3FBIB

Structure of the mediator submodule med7n/31
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
QNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification, structure, and functional requirement of the Mediator submodule Med7N/31
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Mediator of RNA polymerase II transcription subunit 7
total genus 27
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05669 Med31 SOH1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1340 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3fbiB00
3FBIB 3FBNB
chains in the Genus database with same CATH superfamily
3FWEA 4KN7X 4I2OA 4NNJA 4QTRA 3CCEI 1SVLA 2DA6A 3GYHX 3B73A 5ICFA 5DDGA 2WBMA 4AVZA 2BOLA 2X6WA 2GOXB 1RETA 1Y8RB 4CHUA 3CDLA 1YOVB 2QUFA 4U0WA 1QHHD 3FXUA 1VFCA 1X4OA 1I3AA 1ZLJA 3OYMA 2M7BA 2XC7A 3TEDA 3K4KA 1T38A 2UUZA 3OMYA 2ELHA 2IA1A 3K1PA 3CC7I 2X6OA 2VJIA 4DW6A 3F8FA 1NTCA 1S3JA 4RGSA 5GTHC 4DQ2A 2EBIA 1BI0A 1V5EA 2QGUA 5J8FA 1FY7A 5ICCA 3DV8A 5GP9A 4MLOA 3DWLE 2MABA 4UVCA 3GBGA 2PJRA 3L2RA 1IN7A 3ISPA 4EATA 1VTNC 3ZXSA 1ZLKA 2V1NA 5IOZA 2NVUB 2CUEA 3WU2C 4ETSA 1T0FA 4FE4A 1DP7P 1UHWA 2STWA 2V9KA 3SXYA 5LHIA 2KP6A 4L5EA 1TWGJ 3RKYA 3SQNA 1A04A 2G9WA 1BC8C 2IW5A 3K4MA 5LHGA 2LYCA 3DEUA 3CUQC 1FBQA 3W6KB 4ZDLA 2F5VA 1F5TA 3GF2A 2AQEA 1Y0NA 3CJQB 1RI7A 2VJ5A 2IGMA 3IAM2 3JCUC 4FETA 4OOIA 1EA3A 3Q0VA 2R7RA 2MG4A 4HYEA 5CPRB 4AIDA 2F6CA 4XN0A 4B48A 3MKZA 2EIKH 3WTWC 3EUHC 3J80Z 2Z2SB 1ZAOA 1VNDA 5DCFA 3PSFA 3HOUJ 4O5VA 3ABKH 1BN5A 2L54A 2ZFWA 1X1PA 1J75A 3HL2A 1TNSA 4F93B 3D1NI 3LA3A 3O6BB 3MZ8A 3SFIA 1V3FA 1B6AA 3BR6A 2JA2A 2JSPA 1Y0UA 2VBYA 1BBYA 2DA3A 2Z3YA 2E60A 3LQQA 1FLIA 1W5SA 4HX7A 3GXOA 4XKCA 1NH3A 2E2JJ 3HOZJ 4G12A 2IT0A 2YU9J 2EA4A 2NVYJ 3L09A 4Y13A 2IGNA 3OIPA 4IQ4A 4L5JA 1P2FA 2OJED 2OU2A 2FX0A 4MTDA 4A3DJ 2R7TA 1QZYA 5C44J 1A31A 1YJ9I 1ACIA 5J1YA 4WK8F 4UY8I 2HYFA 5HS7A 4MFEA 2WA0A 5TJJA 2VBWA 2F5FA 1JE8A 2ADUA 4U87A 3GO5A 2K7LA 3BOQA 2XPVA 2CRGA 2VT3A 1Z21A 3P7NA 4PZJA 1IRXA 3ZPLA 5A2QZ 4HAMA 2JRTA 2A6EF 4P1WA 1LVKA 2M3AA 2R3SA 3H9JA 3S32A 2EH3A 1ZYRF 2EZLA 2TCTA 4A6EA 2XB0X 3MVPA 3TW6A 2IGOA 2IS1A 4A2UA 1RUNA 2O5RA 3TMOA 3H3VK 4L0YB 3KEQA 4WXHA 3WTYC 1ZR2A 3HB9A 1KYWA 1WJFA 4DOZA 4Q5SF 1D5VA 2F2EA 2QKMB 2ICWG 3BJAA 1L3LA 2CV2A 2ZFUA 3F6VA 3QOEA 2H6CA 3JTGA 2A6TA 2X48A 3HRUA 5B1BH 3ERMA 2DPUA 4ANJA 2RN7A 4KIFA 1Z91A 3TKYA 1V4RA 3ECOA 1W7PD 1H88C 2CV1A 2CUZA 4DZPA 2HZDA 3HHHA 2E1OA 3E97A 4IF4A 2LSOA 3HBLA 1RESA 4V2GA 5D8KB 3F22A 2R0QC 4I0AA 2YU3A 5K7FA 1SFXA 3QOPA 1HA8A 1XMXA 3V7CA 1G3WA 2PX9A 3DEWA 1I6HJ 4LB6B 1P6RA 1I1GA 1J59A 1U5TC 4IPAA 1LFPA 4ENNA 3C1DA 3L2CA 3VDXA 3KZZA 4E7SA 5J47A 1WH7A 3E6DA 1SFUA 2RV8A 2KPMA 5FLMJ 1OYIA 4IVNA 1SFKA 5BPDA 4E7JA 1PDNC 5M3FJ 2MC4A 2B63J 2G7UA 5EZGA 4LMYA 4M3DA 2L9VA 2FQ3A 4RDUA 5FKKA 4A69C 1B72B 2CGPA 4E7IA 1WI9A 1GXQA 1D8JA 2M1BA 1BW5A 4IL6C 3ZMZA 2OD5A 2L5QA 3QPLA 3AG2H 4A3EJ 4I7HA 1UG2A 1VQPI 3H3ZA 5HOOA 1VI0A 3WE2A 3S2DJ 2ZB9A 2DDBA 2VODA 2E5ZA 4BS9A 2BXZA 1R00A 2Q2EA 1YS6A 2WB1N 4B44A 2JJ7A 3MAJA 1JTYA 1XN7A 3QP6A 5ICEA 3S1RJ 2KIUA 5E79C 3BROA 3L2UA 2R5YB 3HSRA 2GA2A 4UB8C 3BR2A 1REPC 1JUSA 2M5WA 5JLXA 1Z67A 1XSVA 4CXFA 2DPDA 3KP4A 4NHJA 2L2OA 3TQNA 4BXXJ 1TT0A 5F0CA 1M1EB 2A6HF 2FSWA 2VJ4A 3VPRA 1TP4A 2KRHA 3CCMI 1D1AA 1FT9A 1LDKB 2DO7A 3DBLB 3CMMA 4HX8A 1O7LA 5CYVA 3DCFA 2WAFA 4HQEA 1UAAA 4D7NA 3LFKA 3HG9A 2CS3A 1G59A 5J1UA 2PMUA 2LRDA 2RGVA 1GUUA 1MW7A 3OS0A 3GTJJ 1IJWC 1MBKA 2EFOA 3ZN1A 3C2HA 2DFHA 3IWFA 4AYBN 4OU0A 4EM2A 1UG0A 5LGTA 2EV0A 2V7FA 2ID3A 3ZMTA 3JRHA 4JBAA 1W4MA 1Z7LA 3I53A 3F8BA 1N75A 4FASD 3ZRGA 1R5GA 2GOMA 4Q48A 3NAUA 4RGRA 5HDNA 4N4NB 1HOMA 1LUJB 3T5XA 3HJEA 1LJ9A 1HSJA 3LSIA 4G7OF 3H1CA 4BEHB 4P96A 2DYSH 5LGNA 1FSHA 3CCYA 4Y52J 4P55A 1ZG1A 3C18A 3KPHA 1UMQA 1HDPA 3J81Z 3ASOH 3D5LA 1UHMA 4CYDA 1VQ9I 3IC7A 1I6XA 3LA2A 2NVXJ 3B6CA 4KISA 4FX0A 1SC7A 3K10A 2ZJPF 1QPMA 2VKVA 5IP6A 2R7ZJ 3OV8A 4WXCA 2HVSA 4UV8A 3REOA 2K02A 3I9V2 3IRRA 2M4GA 4MO7A 4C30A 3DLAA 1QRYA 1VQ7I 3GZ6A 1ZARA 2DA7A 2DDAA 3W2VA 5EYRA 2DMQA 3HSFA 1D1BA 2ECCA 1J7KA 1PYVA 4HG2A 3TO6A 1FSEA 2R7QA 4AD9A 5ILSA 2DT5A 2YR2A 4LIVA 3GW2A 2MW8A 3FK6A 1K7AA 2OUMA 2XDVA 3WTSC 1MJBA 1ETQA 2MYSA 2RQPA 4F7ZA 1LNWA 3EUAA 4OMYA 4HW0A 1TW2A 1FWZA 3C2BA 1Z3XA 2R7DA 1F1ZA 2ME6A 1HW2A 5J3LA 3HPGA 6PAXA 1ONVA 2BYVE 2XROA 4ZYGA 3KYLA 5DD4A 5E17F 1B1BA 3D5SC 4TV7A 2OV7A 1J09A 1FBUA 2VKDA 2VXZA 4HBLA 2E2HJ 1WZ2A 4OMZA 1HXDA 2ECBA 3OY9A 5BOXA 1BI2A 1ORKA 5K7HA 2LD5A 1G4DA 5LLQA 2X1DA 3EUKL 2ZJ2A 1E0EA 1QZEA 3KP3A 3E5UA 1D1CA 2GWRA 1HSTA 2QQ9A 3H5AA 3H9GA 3I71A 1PUFA 2PFBA 3PNVA 5DCMA 2LY2A 3RQ4A 1Q1HA 2O0YA 2W4SA 1MKMA 3NWSA 4P9FA 3CCVI 5HS9A 2AHQA 3ZQGA 2K9SA 2WB1A 3JW4A 1XPXA 1HW1A 2A68F 4RAFA 3BWGA 3FMRA 4XSZF 4RA2A 3BCAA 3E6CC 5FO5A 2Q1ZB 3IKVA 2M2EA 3TOAA 4HRIA 3HKZA 2KLOA 2XGEA 4EGZA 1IUYA 2X0LA 2X9DA 2EPFA 2W85A 4O6JA 2NYXA 3PFIA 3O8GA 1S5LC 2OPTA 1UELB 1W5CC 2ACJA 2COMA 2Q2EB 2VPRA 1K6YA 2L3DA 5LEJA 3GLXA 1YW9A 3KP5A 2BGCA 3L1PA 5IT9K 2KJBA 3M4OJ 3G71I 2GBYA 3FHZA 1ERDA 2DK8A 3TDUC 3H35A 3CESA 4L0ZB 5JHFA 1F36A 3KP7A 3HUGB 3DKWA 5GAEJ 4ABZA 1TBXA 1MIJA 4FX4A 2JT1A 3DBRB 2WY8Q 3M1EA 3JAMZ 3K70C 2R7VA 2DA2A 2I8DA 3U1KA 3DLLF 4NC8A 1ZH5A 2FD5A 3ZQCA 1XDUA 3L00A 2CQQA 2ZXWH 2EK5A 2JUCA 4G8XA 1OCZH 1FYMA 4GO1A 2CW0F 1MMGA 1F43A 3CLQA 1PVEA 2GXBA 3FM5A 4PFOA 2XHKA 4U88A 5HDKA 3IAS2 3P9KA 3NQOA 1W7PB 5LGUA 2JMWA 5LD2C 4RBOA 5IYDJ 2HZTA 2XAHA 4I01A 4L9TA 4KN4X 1WHUA 5DTDA 5GTIC 2VOPA 2XRLA 1DPUA 2WADA 4Z6YA 3GZ5A 2LNBA 1WGXA 2LP0A 3D5RC 1HW5A 2E35A 2MH9A 1WI3A 3KZYA 1MDMB 3PUBA 1BC7C 1S7OA 2P7CB 3OS1A 4MQVA 2BEOA 2L4AA 2QYOA 1F9NA 4BU2A 2LR8A 1B9NA 1MNDA 3H0DA 3M9AA 2V1DA 3S17J 2XKPA 2ZNYA 2JTVA 3NEUA 1JUMA 4GYGA 5EEHA 3SYTA 3GTGJ 2K3PA 3KLNA 3JRAA 3GFLA 3DTIA 2M4KA 2TRTA 4YFXF 2P8TA 1OCPA 5FD6A 2R7UA 1BM9A 3NARA 1K78A 1B4AA 1D0ZA 3HIFA 1IG7A 4MTEA 3WGIA 4XLHA 5IT9Z 1QU3A 1Z3YA 1S29A 2LTPA 1KGSA 3A03A 4BQQA 5J4VA 4FT8A 1AOYA 3DPUA 2LG4A 2HPMA 1SAUA 2HI3A 4A3JJ 1Y39A 3ONQA 3HOSA 4IRGA 5F08A 4BEHA 4AUXA 2JZYA 3DTEA 2Z9OA 3FXMA 2ZMEB 2L7ZA 4IHVA 1OISA 3G3ZA 3QYBA 1LEAA 1AKHB 2VASA 3M1CA 4KA4A 2HOAA 2FQ4A 2JVGA 3K9TA 4NC7A 4L5IA 1IAWA 2HYJA 1SD6A 4V19K 1TQIA 3DF8A 2FNPA 2KDZA 2M0CA 3S1NJ 2AO9A 2PN6A 2Y0MA 3DPTA 4CZCA 4PGGA 2D2WA 1RC9A 2KISA 2UXNA 3WGHA 2MBFA 3PIOF 1AWCA 3ZQQA 1XMAA 3FBIB 3LSTA 2KRCA 4BUPA 4N9HA 2ZJRF 2P6SA 1MSFC 5JI6A 2R92J 2X4HA 3CO7C 3OL4A 3KFWX 3FM3A 1MNEA 2JPCA 2CQNA 2OCCH 2RC4A 4XORA 3I5UA 1ZELA 4KDPA 5BPIA 3HUGA 2K85A 1K4TA 3FXQA 3K2AA 2E2IJ 4CGZA 2X6XA 1ZGJA 4I02A 1D0XA 1TWHJ 2OQGA 2HPIA 2NXNB 3ML6A 4YG2F 2HWVA 2EIJH 3OYBA 4MHGA 5JFRA 2IS6A 2L01A 3SZPA 3MQ0A 3K4NA 3KZIC 1R22A 2NAZA 2RREA 4Q4ZF 1WWXA 3VYTB 1ZG5A 4F92B 1Y1WJ 5FROA 3CMEI 2HQAA 2VT2A 4RGUA 4UUSB 2KIQA 3Q3SA 1TWAJ 3H92A 3F21A 4ZZLA 4KIGA 4BDZA 3I59B 2M87A 1FX7A 2IA0A 2LVSA 1X1CA 1CQTA 3WHCA 3FKIJ 2E5NA 1X58A 3K4LA 1J0RA 1QQIA 5JHUA 4M9XA 5CJ9A 2HS5A 1MBJA 3A4CA 3DKXA 3X2QH 3BTCA 1R1UA 2FF4A 2GQQA 4UV9A 4Z2YA 1YJNI 2DOEA 3JTHA 4MEXF 3HXLA 3DFGA 1PUFB 2FMLA 1N25A 2BXYA 4EVIA 4YIRX 4ZYDA 3CCUI 5CKTA 1FMVA 4XLNF 4NQWB 2FBHA 2JRMA 4B4CA 2O61A 4AWXB 4CCJA 5D5WB 2CUJA 1L0OC 4ENKA 4PCQA 5HNFA 1NK3P 2QSGX 2QZ8A 1AA7A 4XRMA 2KL4A 3ZCOA 2DAOA 2V79A 4RB1A 2E1NA 4G6DA 3HTUA 1XSXA 3TBIA 4A93J 5M3MJ 3FXOA 4UVBA 1OR7C 4XSXF 3W6VA 4KT6A 4QLCU 5LRSA 2A5WA 4XR6A 4UHTA 4RM2A 3DBHB 1AHDP 1ZRCA 4IRIA 4RLFA 3WTXC 2PG4A 5K5RA 5FRNA 2QM3A 1VQOI 2FJ1A 2PMZA 2Y75A 4U7DA 5IYBJ 1RIOH 2HKOA 3BR5A 1ZRDA 3SJMA 2XAJA 4UUTA 1E17A 4B3XA 2CSOA 4A3GJ 4BAYA 5L3EA 2R7XA 3GTQJ 2FOWA 3HGYA 3RYRA 5DS9A 2R5ZA 1R4MB 3WG7H 3PJRA 4W1UA 2XASA 4LK0F 1EKEA 3BG5A 5J40A 1MGTA 4A3CJ 4UNOA 5B5EC 1FYLA 3FXKA 2F5CA 1XD7A 1SANA 1LB2A 3BTJA 4MEYF 3GWZA 3KEYA 2RNJA 5EDNA 4XKBA 4M9ZA 3FISA 4WX9A 5D4RA 1XGNA 3LSRA 5E3MA 5TGTA 1S6LA 4WF2A 1T98A 2HKXA 4U0YA 4LG0B 1ETYA 4YIFA 2LKXA 1YITI 2VONA 2BW3A 4XM3A 3VYRB 1U0JA 4BJ5C 1LE8A 2WV0A 3CCJI 3WU0A 1MSEC 4BXUA 3EUHA 3Q0WA 4ESJA 2E7WA 1IV6A 3JSPA 3IKTA 1BW6A 1EH6A 5ED4A 2DT7B 2EV5A 3KP6A 3BQYA 4RM3A 2LK2A 2BY1A 3R4KA 4M73A 4IHWA 2K9LA 2JSCA 4XBFA 1HKQA 4AVPA 4HEA2 3HC7A 3KE2A 5K5OA 2ZBKA 1OR7A 5EG0A 4LLNA 3MWMA 3JRDA 2WY7Q 2DCEA 2MLKA 4HX4A 3ZMUA 4BHPA 2WC2A 2PJPA 2HR3A 3CJRB 4CCNA 2RAEA 4M72A 5FKMA 2HDCA 4IHYA 3A0BC 1TZLA 2QEXI 2Z1DA 1IDZA 3F0CA 1QNTA 2STTA 1D0YA 1YYVA 4M3EA 2HNHA 2GXGA 4LFUA 4PJJA 1RR8C 3HOWJ 5HLTA 1LFUP 3K7AJ 2HQNA 4YFKF 2FMYA 1A35A 2N8GA 2L9SA 3RYPA 3W2AA 4OIQF 4M74A 2NNYA 1WPKA 2EA2A 3HYIA 2DLLA 2DMTA 2K40A 1BIBA 2ZO4A 1FBSA 3M8JA 3E5XA 3CLOA 1FIAA 1G2HA 2E71A 5CQGA 1X1DA 1MMNA 3S3NA 5C4JJ 2MC3A 3ECHA 1LE8B 2QVOA 2XF6A 2KHMA 1YQAA 1ZGAA 2OCEA 1IRFA 4RS8A 5EG0B 2DW4A 1UCRA 3BC8A 3MN2A 3QU6A 5D8LB 5EGOB 1A6IA 4W97A 3JAMK 5KVRA 1WJAA 1GLNA 2B0LA 1WVRA 4E70A 4KITB 3Q9SA 2VJJA 3V7SA 3E6BA 1Q1VA 2B9SA 2KJCA 4A5NA 1FP2A 3FXJA 2CW8A 2DXIA 4ESBA 3N97A 2CMPA 3S14J 4S05A 4L9JA 3BR0A 3P5JA 3PSIA 4IJAA 4KYWA 3CMYA 2H27A 2X85A 2IAIA 5IYCJ 1AU7A 2LY9A 2CQXA 1U5TA 3QRFF 4LLGF 1RNLA 4PSWA 2W84A 4Y4RA 2Z33A 2EWNA 4EJTA 2H09A 1TW3A 3BLYA 4HV6A 2R7OA 2H1KA 4XONA 4ZJZA 2EINH 2WAQN 4WXDA 2M9HA 4IZZA 3LQRA 4A0YA 3HTSB 4D7MA 2BVLA 2Y0SN 3C3WA 1TQPA 3K69A 3EYIA 2XGXA 3KLOA 1ZGWA 2O8KA 4OAYA 1PUEE 2LFBA 4AC0A 3SEQA 1APLC 2AXLA 4DZJA 4XN3A 4J01A 1BI3A 3V7RA 1UHSA 1FYKA 1IZ1A 1EJ9A 2ZXJA 3WTVC 4CCLA 1DP3A 5FKOA 3M8EA 4OIOF 1MMAA 3HHGA 1XCBA 5E20A 3OOPA 4PGHA 4H0EA 4G7HF 3O2PE 4ESFA 1FTTA 4HPQA 2A61A 1P7IA 1HBXG 3ZMSA 4L18B 2P6TA 3HZJA 2JA6J 2QQ8A 3HSEA 2VBZA 3DTKA 1JTXA 4GCVA 2P5KA 1POGA 1CF7B 4NB5A 1T8IA 3IH3A 3LFUA 2QCOA 3CQZJ 3S2HJ 5A2QK 2R93J 1XDSA 3E0JB 1USSA 1KZHA 1A6QA 1Z6RA 1UJ8A 5H20A 4A5MA 4BHCA 4C2MJ 1OPCA 4QPQA 3J7YJ 4IXAA 5EZHA 4NBQA 2Z99A 1WRJA 2L7KA 3BJOA 1FPQA 1FOYA 3CJNA 1EH8A 1LDJA 3GEZA 1MD0A 2BW3B 2IS4A 3F6OA 1SD5A 4B8XA 3ZQ7A 3FHNA 4GYIA 1IV8A 1WJEA 2W1OA 2CYYA 4EJUA 3GFIA 2XAUA 2DU9A 3CJTB 5FB2A 1PP8F 4FTHA 3T8RA 2H8RA 4NQWA 1LQ1A 5CVVA 2W57A 3FXLA 1P4AA 2VQLA 4BE2A 1YX5A 1BOAA 5E3OA 4IKFA 4OIPF 1J5YA 3OYLA 2D1HA 1A5JA 2CUFA 2WTEA 5JLWA 3OYFA 3K70D 2DJNA 2BBYA 1IRZA 2VKEA 1G3YA 1SMTA 3Q0UA 3A01B 1QVUA 2JPBA 3EETA 1IC8A 4QWQA 5D5UB 3R0JA 3V8JA 3WTUC 5D5XB 1GV2A 3RZDJ 3ASNH 1BL0A 1S72I 3PO2J 4JQFA 2MLGA 1DU0A 3SDGA 2PQ8A 3WU1B 5KCMA 1ZREA 5HDGA 3KEOA 3PL8A 2K9MA 1OFCX 3GUDA 4LJZF 2YX7A 2EZIA 2ME0A 5E1XA 2IBDA 3W3CA 2KQRA 3I56I 1XSDA 4OINF 1JKPC 4XK4A 1P9QC 1P7JA 4ON0A 5L3FA 1QVTA 3G1MA 4N9IA 4R1HA 2AS5F 4XQFA 3M3YJ 4AM3A 3U9GA 3OYJA 3CDHA 3BZCA 3ERED 4DNCA 2BHZA 1JKRC 2LDUA 3GZNB 3ZP5A 4F91B 2DMNA 5DUIA 1WSUA 2NVTJ 1H0MA 3ZOBA 5LRRA 2KFDA 1T0FC 3I64A 1BA5A 1SMYF 3BT9A 1ETKA 2HOEA 3BG3A 1U5TB 3JRGA 3C7JA 1X4PA 4GGGA 2A5YB 4RB3C 1TL8A 4JP0A 5AIPA 4K2EA 4O3MA 3ABLH 2F4OB 3CCLI 5FKLA 3RSNA 2I5UA 3KX2A 1W36C 3BR1A 2HTJA 3LSHA 2QBYB 3LAPA 4S0HB 1U6GA 1SD4A 2CQKA 5F6FA 5BNGA 5B1AH 3CD6I 1D5YA 3GTKJ 1T08B 1ULYA 3QODA 5IP9J 2OZ6A 4KT5C 4BACA 2L02A 1JXSA 2MA3A 4B1RA 4M6YA 1X19A 4CICA 3J81K 4AYBA 3IWZA 3OYEA 4DJAA 1YO5C 2BY3A 2QSHX 3R61A 4Q47A 3OIQA 1R1TA 1VQ4I 5DYMA 1T56A 2EB7A 3E5QA 3OSGA 2E19A 3DXJF 2JVHA 2LH9A 2PBIA 5F0HA 4G7ZF 3U1DA 4IOAF 5TRDA 4MNUA 2DFFA 2WAEA 1R5HA 5KK1A 5J1RA 1WJ5A 1T95A 2E36A 1O7FA 2CW7A 2DYRH 4G6TB 4L9VA 1ZR4A 1QBJA 2QBYA 3VYSB 3FIWA 3E7LA 3DU6A 2UV1A 2IXSA 4HF1A 1ETWA 2FOKA 1PP7U 4G6QA 3MMYB 1QZZA 1USTA 3MEXA 3AL0B 3FF5A 4JX4A 4B47A 5BS6A 2V6CA 3DEEA 4F55A 2VN2A 3HDDA 3K6GA 1XG1A 3GVAA 5FLVA 2ZJQF 4KFCA 2QLZA 2EZHA 1OCRH 1OCCH 3A1YA 5E8GA 4JX5A 3J7AO 2ISYA 3ZQIA 3OYDA 3OYHA 2V1UA 5FFZA 2K3FA 4J19A 2LKPA 2VKHA 2HDDA 1EF4A 3KP2A 5HNHA 3K1MA 2ZMEA 3LSKA 2VE8A 1XGOA 2NOGA 3W2WA 4B43A 5EF6A 1KA8A 4BE0A 3RPUA 1OJLA 2OF7A 4BE1A 2O8XA 1KU3A 4DGWB 5H2FC 4OIRF 2ETHA 2H6BA 4IHXA 2FRHA 1JKQC 3KYDB 2ZSHB 2XGDA 3IHUA 1O57A 3OIOA 4V2FA 1UFMA 5C4XJ 1RZ4A 2HDWA 3BJ6A 1NHAA 2CWEA 2V4JC 2ZC2A 3P9CA 1GT0C 5CVIA 1Z77A 3N05A 4D0PA 4DBQA 2K4JA 3BZKA 4E4HA 2KIMA 3DPLC 4PJMA 5DM7F 3OS2A 3G6EI 1O3SA 1X2NA 2RKHA 2XPWA 4PFPA 4ZYHA 2BE5F 1R49A 1FMWA 3K4JA 4X6AJ 4DBRA 1BI1A 3HM5A 4XLCA 3EQLF 4M3BA 3IV5A 2XIGA 3F72A 3OL3A 4BL0B 2EZKA 2QWWA 4A3BJ 3H36A 4B3AA 2QA4I 4HSTA 1MH4A 2VQGA 1H9GA 2OZUA 1N77A 4IEJA 5GPCA 3M7GA 2HEOA 1IXCA 1U78A 2KRFA 1LDDA 3T0YA 1H89C 3F8NA 2DMUA 5CLSA 2OQRA 2XSJC 3HOXJ 1BOBA 1VQNI 3ZQLA 1C0WA 4N0BA 1T2KA 1VZ0A 3H5NA 2WWYA 1W7PA 3F8MA 2DJIA 2QKLB 3O8HA 5F0FA 4E7ZA 4BYYA 3JSOA 3FMSA 5FRMA 3P9IA 2P0WA 1NG7A 1LEBA 3E3VA 3M8FA 4BXFA 5GAHJ 1KQ0A 4LD5A 2HU9A 2Y69H 4U0VA 3I0TA 4G94A 3HOVJ 2RVCA 2DTZA 2VC1A 5BQTA 4FHTA 3WG9A 3RI4A 1O4XA 2Q0OA 1MMDA 3GX4X 3CF5F 3OWTA 1I3QJ 4P5OA 2RQQA 1YIJI 1YG2A 2DOAA 2V9VA 3RCOA 2CO5A 3AAFA 2ESNA 1ODDA 4XLPF 1FEXA 1RUOA 3OYKA 4A3MJ 1GXPA 5DEQA 1AKHA 1X3ZB 4KIBA 2OC6A 3E6MA 3TO7A 4E7KA 1ETVA 4WCGA 2W00A 1IN5A 4X0GA 3GTLJ 2DA5A 3LSMA 2Q8KA 1OMIA 2EILH 2GA1A 2QENA 4E6KG 3GLLA 1WJCA 2DQRA 1R58A 3S8PA 4LK1F 4BDYA 1OCTC 1X3WB 2R7SA 2QSFX 1JT6A 2X6YA 4CO8A 1MNMC 1ZRFA 1G3SA 4N4OB 1MBGA 3HPHA 1ITYA 3M07A 1D3YA 1I5ZA 2XAQA 1Z7UA 3T1BA 2H94A 4R79A 2HTSA 2W7NA 3EDPA 5F64A 4Y3OA 2HQRA 1B72A 2R7FA 3LAJA 3TO9A 3PO3J 2HOSA 1MJAA 4XOTA 3JRIA 1R7JA 4YRVA 2XB5A 2R5ZB 4YIIA 3LSJA 4HNTA 4G9YA 1U2WA 4OWRB 1XMKA 5F1RA 2F4IA 3C2GA 1YX3A 4XLEA 4BQOA 1GVJA 3ZMDA 3S1MJ 1JT0A 3PFYA 4RAYA 3BZ6A 4JYKA 4CCOA 1P4WA 4H4KC 5DV5A 1X1AA 2L4MA 2F5DA 4ENMA 3I54A 5F27A 3V8KA 1VQMI 1X2MA 4B09A 1B9MA 2OTLI 1HC8A 4Y7NJ 1YFHA 3UNGC 4WWCA 3ZGKA 5FJ8J 1ZN2A 1IXSB 4XOPA 5M5XJ 4JOMA 3Q9VA 5AONA 2DFIA 5HLGA 3A0HC 4RAGA 2VB6A 2L0KA 4IX7A 4LG0A 3IP4B 1S7AA 3SZTA 5H6RA 3LSPA 1DU6A 4ASNA 1YHQI 4HLXA 2KDOA 2V9PA 1E3HA 2XV4S 2XAGA 5AIQA 3OYNA 3R60A 3DU5A 1LVAA 4II3A 2PJRB 4NUBA 4XL9A 3CTAA 3CC4I 3CP8A 5DM6F 1I39A 2DA1A 3R0AA 3MFKA 2K86A 3S15J 2ESHA 4C3HJ 4EV0A 5GAGJ 3W6JB 1ZHFA 4L9NA 1VQKI 1OCOH 2FBIA 2W48A 3OR2C 2ZMEC 2M0MA 2HXOA 2TDXA 3QYFA 5EGOA 2YSRA 3SZGA 3WODF 1E3OC 4XKWA 4QSHA 2LBFA 2GAUA 1ZKGA 4UUSA 1R23A 1WCMJ 3VODA 3QP5A 5KAFC 3HKZN 1I1SA 1R4NB 3NWTA 3KIOA 2NS7A 2L7MP 3I4MJ 5KHDA 1W36D 2HFHA 4ZTJA 3CC2I 2RDPA 2XRNA 3IUOA 2Y0SA 2BVMA 4NDLA 2OAZA 4LGWA 2W82A 5FGMA 4X1EA 4EM0B 3TL4X 4Y33A 4EJOA 1HQCA 1VQ8I 1FZPB 3F8CA 3FK7A 3AG1H 4RMNA 5E18F 5ILVA 2YPRA 2DN0A 2E7XA 3BY6A 3SDBA 1V55H 3EYYA 4QIWN 5F04A 3H3UA 3KYCB 2EFPA 4FE7A 5CVRA 1TWCJ 1HKTA 3HOYJ 2Z5UA 4RGXA 5K5QA 3BP8A 3CZ6A 4LITA 2H1LA 4UXNA 2JK3A 4FQGA 1QA6A 2O9LA 2XPUA 2E1CA 2FNAA 1JJ8C 3BQZA 4I6ZA 3HGGA 3EPZA 3WGGA 2LC2A 3G1OA 2KMUA 2OA4A 2QQBA 1R6RA 2O7OA 3JRFA 4Y17A 4CSWA 4BY7J 2Y9ZA 1R71A 3V4GA 2ISZA 4MQ9F 4BJTA 4ZDOA 1QHGA 3L2QA 2M8EA 3JR9A 1R36A 4DYQA 5B66C 4I99C 3TGNA 2L9RA 4P9UA 1KU7A 2E34A 1OYWA 3ELKA 4CYCA 5IP7J 1WKMA 4KNYA 2IEKA 3A02A 2VPLA 4AIHA 2FA5A 2P81A 3UR3C 3CCRI 2YX4A 1U8RA 3IRQA 1FNNA 1CF7A 2LY1A 2ZXIA 3ABUA 3RTRA 3G73A 3F9KA 2R7WA 1ON2A 3S2WA 1T39A 1V5GA 5JVGF 4ZDPA 4I76A 3BR3A 5E1WA 3TDZC 2DQLA 2MFZA 2X51A 1GVDA 1K4SA 3V8LA 4I09A 2FU4A 1K79A 4C2TA 4GDFA 2VUMJ 3A2KA 1STZA 3ZQFA 3G1LA 4LLLA 4DYCA 1NK2P 4C2UA 4A0ZA 1GHCA 2M45A 1V5FA 1WFXA 3OR1C 5TISC 1KU2A 2LLKA 2P5LC 2IVMA 3N4MA 3TP0A 1WJBA 4J00A 3ABMH 2Z16A 3VFZA 5F1JA 1R1VA 1RRJA 4ZYEA 1LPQA 5E3NA 2W24A 3HEFA 1CGPA 2VOOA 4EEFG 4FCYA 3MCZA 2IRFG 1TTYA 4ZTFA 2ELKA 4PJNA 5LEKA 2Y30A 3L2WA 4M6VA 1MZBA 4CUGA 3QPTA 4ZZDA 3CO6C 3Q5FA 2ZSIB 4CH7A 1N78A 3KCCA 3B02A 1IN6A 1ENHA 2FE3A 2K4BA 2FUG2 3J80K 1QO0D 1QPIA 1W0UA 1ZTRA 2HVQA 4RLQA 1JHFA 2EFNA 1XX5A 1Z0XA 4XRSG 4M3GA 3I3LA 2D1VA 5GADJ 1ZQ3P 4XRFA 2PI0A 5D4SA 2QF7A 1A36A 3F3XA 2DBBA 4CA0A 3I59A 3FKJA 5E3LA 1SFOJ 2WAQA 3OSFA 2YUSA 3PNYA 2R5YA 4DIQA 4CYCB 1P4XA 4HNUA 3PM1A 1RR7A 3CUOA 4ZYAA 4A3IJ 2NOJB 3ROUA 1IRGA 1OLTA 3H5RA 2VIXA 4BJ6C 3UKGA 5DD8A 2LKSA 1LKXA 3BPXA 3HRTA 3I4PA 5JVTA 1YJWI 2AXTC 4HQMA 2LBFB 2MSYA 3COAC 3RPUD 3VSKA 3LWFA 1DGWY 2EFQA 4YFNF 1FP1D 4YELA 5IY5H 5HODA 3BCBA 4PK4A 4IOCF 1R5ID 3VOEA 4D5CA 1YW8A 5E1ZB 3OYAA 2LF7A 3PNTA 3PUFA 1IXRC 3T8TA 2OBPA 2MD5A 3F23A 1O3RA 1Y8QB 4BQNA 3L2VA 4HDVA 2Y31A 3QPHA 2EQRA 1SD7A 2HYGD 3NRVA 1U9NA 4MGRA 3WTZA 2O6GE 2OTJI 2JWTA 1Y56A 2FEZA 3S16J 3GFMA 3FMQA 1O3TA 4D1QA 3VEPA 5FKNA 1DUXC 2CU7A 2LF8A 3PQKA 1FJLA 4YEJA 1R9TJ 5KNLA 3RQIA 2CV0A 2KZGA 4R8HA 2ELJA 5EEGA 3CMAI 4ZC3A 2DTRA 4BQAA 4UVAA 3FBNB 1YW7A 1B8IA 1OQYA 1HLVA 3BG6A 4E7LA 1RPWA 1IUFA 4PSXA 2X1CA 3WHBA 1EV7A 5J6XA 1XGMA 2JA5J 1B59A 1E2XA 2F5EA 2M34A 1BR1A 4A12A 4ITVA 1YRNB 3PIPF 3SHFA 3LSGA 4QPOA 2BY2A 5J4YA 3S93A 3GFJA 2GIVA 2GLOA 1VQLI 3DKYA 4C3JJ 2PLYA 2GM4A 1TT5B 4II2A 4M71A 2G7HA 5M5YJ 1IN4A 2PMZN 3CP2A 5HLIA 2O3FA 3AFHA 3A01A 4A3FJ 4C3IJ 4E7HA 2EIMH 2IGKA 4XNFA 1E3PA 2VQHA 3E1SA 1FOXA 4EJVA 2E1MC 3U2RA 5J8CA 2KZVA 2CFOA 1YTYA 4HZFA 1BIAA 1G8XA 1YS7A 5K1YA 2V6EA 2MD0A 3CF2A 4I98B 3VWBA 1Z6TA 1YI2I 3MZHA 4F3QA 4HSRA 1D8KA 2KT0A 4CCKA 1SAXA 5BMZA 1U8BA 1NG6A 1MBFA 2DI3A 2D45A 5GPAA 1MDMA 4KICA 2IP2A 4OAZA 3B6AA 2F48A 2NNNA 2I10A 1J2XA 5KAIC 1I27A 4HNVA 2PMHA 4LIUA 2QQAA 2L9NA 1Y6IA 1JKOC 2G0EA 5DUKA 2CFXA 4D9JA 2XGCA 3SEZA 1FOWA 2H8WA 2DODA 4KUMA 3HRMA 1MBEA 1UB9A 2ID6A 1X3UA 2KIFA 3VSLA 1HCRA 4ZH4F 1Y1VJ 4CDGA 3MD2A 1IN8A 5FLXZ 3BTIA 1O3QA 5H6QA 2A69F 2HVRA 2IS2A 4A0XA 1MBHA 4EM1A 3RKXA 1W0TA 4XICA 3PQJA 4HF2A 2R4GA 1IDYA 3H0GJ 2A07F 4JK1X 1JUPA 4EGYA 5CVUA 3CUQA 1KYZA 1S8NA 5C3EJ 3WTTC 2MGQA 3AKZA 1XB4A 4XIDA 4BBRJ 3GMEA 4BNCA 2PEXA 2EFWA 4CCMA 4D5FA 2M8GX 1UZCA 2XF5A 1KONA 2DA4A 5EJCA 4RAZA 2M7AA 1KU9A 5HS8A 3K1NA 5L3CA 1JGGA 4XRSA 3QU3A 5JR3A 3OYCA 2CQ7A 2UZKA 1RKTA 2J5PA 2X1EA 2BV6A 5L3DA 3K2ZA 1K6OA 4DYRA 2D5VA 5LFAA 4HOBA 3R6SA 3S1QJ 3OOUA 3FZVA 2NRAC 4A3LJ 4AIKA 3K4BA 1U3EM 4ENJA 1BR4A 2VBXA 2V26A 2YS9A 1OKRA 1YIOA 2VLAA 1ETXA 2VC0A 3S3OA 4LOCA 3BPVA 2DMPA 2LMDA 2M30A 1I50J 2IA2A 1K61A 4HA8A 1KQ9A 3QYEA 5CVJA 1BR2A 3RIRA 1HF0A 5D5VB 2NS8A 4FISA 2VQCA 2CH0A 4XLFA 4IRHA 3BG9A 2XAFA 3G2BA 3BTLA 3K4CA 3U21A 3CCSI 5EEAA 2EV6A 4EJWA 3I55I 4BY1J 4A6DA 1W1WE 5ERIA 3GCMA 2A05A 4F52A 5ILUA 1S9HA 1FC3A 1PJRA 1X1BA 3LL7A 1F4KA 4RB0A 5FFXA 1ZK8A 4I0BA 2VXDA 4IHTA 3TOBA 1T33A 4IQJA 1RKWA 1Z05A 1WJDA 2XVCA 4KMFA 2P4WA 2DFEA 2HGCA 4EQQA 3ABTA 5HVQC 3ZQHA 2K9QA 2V1XA 3VYUB 4CZZA 1SVMA 1JJ6C 1U9OA 3LNQA 2NS0A 2BHYA 3GTOJ 2DK5A 2BY0A 3DQVC 2GZWA 2Y2ZA 4JX6A 5FD5A 3ESWB 4HLYA 3AG4H 2J5OA 1SVOA 3AL0C 5E8IA 2C6YA 4PDKA 2LOOA 1TWFJ 1XGSA 4BHBA 3K0LA 1H9TA 1MH3A 2GXAA 4A3KJ 3OYIA 5M5WJ 2ZXHA 3FXRA 3LOCA 4U7BA 1OYYA 2IPQX 1ON1A 2P5VA 2E1MB 3QWLA 3MKWB 1FTZA 1XS9A 2WV1A 4KJZA 2FBKA 2UWMA 1YLFA 3LMMA 3ZR8X 3GTMJ 3HOTA 2HQ5A 2XKOA 4GRIA 1W5TA 4BH9A 2COBA 1DDNA 1WQ2A 2P7VB 1YRNA 1HKSA 3RJPA 4HV5A 1TNTA 5LBQA 3JRCA 2VE9A 1ETOA 4IO9F 1HDDC 4HDUA 2O03A 5L3BA 1JHHA 2LREA 4RB2C 1MJ9A 1P92A 3QAHA 1B8IB 3CCQI 2FXAA 4XMYA 3JREA 3RKWA 4GXOA 5IOYA 1YE9A 1JI8A 2UXXA 2JQ7A 2B7EA 3SFZA 3CUQB 1BJZA 3G4SI 1G3TA 4LG3A 3I58A 3CDIA 5K7ZA 3H9QA 1XTAA 4AIJA 1MMSA 4BBSJ 2JUGA 2XUBA 4XKVA 5CQEA 3DP7A 3RZOJ 5IT3A 3HRSA 4MIMA 4EMSA 2K5CA 1T6SA 1TQMA 1IW7F 2F4MB 2ZNZA 1FOKA 5B3SH 3ZMVA 1K83J 3ULQB 2RNGA 4AU7A 9ANTA 5D6FA 3S3MA 3RDIA 2CG4A 1H8AC 1DPRA 3BDDA 3D0SA 3BG7A 2BZTA 3V42A 4BGDA 3LA7A 1KQ8A 2A3SA 3OYGA 4M6XA 1TLHB 2DT6A 1GV5A 2CJJA 3O3KA 3MZYA 1JGSA 1VF9A 3FDYA 2KKOA 2NVQJ 5ICGA 2XSDC 3TP3A 2JA8J 4XLAA 4HF0A 1DGRM 4PUSA 1XCVA 2HOTA 5HLHA 2GIZA 5L3GA 1VQ5I 1IF1A 1J9IA 3TW7A 2W25A 4BKXA 1K78B 3QQAA 4C9YA 2HXIA 2JA7J 4UUVA 2MH2A 4PJLA 1LFBA 4PJ0C 3ZN0A 2ZCWA 1Z9CA 1IGNA 1V54H 3RPQA 3KETA 1BJAA 3QPSA 4NC6A 1VQ6I 5DCMB 2EJRA 1ZG3A 1IO2A 3JRBA 1XC5A 3J7ZI 5LHHA 2DOFA 4IHSA 4M9SA 2Y9YA 1SEUA 5IPAA 3MKYB 3IH4A 2VL8A 3IH2A 1DQUA 3VB2A 4S04A 3WE3A 4MFDA 4UB6C 1QGPA 4LB5A 1G6NA 1SFEA 2ZKZA 1Z1DA 5FLXK 1WH5A 4GFBA 3FX3A 5D6EA 3I4NJ 2L7FP 2K9NA 2IJLA 4KMUX 1GDTA 2VI6A 3L9FA 2XF7A 3IL2A 3GTPJ 1FIPA 3AG3H 1S7EA 2K27A 2AQFA 3L7WA 3RKQA 2JN6A 1EH7A 4Y15A 4M3FA 3MKLA 3J7AY 1TC3C 2Y48A
chains in the Genus database with same CATH topology
4F91B 4NNJA 2WADA 1T0FC 2WBMA 4AVZA 4PJNA 3L2WA 4ZTFA 2BOLA 2X6WA 2GOXB 3D5RC 1X4PA 3PUBA 4CUGA 1QHHD 3OS1A 2ZSIB 4CH7A 1N78A 1X4OA 4BU2A 3OYMA 1MNDA 2M7BA 3RSNA 3K4KA 2XC7A 3H0DA 2UUZA 3KX2A 2FUG2 3OMYA 1W36C 2VJIA 3LSHA 2HVQA 4RLQA 3QODA 1V5EA 3SYTA 2K3PA 4BACA 4MLOA 3DWLE 2MABA 3I3LA 3DTIA 3GBGA 2M4KA 2PJRA 3L2RA 1X19A 4EATA 4CA0A 3ZXSA 3FKJA 2R7UA 4AYBA 2WAQA 2V1NA 3PNYA 4DIQA 3OYEA 1D0ZA 4DJAA 4HNUA 4ZYAA 2NOJB 1OLTA 3H5RA 2V9KA 2VIXA 3OIQA 4XLHA 4BJ6C 1QU3A 1Z3YA 2KP6A 1LKXA 4BQQA 2LBFB 3DPUA 3RPUD 2LG4A 3VSKA 1SAUA 2HPMA 2JVHA 3K4MA 2LH9A 3ONQA 2LYCA 1DGWY 3HOSA 4YELA 4BEHA 4ZDLA 3BCBA 4PK4A 2F5VA 3DTEA 2WAEA 2AQEA 3CJQB 3OYAA 3PNTA 3QYBA 2VASA 3M1CA 1WJ5A 2VJ5A 4BQNA 1T95A 2IGMA 3IAM2 3L2VA 4FETA 2CW7A 4G6TB 1EA3A 3VYSB 2JVGA 4NC7A 2R7RA 3DU6A 5CPRB 2UV1A 2F6CA 2IXSA 4XN0A 4B48A 3MKZA 1Y56A 3EUHC 3MMYB 3DPTA 4CZCA 2Z2SB 4D1QA 3AL0B 3PSFA 4B47A 3DEEA 4F55A 3ZQQA 3FBIB 4YEJA 4BUPA 2KRCA 3K6GA 3HL2A 5KNLA 4F93B 2CV0A 3OL4A 3A1YA 2ELJA 1MNEA 4ZC3A 2JA2A 2JSPA 1ZELA 4XORA 3OYDA 3FBNB 3OYHA 2E60A 3BG6A 2VKHA 4PSXA 4E7LA 2X1CA 4XKCA 5HNHA 2X6XA 3LSKA 1D0XA 2HPIA 3W2WA 4B43A 1BR1A 2IGNA 3OIPA 4ITVA 4BE0A 4IQ4A 4BE1A 3LSGA 4QPOA 3OYBA 4DGWB 2IS6A 2R7TA 3S93A 3K4NA 2RREA 2ZSHB 3DKYA 3VYTB 2HDWA 4F92B 5FROA 2V4JC 2HQAA 4II2A 2WA0A 3N05A 4DBQA 4E4HA 3CP2A 3DPLC 4PJMA 3OS2A 4U87A 4BDZA 3AFHA 4PFPA 1X1CA 1FMWA 3K4JA 4E7HA 1Z21A 4DBRA 4XLCA 1IRXA 4P1WA 2E5NA 2IGKA 3K4LA 4XNFA 1LVKA 2M3AA 2VQHA 3E1SA 3OL3A 2E1MC 4BL0B 3A4CA 3DKXA 2KZVA 3H9JA 3S32A 2CFOA 1G8XA 4HSTA 2V6EA 2IS1A 2MD0A 3CF2A 2IGOA 2VQGA 3VWBA 3HXLA 1N77A 4F3QA 4HSRA 2O5RA 3TMOA 5CKTA 4CCKA 1FMVA 4NQWB 1NG6A 4CCJA 1WJFA 4DOZA 2CUJA 2QKMB 4OAZA 2CV2A 2ZFUA 3QOEA 2XSJC 1BOBA 2A6TA 5HNFA 1AA7A 2KL4A 3ZCOA 4ANJA 4LIUA 1VZ0A 3H5NA 2CUZA 2L9NA 1Y6IA 2CV1A 2HZDA 3TBIA 1OR7C 4D9JA 2DJIA 2QKLB 4KT6A 4E7ZA 3SEZA 1HA8A 2A5WA 5FRMA 4XR6A 2P0WA 1NG7A 4RM2A 3VSLA 4BXFA 1LFPA 4RLFA 3MD2A 5FRNA 2HU9A 3VDXA 2PMZA 2HVRA 2IS2A 4E7SA 1MMDA 2R4GA 2KPMA 3OWTA 4P5OA 1SFKA 4B3XA 2RQQA 4E7JA 2R7XA 2DOAA 3RCOA 2MC4A 3AKZA 3OYKA 4E7IA 3PJRA 4CCMA 2XF5A 2L5QA 1KONA 2OC6A 4E7KA 2M7AA 5HOOA 3KEYA 4XKBA 3OYCA 2E5ZA 2W00A 4X0GA 4BS9A 2X1EA 3LSMA 4B44A 5TGTA 4E6KG 1WJCA 5LFAA 2BW3A 4XM3A 3VYRB 1U0JA 4BJ5C 3S8PA 3OOUA 3L2UA 4BDYA 3K4BA 2R7SA 2X6YA 1BR4A 2V26A 4N4OB 3HPHA 2VLAA 3S3OA 2DT7B 2L2OA 4RM3A 4R79A 1TT0A 2W7NA 4Y3OA 3QYEA 2K9LA 2VJ4A 1BR2A 2KRHA 4HEA2 3HC7A 1D1AA 1LDKB 4XOTA 3CMMA 2VQCA 2CH0A 2WAFA 4XLFA 1UAAA 2WY7Q 4YRVA 2DCEA 3HG9A 3CJRB 2CS3A 3G2BA 3K4CA 3U21A 4CCNA 4HNTA 1G59A 4OWRB 2F4IA 2LRDA 3C2GA 1YX3A 4XLEA 4BQOA 1TZLA 1MW7A 2Z1DA 3OS0A 3PFYA 4CCOA 3C2HA 4H4KC 4F52A 1D0YA 1X1AA 1S9HA 1PJRA 1UG0A 1X1BA 2HNHA 3LL7A 2V7FA 4PJJA 5HLTA 2VXDA 1Z7LA 4IQJA 1WJDA 1N75A 4FASD 3UNGC 2L9SA 3W2AA 3ZRGA 3ZGKA 2GOMA 5HVQC 4N4NB 4XOPA 3VYUB 3LSIA 4JOMA 4BEHB 3M8JA 2VB6A 4IX7A 5CQGA 1X1DA 1MMNA 3IP4B 3S3NA 2XF6A 2KHMA 3DQVC 2KDOA 3BC8A 3OYNA 3D5LA 3AL0C 3DU5A 4II3A 2PJRB 4NUBA 4XL9A 4KISA 1WJAA 1GLNA 2LOOA 3K10A 4KITB 3CP8A 2VJJA 2HVSA 3OYIA 2ZXHA 3I9V2 2M4GA 4C30A 3DLAA 3OR2C 4U7BA 2CW8A 2DXIA 2M0MA 2CMPA 3QYFA 3W2VA 2E1MB 3PSIA 3MKWB 1D1BA 3SZGA 1PYVA 4HG2A 4XKWA 2LBFA 4KJZA 2X85A 2R7QA 2UWMA 3LMMA 3ZR8X 3HOTA 4PSWA 4GRIA 4Y4RA 4LIVA 3NWTA 2OUMA 2XDVA 3BLYA 2R7OA 4XONA 4ZJZA 5KHDA 2MYSA 1W36D 4IZZA 3EUAA 4ZTJA 2BVLA 3IUOA 2Y0SA 2BVMA 2LREA 1Z3XA 2W82A 3HPGA 4OAYA 3SEQA 3TL4X 4Y33A 4XMYA 4XN3A 3KYLA 4J01A 3D5SC 1YE9A 1JI8A 2OV7A 1J09A 2VKDA 2VXZA 1DP3A 4CCLA 3OY9A 4RMNA 1MMAA 4LG3A 2X1DA 3EUKL 3SDBA 1E0EA 3H9QA 1D1CA 4HPQA 2JUGA 3H5AA 3H9GA 3PNVA 4XKVA 5CQEA 2LY2A 3RQ4A 3CZ6A 3DTKA 4LITA 2W4SA 3NWSA 2K5CA 3LFUA 2WB1A 2RNGA 3E0JB 4AU7A 3EPZA 3S3MA 2LC2A 2KMUA 3BCAA 4QPQA 2Q1ZB 1R6RA 4HRIA 3HKZA 2KLOA 4CSWA 2L7KA 3BG7A 3V42A 4BGDA 3OYGA 2DT6A 2BW3B 2IS4A 3FDYA 4BJTA 3FHNA 4ZDOA 1WJEA 2W1OA 1UELB 4XLAA 1QHGA 1DGRM 4PUSA 3L2QA 2XAUA 2Q2EB 1K6YA 4C9YA 2VQLA 4BE2A 1YX5A 2VPLA 4PJLA 4IKFA 1ERDA 3OYLA 3H35A 3CESA 3UR3C 5JHFA 2LY1A 3HUGB 2ZXIA 3OYFA 3K70D 3RTRA 3F9KA 2R7WA 1V5GA 2WY8Q 4ZDPA 3K70C 2R7VA 2I8DA 3MKYB 2MFZA 2X51A 2VL8A 4NC8A 1DQUA 4JQFA 4C2TA 3A2KA 5KCMA 4C2UA 3PL8A 1V5FA 2K9MA 1WFXA 3OR1C 1MMGA 2XF7A 4PFOA 3W3CA 2KQRA 1WJBA 1P9QC 4J00A 2AQFA 3IAS2 4XQFA 2Z16A 3OYJA 5LD2C 3J7AY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBI B;  3FBN B; 
#chains in the Genus database with same CATH topology
 3FWE A;  4KN7 X;  4I2O A;  4NNJ A;  4QTR A;  3CCE I;  1SVL A;  2DA6 A;  3GYH X;  3B73 A;  5ICF A;  5DDG A;  2WBM A;  4AVZ A;  2BOL A;  2X6W A;  2GOX B;  1RET A;  1Y8R B;  4CHU A;  3CDL A;  1YOV B;  2QUF A;  4U0W A;  1QHH D;  3FXU A;  1VFC A;  1X4O A;  1I3A A;  1ZLJ A;  3OYM A;  2M7B A;  2XC7 A;  3TED A;  3K4K A;  1T38 A;  2UUZ A;  3OMY A;  2ELH A;  2IA1 A;  3K1P A;  3CC7 I;  2X6O A;  2VJI A;  4DW6 A;  3F8F A;  1NTC A;  1S3J A;  4RGS A;  5GTH C;  4DQ2 A;  2EBI A;  1BI0 A;  1V5E A;  2QGU A;  5J8F A;  1FY7 A;  5ICC A;  3DV8 A;  5GP9 A;  4MLO A;  3DWL E;  2MAB A;  4UVC A;  3GBG A;  2PJR A;  3L2R A;  1IN7 A;  3ISP A;  4EAT A;  1VTN C;  3ZXS A;  1ZLK A;  2V1N A;  5IOZ A;  2NVU B;  2CUE A;  3WU2 C;  4ETS A;  1T0F A;  4FE4 A;  1DP7 P;  1UHW A;  2STW A;  2V9K A;  3SXY A;  5LHI A;  2KP6 A;  4L5E A;  1TWG J;  3RKY A;  3SQN A;  1A04 A;  2G9W A;  1BC8 C;  2IW5 A;  3K4M A;  5LHG A;  2LYC A;  3DEU A;  3CUQ C;  1FBQ A;  3W6K B;  4ZDL A;  2F5V A;  1F5T A;  3GF2 A;  2AQE A;  1Y0N A;  3CJQ B;  1RI7 A;  2VJ5 A;  2IGM A;  3IAM 2;  3JCU C;  4FET A;  4OOI A;  1EA3 A;  3Q0V A;  2R7R A;  2MG4 A;  4HYE A;  5CPR B;  4AID A;  2F6C A;  4XN0 A;  4B48 A;  3MKZ A;  2EIK H;  3WTW C;  3EUH C;  3J80 Z;  2Z2S B;  1ZAO A;  1VND A;  5DCF A;  3PSF A;  3HOU J;  4O5V A;  3ABK H;  1BN5 A;  2L54 A;  2ZFW A;  1X1P A;  1J75 A;  3HL2 A;  1TNS A;  4F93 B;  3D1N I;  3LA3 A;  3O6B B;  3MZ8 A;  3SFI A;  1V3F A;  1B6A A;  3BR6 A;  2JA2 A;  2JSP A;  1Y0U A;  2VBY A;  1BBY A;  2DA3 A;  2Z3Y A;  2E60 A;  3LQQ A;  1FLI A;  1W5S A;  4HX7 A;  3GXO A;  4XKC A;  1NH3 A;  2E2J J;  3HOZ J;  4G12 A;  2IT0 A;  2YU9 J;  2EA4 A;  2NVY J;  3L09 A;  4Y13 A;  2IGN A;  3OIP A;  4IQ4 A;  4L5J A;  1P2F A;  2OJE D;  2OU2 A;  2FX0 A;  4MTD A;  4A3D J;  2R7T A;  1QZY A;  5C44 J;  1A31 A;  1YJ9 I;  1ACI A;  5J1Y A;  4WK8 F;  4UY8 I;  2HYF A;  5HS7 A;  4MFE A;  2WA0 A;  5TJJ A;  2VBW A;  2F5F A;  1JE8 A;  2ADU A;  4U87 A;  3GO5 A;  2K7L A;  3BOQ A;  2XPV A;  2CRG A;  2VT3 A;  1Z21 A;  3P7N A;  4PZJ A;  1IRX A;  3ZPL A;  5A2Q Z;  4HAM A;  2JRT A;  2A6E F;  4P1W A;  1LVK A;  2M3A A;  2R3S A;  3H9J A;  3S32 A;  2EH3 A;  1ZYR F;  2EZL A;  2TCT A;  4A6E A;  2XB0 X;  3MVP A;  3TW6 A;  2IGO A;  2IS1 A;  4A2U A;  1RUN A;  2O5R A;  3TMO A;  3H3V K;  4L0Y B;  3KEQ A;  4WXH A;  3WTY C;  1ZR2 A;  3HB9 A;  1KYW A;  1WJF A;  4DOZ A;  4Q5S F;  1D5V A;  2F2E A;  2QKM B;  2ICW G;  3BJA A;  1L3L A;  2CV2 A;  2ZFU A;  3F6V A;  3QOE A;  2H6C A;  3JTG A;  2A6T A;  2X48 A;  3HRU A;  5B1B H;  3ERM A;  2DPU A;  4ANJ A;  2RN7 A;  4KIF A;  1Z91 A;  3TKY A;  1V4R A;  3ECO A;  1W7P D;  1H88 C;  2CV1 A;  2CUZ A;  4DZP A;  2HZD A;  3HHH A;  2E1O A;  3E97 A;  4IF4 A;  2LSO A;  3HBL A;  1RES A;  4V2G A;  5D8K B;  3F22 A;  2R0Q C;  4I0A A;  2YU3 A;  5K7F A;  1SFX A;  3QOP A;  1HA8 A;  1XMX A;  3V7C A;  1G3W A;  2PX9 A;  3DEW A;  1I6H J;  4LB6 B;  1P6R A;  1I1G A;  1J59 A;  1U5T C;  4IPA A;  1LFP A;  4ENN A;  3C1D A;  3L2C A;  3VDX A;  3KZZ A;  4E7S A;  5J47 A;  1WH7 A;  3E6D A;  1SFU A;  2RV8 A;  2KPM A;  5FLM J;  1OYI A;  4IVN A;  1SFK A;  5BPD A;  4E7J A;  1PDN C;  5M3F J;  2MC4 A;  2B63 J;  2G7U A;  5EZG A;  4LMY A;  4M3D A;  2L9V A;  2FQ3 A;  4RDU A;  5FKK A;  4A69 C;  1B72 B;  2CGP A;  4E7I A;  1WI9 A;  1GXQ A;  1D8J A;  2M1B A;  1BW5 A;  4IL6 C;  3ZMZ A;  2OD5 A;  2L5Q A;  3QPL A;  3AG2 H;  4A3E J;  4I7H A;  1UG2 A;  1VQP I;  3H3Z A;  5HOO A;  1VI0 A;  3WE2 A;  3S2D J;  2ZB9 A;  2DDB A;  2VOD A;  2E5Z A;  4BS9 A;  2BXZ A;  1R00 A;  2Q2E A;  1YS6 A;  2WB1 N;  4B44 A;  2JJ7 A;  3MAJ A;  1JTY A;  1XN7 A;  3QP6 A;  5ICE A;  3S1R J;  2KIU A;  5E79 C;  3BRO A;  3L2U A;  2R5Y B;  3HSR A;  2GA2 A;  4UB8 C;  3BR2 A;  1REP C;  1JUS A;  2M5W A;  5JLX A;  1Z67 A;  1XSV A;  4CXF A;  2DPD A;  3KP4 A;  4NHJ A;  2L2O A;  3TQN A;  4BXX J;  1TT0 A;  5F0C A;  1M1E B;  2A6H F;  2FSW A;  2VJ4 A;  3VPR A;  1TP4 A;  2KRH A;  3CCM I;  1D1A A;  1FT9 A;  1LDK B;  2DO7 A;  3DBL B;  3CMM A;  4HX8 A;  1O7L A;  5CYV A;  3DCF A;  2WAF A;  4HQE A;  1UAA A;  4D7N A;  3LFK A;  3HG9 A;  2CS3 A;  1G59 A;  5J1U A;  2PMU A;  2LRD A;  2RGV A;  1GUU A;  1MW7 A;  3OS0 A;  3GTJ J;  1IJW C;  1MBK A;  2EFO A;  3ZN1 A;  3C2H A;  2DFH A;  3IWF A;  4AYB N;  4OU0 A;  4EM2 A;  1UG0 A;  5LGT A;  2EV0 A;  2V7F A;  2ID3 A;  3ZMT A;  3JRH A;  4JBA A;  1W4M A;  1Z7L A;  3I53 A;  3F8B A;  1N75 A;  4FAS D;  3ZRG A;  1R5G A;  2GOM A;  4Q48 A;  3NAU A;  4RGR A;  5HDN A;  4N4N B;  1HOM A;  1LUJ B;  3T5X A;  3HJE A;  1LJ9 A;  1HSJ A;  3LSI A;  4G7O F;  3H1C A;  4BEH B;  4P96 A;  2DYS H;  5LGN A;  1FSH A;  3CCY A;  4Y52 J;  4P55 A;  1ZG1 A;  3C18 A;  3KPH A;  1UMQ A;  1HDP A;  3J81 Z;  3ASO H;  3D5L A;  1UHM A;  4CYD A;  1VQ9 I;  3IC7 A;  1I6X A;  3LA2 A;  2NVX J;  3B6C A;  4KIS A;  4FX0 A;  1SC7 A;  3K10 A;  2ZJP F;  1QPM A;  2VKV A;  5IP6 A;  2R7Z J;  3OV8 A;  4WXC A;  2HVS A;  4UV8 A;  3REO A;  2K02 A;  3I9V 2;  3IRR A;  2M4G A;  4MO7 A;  4C30 A;  3DLA A;  1QRY A;  1VQ7 I;  3GZ6 A;  1ZAR A;  2DA7 A;  2DDA A;  3W2V A;  5EYR A;  2DMQ A;  3HSF A;  1D1B A;  2ECC A;  1J7K A;  1PYV A;  4HG2 A;  3TO6 A;  1FSE A;  2R7Q A;  4AD9 A;  5ILS A;  2DT5 A;  2YR2 A;  4LIV A;  3GW2 A;  2MW8 A;  3FK6 A;  1K7A A;  2OUM A;  2XDV A;  3WTS C;  1MJB A;  1ETQ A;  2MYS A;  2RQP A;  4F7Z A;  1LNW A;  3EUA A;  4OMY A;  4HW0 A;  1TW2 A;  1FWZ A;  3C2B A;  1Z3X A;  2R7D A;  1F1Z A;  2ME6 A;  1HW2 A;  5J3L A;  3HPG A;  6PAX A;  1ONV A;  2BYV E;  2XRO A;  4ZYG A;  3KYL A;  5DD4 A;  5E17 F;  1B1B A;  3D5S C;  4TV7 A;  2OV7 A;  1J09 A;  1FBU A;  2VKD A;  2VXZ A;  4HBL A;  2E2H J;  1WZ2 A;  4OMZ A;  1HXD A;  2ECB A;  3OY9 A;  5BOX A;  1BI2 A;  1ORK A;  5K7H A;  2LD5 A;  1G4D A;  5LLQ A;  2X1D A;  3EUK L;  2ZJ2 A;  1E0E A;  1QZE A;  3KP3 A;  3E5U A;  1D1C A;  2GWR A;  1HST A;  2QQ9 A;  3H5A A;  3H9G A;  3I71 A;  1PUF A;  2PFB A;  3PNV A;  5DCM A;  2LY2 A;  3RQ4 A;  1Q1H A;  2O0Y A;  2W4S A;  1MKM A;  3NWS A;  4P9F A;  3CCV I;  5HS9 A;  2AHQ A;  3ZQG A;  2K9S A;  2WB1 A;  3JW4 A;  1XPX A;  1HW1 A;  2A68 F;  4RAF A;  3BWG A;  3FMR A;  4XSZ F;  4RA2 A;  3BCA A;  3E6C C;  5FO5 A;  2Q1Z B;  3IKV A;  2M2E A;  3TOA A;  4HRI A;  3HKZ A;  2KLO A;  2XGE A;  4EGZ A;  1IUY A;  2X0L A;  2X9D A;  2EPF A;  2W85 A;  4O6J A;  2NYX A;  3PFI A;  3O8G A;  1S5L C;  2OPT A;  1UEL B;  1W5C C;  2ACJ A;  2COM A;  2Q2E B;  2VPR A;  1K6Y A;  2L3D A;  5LEJ A;  3GLX A;  1YW9 A;  3KP5 A;  2BGC A;  3L1P A;  5IT9 K;  2KJB A;  3M4O J;  3G71 I;  2GBY A;  3FHZ A;  1ERD A;  2DK8 A;  3TDU C;  3H35 A;  3CES A;  4L0Z B;  5JHF A;  1F36 A;  3KP7 A;  3HUG B;  3DKW A;  5GAE J;  4ABZ A;  1TBX A;  1MIJ A;  4FX4 A;  2JT1 A;  3DBR B;  2WY8 Q;  3M1E A;  3JAM Z;  3K70 C;  2R7V A;  2DA2 A;  2I8D A;  3U1K A;  3DLL F;  4NC8 A;  1ZH5 A;  2FD5 A;  3ZQC A;  1XDU A;  3L00 A;  2CQQ A;  2ZXW H;  2EK5 A;  2JUC A;  4G8X A;  1OCZ H;  1FYM A;  4GO1 A;  2CW0 F;  1MMG A;  1F43 A;  3CLQ A;  1PVE A;  2GXB A;  3FM5 A;  4PFO A;  2XHK A;  4U88 A;  5HDK A;  3IAS 2;  3P9K A;  3NQO A;  1W7P B;  5LGU A;  2JMW A;  5LD2 C;  4RBO A;  5IYD J;  2HZT A;  2XAH A;  4I01 A;  4L9T A;  4KN4 X;  1WHU A;  5DTD A;  5GTI C;  2VOP A;  2XRL A;  1DPU A;  2WAD A;  4Z6Y A;  3GZ5 A;  2LNB A;  1WGX A;  2LP0 A;  3D5R C;  1HW5 A;  2E35 A;  2MH9 A;  1WI3 A;  3KZY A;  1MDM B;  3PUB A;  1BC7 C;  1S7O A;  2P7C B;  3OS1 A;  4MQV A;  2BEO A;  2L4A A;  2QYO A;  1F9N A;  4BU2 A;  2LR8 A;  1B9N A;  1MND A;  3H0D A;  3M9A A;  2V1D A;  3S17 J;  2XKP A;  2ZNY A;  2JTV A;  3NEU A;  1JUM A;  4GYG A;  5EEH A;  3SYT A;  3GTG J;  2K3P A;  3KLN A;  3JRA A;  3GFL A;  3DTI A;  2M4K A;  2TRT A;  4YFX F;  2P8T A;  1OCP A;  5FD6 A;  2R7U A;  1BM9 A;  3NAR A;  1K78 A;  1B4A A;  1D0Z A;  3HIF A;  1IG7 A;  4MTE A;  3WGI A;  4XLH A;  5IT9 Z;  1QU3 A;  1Z3Y A;  1S29 A;  2LTP A;  1KGS A;  3A03 A;  4BQQ A;  5J4V A;  4FT8 A;  1AOY A;  3DPU A;  2LG4 A;  2HPM A;  1SAU A;  2HI3 A;  4A3J J;  1Y39 A;  3ONQ A;  3HOS A;  4IRG A;  5F08 A;  4BEH A;  4AUX A;  2JZY A;  3DTE A;  2Z9O A;  3FXM A;  2ZME B;  2L7Z A;  4IHV A;  1OIS A;  3G3Z A;  3QYB A;  1LEA A;  1AKH B;  2VAS A;  3M1C A;  4KA4 A;  2HOA A;  2FQ4 A;  2JVG A;  3K9T A;  4NC7 A;  4L5I A;  1IAW A;  2HYJ A;  1SD6 A;  4V19 K;  1TQI A;  3DF8 A;  2FNP A;  2KDZ A;  2M0C A;  3S1N J;  2AO9 A;  2PN6 A;  2Y0M A;  3DPT A;  4CZC A;  4PGG A;  2D2W A;  1RC9 A;  2KIS A;  2UXN A;  3WGH A;  2MBF A;  3PIO F;  1AWC A;  3ZQQ A;  1XMA A;  3FBI B;  3LST A;  2KRC A;  4BUP A;  4N9H A;  2ZJR F;  2P6S A;  1MSF C;  5JI6 A;  2R92 J;  2X4H A;  3CO7 C;  3OL4 A;  3KFW X;  3FM3 A;  1MNE A;  2JPC A;  2CQN A;  2OCC H;  2RC4 A;  4XOR A;  3I5U A;  1ZEL A;  4KDP A;  5BPI A;  3HUG A;  2K85 A;  1K4T A;  3FXQ A;  3K2A A;  2E2I J;  4CGZ A;  2X6X A;  1ZGJ A;  4I02 A;  1D0X A;  1TWH J;  2OQG A;  2HPI A;  2NXN B;  3ML6 A;  4YG2 F;  2HWV A;  2EIJ H;  3OYB A;  4MHG A;  5JFR A;  2IS6 A;  2L01 A;  3SZP A;  3MQ0 A;  3K4N A;  3KZI C;  1R22 A;  2NAZ A;  2RRE A;  4Q4Z F;  1WWX A;  3VYT B;  1ZG5 A;  4F92 B;  1Y1W J;  5FRO A;  3CME I;  2HQA A;  2VT2 A;  4RGU A;  4UUS B;  2KIQ A;  3Q3S A;  1TWA J;  3H92 A;  3F21 A;  4ZZL A;  4KIG A;  4BDZ A;  3I59 B;  2M87 A;  1FX7 A;  2IA0 A;  2LVS A;  1X1C A;  1CQT A;  3WHC A;  3FKI J;  2E5N A;  1X58 A;  3K4L A;  1J0R A;  1QQI A;  5JHU A;  4M9X A;  5CJ9 A;  2HS5 A;  1MBJ A;  3A4C A;  3DKX A;  3X2Q H;  3BTC A;  1R1U A;  2FF4 A;  2GQQ A;  4UV9 A;  4Z2Y A;  1YJN I;  2DOE A;  3JTH A;  4MEX F;  3HXL A;  3DFG A;  1PUF B;  2FML A;  1N25 A;  2BXY A;  4EVI A;  4YIR X;  4ZYD A;  3CCU I;  5CKT A;  1FMV A;  4XLN F;  4NQW B;  2FBH A;  2JRM A;  4B4C A;  2O61 A;  4AWX B;  4CCJ A;  5D5W B;  2CUJ A;  1L0O C;  4ENK A;  4PCQ A;  5HNF A;  1NK3 P;  2QSG X;  2QZ8 A;  1AA7 A;  4XRM A;  2KL4 A;  3ZCO A;  2DAO A;  2V79 A;  4RB1 A;  2E1N A;  4G6D A;  3HTU A;  1XSX A;  3TBI A;  4A93 J;  5M3M J;  3FXO A;  4UVB A;  1OR7 C;  4XSX F;  3W6V A;  4KT6 A;  4QLC U;  5LRS A;  2A5W A;  4XR6 A;  4UHT A;  4RM2 A;  3DBH B;  1AHD P;  1ZRC A;  4IRI A;  4RLF A;  3WTX C;  2PG4 A;  5K5R A;  5FRN A;  2QM3 A;  1VQO I;  2FJ1 A;  2PMZ A;  2Y75 A;  4U7D A;  5IYB J;  1RIO H;  2HKO A;  3BR5 A;  1ZRD A;  3SJM A;  2XAJ A;  4UUT A;  1E17 A;  4B3X A;  2CSO A;  4A3G J;  4BAY A;  5L3E A;  2R7X A;  3GTQ J;  2FOW A;  3HGY A;  3RYR A;  5DS9 A;  2R5Z A;  1R4M B;  3WG7 H;  3PJR A;  4W1U A;  2XAS A;  4LK0 F;  1EKE A;  3BG5 A;  5J40 A;  1MGT A;  4A3C J;  4UNO A;  5B5E C;  1FYL A;  3FXK A;  2F5C A;  1XD7 A;  1SAN A;  1LB2 A;  3BTJ A;  4MEY F;  3GWZ A;  3KEY A;  2RNJ A;  5EDN A;  4XKB A;  4M9Z A;  3FIS A;  4WX9 A;  5D4R A;  1XGN A;  3LSR A;  5E3M A;  5TGT A;  1S6L A;  4WF2 A;  1T98 A;  2HKX A;  4U0Y A;  4LG0 B;  1ETY A;  4YIF A;  2LKX A;  1YIT I;  2VON A;  2BW3 A;  4XM3 A;  3VYR B;  1U0J A;  4BJ5 C;  1LE8 A;  2WV0 A;  3CCJ I;  3WU0 A;  1MSE C;  4BXU A;  3EUH A;  3Q0W A;  4ESJ A;  2E7W A;  1IV6 A;  3JSP A;  3IKT A;  1BW6 A;  1EH6 A;  5ED4 A;  2DT7 B;  2EV5 A;  3KP6 A;  3BQY A;  4RM3 A;  2LK2 A;  2BY1 A;  3R4K A;  4M73 A;  4IHW A;  2K9L A;  2JSC A;  4XBF A;  1HKQ A;  4AVP A;  4HEA 2;  3HC7 A;  3KE2 A;  5K5O A;  2ZBK A;  1OR7 A;  5EG0 A;  4LLN A;  3MWM A;  3JRD A;  2WY7 Q;  2DCE A;  2MLK A;  4HX4 A;  3ZMU A;  4BHP A;  2WC2 A;  2PJP A;  2HR3 A;  3CJR B;  4CCN A;  2RAE A;  4M72 A;  5FKM A;  2HDC A;  4IHY A;  3A0B C;  1TZL A;  2QEX I;  2Z1D A;  1IDZ A;  3F0C A;  1QNT A;  2STT A;  1D0Y A;  1YYV A;  4M3E A;  2HNH A;  2GXG A;  4LFU A;  4PJJ A;  1RR8 C;  3HOW J;  5HLT A;  1LFU P;  3K7A J;  2HQN A;  4YFK F;  2FMY A;  1A35 A;  2N8G A;  2L9S A;  3RYP A;  3W2A A;  4OIQ F;  4M74 A;  2NNY A;  1WPK A;  2EA2 A;  3HYI A;  2DLL A;  2DMT A;  2K40 A;  1BIB A;  2ZO4 A;  1FBS A;  3M8J A;  3E5X A;  3CLO A;  1FIA A;  1G2H A;  2E71 A;  5CQG A;  1X1D A;  1MMN A;  3S3N A;  5C4J J;  2MC3 A;  3ECH A;  1LE8 B;  2QVO A;  2XF6 A;  2KHM A;  1YQA A;  1ZGA A;  2OCE A;  1IRF A;  4RS8 A;  5EG0 B;  2DW4 A;  1UCR A;  3BC8 A;  3MN2 A;  3QU6 A;  5D8L B;  5EGO B;  1A6I A;  4W97 A;  3JAM K;  5KVR A;  1WJA A;  1GLN A;  2B0L A;  1WVR A;  4E70 A;  4KIT B;  3Q9S A;  2VJJ A;  3V7S A;  3E6B A;  1Q1V A;  2B9S A;  2KJC A;  4A5N A;  1FP2 A;  3FXJ A;  2CW8 A;  2DXI A;  4ESB A;  3N97 A;  2CMP A;  3S14 J;  4S05 A;  4L9J A;  3BR0 A;  3P5J A;  3PSI A;  4IJA A;  4KYW A;  3CMY A;  2H27 A;  2X85 A;  2IAI A;  5IYC J;  1AU7 A;  2LY9 A;  2CQX A;  1U5T A;  3QRF F;  4LLG F;  1RNL A;  4PSW A;  2W84 A;  4Y4R A;  2Z33 A;  2EWN A;  4EJT A;  2H09 A;  1TW3 A;  3BLY A;  4HV6 A;  2R7O A;  2H1K A;  4XON A;  4ZJZ A;  2EIN H;  2WAQ N;  4WXD A;  2M9H A;  4IZZ A;  3LQR A;  4A0Y A;  3HTS B;  4D7M A;  2BVL A;  2Y0S N;  3C3W A;  1TQP A;  3K69 A;  3EYI A;  2XGX A;  3KLO A;  1ZGW A;  2O8K A;  4OAY A;  1PUE E;  2LFB A;  4AC0 A;  3SEQ A;  1APL C;  2AXL A;  4DZJ A;  4XN3 A;  4J01 A;  1BI3 A;  3V7R A;  1UHS A;  1FYK A;  1IZ1 A;  1EJ9 A;  2ZXJ A;  3WTV C;  4CCL A;  1DP3 A;  5FKO A;  3M8E A;  4OIO F;  1MMA A;  3HHG A;  1XCB A;  5E20 A;  3OOP A;  4PGH A;  4H0E A;  4G7H F;  3O2P E;  4ESF A;  1FTT A;  4HPQ A;  2A61 A;  1P7I A;  1HBX G;  3ZMS A;  4L18 B;  2P6T A;  3HZJ A;  2JA6 J;  2QQ8 A;  3HSE A;  2VBZ A;  3DTK A;  1JTX A;  4GCV A;  2P5K A;  1POG A;  1CF7 B;  4NB5 A;  1T8I A;  3IH3 A;  3LFU A;  2QCO A;  3CQZ J;  3S2H J;  5A2Q K;  2R93 J;  1XDS A;  3E0J B;  1USS A;  1KZH A;  1A6Q A;  1Z6R A;  1UJ8 A;  5H20 A;  4A5M A;  4BHC A;  4C2M J;  1OPC A;  4QPQ A;  3J7Y J;  4IXA A;  5EZH A;  4NBQ A;  2Z99 A;  1WRJ A;  2L7K A;  3BJO A;  1FPQ A;  1FOY A;  3CJN A;  1EH8 A;  1LDJ A;  3GEZ A;  1MD0 A;  2BW3 B;  2IS4 A;  3F6O A;  1SD5 A;  4B8X A;  3ZQ7 A;  3FHN A;  4GYI A;  1IV8 A;  1WJE A;  2W1O A;  2CYY A;  4EJU A;  3GFI A;  2XAU A;  2DU9 A;  3CJT B;  5FB2 A;  1PP8 F;  4FTH A;  3T8R A;  2H8R A;  4NQW A;  1LQ1 A;  5CVV A;  2W57 A;  3FXL A;  1P4A A;  2VQL A;  4BE2 A;  1YX5 A;  1BOA A;  5E3O A;  4IKF A;  4OIP F;  1J5Y A;  3OYL A;  2D1H A;  1A5J A;  2CUF A;  2WTE A;  5JLW A;  3OYF A;  3K70 D;  2DJN A;  2BBY A;  1IRZ A;  2VKE A;  1G3Y A;  1SMT A;  3Q0U A;  3A01 B;  1QVU A;  2JPB A;  3EET A;  1IC8 A;  4QWQ A;  5D5U B;  3R0J A;  3V8J A;  3WTU C;  5D5X B;  1GV2 A;  3RZD J;  3ASN H;  1BL0 A;  1S72 I;  3PO2 J;  4JQF A;  2MLG A;  1DU0 A;  3SDG A;  2PQ8 A;  3WU1 B;  5KCM A;  1ZRE A;  5HDG A;  3KEO A;  3PL8 A;  2K9M A;  1OFC X;  3GUD A;  4LJZ F;  2YX7 A;  2EZI A;  2ME0 A;  5E1X A;  2IBD A;  3W3C A;  2KQR A;  3I56 I;  1XSD A;  4OIN F;  1JKP C;  4XK4 A;  1P9Q C;  1P7J A;  4ON0 A;  5L3F A;  1QVT A;  3G1M A;  4N9I A;  4R1H A;  2AS5 F;  4XQF A;  3M3Y J;  4AM3 A;  3U9G A;  3OYJ A;  3CDH A;  3BZC A;  3ERE D;  4DNC A;  2BHZ A;  1JKR C;  2LDU A;  3GZN B;  3ZP5 A;  4F91 B;  2DMN A;  5DUI A;  1WSU A;  2NVT J;  1H0M A;  3ZOB A;  5LRR A;  2KFD A;  1T0F C;  3I64 A;  1BA5 A;  1SMY F;  3BT9 A;  1ETK A;  2HOE A;  3BG3 A;  1U5T B;  3JRG A;  3C7J A;  1X4P A;  4GGG A;  2A5Y B;  4RB3 C;  1TL8 A;  4JP0 A;  5AIP A;  4K2E A;  4O3M A;  3ABL H;  2F4O B;  3CCL I;  5FKL A;  3RSN A;  2I5U A;  3KX2 A;  1W36 C;  3BR1 A;  2HTJ A;  3LSH A;  2QBY B;  3LAP A;  4S0H B;  1U6G A;  1SD4 A;  2CQK A;  5F6F A;  5BNG A;  5B1A H;  3CD6 I;  1D5Y A;  3GTK J;  1T08 B;  1ULY A;  3QOD A;  5IP9 J;  2OZ6 A;  4KT5 C;  4BAC A;  2L02 A;  1JXS A;  2MA3 A;  4B1R A;  4M6Y A;  1X19 A;  4CIC A;  3J81 K;  4AYB A;  3IWZ A;  3OYE A;  4DJA A;  1YO5 C;  2BY3 A;  2QSH X;  3R61 A;  4Q47 A;  3OIQ A;  1R1T A;  1VQ4 I;  5DYM A;  1T56 A;  2EB7 A;  3E5Q A;  3OSG A;  2E19 A;  3DXJ F;  2JVH A;  2LH9 A;  2PBI A;  5F0H A;  4G7Z F;  3U1D A;  4IOA F;  5TRD A;  4MNU A;  2DFF A;  2WAE A;  1R5H A;  5KK1 A;  5J1R A;  1WJ5 A;  1T95 A;  2E36 A;  1O7F A;  2CW7 A;  2DYR H;  4G6T B;  4L9V A;  1ZR4 A;  1QBJ A;  2QBY A;  3VYS B;  3FIW A;  3E7L A;  3DU6 A;  2UV1 A;  2IXS A;  4HF1 A;  1ETW A;  2FOK A;  1PP7 U;  4G6Q A;  3MMY B;  1QZZ A;  1UST A;  3MEX A;  3AL0 B;  3FF5 A;  4JX4 A;  4B47 A;  5BS6 A;  2V6C A;  3DEE A;  4F55 A;  2VN2 A;  3HDD A;  3K6G A;  1XG1 A;  3GVA A;  5FLV A;  2ZJQ F;  4KFC A;  2QLZ A;  2EZH A;  1OCR H;  1OCC H;  3A1Y A;  5E8G A;  4JX5 A;  3J7A O;  2ISY A;  3ZQI A;  3OYD A;  3OYH A;  2V1U A;  5FFZ A;  2K3F A;  4J19 A;  2LKP A;  2VKH A;  2HDD A;  1EF4 A;  3KP2 A;  5HNH A;  3K1M A;  2ZME A;  3LSK A;  2VE8 A;  1XGO A;  2NOG A;  3W2W A;  4B43 A;  5EF6 A;  1KA8 A;  4BE0 A;  3RPU A;  1OJL A;  2OF7 A;  4BE1 A;  2O8X A;  1KU3 A;  4DGW B;  5H2F C;  4OIR F;  2ETH A;  2H6B A;  4IHX A;  2FRH A;  1JKQ C;  3KYD B;  2ZSH B;  2XGD A;  3IHU A;  1O57 A;  3OIO A;  4V2F A;  1UFM A;  5C4X J;  1RZ4 A;  2HDW A;  3BJ6 A;  1NHA A;  2CWE A;  2V4J C;  2ZC2 A;  3P9C A;  1GT0 C;  5CVI A;  1Z77 A;  3N05 A;  4D0P A;  4DBQ A;  2K4J A;  3BZK A;  4E4H A;  2KIM A;  3DPL C;  4PJM A;  5DM7 F;  3OS2 A;  3G6E I;  1O3S A;  1X2N A;  2RKH A;  2XPW A;  4PFP A;  4ZYH A;  2BE5 F;  1R49 A;  1FMW A;  3K4J A;  4X6A J;  4DBR A;  1BI1 A;  3HM5 A;  4XLC A;  3EQL F;  4M3B A;  3IV5 A;  2XIG A;  3F72 A;  3OL3 A;  4BL0 B;  2EZK A;  2QWW A;  4A3B J;  3H36 A;  4B3A A;  2QA4 I;  4HST A;  1MH4 A;  2VQG A;  1H9G A;  2OZU A;  1N77 A;  4IEJ A;  5GPC A;  3M7G A;  2HEO A;  1IXC A;  1U78 A;  2KRF A;  1LDD A;  3T0Y A;  1H89 C;  3F8N A;  2DMU A;  5CLS A;  2OQR A;  2XSJ C;  3HOX J;  1BOB A;  1VQN I;  3ZQL A;  1C0W A;  4N0B A;  1T2K A;  1VZ0 A;  3H5N A;  2WWY A;  1W7P A;  3F8M A;  2DJI A;  2QKL B;  3O8H A;  5F0F A;  4E7Z A;  4BYY A;  3JSO A;  3FMS A;  5FRM A;  3P9I A;  2P0W A;  1NG7 A;  1LEB A;  3E3V A;  3M8F A;  4BXF A;  5GAH J;  1KQ0 A;  4LD5 A;  2HU9 A;  2Y69 H;  4U0V A;  3I0T A;  4G94 A;  3HOV J;  2RVC A;  2DTZ A;  2VC1 A;  5BQT A;  4FHT A;  3WG9 A;  3RI4 A;  1O4X A;  2Q0O A;  1MMD A;  3GX4 X;  3CF5 F;  3OWT A;  1I3Q J;  4P5O A;  2RQQ A;  1YIJ I;  1YG2 A;  2DOA A;  2V9V A;  3RCO A;  2CO5 A;  3AAF A;  2ESN A;  1ODD A;  4XLP F;  1FEX A;  1RUO A;  3OYK A;  4A3M J;  1GXP A;  5DEQ A;  1AKH A;  1X3Z B;  4KIB A;  2OC6 A;  3E6M A;  3TO7 A;  4E7K A;  1ETV A;  4WCG A;  2W00 A;  1IN5 A;  4X0G A;  3GTL J;  2DA5 A;  3LSM A;  2Q8K A;  1OMI A;  2EIL H;  2GA1 A;  2QEN A;  4E6K G;  3GLL A;  1WJC A;  2DQR A;  1R58 A;  3S8P A;  4LK1 F;  4BDY A;  1OCT C;  1X3W B;  2R7S A;  2QSF X;  1JT6 A;  2X6Y A;  4CO8 A;  1MNM C;  1ZRF A;  1G3S A;  4N4O B;  1MBG A;  3HPH A;  1ITY A;  3M07 A;  1D3Y A;  1I5Z A;  2XAQ A;  1Z7U A;  3T1B A;  2H94 A;  4R79 A;  2HTS A;  2W7N A;  3EDP A;  5F64 A;  4Y3O A;  2HQR A;  1B72 A;  2R7F A;  3LAJ A;  3TO9 A;  3PO3 J;  2HOS A;  1MJA A;  4XOT A;  3JRI A;  1R7J A;  4YRV A;  2XB5 A;  2R5Z B;  4YII A;  3LSJ A;  4HNT A;  4G9Y A;  1U2W A;  4OWR B;  1XMK A;  5F1R A;  2F4I A;  3C2G A;  1YX3 A;  4XLE A;  4BQO A;  1GVJ A;  3ZMD A;  3S1M J;  1JT0 A;  3PFY A;  4RAY A;  3BZ6 A;  4JYK A;  4CCO A;  1P4W A;  4H4K C;  5DV5 A;  1X1A A;  2L4M A;  2F5D A;  4ENM A;  3I54 A;  5F27 A;  3V8K A;  1VQM I;  1X2M A;  4B09 A;  1B9M A;  2OTL I;  1HC8 A;  4Y7N J;  1YFH A;  3UNG C;  4WWC A;  3ZGK A;  5FJ8 J;  1ZN2 A;  1IXS B;  4XOP A;  5M5X J;  4JOM A;  3Q9V A;  5AON A;  2DFI A;  5HLG A;  3A0H C;  4RAG A;  2VB6 A;  2L0K A;  4IX7 A;  4LG0 A;  3IP4 B;  1S7A A;  3SZT A;  5H6R A;  3LSP A;  1DU6 A;  4ASN A;  1YHQ I;  4HLX A;  2KDO A;  2V9P A;  1E3H A;  2XV4 S;  2XAG A;  5AIQ A;  3OYN A;  3R60 A;  3DU5 A;  1LVA A;  4II3 A;  2PJR B;  4NUB A;  4XL9 A;  3CTA A;  3CC4 I;  3CP8 A;  5DM6 F;  1I39 A;  2DA1 A;  3R0A A;  3MFK A;  2K86 A;  3S15 J;  2ESH A;  4C3H J;  4EV0 A;  5GAG J;  3W6J B;  1ZHF A;  4L9N A;  1VQK I;  1OCO H;  2FBI A;  2W48 A;  3OR2 C;  2ZME C;  2M0M A;  2HXO A;  2TDX A;  3QYF A;  5EGO A;  2YSR A;  3SZG A;  3WOD F;  1E3O C;  4XKW A;  4QSH A;  2LBF A;  2GAU A;  1ZKG A;  4UUS A;  1R23 A;  1WCM J;  3VOD A;  3QP5 A;  5KAF C;  3HKZ N;  1I1S A;  1R4N B;  3NWT A;  3KIO A;  2NS7 A;  2L7M P;  3I4M J;  5KHD A;  1W36 D;  2HFH A;  4ZTJ A;  3CC2 I;  2RDP A;  2XRN A;  3IUO A;  2Y0S A;  2BVM A;  4NDL A;  2OAZ A;  4LGW A;  2W82 A;  5FGM A;  4X1E A;  4EM0 B;  3TL4 X;  4Y33 A;  4EJO A;  1HQC A;  1VQ8 I;  1FZP B;  3F8C A;  3FK7 A;  3AG1 H;  4RMN A;  5E18 F;  5ILV A;  2YPR A;  2DN0 A;  2E7X A;  3BY6 A;  3SDB A;  1V55 H;  3EYY A;  4QIW N;  5F04 A;  3H3U A;  3KYC B;  2EFP A;  4FE7 A;  5CVR A;  1TWC J;  1HKT A;  3HOY J;  2Z5U A;  4RGX A;  5K5Q A;  3BP8 A;  3CZ6 A;  4LIT A;  2H1L A;  4UXN A;  2JK3 A;  4FQG A;  1QA6 A;  2O9L A;  2XPU A;  2E1C A;  2FNA A;  1JJ8 C;  3BQZ A;  4I6Z A;  3HGG A;  3EPZ A;  3WGG A;  2LC2 A;  3G1O A;  2KMU A;  2OA4 A;  2QQB A;  1R6R A;  2O7O A;  3JRF A;  4Y17 A;  4CSW A;  4BY7 J;  2Y9Z A;  1R71 A;  3V4G A;  2ISZ A;  4MQ9 F;  4BJT A;  4ZDO A;  1QHG A;  3L2Q A;  2M8E A;  3JR9 A;  1R36 A;  4DYQ A;  5B66 C;  4I99 C;  3TGN A;  2L9R A;  4P9U A;  1KU7 A;  2E34 A;  1OYW A;  3ELK A;  4CYC A;  5IP7 J;  1WKM A;  4KNY A;  2IEK A;  3A02 A;  2VPL A;  4AIH A;  2FA5 A;  2P81 A;  3UR3 C;  3CCR I;  2YX4 A;  1U8R A;  3IRQ A;  1FNN A;  1CF7 A;  2LY1 A;  2ZXI A;  3ABU A;  3RTR A;  3G73 A;  3F9K A;  2R7W A;  1ON2 A;  3S2W A;  1T39 A;  1V5G A;  5JVG F;  4ZDP A;  4I76 A;  3BR3 A;  5E1W A;  3TDZ C;  2DQL A;  2MFZ A;  2X51 A;  1GVD A;  1K4S A;  3V8L A;  4I09 A;  2FU4 A;  1K79 A;  4C2T A;  4GDF A;  2VUM J;  3A2K A;  1STZ A;  3ZQF A;  3G1L A;  4LLL A;  4DYC A;  1NK2 P;  4C2U A;  4A0Z A;  1GHC A;  2M45 A;  1V5F A;  1WFX A;  3OR1 C;  5TIS C;  1KU2 A;  2LLK A;  2P5L C;  2IVM A;  3N4M A;  3TP0 A;  1WJB A;  4J00 A;  3ABM H;  2Z16 A;  3VFZ A;  5F1J A;  1R1V A;  1RRJ A;  4ZYE A;  1LPQ A;  5E3N A;  2W24 A;  3HEF A;  1CGP A;  2VOO A;  4EEF G;  4FCY A;  3MCZ A;  2IRF G;  1TTY A;  4ZTF A;  2ELK A;  4PJN A;  5LEK A;  2Y30 A;  3L2W A;  4M6V A;  1MZB A;  4CUG A;  3QPT A;  4ZZD A;  3CO6 C;  3Q5F A;  2ZSI B;  4CH7 A;  1N78 A;  3KCC A;  3B02 A;  1IN6 A;  1ENH A;  2FE3 A;  2K4B A;  2FUG 2;  3J80 K;  1QO0 D;  1QPI A;  1W0U A;  1ZTR A;  2HVQ A;  4RLQ A;  1JHF A;  2EFN A;  1XX5 A;  1Z0X A;  4XRS G;  4M3G A;  3I3L A;  2D1V A;  5GAD J;  1ZQ3 P;  4XRF A;  2PI0 A;  5D4S A;  2QF7 A;  1A36 A;  3F3X A;  2DBB A;  4CA0 A;  3I59 A;  3FKJ A;  5E3L A;  1SFO J;  2WAQ A;  3OSF A;  2YUS A;  3PNY A;  2R5Y A;  4DIQ A;  4CYC B;  1P4X A;  4HNU A;  3PM1 A;  1RR7 A;  3CUO A;  4ZYA A;  4A3I J;  2NOJ B;  3ROU A;  1IRG A;  1OLT A;  3H5R A;  2VIX A;  4BJ6 C;  3UKG A;  5DD8 A;  2LKS A;  1LKX A;  3BPX A;  3HRT A;  3I4P A;  5JVT A;  1YJW I;  2AXT C;  4HQM A;  2LBF B;  2MSY A;  3COA C;  3RPU D;  3VSK A;  3LWF A;  1DGW Y;  2EFQ A;  4YFN F;  1FP1 D;  4YEL A;  5IY5 H;  5HOD A;  3BCB A;  4PK4 A;  4IOC F;  1R5I D;  3VOE A;  4D5C A;  1YW8 A;  5E1Z B;  3OYA A;  2LF7 A;  3PNT A;  3PUF A;  1IXR C;  3T8T A;  2OBP A;  2MD5 A;  3F23 A;  1O3R A;  1Y8Q B;  4BQN A;  3L2V A;  4HDV A;  2Y31 A;  3QPH A;  2EQR A;  1SD7 A;  2HYG D;  3NRV A;  1U9N A;  4MGR A;  3WTZ A;  2O6G E;  2OTJ I;  2JWT A;  1Y56 A;  2FEZ A;  3S16 J;  3GFM A;  3FMQ A;  1O3T A;  4D1Q A;  3VEP A;  5FKN A;  1DUX C;  2CU7 A;  2LF8 A;  3PQK A;  1FJL A;  4YEJ A;  1R9T J;  5KNL A;  3RQI A;  2CV0 A;  2KZG A;  4R8H A;  2ELJ A;  5EEG A;  3CMA I;  4ZC3 A;  2DTR A;  4BQA A;  4UVA A;  3FBN B;  1YW7 A;  1B8I A;  1OQY A;  1HLV A;  3BG6 A;  4E7L A;  1RPW A;  1IUF A;  4PSX A;  2X1C A;  3WHB A;  1EV7 A;  5J6X A;  1XGM A;  2JA5 J;  1B59 A;  1E2X A;  2F5E A;  2M34 A;  1BR1 A;  4A12 A;  4ITV A;  1YRN B;  3PIP F;  3SHF A;  3LSG A;  4QPO A;  2BY2 A;  5J4Y A;  3S93 A;  3GFJ A;  2GIV A;  2GLO A;  1VQL I;  3DKY A;  4C3J J;  2PLY A;  2GM4 A;  1TT5 B;  4II2 A;  4M71 A;  2G7H A;  5M5Y J;  1IN4 A;  2PMZ N;  3CP2 A;  5HLI A;  2O3F A;  3AFH A;  3A01 A;  4A3F J;  4C3I J;  4E7H A;  2EIM H;  2IGK A;  4XNF A;  1E3P A;  2VQH A;  3E1S A;  1FOX A;  4EJV A;  2E1M C;  3U2R A;  5J8C A;  2KZV A;  2CFO A;  1YTY A;  4HZF A;  1BIA A;  1G8X A;  1YS7 A;  5K1Y A;  2V6E A;  2MD0 A;  3CF2 A;  4I98 B;  3VWB A;  1Z6T A;  1YI2 I;  3MZH A;  4F3Q A;  4HSR A;  1D8K A;  2KT0 A;  4CCK A;  1SAX A;  5BMZ A;  1U8B A;  1NG6 A;  1MBF A;  2DI3 A;  2D45 A;  5GPA A;  1MDM A;  4KIC A;  2IP2 A;  4OAZ A;  3B6A A;  2F48 A;  2NNN A;  2I10 A;  1J2X A;  5KAI C;  1I27 A;  4HNV A;  2PMH A;  4LIU A;  2QQA A;  2L9N A;  1Y6I A;  1JKO C;  2G0E A;  5DUK A;  2CFX A;  4D9J A;  2XGC A;  3SEZ A;  1FOW A;  2H8W A;  2DOD A;  4KUM A;  3HRM A;  1MBE A;  1UB9 A;  2ID6 A;  1X3U A;  2KIF A;  3VSL A;  1HCR A;  4ZH4 F;  1Y1V J;  4CDG A;  3MD2 A;  1IN8 A;  5FLX Z;  3BTI A;  1O3Q A;  5H6Q A;  2A69 F;  2HVR A;  2IS2 A;  4A0X A;  1MBH A;  4EM1 A;  3RKX A;  1W0T A;  4XIC A;  3PQJ A;  4HF2 A;  2R4G A;  1IDY A;  3H0G J;  2A07 F;  4JK1 X;  1JUP A;  4EGY A;  5CVU A;  3CUQ A;  1KYZ A;  1S8N A;  5C3E J;  3WTT C;  2MGQ A;  3AKZ A;  1XB4 A;  4XID A;  4BBR J;  3GME A;  4BNC A;  2PEX A;  2EFW A;  4CCM A;  4D5F A;  2M8G X;  1UZC A;  2XF5 A;  1KON A;  2DA4 A;  5EJC A;  4RAZ A;  2M7A A;  1KU9 A;  5HS8 A;  3K1N A;  5L3C A;  1JGG A;  4XRS A;  3QU3 A;  5JR3 A;  3OYC A;  2CQ7 A;  2UZK A;  1RKT A;  2J5P A;  2X1E A;  2BV6 A;  5L3D A;  3K2Z A;  1K6O A;  4DYR A;  2D5V A;  5LFA A;  4HOB A;  3R6S A;  3S1Q J;  3OOU A;  3FZV A;  2NRA C;  4A3L J;  4AIK A;  3K4B A;  1U3E M;  4ENJ A;  1BR4 A;  2VBX A;  2V26 A;  2YS9 A;  1OKR A;  1YIO A;  2VLA A;  1ETX A;  2VC0 A;  3S3O A;  4LOC A;  3BPV A;  2DMP A;  2LMD A;  2M30 A;  1I50 J;  2IA2 A;  1K61 A;  4HA8 A;  1KQ9 A;  3QYE A;  5CVJ A;  1BR2 A;  3RIR A;  1HF0 A;  5D5V B;  2NS8 A;  4FIS A;  2VQC A;  2CH0 A;  4XLF A;  4IRH A;  3BG9 A;  2XAF A;  3G2B A;  3BTL A;  3K4C A;  3U21 A;  3CCS I;  5EEA A;  2EV6 A;  4EJW A;  3I55 I;  4BY1 J;  4A6D A;  1W1W E;  5ERI A;  3GCM A;  2A05 A;  4F52 A;  5ILU A;  1S9H A;  1FC3 A;  1PJR A;  1X1B A;  3LL7 A;  1F4K A;  4RB0 A;  5FFX A;  1ZK8 A;  4I0B A;  2VXD A;  4IHT A;  3TOB A;  1T33 A;  4IQJ A;  1RKW A;  1Z05 A;  1WJD A;  2XVC A;  4KMF A;  2P4W A;  2DFE A;  2HGC A;  4EQQ A;  3ABT A;  5HVQ C;  3ZQH A;  2K9Q A;  2V1X A;  3VYU B;  4CZZ A;  1SVM A;  1JJ6 C;  1U9O A;  3LNQ A;  2NS0 A;  2BHY A;  3GTO J;  2DK5 A;  2BY0 A;  3DQV C;  2GZW A;  2Y2Z A;  4JX6 A;  5FD5 A;  3ESW B;  4HLY A;  3AG4 H;  2J5O A;  1SVO A;  3AL0 C;  5E8I A;  2C6Y A;  4PDK A;  2LOO A;  1TWF J;  1XGS A;  4BHB A;  3K0L A;  1H9T A;  1MH3 A;  2GXA A;  4A3K J;  3OYI A;  5M5W J;  2ZXH A;  3FXR A;  3LOC A;  4U7B A;  1OYY A;  2IPQ X;  1ON1 A;  2P5V A;  2E1M B;  3QWL A;  3MKW B;  1FTZ A;  1XS9 A;  2WV1 A;  4KJZ A;  2FBK A;  2UWM A;  1YLF A;  3LMM A;  3ZR8 X;  3GTM J;  3HOT A;  2HQ5 A;  2XKO A;  4GRI A;  1W5T A;  4BH9 A;  2COB A;  1DDN A;  1WQ2 A;  2P7V B;  1YRN A;  1HKS A;  3RJP A;  4HV5 A;  1TNT A;  5LBQ A;  3JRC A;  2VE9 A;  1ETO A;  4IO9 F;  1HDD C;  4HDU A;  2O03 A;  5L3B A;  1JHH A;  2LRE A;  4RB2 C;  1MJ9 A;  1P92 A;  3QAH A;  1B8I B;  3CCQ I;  2FXA A;  4XMY A;  3JRE A;  3RKW A;  4GXO A;  5IOY A;  1YE9 A;  1JI8 A;  2UXX A;  2JQ7 A;  2B7E A;  3SFZ A;  3CUQ B;  1BJZ A;  3G4S I;  1G3T A;  4LG3 A;  3I58 A;  3CDI A;  5K7Z A;  3H9Q A;  1XTA A;  4AIJ A;  1MMS A;  4BBS J;  2JUG A;  2XUB A;  4XKV A;  5CQE A;  3DP7 A;  3RZO J;  5IT3 A;  3HRS A;  4MIM A;  4EMS A;  2K5C A;  1T6S A;  1TQM A;  1IW7 F;  2F4M B;  2ZNZ A;  1FOK A;  5B3S H;  3ZMV A;  1K83 J;  3ULQ B;  2RNG A;  4AU7 A;  9ANT A;  5D6F A;  3S3M A;  3RDI A;  2CG4 A;  1H8A C;  1DPR A;  3BDD A;  3D0S A;  3BG7 A;  2BZT A;  3V42 A;  4BGD A;  3LA7 A;  1KQ8 A;  2A3S A;  3OYG A;  4M6X A;  1TLH B;  2DT6 A;  1GV5 A;  2CJJ A;  3O3K A;  3MZY A;  1JGS A;  1VF9 A;  3FDY A;  2KKO A;  2NVQ J;  5ICG A;  2XSD C;  3TP3 A;  2JA8 J;  4XLA A;  4HF0 A;  1DGR M;  4PUS A;  1XCV A;  2HOT A;  5HLH A;  2GIZ A;  5L3G A;  1VQ5 I;  1IF1 A;  1J9I A;  3TW7 A;  2W25 A;  4BKX A;  1K78 B;  3QQA A;  4C9Y A;  2HXI A;  2JA7 J;  4UUV A;  2MH2 A;  4PJL A;  1LFB A;  4PJ0 C;  3ZN0 A;  2ZCW A;  1Z9C A;  1IGN A;  1V54 H;  3RPQ A;  3KET A;  1BJA A;  3QPS A;  4NC6 A;  1VQ6 I;  5DCM B;  2EJR A;  1ZG3 A;  1IO2 A;  3JRB A;  1XC5 A;  3J7Z I;  5LHH A;  2DOF A;  4IHS A;  4M9S A;  2Y9Y A;  1SEU A;  5IPA A;  3MKY B;  3IH4 A;  2VL8 A;  3IH2 A;  1DQU A;  3VB2 A;  4S04 A;  3WE3 A;  4MFD A;  4UB6 C;  1QGP A;  4LB5 A;  1G6N A;  1SFE A;  2ZKZ A;  1Z1D A;  5FLX K;  1WH5 A;  4GFB A;  3FX3 A;  5D6E A;  3I4N J;  2L7F P;  2K9N A;  2IJL A;  4KMU X;  1GDT A;  2VI6 A;  3L9F A;  2XF7 A;  3IL2 A;  3GTP J;  1FIP A;  3AG3 H;  1S7E A;  2K27 A;  2AQF A;  3L7W A;  3RKQ A;  2JN6 A;  1EH7 A;  4Y15 A;  4M3F A;  3MKL A;  3J7A Y;  1TC3 C;  2Y48 A; 
#chains in the Genus database with same CATH homology
 4F91 B;  4NNJ A;  2WAD A;  1T0F C;  2WBM A;  4AVZ A;  4PJN A;  3L2W A;  4ZTF A;  2BOL A;  2X6W A;  2GOX B;  3D5R C;  1X4P A;  3PUB A;  4CUG A;  1QHH D;  3OS1 A;  2ZSI B;  4CH7 A;  1N78 A;  1X4O A;  4BU2 A;  3OYM A;  1MND A;  2M7B A;  3RSN A;  3K4K A;  2XC7 A;  3H0D A;  2UUZ A;  3KX2 A;  2FUG 2;  3OMY A;  1W36 C;  2VJI A;  3LSH A;  2HVQ A;  4RLQ A;  3QOD A;  1V5E A;  3SYT A;  2K3P A;  4BAC A;  4MLO A;  3DWL E;  2MAB A;  3I3L A;  3DTI A;  3GBG A;  2M4K A;  2PJR A;  3L2R A;  1X19 A;  4EAT A;  4CA0 A;  3ZXS A;  3FKJ A;  2R7U A;  4AYB A;  2WAQ A;  2V1N A;  3PNY A;  4DIQ A;  3OYE A;  1D0Z A;  4DJA A;  4HNU A;  4ZYA A;  2NOJ B;  1OLT A;  3H5R A;  2V9K A;  2VIX A;  3OIQ A;  4XLH A;  4BJ6 C;  1QU3 A;  1Z3Y A;  2KP6 A;  1LKX A;  4BQQ A;  2LBF B;  3DPU A;  3RPU D;  2LG4 A;  3VSK A;  1SAU A;  2HPM A;  2JVH A;  3K4M A;  2LH9 A;  3ONQ A;  2LYC A;  1DGW Y;  3HOS A;  4YEL A;  4BEH A;  4ZDL A;  3BCB A;  4PK4 A;  2F5V A;  3DTE A;  2WAE A;  2AQE A;  3CJQ B;  3OYA A;  3PNT A;  3QYB A;  2VAS A;  3M1C A;  1WJ5 A;  2VJ5 A;  4BQN A;  1T95 A;  2IGM A;  3IAM 2;  3L2V A;  4FET A;  2CW7 A;  4G6T B;  1EA3 A;  3VYS B;  2JVG A;  4NC7 A;  2R7R A;  3DU6 A;  5CPR B;  2UV1 A;  2F6C A;  2IXS A;  4XN0 A;  4B48 A;  3MKZ A;  1Y56 A;  3EUH C;  3MMY B;  3DPT A;  4CZC A;  2Z2S B;  4D1Q A;  3AL0 B;  3PSF A;  4B47 A;  3DEE A;  4F55 A;  3ZQQ A;  3FBI B;  4YEJ A;  4BUP A;  2KRC A;  3K6G A;  3HL2 A;  5KNL A;  4F93 B;  2CV0 A;  3OL4 A;  3A1Y A;  2ELJ A;  1MNE A;  4ZC3 A;  2JA2 A;  2JSP A;  1ZEL A;  4XOR A;  3OYD A;  3FBN B;  3OYH A;  2E60 A;  3BG6 A;  2VKH A;  4PSX A;  4E7L A;  2X1C A;  4XKC A;  5HNH A;  2X6X A;  3LSK A;  1D0X A;  2HPI A;  3W2W A;  4B43 A;  1BR1 A;  2IGN A;  3OIP A;  4ITV A;  4BE0 A;  4IQ4 A;  4BE1 A;  3LSG A;  4QPO A;  3OYB A;  4DGW B;  2IS6 A;  2R7T A;  3S93 A;  3K4N A;  2RRE A;  2ZSH B;  3DKY A;  3VYT B;  2HDW A;  4F92 B;  5FRO A;  2V4J C;  2HQA A;  4II2 A;  2WA0 A;  3N05 A;  4DBQ A;  4E4H A;  3CP2 A;  3DPL C;  4PJM A;  3OS2 A;  4U87 A;  4BDZ A;  3AFH A;  4PFP A;  1X1C A;  1FMW A;  3K4J A;  4E7H A;  1Z21 A;  4DBR A;  4XLC A;  1IRX A;  4P1W A;  2E5N A;  2IGK A;  3K4L A;  4XNF A;  1LVK A;  2M3A A;  2VQH A;  3E1S A;  3OL3 A;  2E1M C;  4BL0 B;  3A4C A;  3DKX A;  2KZV A;  3H9J A;  3S32 A;  2CFO A;  1G8X A;  4HST A;  2V6E A;  2IS1 A;  2MD0 A;  3CF2 A;  2IGO A;  2VQG A;  3VWB A;  3HXL A;  1N77 A;  4F3Q A;  4HSR A;  2O5R A;  3TMO A;  5CKT A;  4CCK A;  1FMV A;  4NQW B;  1NG6 A;  4CCJ A;  1WJF A;  4DOZ A;  2CUJ A;  2QKM B;  4OAZ A;  2CV2 A;  2ZFU A;  3QOE A;  2XSJ C;  1BOB A;  2A6T A;  5HNF A;  1AA7 A;  2KL4 A;  3ZCO A;  4ANJ A;  4LIU A;  1VZ0 A;  3H5N A;  2CUZ A;  2L9N A;  1Y6I A;  2CV1 A;  2HZD A;  3TBI A;  1OR7 C;  4D9J A;  2DJI A;  2QKL B;  4KT6 A;  4E7Z A;  3SEZ A;  1HA8 A;  2A5W A;  5FRM A;  4XR6 A;  2P0W A;  1NG7 A;  4RM2 A;  3VSL A;  4BXF A;  1LFP A;  4RLF A;  3MD2 A;  5FRN A;  2HU9 A;  3VDX A;  2PMZ A;  2HVR A;  2IS2 A;  4E7S A;  1MMD A;  2R4G A;  2KPM A;  3OWT A;  4P5O A;  1SFK A;  4B3X A;  2RQQ A;  4E7J A;  2R7X A;  2DOA A;  3RCO A;  2MC4 A;  3AKZ A;  3OYK A;  4E7I A;  3PJR A;  4CCM A;  2XF5 A;  2L5Q A;  1KON A;  2OC6 A;  4E7K A;  2M7A A;  5HOO A;  3KEY A;  4XKB A;  3OYC A;  2E5Z A;  2W00 A;  4X0G A;  4BS9 A;  2X1E A;  3LSM A;  4B44 A;  5TGT A;  4E6K G;  1WJC A;  5LFA A;  2BW3 A;  4XM3 A;  3VYR B;  1U0J A;  4BJ5 C;  3S8P A;  3OOU A;  3L2U A;  4BDY A;  3K4B A;  2R7S A;  2X6Y A;  1BR4 A;  2V26 A;  4N4O B;  3HPH A;  2VLA A;  3S3O A;  2DT7 B;  2L2O A;  4RM3 A;  4R79 A;  1TT0 A;  2W7N A;  4Y3O A;  3QYE A;  2K9L A;  2VJ4 A;  1BR2 A;  2KRH A;  4HEA 2;  3HC7 A;  1D1A A;  1LDK B;  4XOT A;  3CMM A;  2VQC A;  2CH0 A;  2WAF A;  4XLF A;  1UAA A;  2WY7 Q;  4YRV A;  2DCE A;  3HG9 A;  3CJR B;  2CS3 A;  3G2B A;  3K4C A;  3U21 A;  4CCN A;  4HNT A;  1G59 A;  4OWR B;  2F4I A;  2LRD A;  3C2G A;  1YX3 A;  4XLE A;  4BQO A;  1TZL A;  1MW7 A;  2Z1D A;  3OS0 A;  3PFY A;  4CCO A;  3C2H A;  4H4K C;  4F52 A;  1D0Y A;  1X1A A;  1S9H A;  1PJR A;  1UG0 A;  1X1B A;  2HNH A;  3LL7 A;  2V7F A;  4PJJ A;  5HLT A;  2VXD A;  1Z7L A;  4IQJ A;  1WJD A;  1N75 A;  4FAS D;  3UNG C;  2L9S A;  3W2A A;  3ZRG A;  3ZGK A;  2GOM A;  5HVQ C;  4N4N B;  4XOP A;  3VYU B;  3LSI A;  4JOM A;  4BEH B;  3M8J A;  2VB6 A;  4IX7 A;  5CQG A;  1X1D A;  1MMN A;  3IP4 B;  3S3N A;  2XF6 A;  2KHM A;  3DQV C;  2KDO A;  3BC8 A;  3OYN A;  3D5L A;  3AL0 C;  3DU5 A;  4II3 A;  2PJR B;  4NUB A;  4XL9 A;  4KIS A;  1WJA A;  1GLN A;  2LOO A;  3K10 A;  4KIT B;  3CP8 A;  2VJJ A;  2HVS A;  3OYI A;  2ZXH A;  3I9V 2;  2M4G A;  4C30 A;  3DLA A;  3OR2 C;  4U7B A;  2CW8 A;  2DXI A;  2M0M A;  2CMP A;  3QYF A;  3W2V A;  2E1M B;  3PSI A;  3MKW B;  1D1B A;  3SZG A;  1PYV A;  4HG2 A;  4XKW A;  2LBF A;  4KJZ A;  2X85 A;  2R7Q A;  2UWM A;  3LMM A;  3ZR8 X;  3HOT A;  4PSW A;  4GRI A;  4Y4R A;  4LIV A;  3NWT A;  2OUM A;  2XDV A;  3BLY A;  2R7O A;  4XON A;  4ZJZ A;  5KHD A;  2MYS A;  1W36 D;  4IZZ A;  3EUA A;  4ZTJ A;  2BVL A;  3IUO A;  2Y0S A;  2BVM A;  2LRE A;  1Z3X A;  2W82 A;  3HPG A;  4OAY A;  3SEQ A;  3TL4 X;  4Y33 A;  4XMY A;  4XN3 A;  3KYL A;  4J01 A;  3D5S C;  1YE9 A;  1JI8 A;  2OV7 A;  1J09 A;  2VKD A;  2VXZ A;  1DP3 A;  4CCL A;  3OY9 A;  4RMN A;  1MMA A;  4LG3 A;  2X1D A;  3EUK L;  3SDB A;  1E0E A;  3H9Q A;  1D1C A;  4HPQ A;  2JUG A;  3H5A A;  3H9G A;  3PNV A;  4XKV A;  5CQE A;  2LY2 A;  3RQ4 A;  3CZ6 A;  3DTK A;  4LIT A;  2W4S A;  3NWS A;  2K5C A;  3LFU A;  2WB1 A;  2RNG A;  3E0J B;  4AU7 A;  3EPZ A;  3S3M A;  2LC2 A;  2KMU A;  3BCA A;  4QPQ A;  2Q1Z B;  1R6R A;  4HRI A;  3HKZ A;  2KLO A;  4CSW A;  2L7K A;  3BG7 A;  3V42 A;  4BGD A;  3OYG A;  2DT6 A;  2BW3 B;  2IS4 A;  3FDY A;  4BJT A;  3FHN A;  4ZDO A;  1WJE A;  2W1O A;  1UEL B;  4XLA A;  1QHG A;  1DGR M;  4PUS A;  3L2Q A;  2XAU A;  2Q2E B;  1K6Y A;  4C9Y A;  2VQL A;  4BE2 A;  1YX5 A;  2VPL A;  4PJL A;  4IKF A;  1ERD A;  3OYL A;  3H35 A;  3CES A;  3UR3 C;  5JHF A;  2LY1 A;  3HUG B;  2ZXI A;  3OYF A;  3K70 D;  3RTR A;  3F9K A;  2R7W A;  1V5G A;  2WY8 Q;  4ZDP A;  3K70 C;  2R7V A;  2I8D A;  3MKY B;  2MFZ A;  2X51 A;  2VL8 A;  4NC8 A;  1DQU A;  4JQF A;  4C2T A;  3A2K A;  5KCM A;  4C2U A;  3PL8 A;  1V5F A;  2K9M A;  1WFX A;  3OR1 C;  1MMG A;  2XF7 A;  4PFO A;  3W3C A;  2KQR A;  1WJB A;  1P9Q C;  4J00 A;  2AQF A;  3IAS 2;  4XQF A;  2Z16 A;  3OYJ A;  5LD2 C;  3J7A Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...