QYF A;  4CUG A;  3TED A;  4NQW A;  1ZGA A;  4U0W A;  2R7Z J;  4M73 A;  4BEH B;  4WCG A;  2XGX A;  3ZQH A;  4WK8 F;  4XRS G;  2G0E A;  2GXG A;  4A6E A;  2P5K A;  4F91 B;  1Z3X A;  3OYN A;  1FPQ A;  1FBU A;  2FQ3 A;  4E7J A;  1J9I A;  5FD6 A;  3TO7 A;  1P4X A;  5CVR A;  3RPU D;  3ZGK A;  1Y39 A;  1UST A;  4AYB N;  2ZFU A;  3BY6 A;  3JAM Z;  2N8G A;  2NS8 A;  3VSK A;  2GXA A;  1IXC A;  3W2V A;  4E6K G;  2OTJ I;  1ETW A;  2VKE A;  2FBK A;  4BDY A;  1KA8 A;  3E1S A;  4UB8 C;  2EIN H;  3BJA A;  4XLP F;  3CDH A;  3CCJ I;  1ZR4 A;  3S1Q J;  2JK3 A;  3KZI C;  5J4V A;  2XPV A;  1IF1 A;  2JRM A;  2PMU A;  3ECH A;  2KJC A;  3AG4 H;  3HUG B;  4GFB A;  2M8E A;  3GUD A;  3S3O A;  2K9Q A;  2K9M A;  2OAZ A;  2ZXH A;  3B73 A;  3KET A;  3G1L A;  3RQ4 A;  5TRD A;  1IN4 A;  5D4R A;  1J0R A;  1K7A A;  1HQC A;  2PJP A;  2CQ7 A;  4OAZ A;  3CO7 C;  1A31 A;  2GIZ A;  3K4M A;  3M8E A;  4ITV A;  1WWX A;  4C2U A;  3HOW J;  4L5E A;  5IP9 J;  2UUZ A;  1SC7 A;  3SDB A;  4LFU A;  1T33 A;  4L9J A;  2R93 J;  3CDL A;  1ETQ A;  2AQE A;  3RJP A;  2MAB A;  3ONQ A;  3K4N A;  4ZTJ A;  4OIN F;  4YFK F;  3FHZ A;  3A0B C;  5D5W B;  1FYL A;  2K40 A;  3CMM A;  1D0Y A;  3HZJ A;  2LNB A;  4NUB A;  1YI2 I;  1FOX A;  2RQQ A;  1LEB A;  1IW7 F;  1R36 A;  3E3V A;  2LFB A;  1S6L A;  4GCV A;  4NDL A;  4IHT A;  3IHU A;  3FXK A;  4NQW B;  4Y15 A;  2Q8K A;  5D5X B;  4ZJZ A;  1HOM A;  3ABK H;  2X1D A;  1GLN A;  2MD0 A;  3G3Z A;  2DA6 A;  1VQN I;  4I2O A;  3ZCO A;  4H0E A;  4DYC A;  2E35 A;  2CW0 F;  3BJ6 A;  3FBN B;  3IKV A;  1TNT A;  5B1B H;  4O3M A;  3KP6 A;  2W7N A;  3J7Y J;  2EA4 A;  3E5U A;  5LGN A;  3ZRG A;  3KX2 A;  1XGN A;  1QQI A;  3FXL A;  2LYC A;  2Q0O A;  4WXH A;  4OAY A;  3ZMS A;  3BTL A;  4IJA A;  5F1R A;  1VTN C;  9ANT A;  3EUH A;  5HS7 A;  3RKY A;  3OYL A;  2LY9 A;  5FKO A;  2HR3 A;  2DFH A;  1ODD A;  3S1R J;  4PJ0 C;  4G7O F;  3OL4 A;  3GTK J;  2B0L A;  5J8C A;  2A05 A;  4M3F A;  2BOL A;  2AQF A;  2O0Y A;  3BQY A;  2V7F A;  1B6A A;  4EJO A;  1W36 D;  2M2E A;  3S2W A;  2CUJ A;  5A2Q Z;  1KGS A;  3BR0 A;  4YG2 F;  2LBF A;  1LE8 A;  3GLX A;  4S0H B;  4KUM A;  1I1G A;  2EV0 A;  4I76 A;  1ZLK A;  1A35 A;  2VLA A;  3JRF A;  4GDF A;  1B9M A;  3P7N A;  4ESJ A;  3VYR B;  4XRM A;  5EYR A;  1D5Y A;  4BY1 J;  2VJJ A;  4ZZD A;  1IV8 A;  2LSO A;  4PJN A;  2PN6 A;  3FM3 A;  3LMM A;  4A0Z A;  2L9R A;  4CH7 A;  2DFF A;  4CCK A;  3J7A Y;  5E3N A;  1DGW Y;  2CQN A;  3V4G A;  2HOT A;  1I1S A;  2TDX A;  4RB3 C;  1OQY A;  2K7L A;  3WGI A;  3L00 A;  1F36 A;  2KRF A;  3F72 A;  4NBQ A;  4CCN A;  3H0G J;  3OYJ A;  3IL2 A;  4PSX A;  2H6C A;  1E3H A;  2L3D A;  2P5V A;  3HRM A;  3I54 A;  3GTL J;  2ZKZ A;  2LF8 A;  2V1U A;  3BZK A;  4BHC A;  3JTH A;  4FE7 A;  3LAJ A;  4ZYD A;  2CSO A;  3S93 A;  4XOR A;  1X2M A;  2DOE A;  4HZF A;  2JUC A;  5HLT A;  3ZMV A;  4MTD A;  1LFP A;  1X1A A;  4LB5 A;  2DA3 A;  1P92 A;  3FHN A;  4A6D A;  1ZEL A;  2HI3 A;  3LSH A;  3ZP5 A;  4YIF A;  4I02 A;  4XBF A;  1EH7 A;  3OR1 C;  3LA2 A;  2DTR A;  1AU7 A;  1YW9 A;  1EH8 A;  2GOM A;  2XPW A;  4OWR B;  5IT9 K;  4RGX A;  2P4W A;  2KHM A;  3H5R A;  4L9V A;  1J75 A;  2J5O A;  4M9S A;  4HF1 A;  2D1H A;  3S3N A;  3KYL A;  1QHH D;  2DW4 A;  5EEG A;  5H20 A;  3RZD J;  1W1W E;  1LDD A;  3GEZ A;  3LSI A;  1O4X A;  2LBF B;  2EH3 A;  4II3 A;  1LE8 B;  5FKK A;  3JRB A;  4D9J A;  1NTC A;  2CQK A;  1ZG1 A;  5D6E A;  2WV0 A;  3DTK A;  4M74 A;  5LHH A;  4IF4 A;  1WI3 A;  2Z16 A;  5B3S H;  3HHG A;  1XPX A;  4O5V A;  1HST A;  3LQR A;  4UV8 A;  4X6A J;  1MMG A;  1G3S A;  3LSM A;  3PUB A;  3CC2 I;  5HS9 A;  4M6Y A;  2H1K A;  5C4X J;  4A3M J;  3RKX A;  4IL6 C;  1H9T A;  4AM3 A;  1FYK A;  2WC2 A;  4CDG A;  4PUS A;  3JRA A;  4AIK A;  4DJA A;  5FRO A;  3ZMZ A;  2DAO A;  4LOC A;  5AON A;  5LD2 C;  4BE2 A;  3MVP A;  1HKS A;  3QQA A;  2MFZ A;  3WTZ A;  5BNG A;  2F5V A;  2M3A A;  4EQQ A;  4LK1 F;  5C44 J;  3VEP A;  1O7F A;  1H9G A;  4UHT A;  4E7L A;  1X1D A;  4HRI A;  1PJR A;  1F4K A;  2X4H A;  4FCY A;  3HKZ N;  4E7K A;  3CLO A;  3QYE A;  2HOS A;  3G71 I;  4D0P A;  1BIA A;  2QVO A;  2YU3 A;  1RUN A;  2VE9 A;  1IRX A;  5FKM A;  1R1V A;  2KL4 A;  1VND A;  1EKE A;  3WTT C;  2FOK A;  3QPS A;  3FM5 A;  3M4O J;  3C2B A;  3WHC A;  1OIS A;  2KRH A;  1IN8 A;  4RLQ A;  5BQT A;  2IAI A;  4FAS D;  2OF7 A;  4B4C A;  5ICF A;  5FB2 A;  2LK2 A;  2H09 A;  4MNU A;  4BXX J;  3BCB A;  1WRJ A;  2RC4 A;  1U9N A;  3HM5 A;  3AL0 C;  2YSR A;  3H9G A;  2EK5 A;  5CQG A;  2BW3 B;  3D1N I;  4YIR X;  1IRZ A;  4YEJ A;  2XF5 A;  1X2N A;  3CCS I;  3BCA A;  4A3I J;  1FOK A;  1RZ4 A;  2DLL A;  3DPL C;  3PNV A;  3BR2 A;  4OMZ A;  3C18 A;  5E1W A;  3S1M J;  2VC1 A;  5IY5 H;  3GME A;  3KP7 A;  4HF2 A;  4XON A;  5ILS A;  1R4N B;  2QGU A;  1KU3 A;  1GT0 C;  4I6Z A;  5KCM A;  3N4M A;  3IC7 A;  4DYR A;  2CUF A;  2YS9 A;  3MKY B;  1JT6 A;  2FXA A;  2QQB A;  2HVR A;  2XV4 S;  4CIC A;  3IRQ A;  4XLF A;  5ICG A;  4UUS A;  2M45 A;  1Z05 A;  1IN6 A;  2EB7 A;  2E1O A;  4XLH A;  5F0H A;  5CPR B;  3I53 A;  4NC8 A;  5K5R A;  1P7I A;  3LSK A;  2ECC A;  2Y31 A;  2M0C A;  3ZQ7 A;  2HXI A;  3W3C A;  2LR8 A;  4AVZ A;  1SFU A;  1LB2 A;  5EDN A;  2HQA A;  4GO1 A;  1D8J A;  2ZC2 A;  1MBE A;  2XHK A;  2QEX I;  2DYS H;  4HDU A;  3EYI A;  2M9H A;  2GLO A;  3TW6 A;  3V8J A;  1ZGW A;  4QIW N;  4D7M A;  2NVT J;  3PFI A;  1XGS A;  4HBL A;  1LNW A;  3DPT A;  3R60 A;  3QU6 A;  1HC8 A;  4ZYG A;  1P4A A;  3HOZ J;  5HLI A;  3GLL A;  5ICE A;  3FKI J;  3WTV C;  2V6E A;  3CME I;  4LLG F;  3L2U A;  4JYK A;  2ZCW A;  1WJC A;  2L0K A;  3CF5 F;  1VQO I;  3VYU B;  2ELH A;  3VDX A;  1RPW A;  3SYT A;  3TOA A;  1XGO A;  2HZT A;  4IPA A;  3M1E A;  4A3C J;  3OYB A;  3FDY A;  2E1M C;  1FIA A;  3D5L A;  3GFJ A;  4BBS J;  2E2H J;  5KAI C;  4HF0 A;  5M5X J;  2QSF X;  2IPQ X;  3EET A;  2XB0 X;  4YRV A;  3TP0 A;  3DV8 A;  2VKD A;  1UJ8 A;  1C0W A;  3ZN0 A;  1JHH A;  2STT A;  2HKX A;  3DKW A;  1W0U A;  3A2K A;  1F5T A;  4A3G J;  1SD4 A;  1T56 A;  2DQL A;  2FBI A;  3OY9 A;  2UWM A;  1ETO A;  4D5F A;  3JR9 A;  1HDP A;  4EGY A;  1ZKG A;  1XCV A;  4UUS B;  1OYI A;  2XRN A;  3COA C;  4E7Z A;  1ZG3 A;  3L7W A;  4F55 A;  5H2F C;  3FMQ A;  2WAF A;  2DA2 A;  4QSH A;  4PDK A;  2XAF A;  1O57 A;  2FX0 A;  4RGR A;  3BP8 A;  1ONV A;  3HTU A;  2XRL A;  4LD5 A;  3PNT A;  5AIP A;  4PJM A;  2O3F A;  3D0S A;  3UNG C;  1Z91 A;  4ON0 A;  3CMA I;  2E71 A;  4RAZ A;  2DJI A;  3PSF A;  2HWV A;  1TWG J;  5E8G A;  2GQQ A;  3AG3 H;  1KYW A;  2A5Y B;  4RB1 A;  1U8R A;  1OCP A;  4G6D A;  1IDZ A;  2ZB9 A;  2KMU A;  4A5M A;  3V7R A;  3OIP A;  1X4O A;  4OIO F;  1QZY A;  1MBF A;  5D8K B;  1SD5 A;  4XMY A;  5L3D A;  4IO9 F;  2DPD A;  2IW5 A;  2QQA A;  1YOV B;  2V26 A;  1QU3 A;  4XKB A;  1TT0 A;  1BR4 A;  1GV2 A;  2WY8 Q;  4BXU A;  4A3K J;  4E7S A;  1OKR A;  4ABZ A;  5D6F A;  3V42 A;  5LFA A;  2R0Q C;  2CV1 A;  2NVU B;  3K9T A;  3I71 A;  2Y2Z A;  2L4A A;  1YX3 A;  2K5C A;  3GTM J;  1ZAO A;  3OIQ A;  2F6C A;  5H6R A;  5F1J A;  2COM A;  3EUA A;  4HV5 A;  2IS1 A;  3RYR A;  3HOY J;  3ZMD A;  1LVA A;  1X19 A;  2P0W A;  2JRT A;  5K5O A;  1WJ5 A;  1Z3Y A;  4N9H A;  3F8M A;  2F4M B;  1UMQ A;  3U1K A;  1NG6 A;  1R4M B;  1VF9 A;  4PGH A;  3E6D A;  2W25 A;  4R79 A;  3SQN A;  3E7L A;  2M0M A;  3T0Y A;  1Y0N A;  2E34 A;  4HOB A;  2DFI A;  1ETY A;  1YG2 A;  2X6Y A;  3TDZ C;  1IJW C;  3RTR A;  3GZ6 A;  2V1D A;  3JRG A;  3MMY B;  4XK4 A;  4L9N A;  3HHH A;  1DGR M;  1T95 A;  2P7V B;  1U0J A;  5JFR A;  3U21 A;  3HPH A;  1UG2 A;  2J5P A;  1FOW A;  1TW3 A;  4B3A A;  4QPQ A;  3AL0 B;  4MGR A;  1FMV A;  2ZME B;  5F08 A;  2K9S A;  2ESN A;  1JJ8 C;  2WV1 A;  2XIG A;  2YX7 A;  2XAH A;  5TJJ A;  3WHB A;  2AHQ A;  4XSZ F;  4EJU A;  3PQJ A;  2X85 A;  4BQA A;  4Y52 J;  4OIR F;  2K4J A;  3LNQ A;  3E6B A;  4GYG A;  4AYB A;  1LKX A;  2R7T A;  1J59 A;  1FX7 A;  2RN7 A;  3HSE A;  5HNF A;  2PMZ N;  3TBI A;  3L09 A;  1YS7 A;  1TWC J;  2PEX A;  3NAU A;  3SFZ A;  1ZG5 A;  3BG9 A;  1NH3 A;  2L7M P;  1YJ9 I;  3N05 A;  4BAY A;  3AG2 H;  2I5U A;  3JTG A;  3DBR B;  1Q1H A;  3F8B A;  2JA5 J;  4RAG A;  5M3M J;  1D0Z A;  1WPK A;  2BE5 F;  4QPO A;  4L18 B;  1K4T A;  2LH9 A;  2WAQ N;  4RGS A;  1MGT A;  1FLI A;  2EFQ A;  2XAS A;  3SFI A;  2EFW A;  1WHU A;  2BVL A;  1IUY A;  4HEA 2;  3FK6 A;  3AKZ A;  2DI3 A;  2A61 A;  3E5X A;  4HW0 A;  3H92 A;  2MH2 A;  3K4J A;  4UB6 C;  1JTX A;  1D0X A;  2BXZ A;  1HBX G;  5IOY A;  4KT5 C;  1MMA A;  4D7N A;  1YRN A;  4U88 A;  2EIJ H;  2P6S A;  3RYP A;  3HB9 A;  1TW2 A;  1Z6R A;  5J40 A;  3E6M A;  3MFK A;  2OPT A;  2K3F A;  3FK7 A;  2DMN A;  2FBH A;  1VQ7 I;  2XRO A;  2F5D A;  2LTP A;  3H5A A;  1ZK8 A;  2HVS A;  5M5W J;  2NOG A;  3G1O A;  1ON1 A;  3LFK A;  4V2G A;  3DKY A;  2A68 F;  1PUE E;  2OJE D;  3NRV A;  4DIQ A;  2K3P A;  2CJJ A;  4ZZL A;  4AIJ A;  2VT3 A;  3ZN1 A;  3CCM I;  2GBY A;  3KEO A;  2LKX A;  2H8R A;  3JW4 A;  4BUP A;  1ZYR F;  2XGC A;  5L3E A;  5LGT A;  1R49 A;  2YU9 J;  3BR6 A;  3T8T A;  2DK5 A;  3GF2 A;  3FXU A;  1VQM I;  4RA2 A;  2VXZ A;  4IHV A;  2BY1 A;  4AU7 A;  5GAG J;  1U78 A;  3WGH A;  2EWN A;  3GYH X;  1MND A;  1XGM A;  5DD8 A;  2NAZ A;  4G9Y A;  4ZDP A;  5DCF A;  4RBO A;  2K9L A;  1USS A;  1X1P A;  4WWC A;  4BXF A;  2VPR A;  4C30 A;  1GXP A;  4BKX A;  2HKO A;  3CTA A;  2RNG A;  2ID6 A;  2DYR H;  2W84 A;  4D1Q A;  1KYZ A;  3IH4 A;  3VSL A;  3Q0V A;  3SEQ A;  3CCE I;  2VAS A;  3ZQC A;  2L01 A;  2VXD A;  1OPC A;  2L7Z A;  1YRN B;  2XGE A;  2R7V A;  4KT6 A;  1MBG A;  1FTZ A;  1MDM A;  5FLV A;  2HYJ A;  1OR7 C;  2DT5 A;  3ROU A;  2KIQ A;  3CJQ B;  4WXD A;  1DDN A;  1F1Z A;  1OFC X;  3FIS A;  3OYH A;  1R6R A;  3F3X A;  2Z2S B;  3F21 A;  3KZY A;  1HW1 A;  1IG7 A;  2XAQ A;  2OU2 A;  2ECB A;  4BE1 A;  2CU7 A;  3Q0W A;  5FD5 A;  3HGG A;  1WQ2 A;  4LJZ F;  2VJI A;  3HRU A;  3DFG A;  3E0J B;  2AS5 F;  2NS0 A;  3GBG A;  3O3K A;  3F22 A;  2XUB A;  2EZH A;  3KZZ A;  4LG3 A;  1REP C;  3CJR B;  4G7H F;  2Z5U A;  3H0D A;  1WJD A;  2R5Y A;  4LGW A;  4HNU A;  1H89 C;  3PM1 A;  2DMT A;  2DMU A;  4OOI A;  1MJB A;  2RKH A;  1O3T A;  4L0Z B;  2B9S A;  2KJB A;  2CYY A;  1TNS A;  3ZQL A;  1BOA A;  2XB5 A;  1LPQ A;  1B72 A;  3MQ0 A;  2JA7 J;  1MBH A;  1N75 A;  4A12 A;  1FMW A;  3RQI A;  2K27 A;  3MWM A;  2B63 J;  3PIP F;  1ZN2 A;  1YHQ I;  2HNH A;  3BG7 A;  2K86 A;  3SZP A;  5E8I A;  3BC8 A;  1ZRF A;  2QBY A;  2HU9 A;  3DQV C;  4MEX F;  2R7O A;  2DK8 A;  2FF4 A;  2W4S A;  3IH2 A;  1TP4 A;  2DOF A;  2IGM A;  3FXR A;  1OYY A;  3BZ6 A;  1T0F C;  4XN0 A;  1G2H A;  2L9V A;  4ENN A;  4UVA A;  1AA7 A;  2W24 A;  3K1M A;  5GTI C;  1XMA A;  1X58 A;  1SFK A;  2XKP A;  3DBL B;  3IWF A;  3K2A A;  5EGO A;  1AWC A;  1ITY A;  1SMT A;  4CSW A;  3Q3S A;  1YW7 A;  1MDM B;  3RPQ A;  3VOD A;  5CJ9 A;  4AIH A;  2AXT C;  1Z0X A;  2ZNZ A;  4MQV A;  1KU2 A;  4XOP A;  2DA7 A;  2L54 A;  3QPL A;  1X3U A;  2ESH A;  2M5W A;  1WH5 A;  1UCR A;  2IVM A;  3BG6 A;  3K69 A;  1ZRE A;  1HA8 A;  4WF2 A;  5J1U A;  3FXO A;  1O7L A;  2ETH A;  2V4J C;  5CVI A;  3P9I A;  4KIB A;  2CO5 A;  3JAM K;  1O3S A;  2YPR A;  4I99 C;  3T1B A;  2E1N A;  2FU4 A;  3GVA A;  3HKZ A;  4S05 A;  5C4J J;  3OYG A;  3ASO H;  2VBX A;  3PNY A;  4KJZ A;  4AUX A;  4R8H A;  3L2V A;  2P6T A;  4C3H J;  2R5Y B;  4AC0 A;  3H5N A;  1TLH B;  3V8L A;  3IWZ A;  5D4S A;  1SAN A;  3DTI A;  4Y7N J;  1DUX C;  3A0H C;  1BJA A;  3I9V 2;  5CYV A;  3L2W A;  1OCR H;  4LLN A;  1IRF A;  1ZGJ A;  2O9L A;  1IO2 A;  4LG0 A;  2DU9 A;  3HG9 A;  3G73 A;  1B72 B;  1EH6 A;  4RDU A;  1SAX A;  2DBB A;  2JSC A;  4BJ6 C;  2KIF A;  4L9T A;  3REO A;  1I6X A;  2VBW A;  5F27 A;  4JX6 A;  2EQR A;  3U2R A;  1VQP I;  1QPI A;  1YO5 C;  2QBY B;  4P55 A;  1TC3 C;  5FFX A;  3K4C A;  1OR7 A;  3VYT B;  1FTT A;  4L5I A;  4MLO A;  2BVM A;  3O8H A;  2NNY A;  3DKX A;  3RSN A;  1CF7 A;  1PDN C;  2E2I J;  4E4H A;  3ESW B;  1T39 A;  1R23 A;  1JUS A;  3GTQ J;  1Y0U A;  1ZRC A;  4R1H A;  4M71 A;  2HFH A;  1R00 A;  5EGO B;  2X1C A;  2ICW G;  4FX4 A;  5E3L A;  6PAX A;  4FIS A;  4Y33 A;  1T2K A;  1ZH5 A;  1Y1W J;  4B09 A;  2PI0 A;  1FSH A;  4KA4 A;  4JX5 A;  1YJN I;  2MC4 A;  4CCL A;  1V5G A;  1Z7L A;  1ETV A;  2XAJ A;  2Z33 A;  4HG2 A;  5J1R A;  3WE3 A;  2R7F A;  4BQQ A;  1XMX A;  1XS9 A;  2H8W A;  3RCO A;  1VQ9 I;  3J80 Z;  2VBY A;  3RIR A;  5K7H A;  3CJT B;  2BW3 A;  4HYE A;  4B43 A;  4F92 B;  3ERM A;  2ELJ A;  5GTH C;  1V5E A;  2R3S A;  4N4O B;  1I6H J;  4IHX A;  5GPA A;  4JQF A;  1S7O A;  3RZO J;  2ZSH B;  2DA5 A;  3LAP A;  3HGY A;  3OYE A;  3H3V K;  1FT9 A;  5HVQ C;  3HYI A;  3A4C A;  1G3T A;  2CS3 A;  2KP6 A;  2TCT A;  4EV0 A;  1SFO J;  3R61 A;  4AWX B;  1WCM J;  2RGV A;  5LHG A;  2ZJP F;  3K6G A;  1MMD A;  2CG4 A;  3FMS A;  2VIX A;  4HQE A;  3CC7 I;  4LG0 B;  2X9D A;  4W1U A;  5JLX A;  1HDD C;  2JA8 J;  2OV7 A;  2NNN A;  4FTH A;  1QBJ A;  1RKW A;  3F9K A;  4XSX F;  4N4N B;  3CCQ I;  3W6V A;  1K83 J;  5J6X A;  5A2Q K;  1E17 A;  1T0F A;  2HPI A;  1V54 H;  3L2Q A;  3ZMU A;  3JCU C;  1U6G A;  2OD5 A;  1FY7 A;  1OCO H;  1W0T A;  1PP7 U;  2GXB A;  2COB A;  4MHG A;  4HX8 A;  1H0M A;  1T38 A;  3F8N A;  4M9Z A;  2PLY A;  4U0V A;  1CF7 B;  1MZB A;  1LQ1 A;  3F8F A;  3HSR A;  3OV8 A;  4IQ4 A;  2DFE A;  4RLF A;  1TWH J;  3D5S C;  2VOP A;  3BJO A;  1Z1D A;  1IUF A;  4IHW A;  3OYD A;  5CVU A;  3I4M J;  3ERE D;  5F0C A;  2LKS A;  2PQ8 A;  2VBZ A;  4RM3 A;  2CUE A;  3EYY A;  2V9P A;  3BR3 A;  1LFU P;  1LJ9 A;  2A6T A;  2QLZ A;  3KP3 A;  5K1Y A;  1CGP A;  1UB9 A;  2AXL A;  2ZME C;  3G2B A;  5ILU A;  1MSF C;  1RRJ A;  4CGZ A;  2D5V A;  3J7Z I;  1G6N A;  2XSJ C;  1YIO A;  1ON2 A;  4ESF A;  2MG4 A;  2PBI A;  5DEQ A;  4E7I A;  1OCZ H;  2VJ4 A;  1ULY A;  3DXJ F;  1D5V A;  5LLQ A;  4E70 A;  1QZZ A;  2XF6 A;  5GP9 A;  1WSU A;  3CUQ C;  1BM9 A;  2KIM A;  3F6V A;  5DUI A;  2IBD A;  3OS2 A;  2H6B A;  3I3L A;  3C2H A;  2VON A;  3BTC A;  3KYD B;  5HNH A;  4BE0 A;  2ISY A;  4KFC A;  4OMY A;  1UZC A;  3HC7 A;  1JUP A;  1VQ4 I;  2MYS A;  1Z67 A;  1PUF A;  4KYW A;  2ZJR F;  4BU2 A;  1GVJ A;  2W1O A;  3CJN A;  4XID A;  3KEQ A;  3BG5 A;  2VOD A;  1JI8 A;  3KCC A;  1YS6 A;  4HPQ A;  1V3F A;  5ICC A;  5FRN A;  1O3R A;  1BC7 C;  3QOD A;  2UXX A;  1R7J A;  4A3E J;  5KK1 A;  3WU2 C;  1NK3 P;  2FJ1 A;  2CGP A;  4IEJ A;  3WGG A;  2ZJ2 A;  3VYS B;  4N9I A;  4DBQ A;  2CWE A;  5F0F A;  1XCB A;  1STZ A;  4CYC A;  3ABU A;  4DYQ A;  3MZH A;  5K7Z A;  1WVR A;  2ISZ A;  1W5T A;  2LKP A;  3H1C A;  5GAH J;  2KT0 A;  1Y56 A;  5DDG A;  2FMY A;  3U1D A;  2F4O B;  2HVQ A;  5HLH A;  2R7R A;  2DDB A;  2XVC A;  4PFO A;  4N0B A;  3LSR A;  1GHC A;  1A6Q A;  4ZH4 F;  1E3O C;  2H94 A;  2ZSI B;  2ZXW H;  1Z7U A;  2XKO A;  4FQG A;  5D8L B;  4C3J J;  2PG4 A;  3OIO A;  3MCZ A;  4I0B A;  1TT5 B;  3P9C A;  5M3F J;  2FQ4 A;  4B44 A;  2OQR A;  2W82 A;  3I5U A;  3A02 A;  3K4K A;  3JRE A;  3WU0 A;  2W85 A;  2VQH A;  4BL0 B;  4OU0 A;  2K9N A;  5HOO A;  4MTE A;  1GUU A;  3CUO A;  1HCR A;  4G8X A;  2IXS A;  2XPU A;  1ZRD A;  2NS7 A;  2RDP A;  4XKV A;  1GXQ A;  2DJN A;  4ENM A;  4J00 A;  1T98 A;  1BBY A;  1KQ9 A;  4M6X A;  3VFZ A;  2KDZ A;  1VQ8 I;  4NNJ A;  2E19 A;  3ZOB A;  4IKF A;  4JK1 X;  2RV8 A;  1YIJ I;  1IGN A;  1HSJ A;  1WJB A;  2W48 A;  4I7H A;  1OYW A;  2E1C A;  4B47 A;  3KP4 A;  2LY1 A;  2ZNY A;  1PUF B;  3NWS A;  2LY2 A;  4C2M J;  4U0Y A;  1SD6 A;  2MW8 A;  4CYD A;  2OCC H;  1VQ6 I;  4B8X A;  3DEW A;  3S8P A;  1D8K A;  2RAE A;  4BGD A;  1JJ6 C;  3WTY C;  2A07 F;  2Y0S A;  2WB1 N;  4DW6 A;  2A5W A;  3CD6 I;  2EFP A;  1V5F A;  2PMZ A;  4I0A A;  5JHF A;  3PQK A;  1MIJ A;  1VQ5 I;  2A6H F;  4KN4 X;  2L02 A;  3WOD F;  4XLC A;  3L2C A;  4CYC B;  1MBK A;  3HJE A;  2V9V A;  3OYF A;  4BAC A;  3K2Z A;  3LWF A;  3AAF A;  1I27 A;  2WWY A;  2ZME A;  4Q48 A;  2X48 A;  3H36 A;  4AD9 A;  4DZJ A;  3QU3 A;  4E7H A;  4P96 A;  3QRF F;  5F64 A;  3KP2 A;  1PVE A;  1VZ0 A;  5E3M A;  1AOY A;  2LD5 A;  2L5Q A;  2MD5 A;  2EZL A;  5FKL A;  1RR8 C;  5K7F A;  2QQ8 A;  4A3J J;  5EZH A;  3CUQ A;  1POG A;  3D5R C;  2YR2 A;  3HTS B;  3R4K A;  5JVG F;  1N78 A;  1MW7 A;  2MA3 A;  3EUK L;  4A2U A;  3JSP A;  3KFW X;  1DQU A;  3GTP J;  3GTG J;  3KP5 A;  4BHB A;  2ELK A;  1W4M A;  4NB5 A;  2NVQ J;  3C2G A;  3QOP A;  2O8K A;  4S04 A;  3B6A A;  3TP3 A;  1FOY A;  3OYA A;  2FSW A;  4A3L J;  5KHD A;  2GA2 A;  4FX0 A;  1WJA A;  4IXA A;  4XLA A;  1MD0 A;  1B9N A;  3EPZ A;  2LRE A;  3DBH B;  5HDG A;  3BR1 A;  3MAJ A;  2KDO A;  1IN5 A;  1S8N A;  4XNF A;  4WX9 A;  5FLX Z;  4CZZ A;  4TV7 A;  4Z2Y A;  4IVN A;  2Y9Z A;  4HST A;  2HYG D;  5F04 A;  4Y13 A;  2GA1 A;  2QUF A;  3PFY A;  3U9G A;  3MKZ A;  4IRI A;  4PGG A;  1XD7 A;  1E2X A;  3K4B A;  2PMH A;  1RI7 A;  4M3G A;  3O2P E;  5EJC A;  4BHP A;  2DO7 A;  3HOU J;  2G7H A;  2MBF A;  3J81 Z;  3M7G A;  4DQ2 A;  4U87 A;  2HTJ A;  3OR2 C;  3FX3 A;  2CRG A;  1IV6 A;  2IT0 A;  1HKT A;  1KQ0 A;  3BG3 A;  3H9Q A;  3JRC A;  1JGG A;  1Z6T A;  1P4W A;  2DOD A;  2DOA A;  2EZI A;  2XAU A;  3BPV A;  2EIM H;  3I59 A;  1XC5 A;  3LSG A;  4DNC A;  4EEF G;  1PP8 F;  1DP3 A;  2M34 A;  4F93 B;  1QZE A;  1QO0 D;  2EFO A;  2RQP A;  3R6S A;  1DPU A;  1T8I A;  3DLA A;  1W7P A;  2DQR A;  2DCE A;  5FFZ A;  4A3D J;  1S72 I;  1LFB A;  2OZU A;  2MSY A;  2OC6 A;  1IAW A;  3LSJ A;  3S3M A;  2L2O A;  1A36 A;  1ACI A;  3F23 A;  1A04 A;  3CUQ B;  2Q1Z B;  1OJL A;  4LIV A;  1J2X A;  2E5N A;  1FNN A;  3CDI A;  1K6Y A;  1TZL A;  2QF7 A;  4EJV A;  5D5V B;  3E5Q A;  1FIP A;  3HXL A;  2TRT A;  4ANJ A;  3IP4 B;  3I4N J;  2QSG X;  2Y75 A;  2MLG A;  1K61 A;  2BEO A;  3CLQ A;  2KFD A;  1MSE C;  2NVY J;  3MD2 A;  3UKG A;  1BN5 A;  2MH9 A;  5EG0 A;  1W7P D;  3X2Q H;  3WG9 A;  1NK2 P;  2C6Y A;  3CC4 I;  1U3E M;  1V55 H;  3LA3 A;  4V19 K;  3LOC A;  3AG1 H;  3NQO A;  1BL0 A;  2FNP A;  4I98 B;  2PFB A;  2QWW A;  5KAF C;  1KQ8 A;  4HX7 A;  2STW A;  1TBX A;  1R9T J;  4KIT B;  5JLW A;  1MJ9 A;  1OLT A;  1ENH A;  4PSW A;  1R1U A;  3FIW A;  4II2 A;  4UNO A;  1J09 A;  1MMN A;  1BI0 A;  5FJ8 J;  2VI6 A;  5BS6 A;  2QSH X;  1W5C C;  1MKM A;  2JA2 A;  1SVL A;  3CF2 A;  3K0L A;  3NEU A;  4FET A;  5M5Y J;  4KIC A;  3DCF A;  2I8D A;  2V79 A;  3LST A;  3H3U A;  2V1X A;  4AID A;  1BA5 A;  3I59 B;  1Z77 A;  1UHW A;  4HNV A;  1V4R A;  1JTY A;  3FXQ A;  2UXN A;  1KZH A;  2HQR A;  3EQL F;  4NC7 A;  3G4S I;  5CVJ A;  4D5C A;  3DP7 A;  1W7P B;  2FA5 A;  2M4G A;  1VFC A;  1DU6 A;  3IAS 2;  2FD5 A;  2P81 A;  2VKH A;  3KYC B;  1UHM A;  3LFU A;  3ZXS A;  2Y48 A;  5E17 F;  4YII A;  2DMP A;  4PFP A;  1CQT A;  4O6J A;  3WTU C;  1EV7 A;  1MH4 A;  2GWR A;  5FRM A;  3C3W A;  3TW7 A;  1S5L C;  4XOT A;  3A01 B;  1MJA A;  3G6E I;  2IS4 A;  3CO6 C;  1SVM A;  4HLX A;  3QPT A;  4GXO A;  2RNJ A;  1B4A A;  2FUG 2;  1KON A;  3SJM A;  3KE2 A;  1SAU A;  2KZV A;  3ZQQ A;  4CCM A;  4Z6Y A;  1GVD A;  3FWE A;  3M8J A;  2LC2 A;  1VQK I;  1EF4 A;  2R4G A;  1U9O A;  5EG0 B;  4ZYH A;  3PSI A;  1NHA A;  5J3L A;  5IOZ A;  3P5J A;  2HYF A;  3HOX J;  2VL8 A;  4ZDO A;  2CV2 A;  4IQJ A;  1FBS A;  3DU6 A;  3Q9S A;  2Y69 H;  2UZK A;  4FT8 A;  3KPH A;  4CCO A;  1K4S A;  3MZY A;  1RET A;  3HPG A;  4EGZ A;  3PO3 J;  4JBA A;  3R0J A;  2XGD A;  2GIV A;  5AIQ A;  2IS2 A;  2V1N A;  2CFO A;  4IOC F;  4A3F J;  1L3L A;  4EAT A;  1X1C A;  3Q0U A;  1TQP A;  3ABL H;  1SD7 A;  4I09 A;  2FML A;  2XAG A;  1JGS A;  2KQR A;  3W2W A;  3MKL A;  1YIT I;  1XSX A;  4A93 J;  1U2W A;  1FBQ A;  3LQQ A;  1FP1 D;  1XSD A;  1BI3 A;  1OMI A;  2IGN A;  2HDD A;  1SFE A;  2X0L A;  3DTE A;  1JKQ C;  2H27 A;  3OYC A;  3LL7 A;  3VB2 A;  4WXC A;  1R5G A;  3L9F A;  4HDV A;  3M1C A;  4XKC A;  5E79 C;  3OYM A;  1R5I D;  3GWZ A;  4GRI A;  1B8I A;  1X3W B;  1BW6 A;  1P9Q C;  1VI0 A;  3GFI A;  3TOB A;  2CW8 A;  2CQQ A;  2JVH A;  3ZPL A;  3FMR A;  2ME0 A;  3E97 A;  3RI4 A;  2NYX A;  5B1A H;  5LHI A;  2VN2 A;  1MBJ A;  2KZG A;  5EEH A;  1RR7 A;  1N25 A;  3SHF A;  3TKY A;  2VKV A;  2OZ6 A;  4XL9 A;  2D2W A;  2LG4 A;  2Z9O A;  3HOT A;  3BRO A;  4ENK A;  3QP6 A;  4EVI A;  4XRF A;  1YE9 A;  4BH9 A;  3CES A;  3BLY A;  3KIO A;  3L2R A;  3H3Z A;  2X6O A;  1P7J A;  1XDU A;  2F5F A;  4P9F A;  3IH3 A;  3ZQF A;  3S1N J;  4EM1 A;  3DEU A;  2IS6 A;  2OQG A;  4MFE A;  4M9X A;  3MZ8 A;  3I64 A;  1IN7 A;  3OWT A;  3RDI A;  1HXD A;  3K1N A;  4HQM A;  2GZW A;  2MC3 A;  5IT9 Z;  5IYD J;  2CMP A;  1TQM A;  5CLS A;  3ZR8 X;  2QA4 I;  4GYI A;  3GFM A;  5GAE J;  2DXI A;  1MH3 A;  3OOP A;  3HSF A;  4U7D A;  2ACJ A;  2F5E A;  4FHT A;  4KIG A;  3TDU C;  4F7Z A;  2ZO4 A;  2Z99 A;  2BV6 A;  4BS9 A;  2Z3Y A;  1F9N A;  3SXY A;  3QOE A;  5L3F A;  3W2A A;  3ML6 A;  2XDV A;  5C3E J;  2IA2 A;  5J47 A;  1I50 J;  5EZG A;  3EDP A;  4KMU X;  4Y3O A;  2JQ7 A;  1M1E B;  5HDN A;  3HRT A;  3HEF A;  3S14 J;  1IXR C;  1Z21 A;  2O5R A;  2BHZ A;  2G9W A;  2M30 A;  3E6C C;  2DT6 A;  4PJJ A;  3GCM A;  4G7Z F;  2JWT A;  4W97 A;  3C7J A;  4HSR A;  2JSP A;  3VPR A;  4YFX F;  1YJW I;  4LIT A;  1B8I B;  4EJT A;  1WI9 A;  5F6F A;  1D1C A;  2K4B A;  4G94 A;  2EBI A;  2VUM J;  3DF8 A;  1KU7 A;  2F2E A;  1MNM C;  3DU5 A;  1J5Y A;  4HX4 A;  2EV6 A;  1Q1V A;  1UHS A;  4RS8 A;  2M8G X;  4LB6 B;  4UV9 A;  1MNE A;  2R92 J;  4JOM A;  2EIL H;  4IHS A;  2JZY A;  4OIP F;  2R5Z A;  1SEU A;  1FC3 A;  4I01 A;  2V6C A;  3WTW C;  1YW8 A;  5E20 A;  1UG0 A;  2KIS A;  5TGT A;  3H9J A;  3IV5 A;  3T5X A;  3WU1 B;  3I58 A;  5L3B A;  1DPR A;  2VOO A;  5H6Q A;  2BXY A;  1WH7 A;  4F3Q A;  2M4K A;  2ZXJ A;  2JTV A;  4FE4 A;  2P7C B;  1BW5 A;  1WJE A;  2A3S A;  3KLN A;  4L0Y B;  4C9Y A;  5ED4 A;  3HIF A;  5BPI A;  1N77 A;  2X1E A;  2QZ8 A;  3M9A A;  4DOZ A;  5LEJ A;  3BZC A;  3MKW B;  2NXN B;  5KNL A;  1JUM A;  2CW7 A;  4XKW A;  2Y30 A;  1KU9 A;  1LEA A;  2ADU A;  2E5Z A;  2X6W A;  2BY0 A;  3I4P A;  1ETX A;  5IP7 J;  2HQN A;  1JKO C;  3FKJ A;  2BGC A;  1J7K A;  3ZMT A;  4GGG A;  1VQL I;  1WGX A;  3JRI A;  2M7B A;  2CV0 A;  3FXM A;  2ZFW A;  2OCE A;  1YQA A;  2O8X A;  2DA4 A;  3MEX A;  1Y8R B;  2HDW A;  5IT3 A;  3HL2 A;  5EEA A;  3W6J B;  1ERD A;  1G4D A;  2M7A A;  3ABT A;  5ILV A;  1I3Q J;  2XC7 A;  3DLL F;  4XQF A;  5B5E C;  1HLV A;  5DD4 A;  4J19 A;  4UVB A;  2DDA A;  2HTS A;  3SDG A;  1ETK A;  5FO5 A;  3S32 A;  2QKL B;  1G3Y A;  1EJ9 A;  4J01 A;  2HZD A;  2WA0 A;  4IOA F;  4HV6 A;  1D3Y A;  1U8B A;  3SZT A;  1YTY A;  4EMS A;  5KVR A;  2AO9 A;  5J4Y A;  3WE2 A;  1A6I A;  2ZXI A;  1DP7 P;  5J1Y A;  3CCR I;  2R5Z B;  1ZHF A;  2A69 F;  3AFH A;  4A0X A;  2YUS A;  4KDP A;  3A1Y A;  4JP0 A;  1D1B A;  2FOW A;  4CA0 A;  1XN7 A;  3P9K A;  3V8K A;  4BY7 J; 
#chains in the Genus database with same CATH homology
 4NQW B;  4ZYA A;  1E0E A;  2LY1 A;  3NWS A;  2LY2 A;  4ZJZ A;  4XN3 A;  2BVL A;  2X1D A;  1GLN A;  2MD0 A;  2NOJ B;  4HEA 2;  3AKZ A;  3S8P A;  2WAD A;  2PJR A;  4BQO A;  4BGD A;  3ZCO A;  2Y0S A;  3K4J A;  1D0X A;  2A5W A;  2R7W A;  1BOB A;  3FBN B;  1V5F A;  2PMZ A;  5JHF A;  4P1W A;  1MMA A;  2LRD A;  2W7N A;  2IGO A;  4XLC A;  3ZRG A;  3KX2 A;  2LYC A;  4OAY A;  3OYF A;  4BAC A;  3CZ6 A;  4Y4R A;  4ZC3 A;  3OYL A;  4C2T A;  2R7X A;  4E7H A;  3H5A A;  2HVS A;  3OL4 A;  2WBM A;  2VQG A;  1VZ0 A;  4ZTF A;  5CQE A;  2BOL A;  2L5Q A;  2CH0 A;  3DKY A;  2AQF A;  4RMN A;  3K4L A;  2DT7 B;  2CUZ A;  2V7F A;  4IX7 A;  1WJF A;  2WB1 A;  4DIQ A;  2KLO A;  2K3P A;  1W36 D;  3D5R C;  2CUJ A;  3OS1 A;  2LBF A;  1N78 A;  1MW7 A;  3EUK L;  1DQU A;  2VLA A;  4BUP A;  2HPM A;  4XM3 A;  3K70 C;  3VYR B;  3C2G A;  2X51 A;  3OYA A;  2VJJ A;  5KHD A;  4PJN A;  3LMM A;  3K10 A;  1WJA A;  2VXZ A;  3OOU A;  4CH7 A;  4XLA A;  4AU7 A;  3J7A Y;  3EPZ A;  4CCK A;  2LRE A;  1DGW Y;  1LVK A;  1MND A;  2KDO A;  1EA3 A;  4XNF A;  4ZDP A;  2K9L A;  2R7Q A;  4BXF A;  4XLE A;  4CCN A;  3OYJ A;  4HST A;  4C30 A;  4PSX A;  2VQL A;  3PFY A;  2RNG A;  2PJR B;  3MKZ A;  2IGK A;  3DEE A;  4D1Q A;  3VSL A;  2UV1 A;  3K4B A;  3SEQ A;  2VAS A;  2VXD A;  3S93 A;  2R7V A;  1QHG A;  4XOR A;  4KT6 A;  5HLT A;  2QKM B;  4U7B A;  2OUM A;  3OMY A;  1OR7 C;  4U87 A;  1LFP A;  1X1A A;  3CJQ B;  3OR2 C;  2F4I A;  3OYH A;  4HNT A;  2Z1D A;  3FHN A;  1R6R A;  1ZEL A;  3LSH A;  2Z2S B;  1LDK B;  3H9Q A;  3VWB A;  2DOA A;  2XAU A;  3OR1 C;  4BE1 A;  3LSG A;  2R7U A;  1DP3 A;  4BJT A;  2VJI A;  4F93 B;  2GOM A;  4OWR B;  3E0J B;  3DLA A;  3GBG A;  2KHM A;  2DCE A;  3H5R A;  4LG3 A;  3QYB A;  3UR3 C;  2OC6 A;  1UAA A;  3CJR B;  3S3N A;  3KYL A;  2L2O A;  3S3M A;  1QHH D;  4RM2 A;  3H0D A;  1WJD A;  2Q1Z B;  3LSI A;  4HNU A;  4LIV A;  2LBF B;  4II3 A;  2E5N A;  1K6Y A;  4D9J A;  1TZL A;  1UEL B;  3DTK A;  3HXL A;  2RRE A;  2VPL A;  4ANJ A;  3IP4 B;  2Z16 A;  2LOO A;  1MMG A;  2V9K A;  4CCJ A;  3LSM A;  1N75 A;  3PUB A;  1FMW A;  3MD2 A;  1BR1 A;  5CKT A;  3KEY A;  2HNH A;  3BG7 A;  4PUS A;  4DJA A;  5FRO A;  3BC8 A;  4CZC A;  2WY7 Q;  4BE2 A;  5LD2 C;  2MFZ A;  2E60 A;  2F5V A;  2HU9 A;  2M3A A;  3DQV C;  2R7O A;  4B3X A;  4KIT B;  2W4S A;  4E7L A;  2IGM A;  3SZG A;  1X1D A;  4HRI A;  1PJR A;  1OLT A;  4PSW A;  4E7K A;  4II2 A;  1J09 A;  1MMN A;  1T0F C;  3QYE A;  4XN0 A;  1AA7 A;  4ZDL A;  1BR2 A;  4DGW B;  1SFK A;  1IRX A;  2JA2 A;  3CF2 A;  3DPU A;  4CSW A;  2KL4 A;  4FET A;  2WAQ A;  2KRH A;  2I8D A;  4RLQ A;  4XOP A;  4FAS D;  3BG6 A;  1HA8 A;  2V4J C;  3BCB A;  4NC7 A;  2M4G A;  2W00 A;  3AL0 C;  3IAS 2;  2VKH A;  3LFU A;  3H9G A;  3ZXS A;  5CQG A;  4PFP A;  2BW3 B;  1X1B A;  3HKZ A;  3OYG A;  2JUG A;  4KJZ A;  4YEJ A;  3PNY A;  3L2V A;  2XF5 A;  4YEL A;  1WFX A;  3BCA A;  2R7S A;  5FRM A;  1G8X A;  4XOT A;  3H5N A;  2IS4 A;  3PNV A;  3DPL C;  3DTI A;  2L7K A;  2FUG 2;  2L9S A;  3I9V 2;  3L2W A;  1KON A;  4XON A;  2X6X A;  1SAU A;  2KZV A;  3HG9 A;  3ZQQ A;  4CCM A;  3M8J A;  2LC2 A;  5KCM A;  4BQN A;  2R4G A;  4P5O A;  3MKY B;  3PSI A;  4ZDO A;  2HVR A;  4BJ6 C;  2VL8 A;  4BJ5 C;  2CV2 A;  4IQJ A;  4XLF A;  3DU6 A;  3K70 D;  2L9N A;  4XLH A;  5CPR B;  4PJL A;  4NC8 A;  2WAE A;  4CCO A;  3LSK A;  2VJ5 A;  3FBI B;  1X4P A;  3K4C A;  3VYT B;  3HPG A;  4MLO A;  2BVM A;  3W3C A;  3NWT A;  3DKX A;  3RSN A;  4BDZ A;  4E4H A;  4AVZ A;  4B48 A;  2IS2 A;  2V1N A;  2CFO A;  2HQA A;  4EAT A;  1X1C A;  2X1C A;  3W2W A;  3IUO A;  2KQR A;  4Y33 A;  3PL8 A;  4F52 A;  2MC4 A;  2KRC A;  1V5G A;  2KPM A;  4CCL A;  3CP8 A;  1Z7L A;  3DPT A;  4HG2 A;  2IGN A;  4BQQ A;  3DTE A;  3OYC A;  3LL7 A;  3RCO A;  2V6E A;  2BW3 A;  3M1C A;  4B43 A;  4F92 B;  2ELJ A;  3CP2 A;  4XKC A;  3OYM A;  1WJC A;  3L2U A;  1V5E A;  4GRI A;  4N4O B;  4DBR A;  4JQF A;  3VYU B;  1P9Q C;  3VDX A;  3H35 A;  2CW8 A;  2JVH A;  2ZSH B;  3SYT A;  3OYE A;  4LIU A;  5HVQ C;  3A4C A;  3OYB A;  2CS3 A;  3FDY A;  2E1M C;  2KP6 A;  3D5L A;  3OS0 A;  4XL9 A;  2LG4 A;  3HOT A;  1S9H A;  3K6G A;  1MMD A;  4YRV A;  2VIX A;  1YE9 A;  3CES A;  2VKD A;  3BLY A;  3L2R A;  2OV7 A;  3OYI A;  3A2K A;  3SEZ A;  4BEH A;  3DWL E;  3OY9 A;  2UWM A;  3OL3 A;  3F9K A;  2IS6 A;  4N4N B;  1G59 A;  1D1A A;  2HPI A;  3OWT A;  3L2Q A;  2JVG A;  4E7Z A;  4F55 A;  2WAF A;  2CMP A;  4X0G A;  3ZR8 X;  2DXI A;  4IQ4 A;  3PNT A;  4RLF A;  1Y6I A;  3D5S C;  4PJM A;  3UNG C;  4BS9 A;  4KIS A;  1NG7 A;  2Q2E B;  2VB6 A;  3OYD A;  3QOE A;  1W36 C;  3W2A A;  2DJI A;  3PSF A;  2XDV A;  3TL4 X;  4Y3O A;  4RM3 A;  2KMU A;  2GOX B;  3IAM 2;  3OIP A;  2A6T A;  1Z21 A;  2O5R A;  1X4O A;  3EUH C;  3G2B A;  2DT6 A;  4PJJ A;  3TMO A;  4XMY A;  4HSR A;  2JSP A;  2XSJ C;  2V26 A;  4LIT A;  1QU3 A;  1D1C A;  4XKB A;  1TT0 A;  3OYK A;  3HOS A;  4E7I A;  3PJR A;  2VJ4 A;  1BR4 A;  3DU5 A;  2E1M B;  4XR6 A;  2XF7 A;  4G6T B;  4H4K C;  2WY8 Q;  1YX5 A;  2XF6 A;  1MNE A;  4E7S A;  4JOM A;  3V42 A;  5LFA A;  2VQC A;  3OS2 A;  2CV1 A;  1PYV A;  3I3L A;  3C2H A;  1YX3 A;  1UG0 A;  5TGT A;  2K5C A;  3H9J A;  3OIQ A;  4IZZ A;  2F6C A;  5HNH A;  4BE0 A;  4PK4 A;  3QYF A;  3HC7 A;  4CUG A;  3EUA A;  2MYS A;  2IS1 A;  1X19 A;  2P0W A;  4BEH B;  4BU2 A;  1WJ5 A;  1Z3Y A;  4F3Q A;  2W1O A;  1JI8 A;  2M4K A;  5FRN A;  4HPQ A;  1NG6 A;  3QOD A;  4F91 B;  1Z3X A;  3OYN A;  4R79 A;  1WJE A;  2M0M A;  4C9Y A;  4E7J A;  1N77 A;  2X1E A;  4DOZ A;  3RPU D;  3ZGK A;  3VYS B;  3MKW B;  2ZFU A;  5KNL A;  4DBQ A;  2CW7 A;  2X6Y A;  4XKW A;  3VSK A;  2X6W A;  2E5Z A;  3RTR A;  3W2V A;  4E6K G;  3MMY B;  4BDY A;  3E1S A;  1DGR M;  1T95 A;  1U0J A;  3FKJ A;  3HUG B;  1Y56 A;  3U21 A;  3HPH A;  3S3O A;  2HVQ A;  2M7B A;  2K9M A;  2R7R A;  2CV0 A;  4QPQ A;  3AL0 B;  2ZXH A;  4PFO A;  1FMV A;  3RQ4 A;  2HDW A;  3HL2 A;  2ZSI B;  1ERD A;  2M7A A;  4OAZ A;  2XC7 A;  4XQF A;  3K4M A;  4B44 A;  2W82 A;  2X85 A;  3K4K A;  4ITV A;  4C2U A;  4BL0 B;  2VQH A;  3S32 A;  4AYB A;  1LKX A;  2UUZ A;  5HOO A;  2QKL B;  2R7T A;  3SDB A;  4J01 A;  5HNF A;  2HZD A;  2IXS A;  2WA0 A;  3TBI A;  4XKV A;  2AQE A;  2MAB A;  3ONQ A;  3K4N A;  3N05 A;  4ZTJ A;  2ZXI A;  4J00 A;  3AFH A;  3CMM A;  1D0Y A;  3A1Y A;  4NUB A;  1D1B A;  4NNJ A;  2RQQ A;  4CA0 A;  4IKF A;  1D0Z A;  1WJB A;  4QPO A;  2LH9 A;  4B47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...