3FBIB

Structure of the mediator submodule med7n/31
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
b'QNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mediator of RNA polymerase II transcription subunit 7
publication title Identification, structure, and functional requirement of the Mediator submodule Med7N/31
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 27
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05669 Med31 SOH1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1340 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3fbiB00
3FBNB 3FBIB
chains in the Genus database with same CATH superfamily
3I59A 1MNMC 1OCTC 2XKOA 3OYMA 2ESNA 4Z2YA 2ELHA 4HF1A 1I3AA 3B6AA 2CFXA 3U21A 1WRJA 4J00A 2CJJA 4LG0B 5J4VA 4X0GA 3K1NA 1FMWA 3C1DA 3WHBA 4DNCA 4X6AJ 4M6VA 1SD4A 2AO9A 3TMOA 3JRCA 3CLQA 3CJTB 2W48A 2O03A 2DK5A 1QRYA 2CSOA 3LA2A 3GYHX 1R6RA 1LDDA 5JFRA 4YIRX 1ETOA 1XCVA 3MKYB 2DK8A 1LFUP 1PYVA 3IWFA 2M30A 3VYRB 2D1HA 1RZ4A 2E1MB 2HOSA 2NS7A 4XBFA 3F6VA 1R1VA 1N77A 4BJTA 5IYDJ 1NG7A 4ITVA 3MEXA 4IQJA 2XGEA 5CJ9A 3G1OA 3KLNA 3L2WA 2YPRA 2BBYA 2XAFA 1WJFA 1UG2A 2F5FA 3HHHA 1WZ2A 3W6KB 4L0YB 4CCOA 4EVIA 1N25A 3RJPA 3V42A 3HGGA 1EH8A 1OKRA 5GP9A 4RB3C 4BDZA 4F52A 3M1CA 1GXQA 1S5LC 1IRFA 3TGNA 4S05A 4B43A 2H8WA 3QODA 2F4IA 2ZO4A 2R3SA 2XRLA 3L2CA 4LJZF 1M1EB 2MG4A 4EQQA 4PUSA 2GQQA 1S8NA 4A6EA 1RETA 2VC0A 2QENA 2Z33A 2V79A 2FBIA 2FBHA 3HG9A 4NC6A 1G3YA 3OS0A 2KMUA 4DZPA 4IZZA 4AIHA 1IRXA 4FTHA 4GYGA 2CV2A 2Z16A 4C3JJ 3C18A 1BI1A 3FDYA 4M73A 1H9GA 2IA1A 1W5TA 4P9FA 4MTEA 2L9RA 3H36A 2R7XA 2AXTC 1XDSA 1IN7A 1RC9A 4BQOA 1K61A 4Y4RA 1D5YA 4O3MA 2DW4A 3U1DA 5FFZA 1R00A 5BNGA 1RRJA 5F04A 3WU0A 2V9VA 3PNTA 2D1VA 3W2AA 1BI3A 2UUZA 4CDGA 2WA0A 3QP6A 4A5NA 5EG0A 1VQ9I 2EJRA 2DJNA 2DOFA 4BU2A 2ACJA 3WG7H 3LQQA 1ZLJA 3S3MA 3ZRGA 2B63J 4XSXF 4IHTA 1BJAA 4UNOA 2EZIA 2KISA 4OMZA 2BOLA 3PSFA 1MSEC 2VXDA 4AWXB 3IC7A 1RUNA 2W1OA 3RDIA 2M4KA 4BXXJ 1D0YA 1SVMA 1ITYA 3FXQA 5F6FA 3EYYA 1O57A 1IRGA 2IPQX 1LFBA 2RQQA 1TQMA 2QSGX 3J7AY 1MMDA 3QYBA 1ZN2A 2K02A 4XLFA 2QKLB 2RVCA 3BR6A 4MFEA 3PIPF 1RESA 1HDPA 2V9PA 5D5UB 1MKMA 4KYWA 2Y75A 4QTRA 1WJAA 4YG2F 1XB4A 3MQ0A 3OYKA 5M5WJ 2P81A 4GFBA 3AL0C 4A3CJ 2LC2A 2Y48A 3A01A 1S72I 5C44J 1HXDA 1FX7A 2VONA 4BHPA 3GTGJ 4BXUA 2K7LA 1QO0D 3CD6I 2F48A 4E7JA 3ZQQA 2VJ4A 1IUFA 2NVYJ 5CVRA 1HC8A 4MQVA 2FBKA 3DCFA 2Z2SB 5C3EJ 3GWZA 2BEOA 3M7GA 3OYAA 2PMHA 3JRGA 4J19A 4N9HA 3OIQA 1FOXA 4KFCA 2W24A 2A05A 1K6YA 5DD4A 1FYMA 5ICCA 1W36D 4F55A 2E7WA 3RZDJ 1HW2A 5H20A 1YQAA 5LEJA 5HS8A 2R7RA 3BTIA 4II3A 2XAHA 1FT9A 1TWFJ 2MA3A 3GEZA 1X4PA 4RBOA 3IAS2 3QU3A 1ZARA 1SAUA 2JRMA 4XRSG 5FKLA 3CP2A 2HKOA 4B1RA 2VOOA 2V6CA 3DEWA 3DXJF 2JZYA 4OIOF 4JOMA 3K9TA 4IHVA 3HIFA 2CQXA 2D45A 5BOXA 4KT5C 2CFOA 4MEYF 3C2GA 4BUPA 1ACIA 2KJCA 2NS8A 3ONQA 4LLGF 4RGSA 4ZYDA 2HYJA 2LVSA 2K9NA 4D9JA 3I4MJ 1B8IA 2OUMA 2IGOA 5TJJA 1UHSA 4KUMA 3QRFF 4BS9A 1TTYA 1JTYA 2RN7A 3MZ8A 4C2UA 3CO7C 2M9HA 1BC7C 3CUOA 3IV5A 4CSWA 4Z6YA 5FJ8J 3HOXJ 2IP2A 1D1BA 3S32A 2VODA 1VQ7I 2XSJC 2RAEA 1Y8RB 2ZJ2A 1Z21A 2DOAA 2ID6A 1X1CA 2LBFA 2E19A 1HKTA 1OJLA 3ROUA 4ZH4F 2NNYA 4XIDA 4RGRA 2PI0A 2KRHA 3KP7A 3IH3A 1VFCA 2L9VA 3JW4A 2IW5A 4PDKA 2ISYA 1D3YA 4U0YA 4C2MJ 4ZDLA 3K1MA 1VF9A 4ZTJA 3QPTA 4BE1A 3EUKL 2R7FA 4WK8F 2CGPA 1OYWA 1ETKA 2OF7A 2ZKZA 3R0JA 5AONA 1H88C 1TWGJ 3BG9A 1MH4A 1Z0XA 4M3EA 2BXZA 1E17A 4R1HA 1LB2A 3Q0WA 2DOEA 3NWSA 1CF7B 1TC3C 4EJWA 2VQGA 1T39A 3SEQA 3A0HC 2R7UA 2B9SA 3FXMA 3NQOA 1ZGJA 4W97A 3HOWJ 1F43A 1O3SA 2HXOA 2DDAA 4KJZA 1WQ2A 2KT0A 1IDYA 4IF4A 5J3LA 4UUTA 3CC2I 3V8LA 3LNQA 4BBSJ 4F3QA 4N4OB 1JTXA 5B3SH 2BW3B 1UG0A 1Z05A 1BIBA 2KRCA 4HF2A 1YX3A 1FTTA 2YU3A 1ON1A 3PO2J 3A03A 3V4GA 2MYSA 3KP5A 5J40A 1WJBA 3GTKJ 3HJEA 4ESFA 4K2EA 2O5RA 4PZJA 3KYLA 3A02A 2VT3A 4ZZLA 4PFOA 3MKWB 1R5HA 2L02A 2HGCA 2X0LA 3HTSB 4NDLA 3C7JA 4AIKA 3OS2A 2FMYA 2WAEA 4XRMA 4BDYA 1WSUA 2DT6A 3S1QJ 3BQYA 5D8KB 1P92A 3LAJA 1JJ6C 4DW6A 4HX7A 4LITA 1SD7A 4Y17A 1J59A 2HVSA 2V4JC 1K83J 2VKVA 4AIJA 2PJPA 2R7VA 3M8JA 1FEXA 4KISA 3BCAA 1B9NA 2OD5A 2GAUA 1VQNI 4ZDOA 3B02A 2M2EA 1UCRA 1WVRA 3OYFA 1AKHA 3WTUC 1X3WB 4FISA 3K70D 3DTKA 2CMPA 4BNCA 2L7FP 4L9JA 2DMQA 2XROA 3CCQI 4Y13A 2PJRA 3WGHA 1ZAOA 4UB6C 1D8KA 2DMUA 1KZHA 3AAFA 1R71A 3F8NA 4RGXA 1XGMA 4LK0F 4O5VA 3ZQ7A 5FLVA 3SYTA 1X1AA 3GFMA 5IPAA 3JRIA 2NOJB 2E2IJ 5H6QA 2P8TA 1G8XA 1HCRA 2EV0A 2WY7Q 1QGPA 1P2FA 2VXZA 1FWZA 1PDNC 2HDCA 2E7XA 1XSDA 3MFKA 4XRSA 2O61A 3RKQA 1HKQA 4HQEA 2NOGA 4HX4A 2O6GE 1QHGA 5K1YA 5DS9A 4NBQA 4CO8A 1T0FA 2XV4S 1MBFA 2XDVA 3PNYA 1FJLA 2L9SA 5DCFA 2A68F 3S1RJ 5DEQA 1XDUA 3S15J 3DTEA 1OCRH 3PUBA 1BJZA 4E70A 2Y9ZA 1QPMA 4XORA 3O3KA 3S8PA 1I50J 2M3AA 3M1EA 4HDVA 1J5YA 2R92J 2X48A 4YEJA 2GA2A 4ASNA 2DFEA 3N97A 2DA1A 2GXGA 5FKNA 1T08B 2O7OA 3OIPA 4A3FJ 2KFDA 4DYCA 5GAHJ 1MBGA 1YTYA 2XF7A 3GF2A 4HOBA 4ZC3A 4MFDA 3JAMZ 3Q9VA 3HUGA 3W3CA 1A31A 3HSEA 4QPQA 2OA4A 1A6IA 2LMDA 3UR3C 2CQKA 2QKMB 4CYCA 1YLFA 5F08A 3BG3A 2M0MA 4B09A 1U5TB 3CJNA 2V1DA 3LA3A 3E3VA 5GADJ 3HUGB 2MD5A 5LFAA 4HX8A 4DZJA 1TWHJ 2Y9YA 2AXLA 3WTYC 1EF4A 4OINF 1QZYA 2BV6A 2F2EA 2OCCH 2KHMA 3CQZJ 4HNVA 2IS6A 4ZZDA 2LKPA 1W7PA 4OAZA 3ULQB 3K0LA 3V8KA 1OMIA 4F93B 1H89C 2EA2A 3LSGA 5GTIC 4M9SA 2VJIA 3I5UA 4TV7A 4UVCA 3V8JA 2PLYA 5D8LB 1TNTA 5FLXZ 1IG7A 2HOAA 1KYWA 2ZMEC 1IDZA 2DMNA 4UUVA 3PJRA 3IH2A 1KYZA 2YX7A 3NAUA 2X51A 2EFWA 3GLLA 2JQ7A 3EUHA 2KIFA 3ZMZA 1K79A 2TCTA 1G4DA 3K4BA 1BC8C 1BL0A 2KL4A 2VUMJ 4NQWA 1ZELA 4D5CA 5DUKA 2EFQA 2LRDA 4LK1F 4A0XA 1K4TA 3VFZA 2E1OA 1LVKA 2QM3A 2HDWA 1RR7A 4OIPF 4LLNA 3P5JA 4II2A 4A5MA 1OFCX 4G7OF 3OYCA 1E3OC 1LNWA 4XNFA 2NVXJ 1J0RA 1T98A 4OAYA 2L7KA 2E2HJ 4E7KA 3KIOA 3L1PA 4E7IA 4Q48A 2ZNZA 2WB1A 3KP2A 4O6JA 1R4MB 4PK4A 1FNNA 3F8MA 3R6SA 4DIQA 5JHFA 4UUSB 4CCKA 3FBIB 2L54A 3MCZA 2MFZA 3FX3A 1KU3A 2VQCA 3F8BA 2Z9OA 3OYGA 1A36A 5HLIA 3L2QA 3AG4H 3QAHA 1RIOH 3HPGA 3ZQFA 4I6ZA 2W00A 5IY5H 5HNFA 2K9LA 1W5SA 1U78A 2QGUA 2Y2ZA 4LOCA 4Y3OA 4PGHA 1XTAA 4M9ZA 2KKOA 5CYVA 4Y52J 3VPRA 4U0WA 3A0BC 4RB2C 4PJ0C 2EZKA 2ME0A 3HHGA 2DJIA 4PSXA 2WBMA 1SANA 1OCZH 3PL8A 3R0AA 2EZHA 3BR5A 1WJCA 5LHIA 2DLLA 5JVGF 3GCMA 4NNJA 1GVDA 2P5LC 1YI2I 2R7ZJ 1U6GA 3W2WA 4CICA 2DI3A 3S1NJ 4PJLA 3H9GA 1PUFA 1NK3P 2HI3A 1X3ZB 5E8IA 2CWEA 2YU9J 4MO7A 1K78B 1FP2A 2BY2A 3HSRA 3MAJA 3JTGA 3P9KA 5FGMA 4OMYA 1MIJA 3DPUA 2GBYA 3RPUA 2FQ4A 3K4MA 3HL2A 1SD6A 2NNNA 1R1TA 3NEUA 3CCJI 2GIVA 2QQ8A 4HV5A 1JXSA 1MBHA 3S93A 2QUFA 1DGWY 3H35A 1Z1DA 1KONA 3W2VA 3KETA 2XAGA 4KIGA 1ZR2A 1SAXA 3QOEA 3ZCOA 2MSYA 1T56A 3JRBA 1IN4A 1BR4A 2JA5J 2H94A 4M3GA 2QSHX 3G6EI 3AG3H 3LSTA 1IUYA 3K1PA 2A5YB 3HPHA 3WODF 2EINH 4EJTA 4PJMA 3L2VA 2XASA 2EBIA 3FK7A 4L9VA 4M3BA 5M3MJ 2DN0A 2I5UA 2WAFA 4RB1A 2HQAA 1T38A 3RTRA 1W0TA 5HLGA 2CH0A 1YJNI 4LG0A 1LKXA 4DOZA 1DDNA 2ZXWH 1I27A 3I4PA 1MNDA 3LAPA 2DA7A 2A5WA 4PFPA 2ECBA 3CTAA 4GRIA 4HLYA 1CGPA 3HYIA 2FEZA 4ENMA 3BR2A 5EEGA 4I98B 1EH7A 1TW2A 1PJRA 1Y1WJ 1ZG1A 4UY8I 3DBHB 3V7CA 3CCEI 1Y6IA 2ESHA 1I5ZA 3D5SC 2BY1A 4I7HA 4RB0A 5D5VB 3PQKA 2K4BA 2DFFA 5E3NA 2A6HF 1PP7U 3FBNB 1R7JA 1DP7P 4G9YA 3FXKA 1F36A 4DGWB 2HQNA 3F3XA 3OL3A 4HAMA 1D0XA 1B72B 1QU3A 2F4OB 1O7FA 2QF7A 4OIQF 4U0VA 1YS7A 2O0YA 3KX2A 3TQNA 3GTQJ 3MZHA 1P7JA 2EK5A 5FB2A 4H0EA 2K4JA 5EGOA 3ZMTA 2HU9A 5BQTA 3BJOA 2OBPA 4OOIA 3HTUA 1VQOI 1IV8A 3H3UA 3OYNA 3H92A 3HZJA 1FOKA 2Q1ZB 4L9TA 3CC4I 5F27A 3AL0B 2P6TA 1WH5A 5HLTA 4RAZA 5EGOB 2HVRA 5IP6A 3WHCA 2XPUA 5HNHA 3ABTA 4RM3A 3CJRB 2IVMA 4ZYAA 1LQ1A 2EIKH 1MJBA 3ZP5A 2DPDA 2F5VA 2PMZN 3KZZA 3ZGKA 3HGYA 4RA2A 1DUXC 2QVOA 1QZZA 1YW9A 1UMQA 2DQRA 2E35A 2QBYB 4JX5A 1EH6A 1Z6TA 1B59A 4G6TB 1WI9A 3E0JB 3MMYB 4B3XA 2EPFA 4S0HB 2GXBA 3MKLA 1KU7A 2COMA 3M3YJ 3C2BA 3OV8A 3OYDA 1SFXA 4ENNA 4M6YA 3K69A 2M8EA 3QYFA 1AOYA 2JPCA 4EM1A 1HQCA 4S04A 3K4LA 4M6XA 2CO5A 3IHUA 3F0CA 4E7ZA 3RCOA 3IRRA 3CUQC 1JUMA 3CCMI 1V5GA 1FOWA 1MNEA 3K2AA 1ZHFA 2VN2A 1O4XA 1ZRCA 2LF8A 4MNUA 3JSOA 2VASA 5IT9Z 4RS8A 1FSHA 2XF6A 2M4GA 3ZMSA 1POGA 3SFIA 4C9YA 1LPQA 4XN3A 4N0BA 2HTJA 5D5XB 5HS7A 2FMLA 3PUFA 4CCLA 3H9QA 1N75A 3IAM2 5DYMA 5ILVA 1DP3A 2BXYA 2KDOA 2IAIA 1I6HJ 3BPVA 4A3EJ 1BR2A 1MDMB 1LFPA 5FO5A 4CGZA 5JHUA 1T6SA 4WWCA 4XLPF 3FIWA 1J09A 1HOMA 4YFXF 1G2HA 1MBKA 4GGGA 4FQGA 4BE0A 3FXLA 2CQNA 2QWWA 1XSXA 2ID3A 3OSGA 1OCOH 1K4SA 1WFXA 3BG6A 4F91B 2DTRA 1TZLA 3SZTA 2LNBA 5KVRA 3GTOJ 1DGRM 1O3TA 3BTLA 1XMKA 4RM2A 4IRGA 2E5NA 2K40A 1QA6A 4BACA 1Z6RA 4V2FA 3JSPA 3KFWX 3JTHA 1SFKA 2NYXA 2GIZA 2QQBA 5IOYA 2H27A 2GA1A 2WY8Q 1G3TA 3DKYA 2F5EA 5EEAA 1Y56A 3WTVC 1Q1VA 3I54A 2XIGA 3OYEA 4CCNA 3QWLA 3QP5A 3J7YJ 2V7FA 2CW7A 4V19K 3ZN1A 1WJ5A 1J9IA 2HFHA 1JKRC 4GDFA 5J1RA 2QQ9A 5H2FC 1ZG3A 5DDGA 1RR8C 1Y0NA 2QZ8A 4BBRJ 1AWCA 2ZJQF 2K9SA 2F5CA 5HOOA 1ZG5A 1YIJI 1MMSA 1XN7A 4AM3A 4ENJA 4M3FA 4RAGA 4DYRA 3QPSA 2PBIA 3ZR8X 5TISC 2X4HA 1YFHA 3OSFA 3G3ZA 3MWMA 5DV5A 2ZSIB 3I9V2 4HNUA 1YJWI 4ABZA 3O8GA 3KP3A 4FE4A 3WTWC 3M4OJ 3S3OA 4BH9A 5IP9J 2JA2A 1IAWA 2VKHA 3G1MA 5FD5A 2W57A 5EZGA 4HF0A 5GAEJ 3GX4X 1ZR4A 3I3LA 3WGIA 3JRDA 1ENHA 3BZ6A 1VTNC 3CMAI 1GT0C 5ICEA 2MH2A 4HBLA 1H9TA 3GZ6A 1OR7A 1FLIA 3BDDA 5L3CA 2JUGA 2ZJRF 3JAMK 4HEA2 3TOAA 5K5RA 4HV6A 1Y1VJ 3E6MA 1O3QA 3WE2A 5K5QA 4A0YA 3S1MJ 2L4MA 1IJWC 4BE2A 3OOUA 2H6CA 2W25A 1MGTA 3FHNA 2NRAC 2ZSHB 1I1SA 2ZCWA 4N4NB 4JX4A 4G8XA 2HZDA 4RLQA 3DV8A 3CDLA 2A69F 2EQRA 3SDBA 4CH7A 3IH4A 3KE2A 3RYPA 4EGZA 5EDNA 4C3HJ 3H0GJ 4U87A 5J8CA 3F21A 2WAQN 2J5OA 2X6WA 4G7HF 3R61A 3CJQB 4ENKA 3GFLA 2IXSA 4HRIA 2OAZA 2DYRH 1UHMA 3VYTB 4WXCA 1CF7A 3SZGA 1JUPA 2FUG2 4RLFA 2Y30A 1OYYA 4X1EA 4AVPA 2W4SA 2IT0A 3FM3A 3BR1A 3CMEI 1V3FA 3GFIA 2QEXI 1S7OA 2DT5A 2M34A 5IOZA 2R4GA 3S2DJ 3RSNA 3CCSI 3E1SA 3BROA 5LHGA 2Q0OA 2P4WA 3IUOA 4HQMA 3GTJJ 3QQAA 4HW0A 5B1AH 1X3UA 2JUCA 2DA3A 4IEJA 2BW3A 4BAYA 1YJ9I 4I09A 1JJ8C 1IN5A 3GTLJ 5CVJA 2M7AA 1NTCA 1QPIA 4P96A 2GOMA 2HXIA 2PEXA 3ASOH 2LREA 3M8FA 3DU6A 4JP0A 1QBJA 1S3JA 4EJOA 5CVIA 3OYLA 4FHTA 1VQMI 2PMZA 1IN8A 5IP7J 3BTJA 2CQQA 4IRHA 3UNGC 2VI6A 2WWYA 3VOEA 1WHUA 1E0EA 1P9QC 3PFIA 5HS9A 4HNTA 3EUAA 4F7ZA 2KLOA 4CXFA 1LE8B 3PO3J 2Z99A 5K7FA 4D0PA 3QPLA 2QYOA 1EJ9A 1RKTA 2VBYA 3ABMH 1KA8A 3K10A 1OLTA 1JI8A 4C2TA 2E60A 2DA6A 2DU9A 2L5QA 2MLKA 3QYEA 3DP7A 3DPTA 4OWRB 1ZTRA 2G7UA 3VODA 4BEHA 1J75A 3TO9A 5E1ZB 3Q0VA 3S16J 9ANTA 1Z9CA 4A12A 2LG4A 3AFHA 1FC3A 3K7AJ 1LEAA 4E7SA 3SFZA 4HYEA 2GXAA 4BEHB 3I55I 4WX9A 2KQRA 2ISZA 3BWGA 4XKVA 1U8RA 1GDTA 4P9UA 1RUOA 4FX0A 5KK1A 1R58A 1S29A 2N8GA 5GPAA 3CCRI 5E1XA 3TDUC 4G6QA 3LOCA 4XN0A 1LEBA 1R9TJ 3VSLA 4IVNA 1P7IA 1IXRC 1W7PD 3VDXA 2DCEA 5C4JJ 4A3GJ 2XC7A 3CCVI 3MD2A 2ZMEB 3O8HA 1AHDP 3ASNH 3WTTC 3JR9A 4A93J 2ECCA 3WU2C 2M1BA 5LGUA 2MBFA 5E18F 1NG6A 2H09A 2VE9A 3BZKA 3BPXA 5GTHC 3WTSC 3MVPA 1FZPB 4UHTA 1UB9A 3OYJA 1SC7A 4CCJA 1VQLI 3Q5FA 3H1CA 2LF7A 2ZBKA 4A2UA 3ZQCA 3KYDB 1W36C 3D1NI 5F0FA 1L0OC 2X1CA 2LK2A 2DA2A 2FU4A 1LDKB 4E7HA 3RKYA 3HSFA 3RKXA 2W85A 3M8EA 1R4NB 4BQQA 2DDBA 2CW8A 3OL4A 3PFYA 4A0ZA 3J81K 1ON2A 2MABA 2CS3A 2K3PA 3H9JA 1QNTA 3M07A 2DXIA 4I0BA 2ZXIA 3N05A 3LSHA 3BC8A 3NRVA 4UVBA 1TLHB 1DU6A 1U5TA 4XLCA 1R36A 2W84A 4EM2A 3R60A 1VQ5I 3CP8A 2X6OA 4HLXA 3FKIJ 1UJ8A 2QLZA 2XPWA 2XRNA 4A69C 2IS2A 1Z67A 3OOPA 5LGNA 1BW6A 3I58A 3SEZA 5LBQA 2R93J 4WF2A 1XC5A 1Y8QB 3HB9A 2L3DA 2EH3A 1RKWA 3GFJA 2UXXA 1VQPI 1YE9A 2FA5A 3CLOA 2R5YB 1ZLKA 2RNJA 3Q9SA 3BG5A 3HOSA 2NXNB 1HKSA 3N4MA 1JGSA 3RQ4A 2ADUA 4IXAA 3TO6A 5M5YJ 4AIDA 3ABLH 4YIIA 1IRZA 4P1WA 4ETSA 5DUIA 1V4RA 3VEPA 3GXOA 3I71A 4G6DA 2Q8KA 2LY2A 5B1BH 4ZTFA 2EV6A 5BMZA 5L3EA 1XGOA 2UV1A 2X1EA 5E3LA 1YW7A 4HSTA 4BGDA 2XHKA 2MC3A 3DLAA 1QVUA 2LTPA 5E8GA 4YFKF 2CUFA 1IV6A 3RQIA 3E5UA 5IT3A 2VBXA 2DQLA 1X19A 4AYBN 4D7NA 2M8GX 1MMNA 1ZGWA 5TGTA 1SVLA 1MMAA 4Q4ZF 1BI2A 2VT2A 5ICFA 5B66C 5HDKA 2XSDC 4XOTA 1E2XA 1S7AA 3SDGA 1BBYA 2A61A 3GMEA 4L0ZB 1XX5A 3EDPA 2DT7B 4R8HA 4XOPA 2LH9A 3TDZC 3BG7A 3GVAA 3G1LA 1USSA 3ZQHA 1D5VA 2WAQA 3RPUD 3TW6A 3ZQIA 2DFHA 2EZLA 1YITI 1LDJA 2HQRA 2VPRA 1STZA 1P4WA 2WTEA 1FOYA 4UUSA 4QLCU 3DKWA 3S2HJ 5J8FA 1L3LA 5FLMJ 4D1QA 1W5CC 1O3RA 3WTZA 4IJAA 3K6GA 1W0UA 3P9IA 1Q1HA 1KU9A 2A6TA 3Q3SA 5FKMA 4A6DA 4B48A 3JRFA 3IL2A 4QIWN 1T8IA 4BXFA 2E1CA 1ODDA 2ZNYA 3FMSA 1YW8A 2FRHA 4BQAA 2KDZA 2ETHA 4ZYEA 2HPMA 3A2KA 3W6JB 5L3FA 3J80Z 4DQ2A 4YIFA 2IGKA 2CV0A 4MHGA 2R7OA 3COAC 2PMUA 3DEUA 4MTDA 2Q2EB 4AC0A 3K4JA 2OTLI 1OCPA 3EETA 1AU7A 1D0ZA 5CQGA 1DPUA 1S7EA 1OYIA 3P7NA 3BCBA 1G3WA 4IQ4A 5FD6A 1KQ9A 4EATA 1YOVB 2JT1A 4FETA 2KP6A 3GZNB 5CPRB 5IYBJ 4ZYGA 1REPC 2OQGA 2ELKA 2GWRA 3B6CA 4GO1A 2BY3A 2B7EA 2FX0A 4MIMA 5EYRA 2QQAA 3F23A 1RPWA 1FIAA 2LY1A 2GM4A 5CQEA 2VE8A 4FCYA 2YS9A 3T1BA 4OIRF 1K78A 1ZK8A 3QOPA 5GAGJ 4B3AA 1G3SA 1KQ0A 1FYLA 4GYIA 1R1UA 4IHXA 1HDDC 4I01A 4XM3A 5J4YA 1YO5C 4RAYA 3K70C 2STTA 4LB6B 4Y33A 3O6BB 5DCMA 3NARA 2ZFUA 4Q5SF 2DYSH 4UVAA 4M74A 2R7QA 4IHYA 2CW0F 3HEFA 4GXOA 1QQIA 4LFUA 4DYQA 3LSRA 1TW3A 2MC4A 3MZYA 5DCMB 2HYGD 4AUXA 3LSPA 3I4NJ 3G2BA 5KCMA 2B0LA 2RGVA 1X4OA 1ZREA 3QPHA 2HWVA 1T95A 1XGSA 5ILSA 5DD8A 4D5FA 1B4AA 1SMTA 4L5JA 4EJUA 3BT9A 1YG2A 2NAZA 1KQ8A 1F5TA 1V55H 3V7RA 3EUHC 1J7KA 2IGNA 1VQKI 2JA6J 3F6OA 3E97A 5KAFC 3AG1H 1TP4A 1TQPA 2JN6A 2RV8A 5L3DA 4M72A 3ISPA 1ETVA 1YIOA 2NVUB 3VWBA 3OMYA 5D6EA 2WV1A 3Q0UA 3ZMUA 1ZQ3P 4V2GA 3F72A 1GV2A 4XLAA 2DBBA 2UZKA 2ZFWA 2Z1DA 2E2JJ 1YYVA 3BQZA 1RI7A 4F92B 5L3BA 2FXAA 5HDNA 2LP0A 1MJAA 1Y0UA 1XCBA 4A3LJ 4AVZA 1UFMA 2P5KA 1HA8A 2HDDA 2FF4A 3LSKA 1ONVA 3J7ZI 1R5GA 1TBXA 4XKCA 2DA5A 5E17F 4UXNA 3PSIA 5JVTA 5LHHA 2O3FA 4XSZF 4IHSA 1JKPC 2AHQA 1VNDA 4XLEA 1MZBA 2K86A 3CUQB 1IZ1A 5ED4A 2LFBA 2K9QA 2KIMA 3BLYA 4L9NA 4M3DA 3KYCB 1YRNB 3G71I 3WU1B 2YR2A 4C30A 2OV7A 1JT0A 4EMSA 2V9KA 1APLC 4KNYA 4XKWA 1MSFC 1B72A 1EKEA 3DU5A 1IGNA 3I59B 3H5AA 3GLXA 3F22A 2R7TA 3U2RA 5F0CA 2JVHA 5DM6F 3CCYA 1UELB 4I0AA 4A3BJ 3OR2C 4HZFA 4N9IA 2HOTA 1A04A 1U2WA 3LMMA 5EZHA 2JK3A 3FWEA 1ULYA 4LGWA 1H8AC 2COBA 2KPMA 3K2ZA 4LIVA 5HVQC 3JCUC 3HOYJ 4DBQA 2OPTA 4IL6C 5F1RA 2X6XA 5HODA 3TW7A 4AD9A 3T8TA 5J1UA 5LEKA 2G9WA 5FROA 3S14J 2D5VA 1E3HA 1C0WA 1FIPA 3FXJA 2PN6A 1BOAA 4HPQA 4XR6A 4CCMA 2QBYA 5GPCA 2HYFA 5LD2C 4FT8A 1VQ4I 2A6EF 5LLQA 3HOZJ 6PAXA 2WC2A 4XONA 2I10A 1F9NA 1HW5A 1XMXA 3D0SA 4D7MA 3RI4A 1IN6A 3CDHA 2VB6A 1BR1A 3ZMVA 3J7AO 3HKZN 4DBRA 1R5ID 4IKFA 4AYBA 2HQ5A 3TBIA 2E34A 2E36A 2W82A 5HDGA 3JREA 2VJJA 2F5DA 1NH3A 3C2HA 4XLHA 1X2NA 2CRGA 1V5FA 4XLNF 2BVMA 1FBSA 2L9NA 3S3NA 2DODA 4HG2A 1FY7A 4H4KC 3CC7I 1HF0A 3KEOA 2LKXA 3VYSB 5EEHA 2QA4I 2Z3YA 3W6VA 1R23A 2K85A 3ZOBA 2VL8A 3E7LA 1SFUA 3ELKA 4IHWA 3DTIA 1ZKGA 3D5RC 4JX6A 4JQFA 5BPDA 2L01A 1FPQA 3WE3A 2C6YA 1MDMA 2HOEA 4PCQA 3CF5F 4Y15A 5TRDA 3LWFA 2Y0SN 3CESA 2RDPA 3SQNA 2IBDA 2J5PA 2ZC2A 4BHBA 4LG3A 2XGCA 4XKBA 2EILH 2OU2A 3L7WA 3SHFA 5HLHA 4PJNA 4IX7A 2EA4A 3I0TA 1IW7F 2H6BA 2BHZA 5D4SA 3FZVA 2XGDA 3AG2H 1JE8A 2JA8J 2V1XA 4KT6A 4BKXA 2DFIA 2VC1A 3KP4A 3PM1A 3PNVA 1EA3A 1SFEA 1GLNA 2CG4A 4P55A 1WJDA 1JUSA 1BW5A 4NHJA 5D4RA 2E1MC 4IPAA 5EG0B 3T0YA 2FOWA 5E3OA 3CZ6A 2XB5A 4L18B 2AQEA 1DU0A 3FISA 3DEEA 2GZWA 3K4KA 3RYRA 1GHCA 2IJLA 1W4MA 3GZ5A 3T5XA 1ETYA 3ZPLA 4CUGA 1OQYA 1GVJA 3TOBA 3PIOF 3GW2A 5A2QZ 2XVCA 3DBLB 2LSOA 2RREA 5J1YA 1G6NA 1P6RA 5ERIA 5EJCA 1SEUA 2F6CA 2XB0X 4EJVA 2M45A 4IRIA 3TP0A 3ABUA 2A07F 4FASD 3RIRA 4RMNA 1UZCA 1VI0A 2A3SA 4MEXF 2XAUA 1Z77A 2K5CA 2L0KA 1IXCA 4XRFA 2O9LA 1WCMJ 1TWAJ 1IC8A 3A01B 3KPHA 2JSCA 4ON0A 5J47A 4A3IJ 1PVEA 1Z7LA 2VLAA 2VBZA 4EM0B 2R7SA 2GLOA 1WPKA 2VOPA 4RDUA 3ML6A 5C4XJ 3IRQA 1JGGA 4LD5A 2LYCA 3LA7A 1BM9A 4PGGA 4LLLA 1Y39A 3H3VK 1R49A 4ESBA 2L2OA 2HR3A 1X2MA 3A4CA 1P4XA 1N78A 3HRSA 1BIAA 1IF1A 2K9MA 2VJ5A 1QHHD 1HW1A 4ZDPA 3DLLF 5IYCJ 3LQRA 1SVOA 2FJ1A 3DWLE 1T33A 1X1DA 3D5LA 1Z7UA 1J2XA 3L00A 1U8BA 2W7NA 1VZ0A 1LVAA 1D1AA 1MD0A 4FX4A 3RZOJ 2H1KA 5CVUA 3CCLI 2FD5A 2HTSA 2M0CA 3IWZA 2V1NA 4WXDA 2E5ZA 2XAQA 2P5VA 2HKXA 4WCGA 5DM7F 2MH9A 2G0EA 3BJAA 1WWXA 1OCCH 4YRVA 4JK1X 1CQTA 4BJ5C 3OYBA 1S6LA 3GUDA 1U3EM 3ZMDA 1MMGA 1HBXG 2LD5A 4KDPA 1U0JA 4NC7A 3DFGA 3TO7A 3GTPJ 2FNAA 3FM5A 1XGNA 4NUBA 1Z3XA 2AS5F 1B8IB 1ETWA 1X1PA 5FKOA 1BA5A 2PX9A 2XUBA 3REOA 1ZH5A 3F8FA 3BOQA 4CA0A 2VPLA 3QU6A 3FHZA 1FSEA 1BN5A 5FLXK 2FNPA 4C3IJ 4RGUA 2KZVA 4BY7J 2XGXA 4MGRA 2YX4A 5E1WA 4JBAA 3IKTA 3DPLC 4MQ9F 3E6DA 1D8JA 2BE5F 1OISA 4JYKA 1JKOC 2LBFB 4KICA 3KLOA 3B73A 2X9DA 1VQ6I 2V1UA 2JRTA 2BVLA 4IOCF 2IEKA 1MH3A 2UXNA 3E6BA 1KU2A 2WB1N 3ZQGA 3L2UA 1WI3A 1NHAA 2VQHA 4HDUA 4B8XA 2M5WA 1O7LA 2L7MP 4ZYHA 4A3KJ 1YS6A 3G73A 4LB5A 5F64A 3HOVJ 2DA4A 3CF2A 1LE8A 3GTMJ 3TL4X 2LOOA 3LSIA 4EGYA 4KN4X 2MW8A 1BI0A 3UKGA 2IA2A 3HKZA 4L5IA 1E3PA 3FXOA 2YUSA 3L2RA 1QVTA 1HSTA 2L4AA 4I76A 2CU7A 5AIQA 5JLXA 3ABKH 4YFNF 5AIPA 4HSRA 4B44A 3CCUI 1WGXA 4A3DJ 5F1JA 3FXRA 3J80K 5H6RA 1ZRFA 5L3GA 4XK4A 3FK6A 2JJ7A 3KZYA 3ESWB 2O8KA 2CUZA 4KN7X 2V6EA 3GO5A 2IGMA 3ECOA 5FFXA 3KP6A 3I53A 3T8RA 2H1LA 1W1WE 2EIJH 2CQ7A 2ZB9A 3H5RA 1B6AA 1XSVA 3HRMA 2STWA 2JWTA 2WADA 2KRFA 4I99C 4KIFA 1OR7C 2ZMEA 2Y0SA 2MLGA 5CLSA 2RQPA 2VKDA 3BTCA 1SD5A 4Y7NJ 4FE7A 2ME6A 3KEQA 3A1YA 3OWTA 1GV5A 3KZIC 3IP4B 2I8DA 1T2KA 2FSWA 4LIUA 2BGCA 2RNGA 2YSRA 4KMFA 3V7SA 1WJEA 3BP8A 3TP3A 3E6CC 1QZEA 1TT0A 3F9KA 1H0MA 5M3FJ 3LFKA 2DTZA 4QSHA 4PJJA 1AKHB 1Z3YA 1JHHA 1V54H 1PP8F 2IRFG 3M9AA 2R7WA 1KGSA 4NB5A 2HPIA 2H8RA 2PJRB 2Y0MA 3MN2A 3BY6A 4U88A 3S17J 2VBWA 2JPBA 1ORKA 2VQLA 3EYIA 1WH7A 2DPUA 5FKKA 3O2PE 3BJ6A 2ICWG 2OC6A 2CYYA 2OZUA 4BQNA 2QCOA 2P7VB 1U9NA 1MBJA 3DKXA 2R0QC 2P0WA 4P5OA 1YHQI 1GXPA 1BOBA 2M7BA 2RKHA 5J6XA 3OYIA 4E7LA 4GCVA 2V26A 4CZZA 1EV7A 1K6OA 3ECHA 3EQLF 2FOKA 3LL7A 3H3ZA 3SZPA 4E6KG 3S2WA 2EFNA 2OQRA 3H0DA 2ZXHA 2R5YA 1TWCJ 1MBEA 2BZTA 3CO6C 2LDUA 5F0HA 1D1CA 3HDDA 1MJ9A 1XMAA 5CKTA 4L5EA 2Z5UA 1FBQA 2PQ8A 1DPRA 2OZ6A 3HRUA 4G12A 2HVQA 3FF5A 4EV0A 4A3JJ 2IS4A 4UV8A 5E20A 3F8CA 5M5XJ 4NC8A 1SMYF 2QSFX 2HNHA 4YELA 5K7ZA 2LR8A 1X58A 1JKQC 1ERDA 1I6XA 2XKPA 4W1UA 2ZXJA 5K7HA 3AKZA 3DQVC 1HSJA 5LRSA 2MD0A 2HZTA 4XMYA 3CMMA 4MLOA 1B1BA 2EWNA 1XD7A 3WGGA 4CYCB 4G7ZF 1TQIA 2M87A 5K5OA 1VQ8I 2WV0A 1NK2P 3OY9A 1OPCA 1AA7A 3ZXSA 2NVQJ 3U1KA 1IXSB 3ERED 4WXHA 2OTJI 4QPOA 2IA0A 3JRAA 1F1ZA 4U7DA 4IO9F 3KEYA 4QWQA 1XS9A 3FMRA 3OIOA 2KJBA 3FKJA 3HRTA 4UV9A 5D6FA 3TEDA 2ELJA 2GOXB 2CUJA 1HLVA 1ETQA 1JHFA 3P9CA 1W7PB 2VIXA 5BS6A 3RPQA 4R79A 4CZCA 1PUEE 2Y69H 3WTXC 4E4HA 3FXUA 1UAAA 2FQ3A 4PSWA 2PG4A 4HA8A 1A6QA 1SFOJ 1ZRDA 5ILUA 2UWMA 1XG1A 3PQJA 4B47A 2DAOA 1Z91A 4XICA 1X1BA 2CV1A 3BR0A 1RNLA 5FRNA 2DMTA 2JMWA 4CYDA 2OJED 4NQWB 4KITB 4KIBA 3FMQA 1ETXA 3HBLA 3CDIA 2Q2EA 4IOAF 1UHWA 2EIMH 2NS0A 2XPVA 2DO7A 4EEFG 4ANJA 4BL0B 5JLWA 5BPIA 4XL9A 1T0FC 3WG9A 2FE3A 4DJAA 3X2QH 2EFOA 1A5JA 1S9HA 2R7DA 4J01A 2KIUA 2TRTA 4ZJZA 5LGTA 3R4KA 3ZQLA 1I3QJ 1P4AA 3HXLA 3DF8A 2X85A 3TKYA 5EF6A 2P7CB 4M71A 1K7AA 3ZN0A 1TT5B 3SJMA 2Y31A 2K3FA 4BHCA 3VSKA 4G94A 2O8XA 2L7ZA 4BY1J 3NWTA 1ZYRF 3VYUB 1G59A 1GUUA 2G7HA 3E5QA 3KCCA 5KNLA 1U5TC 2E1NA 1DQUA 3CMYA 1F4KA 1I1GA 2OCEA 5IT9K 4UB8C 2BHYA 1LJ9A 5KAIC 5E79C 2VKEA 3BZCA 3SXYA 2X6YA 3E5XA 3RKWA 4LMYA 1FTZA 1TNSA 5E3MA 5DTDA 1A35A 2P6SA 1IO2A 4KA4A 4BJ6C 5D5WB 5KHDA 1FYKA 2HEOA 2AQFA 5JR3A 2HS5A 2KZGA 2ZJPF 1U9OA 3GBGA 3LSMA 3OR1C 2CUEA 1MW7A 3K4NA 2JVGA 3H5NA 2X1DA 5CVVA 5LRRA 2IS1A 2BY0A 1FBUA 1USTA 1R22A 1YX5A 3BR3A 4I02A 2KIQA 3ERMA 2TDXA 2LLKA 2JTVA 1I39A 2RC4A 1LUJB 2XF5A 2E71A 2EV5A 3L09A 4I2OA 3OS1A 3I56I 5ICGA 2K27A 3K4CA 2R5ZA 1PUFB 4XQFA 5A2QK 4A3MJ 1WKMA 2JA7J 2PFBA 3OYHA 3U9GA 4B4CA 4BYYA 4CHUA 3I64A 4KMUX 1XPXA 3LFUA 2R5ZB 3IKVA 5JI6A 4RAFA 3L9FA 1FMVA 3C3WA 1B9MA 2EFPA 2F4MB 5FRMA 3HC7A 1TL8A 3JRHA 2LY9A 3J81Z 4M9XA 3VB2A 2LKSA 3DBRB 3HM5A 2NVTJ 1V5EA 3CUQA 5B5EC 1ZGAA 3LSJA 2EB7A 4U7BA 2D2WA 1FP1D 2BYVE 2MGQA 4Q47A 2XAJA 1YRNA 4OU0A 3HOUJ 3G4SI 4AU7A 1JT6A 3HOTA 2JSPA 2DMPA 3MKZA 4ESJA 3EPZA
chains in the Genus database with same CATH topology
2KLOA 2F6CA 3K4BA 3OYMA 2KL4A 4FASD 4RMNA 1ZELA 3K10A 1OLTA 2LRDA 2XAUA 1JI8A 4C2TA 2E60A 2K5CA 1LVKA 2L5QA 3U21A 3QYEA 2HDWA 4J00A 3DPTA 4OWRB 4X0GA 4II2A 4BEHA 1FMWA 3OYCA 4XNFA 3TMOA 4OAYA 2L7KA 2LG4A 4E7KA 3AFHA 4E7SA 1Z7LA 2VLAA 2R7SA 4BEHB 4E7IA 1R6RA 2KQRA 4XKVA 3MKYB 2WB1A 1PYVA 3VYRB 2E1MB 4PK4A 2LYCA 4XN0A 4DIQA 5JHFA 2L2OA 4CCKA 3FBIB 1N77A 3VSLA 4BJTA 1NG7A 3A4CA 4ITVA 2MFZA 3VDXA 2VQCA 3L2WA 2DCEA 4IQJA 1N78A 3OYGA 2XC7A 3MD2A 1WJFA 2K9MA 3L2QA 2VJ5A 1QHHD 4ZDPA 4CCOA 3HPGA 2W00A 3DWLE 3V42A 5HNFA 2K9LA 1X1DA 3D5LA 2W7NA 1VZ0A 4F52A 1NG6A 1D1AA 4Y3OA 4BDZA 3M1CA 2V1NA 2E5ZA 3OYJA 4B43A 4CCJA 3QODA 2F4IA 4YRVA 2DJIA 4BJ5C 4PSXA 3OYBA 1W36C 2WBMA 3PL8A 4PUSA 2X1CA 1WJCA 1MMGA 1LDKB 4E7HA 1U0JA 3HG9A 4NC7A 4NNJA 3OS0A 2KMUA 4BQQA 4IZZA 1IRXA 2CW8A 3OL4A 3PFYA 1Z3XA 4NUBA 2CV2A 2Z16A 3W2WA 2MABA 2CS3A 3FDYA 4PJLA 3H9GA 2K3PA 3H9JA 2DXIA 2ZXIA 4CA0A 2VPLA 3N05A 3LSHA 3BC8A 2R7XA 4BQOA 4XLCA 3CP8A 4Y4RA 2KZVA 3DPUA 2IS2A 3W2AA 3DPLC 3PNTA 2UUZA 3K4MA 3HL2A 3SEZA 2WA0A 2LBFB 3S93A 4BU2A 1DGWY 3H35A 3S3MA 3ZRGA 1KONA 2BVLA 1YE9A 3W2VA 3HOSA 3L2UA 2BOLA 2VQHA 3QOEA 3ZCOA 3PSFA 3RQ4A 2VXDA 2W1OA 1BR4A 4P1WA 2M4KA 1D0YA 3CF2A 2LY2A 3TL4X 3HPHA 4ZTFA 2RQQA 4PJMA 2LOOA 3L2VA 3LSIA 3J7AY 2UV1A 1MMDA 2X1EA 2WAFA 3QYBA 4HSTA 4BGDA 4XLFA 2HQAA 2QKLB 3RTRA 3DLAA 3HKZA 2CH0A 3L2RA 1LKXA 1X19A 1WJAA 4DOZA 3OYKA 3AL0C 1MMNA 2LC2A 1MNDA 5TGTA 1MMAA 4HSRA 4B44A 2A5WA 4PFPA 4XOTA 4GRIA 2DT7B 4XOPA 2LH9A 3BG7A 4E7JA 3ZQQA 1PJRA 2VJ4A 2CUZA 2V6EA 2WAQA 3RPUD 2IGMA 2Z2SB 1Y6IA 3OYAA 3D5SC 3H5RA 3OIQA 4D1QA 2WADA 1OR7C 3K6GA 2Y0SA 1K6YA 3FBNB 2VKDA 1W36D 4F55A 2A6TA 4B48A 4BXFA 4DGWB 3OL3A 2R7RA 4II3A 1D0XA 3A1YA 1QU3A 3OWTA 3IP4B 2I8DA 2HPMA 3A2KA 1X4PA 3IAS2 3KX2A 4LIUA 2RNGA 1SAUA 2IGKA 2CV0A 3CP2A 1WJEA 2R7OA 2HU9A 2Q2EB 1TT0A 3F9KA 4JOMA 3K4JA 3OYNA 2Q1ZB 1D0ZA 5CQGA 2CFOA 4PJJA 3AL0B 5HLTA 2HVRA 3BCBA 3C2GA 4IQ4A 4BUPA 1Z3YA 3ONQA 5HNHA 4EATA 4RM3A 4ZYAA 3CJRB 4FETA 2KP6A 2R7WA 5CPRB 2PJRB 2HPIA 4D9JA 2F5VA 2OUMA 2IGOA 3ZGKA 4BS9A 2LY1A 2VQLA 5CQEA 4C2UA 4CSWA 2OC6A 4G6TB 3E0JB 4BQNA 3MMYB 4B3XA 4XM3A 1D1BA 3DKXA 3K70C 4Y33A 2P0WA 4P5OA 3S32A 1BOBA 2ZFUA 2M7BA 2XSJC 3OYIA 4E7LA 1Z21A 2V26A 2DOAA 3OYDA 2LBFA 1X1CA 3QYFA 2R7QA 3LL7A 4E6KG 3H0DA 3K4LA 4E7ZA 2MC4A 2ZXHA 3RCOA 2KRHA 1V5GA 3G2BA 5KCMA 1X4OA 1MNEA 1D1CA 5CKTA 2VASA 1T95A 2XF6A 2M4GA 4ZDLA 4ZTJA 2HVQA 4BE1A 3EUKL 2IS4A 4C9YA 4NC8A 2HNHA 4XN3A 4YELA 3EUHC 2IGNA 4CCLA 3H9QA 1N75A 3IAM2 1DP3A 1ERDA 2KDOA 1BR2A 3VWBA 1LFPA 3AKZA 3DQVC 3OMYA 3NWSA 2MD0A 4XMYA 2VQGA 3SEQA 2R7UA 3CMMA 4MLOA 4XLAA 1J09A 2Z1DA 4F92B 4KJZA 4BE0A 3OY9A 1AA7A 3ZXSA 4AVZA 1WFXA 3BG6A 4QPOA 1HA8A 3KEYA 4F3QA 3LSKA 4N4OB 4F91B 1TZLA 2BW3B 3FKJA 1UG0A 4XKCA 1DGRM 2ELJA 2GOXB 2CUJA 2KRCA 3PSIA 1YX3A 4RM2A 2E5NA 2MYSA 2VIXA 4XLEA 4R79A 4BACA 4CZCA 1WJBA 4E4HA 2O5RA 1UAAA 3KYLA 1SFKA 3BLYA 4PSWA 3MKWB 4PFOA 2WY8Q 3DKYA 3OS2A 1Y56A 2OV7A 2WAEA 4C30A 2UWMA 2V9KA 4XKWA 4BDYA 4B47A 3OYEA 4CCNA 2DT6A 3DU5A 2CV1A 1X1BA 5FRNA 2V7FA 2CW7A 3H5AA 4LITA 4KITB 1WJ5A 4NQWB 2HVSA 2R7TA 2JVHA 2V4JC 2R7VA 3M8JA 4KISA 1UELB 3OR2C 3BCAA 4ANJA 4BL0B 3LMMA 4XL9A 4ZDOA 1T0FC 4DJAA 5HOOA 2KPMA 5HVQC 4LIVA 3OYFA 4DBQA 1S9HA 4J01A 2X6XA 3ZR8X 4ZJZA 3DTKA 3K70D 2CMPA 3HXLA 2X85A 2ZSIB 3I9V2 5FROA 4HNUA 2PJRA 3VSKA 4XR6A 4HPQA 3S3OA 3NWTA 2JA2A 4CCMA 3SYTA 3VYUB 1X1AA 1G59A 2VKHA 5LD2C 2NOJB 5KNLA 3I3LA 1DQUA 1G8XA 4XONA 2WY7Q 2VB6A 1BR1A 2VXZA 2JUGA 2X6YA 4HEA2 4DBRA 4IKFA 4AYBA 3TBIA 2W82A 4BE2A 3OOUA 3FHNA 2VJJA 2ZSHB 1QHGA 4N4NB 4BJ6C 5KHDA 3C2HA 2AQFA 4XLHA 2HZDA 1V5FA 2BVMA 4RLQA 2L9NA 3SDBA 3GBGA 3PNYA 2XDVA 3LSMA 3OR1C 4HG2A 4H4KC 4CH7A 3S3NA 2L9SA 1MW7A 3K4NA 2JVGA 3H5NA 2X1DA 3VYSB 3DTEA 3PUBA 4XORA 2IS1A 3S8PA 2M3AA 4U87A 2VL8A 2X6WA 4YEJA 3CJQB 4HRIA 1YX5A 2IXSA 3D5RC 3DTIA 4JQFA 3OIPA 3VYTB 2XF7A 4ZC3A 2XF5A 3CESA 3SZGA 3OS1A 3W3CA 2FUG2 4RLFA 3K4CA 4LG3A 4XQFA 4QPQA 4XKBA 2W4SA 3UR3C 3OYHA 2QKMB 4PJNA 2R4GA 4IX7A 2M0MA 3RSNA 3LFUA 3E1SA 3HUGB 5LFAA 3IUOA 4KT6A 3PNVA 1EA3A 1FMVA 1GLNA 1WJDA 2BW3A 2IS6A 2KHMA 2E1MC 5FRMA 3HC7A 3CZ6A 2M7AA 2AQEA 4OAZA 3DEEA 2GOMA 3K4KA 2LREA 4F93B 1V5EA 3DU6A 3LSGA 3OYLA 2VJIA 2PMZA 4CUGA 4U7BA 3UNGC 3PJRA 1E0EA 1P9QC 4AU7A 2RREA 3HOTA 2JSPA 2X51A 4HNTA 3MKZA 3EUAA 3EPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBN B;  3FBI B; 
#chains in the Genus database with same CATH topology
 3I59 A;  1MNM C;  1OCT C;  2XKO A;  3OYM A;  2ESN A;  4Z2Y A;  2ELH A;  4HF1 A;  1I3A A;  3B6A A;  2CFX A;  3U21 A;  1WRJ A;  4J00 A;  2CJJ A;  4LG0 B;  5J4V A;  4X0G A;  3K1N A;  1FMW A;  3C1D A;  3WHB A;  4DNC A;  4X6A J;  4M6V A;  1SD4 A;  2AO9 A;  3TMO A;  3JRC A;  3CLQ A;  3CJT B;  2W48 A;  2O03 A;  2DK5 A;  1QRY A;  2CSO A;  3LA2 A;  3GYH X;  1R6R A;  1LDD A;  5JFR A;  4YIR X;  1ETO A;  1XCV A;  3MKY B;  2DK8 A;  1LFU P;  1PYV A;  3IWF A;  2M30 A;  3VYR B;  2D1H A;  1RZ4 A;  2E1M B;  2HOS A;  2NS7 A;  4XBF A;  3F6V A;  1R1V A;  1N77 A;  4BJT A;  5IYD J;  1NG7 A;  4ITV A;  3MEX A;  4IQJ A;  2XGE A;  5CJ9 A;  3G1O A;  3KLN A;  3L2W A;  2YPR A;  2BBY A;  2XAF A;  1WJF A;  1UG2 A;  2F5F A;  3HHH A;  1WZ2 A;  3W6K B;  4L0Y B;  4CCO A;  4EVI A;  1N25 A;  3RJP A;  3V42 A;  3HGG A;  1EH8 A;  1OKR A;  5GP9 A;  4RB3 C;  4BDZ A;  4F52 A;  3M1C A;  1GXQ A;  1S5L C;  1IRF A;  3TGN A;  4S05 A;  4B43 A;  2H8W A;  3QOD A;  2F4I A;  2ZO4 A;  2R3S A;  2XRL A;  3L2C A;  4LJZ F;  1M1E B;  2MG4 A;  4EQQ A;  4PUS A;  2GQQ A;  1S8N A;  4A6E A;  1RET A;  2VC0 A;  2QEN A;  2Z33 A;  2V79 A;  2FBI A;  2FBH A;  3HG9 A;  4NC6 A;  1G3Y A;  3OS0 A;  2KMU A;  4DZP A;  4IZZ A;  4AIH A;  1IRX A;  4FTH A;  4GYG A;  2CV2 A;  2Z16 A;  4C3J J;  3C18 A;  1BI1 A;  3FDY A;  4M73 A;  1H9G A;  2IA1 A;  1W5T A;  4P9F A;  4MTE A;  2L9R A;  3H36 A;  2R7X A;  2AXT C;  1XDS A;  1IN7 A;  1RC9 A;  4BQO A;  1K61 A;  4Y4R A;  1D5Y A;  4O3M A;  2DW4 A;  3U1D A;  5FFZ A;  1R00 A;  5BNG A;  1RRJ A;  5F04 A;  3WU0 A;  2V9V A;  3PNT A;  2D1V A;  3W2A A;  1BI3 A;  2UUZ A;  4CDG A;  2WA0 A;  3QP6 A;  4A5N A;  5EG0 A;  1VQ9 I;  2EJR A;  2DJN A;  2DOF A;  4BU2 A;  2ACJ A;  3WG7 H;  3LQQ A;  1ZLJ A;  3S3M A;  3ZRG A;  2B63 J;  4XSX F;  4IHT A;  1BJA A;  4UNO A;  2EZI A;  2KIS A;  4OMZ A;  2BOL A;  3PSF A;  1MSE C;  2VXD A;  4AWX B;  3IC7 A;  1RUN A;  2W1O A;  3RDI A;  2M4K A;  4BXX J;  1D0Y A;  1SVM A;  1ITY A;  3FXQ A;  5F6F A;  3EYY A;  1O57 A;  1IRG A;  2IPQ X;  1LFB A;  2RQQ A;  1TQM A;  2QSG X;  3J7A Y;  1MMD A;  3QYB A;  1ZN2 A;  2K02 A;  4XLF A;  2QKL B;  2RVC A;  3BR6 A;  4MFE A;  3PIP F;  1RES A;  1HDP A;  2V9P A;  5D5U B;  1MKM A;  4KYW A;  2Y75 A;  4QTR A;  1WJA A;  4YG2 F;  1XB4 A;  3MQ0 A;  3OYK A;  5M5W J;  2P81 A;  4GFB A;  3AL0 C;  4A3C J;  2LC2 A;  2Y48 A;  3A01 A;  1S72 I;  5C44 J;  1HXD A;  1FX7 A;  2VON A;  4BHP A;  3GTG J;  4BXU A;  2K7L A;  1QO0 D;  3CD6 I;  2F48 A;  4E7J A;  3ZQQ A;  2VJ4 A;  1IUF A;  2NVY J;  5CVR A;  1HC8 A;  4MQV A;  2FBK A;  3DCF A;  2Z2S B;  5C3E J;  3GWZ A;  2BEO A;  3M7G A;  3OYA A;  2PMH A;  3JRG A;  4J19 A;  4N9H A;  3OIQ A;  1FOX A;  4KFC A;  2W24 A;  2A05 A;  1K6Y A;  5DD4 A;  1FYM A;  5ICC A;  1W36 D;  4F55 A;  2E7W A;  3RZD J;  1HW2 A;  5H20 A;  1YQA A;  5LEJ A;  5HS8 A;  2R7R A;  3BTI A;  4II3 A;  2XAH A;  1FT9 A;  1TWF J;  2MA3 A;  3GEZ A;  1X4P A;  4RBO A;  3IAS 2;  3QU3 A;  1ZAR A;  1SAU A;  2JRM A;  4XRS G;  5FKL A;  3CP2 A;  2HKO A;  4B1R A;  2VOO A;  2V6C A;  3DEW A;  3DXJ F;  2JZY A;  4OIO F;  4JOM A;  3K9T A;  4IHV A;  3HIF A;  2CQX A;  2D45 A;  5BOX A;  4KT5 C;  2CFO A;  4MEY F;  3C2G A;  4BUP A;  1ACI A;  2KJC A;  2NS8 A;  3ONQ A;  4LLG F;  4RGS A;  4ZYD A;  2HYJ A;  2LVS A;  2K9N A;  4D9J A;  3I4M J;  1B8I A;  2OUM A;  2IGO A;  5TJJ A;  1UHS A;  4KUM A;  3QRF F;  4BS9 A;  1TTY A;  1JTY A;  2RN7 A;  3MZ8 A;  4C2U A;  3CO7 C;  2M9H A;  1BC7 C;  3CUO A;  3IV5 A;  4CSW A;  4Z6Y A;  5FJ8 J;  3HOX J;  2IP2 A;  1D1B A;  3S32 A;  2VOD A;  1VQ7 I;  2XSJ C;  2RAE A;  1Y8R B;  2ZJ2 A;  1Z21 A;  2DOA A;  2ID6 A;  1X1C A;  2LBF A;  2E19 A;  1HKT A;  1OJL A;  3ROU A;  4ZH4 F;  2NNY A;  4XID A;  4RGR A;  2PI0 A;  2KRH A;  3KP7 A;  3IH3 A;  1VFC A;  2L9V A;  3JW4 A;  2IW5 A;  4PDK A;  2ISY A;  1D3Y A;  4U0Y A;  4C2M J;  4ZDL A;  3K1M A;  1VF9 A;  4ZTJ A;  3QPT A;  4BE1 A;  3EUK L;  2R7F A;  4WK8 F;  2CGP A;  1OYW A;  1ETK A;  2OF7 A;  2ZKZ A;  3R0J A;  5AON A;  1H88 C;  1TWG J;  3BG9 A;  1MH4 A;  1Z0X A;  4M3E A;  2BXZ A;  1E17 A;  4R1H A;  1LB2 A;  3Q0W A;  2DOE A;  3NWS A;  1CF7 B;  1TC3 C;  4EJW A;  2VQG A;  1T39 A;  3SEQ A;  3A0H C;  2R7U A;  2B9S A;  3FXM A;  3NQO A;  1ZGJ A;  4W97 A;  3HOW J;  1F43 A;  1O3S A;  2HXO A;  2DDA A;  4KJZ A;  1WQ2 A;  2KT0 A;  1IDY A;  4IF4 A;  5J3L A;  4UUT A;  3CC2 I;  3V8L A;  3LNQ A;  4BBS J;  4F3Q A;  4N4O B;  1JTX A;  5B3S H;  2BW3 B;  1UG0 A;  1Z05 A;  1BIB A;  2KRC A;  4HF2 A;  1YX3 A;  1FTT A;  2YU3 A;  1ON1 A;  3PO2 J;  3A03 A;  3V4G A;  2MYS A;  3KP5 A;  5J40 A;  1WJB A;  3GTK J;  3HJE A;  4ESF A;  4K2E A;  2O5R A;  4PZJ A;  3KYL A;  3A02 A;  2VT3 A;  4ZZL A;  4PFO A;  3MKW B;  1R5H A;  2L02 A;  2HGC A;  2X0L A;  3HTS B;  4NDL A;  3C7J A;  4AIK A;  3OS2 A;  2FMY A;  2WAE A;  4XRM A;  4BDY A;  1WSU A;  2DT6 A;  3S1Q J;  3BQY A;  5D8K B;  1P92 A;  3LAJ A;  1JJ6 C;  4DW6 A;  4HX7 A;  4LIT A;  1SD7 A;  4Y17 A;  1J59 A;  2HVS A;  2V4J C;  1K83 J;  2VKV A;  4AIJ A;  2PJP A;  2R7V A;  3M8J A;  1FEX A;  4KIS A;  3BCA A;  1B9N A;  2OD5 A;  2GAU A;  1VQN I;  4ZDO A;  3B02 A;  2M2E A;  1UCR A;  1WVR A;  3OYF A;  1AKH A;  3WTU C;  1X3W B;  4FIS A;  3K70 D;  3DTK A;  2CMP A;  4BNC A;  2L7F P;  4L9J A;  2DMQ A;  2XRO A;  3CCQ I;  4Y13 A;  2PJR A;  3WGH A;  1ZAO A;  4UB6 C;  1D8K A;  2DMU A;  1KZH A;  3AAF A;  1R71 A;  3F8N A;  4RGX A;  1XGM A;  4LK0 F;  4O5V A;  3ZQ7 A;  5FLV A;  3SYT A;  1X1A A;  3GFM A;  5IPA A;  3JRI A;  2NOJ B;  2E2I J;  5H6Q A;  2P8T A;  1G8X A;  1HCR A;  2EV0 A;  2WY7 Q;  1QGP A;  1P2F A;  2VXZ A;  1FWZ A;  1PDN C;  2HDC A;  2E7X A;  1XSD A;  3MFK A;  4XRS A;  2O61 A;  3RKQ A;  1HKQ A;  4HQE A;  2NOG A;  4HX4 A;  2O6G E;  1QHG A;  5K1Y A;  5DS9 A;  4NBQ A;  4CO8 A;  1T0F A;  2XV4 S;  1MBF A;  2XDV A;  3PNY A;  1FJL A;  2L9S A;  5DCF A;  2A68 F;  3S1R J;  5DEQ A;  1XDU A;  3S15 J;  3DTE A;  1OCR H;  3PUB A;  1BJZ A;  4E70 A;  2Y9Z A;  1QPM A;  4XOR A;  3O3K A;  3S8P A;  1I50 J;  2M3A A;  3M1E A;  4HDV A;  1J5Y A;  2R92 J;  2X48 A;  4YEJ A;  2GA2 A;  4ASN A;  2DFE A;  3N97 A;  2DA1 A;  2GXG A;  5FKN A;  1T08 B;  2O7O A;  3OIP A;  4A3F J;  2KFD A;  4DYC A;  5GAH J;  1MBG A;  1YTY A;  2XF7 A;  3GF2 A;  4HOB A;  4ZC3 A;  4MFD A;  3JAM Z;  3Q9V A;  3HUG A;  3W3C A;  1A31 A;  3HSE A;  4QPQ A;  2OA4 A;  1A6I A;  2LMD A;  3UR3 C;  2CQK A;  2QKM B;  4CYC A;  1YLF A;  5F08 A;  3BG3 A;  2M0M A;  4B09 A;  1U5T B;  3CJN A;  2V1D A;  3LA3 A;  3E3V A;  5GAD J;  3HUG B;  2MD5 A;  5LFA A;  4HX8 A;  4DZJ A;  1TWH J;  2Y9Y A;  2AXL A;  3WTY C;  1EF4 A;  4OIN F;  1QZY A;  2BV6 A;  2F2E A;  2OCC H;  2KHM A;  3CQZ J;  4HNV A;  2IS6 A;  4ZZD A;  2LKP A;  1W7P A;  4OAZ A;  3ULQ B;  3K0L A;  3V8K A;  1OMI A;  4F93 B;  1H89 C;  2EA2 A;  3LSG A;  5GTI C;  4M9S A;  2VJI A;  3I5U A;  4TV7 A;  4UVC A;  3V8J A;  2PLY A;  5D8L B;  1TNT A;  5FLX Z;  1IG7 A;  2HOA A;  1KYW A;  2ZME C;  1IDZ A;  2DMN A;  4UUV A;  3PJR A;  3IH2 A;  1KYZ A;  2YX7 A;  3NAU A;  2X51 A;  2EFW A;  3GLL A;  2JQ7 A;  3EUH A;  2KIF A;  3ZMZ A;  1K79 A;  2TCT A;  1G4D A;  3K4B A;  1BC8 C;  1BL0 A;  2KL4 A;  2VUM J;  4NQW A;  1ZEL A;  4D5C A;  5DUK A;  2EFQ A;  2LRD A;  4LK1 F;  4A0X A;  1K4T A;  3VFZ A;  2E1O A;  1LVK A;  2QM3 A;  2HDW A;  1RR7 A;  4OIP F;  4LLN A;  3P5J A;  4II2 A;  4A5M A;  1OFC X;  4G7O F;  3OYC A;  1E3O C;  1LNW A;  4XNF A;  2NVX J;  1J0R A;  1T98 A;  4OAY A;  2L7K A;  2E2H J;  4E7K A;  3KIO A;  3L1P A;  4E7I A;  4Q48 A;  2ZNZ A;  2WB1 A;  3KP2 A;  4O6J A;  1R4M B;  4PK4 A;  1FNN A;  3F8M A;  3R6S A;  4DIQ A;  5JHF A;  4UUS B;  4CCK A;  3FBI B;  2L54 A;  3MCZ A;  2MFZ A;  3FX3 A;  1KU3 A;  2VQC A;  3F8B A;  2Z9O A;  3OYG A;  1A36 A;  5HLI A;  3L2Q A;  3AG4 H;  3QAH A;  1RIO H;  3HPG A;  3ZQF A;  4I6Z A;  2W00 A;  5IY5 H;  5HNF A;  2K9L A;  1W5S A;  1U78 A;  2QGU A;  2Y2Z A;  4LOC A;  4Y3O A;  4PGH A;  1XTA A;  4M9Z A;  2KKO A;  5CYV A;  4Y52 J;  3VPR A;  4U0W A;  3A0B C;  4RB2 C;  4PJ0 C;  2EZK A;  2ME0 A;  3HHG A;  2DJI A;  4PSX A;  2WBM A;  1SAN A;  1OCZ H;  3PL8 A;  3R0A A;  2EZH A;  3BR5 A;  1WJC A;  5LHI A;  2DLL A;  5JVG F;  3GCM A;  4NNJ A;  1GVD A;  2P5L C;  1YI2 I;  2R7Z J;  1U6G A;  3W2W A;  4CIC A;  2DI3 A;  3S1N J;  4PJL A;  3H9G A;  1PUF A;  1NK3 P;  2HI3 A;  1X3Z B;  5E8I A;  2CWE A;  2YU9 J;  4MO7 A;  1K78 B;  1FP2 A;  2BY2 A;  3HSR A;  3MAJ A;  3JTG A;  3P9K A;  5FGM A;  4OMY A;  1MIJ A;  3DPU A;  2GBY A;  3RPU A;  2FQ4 A;  3K4M A;  3HL2 A;  1SD6 A;  2NNN A;  1R1T A;  3NEU A;  3CCJ I;  2GIV A;  2QQ8 A;  4HV5 A;  1JXS A;  1MBH A;  3S93 A;  2QUF A;  1DGW Y;  3H35 A;  1Z1D A;  1KON A;  3W2V A;  3KET A;  2XAG A;  4KIG A;  1ZR2 A;  1SAX A;  3QOE A;  3ZCO A;  2MSY A;  1T56 A;  3JRB A;  1IN4 A;  1BR4 A;  2JA5 J;  2H94 A;  4M3G A;  2QSH X;  3G6E I;  3AG3 H;  3LST A;  1IUY A;  3K1P A;  2A5Y B;  3HPH A;  3WOD F;  2EIN H;  4EJT A;  4PJM A;  3L2V A;  2XAS A;  2EBI A;  3FK7 A;  4L9V A;  4M3B A;  5M3M J;  2DN0 A;  2I5U A;  2WAF A;  4RB1 A;  2HQA A;  1T38 A;  3RTR A;  1W0T A;  5HLG A;  2CH0 A;  1YJN I;  4LG0 A;  1LKX A;  4DOZ A;  1DDN A;  2ZXW H;  1I27 A;  3I4P A;  1MND A;  3LAP A;  2DA7 A;  2A5W A;  4PFP A;  2ECB A;  3CTA A;  4GRI A;  4HLY A;  1CGP A;  3HYI A;  2FEZ A;  4ENM A;  3BR2 A;  5EEG A;  4I98 B;  1EH7 A;  1TW2 A;  1PJR A;  1Y1W J;  1ZG1 A;  4UY8 I;  3DBH B;  3V7C A;  3CCE I;  1Y6I A;  2ESH A;  1I5Z A;  3D5S C;  2BY1 A;  4I7H A;  4RB0 A;  5D5V B;  3PQK A;  2K4B A;  2DFF A;  5E3N A;  2A6H F;  1PP7 U;  3FBN B;  1R7J A;  1DP7 P;  4G9Y A;  3FXK A;  1F36 A;  4DGW B;  2HQN A;  3F3X A;  3OL3 A;  4HAM A;  1D0X A;  1B72 B;  1QU3 A;  2F4O B;  1O7F A;  2QF7 A;  4OIQ F;  4U0V A;  1YS7 A;  2O0Y A;  3KX2 A;  3TQN A;  3GTQ J;  3MZH A;  1P7J A;  2EK5 A;  5FB2 A;  4H0E A;  2K4J A;  5EGO A;  3ZMT A;  2HU9 A;  5BQT A;  3BJO A;  2OBP A;  4OOI A;  3HTU A;  1VQO I;  1IV8 A;  3H3U A;  3OYN A;  3H92 A;  3HZJ A;  1FOK A;  2Q1Z B;  4L9T A;  3CC4 I;  5F27 A;  3AL0 B;  2P6T A;  1WH5 A;  5HLT A;  4RAZ A;  5EGO B;  2HVR A;  5IP6 A;  3WHC A;  2XPU A;  5HNH A;  3ABT A;  4RM3 A;  3CJR B;  2IVM A;  4ZYA A;  1LQ1 A;  2EIK H;  1MJB A;  3ZP5 A;  2DPD A;  2F5V A;  2PMZ N;  3KZZ A;  3ZGK A;  3HGY A;  4RA2 A;  1DUX C;  2QVO A;  1QZZ A;  1YW9 A;  1UMQ A;  2DQR A;  2E35 A;  2QBY B;  4JX5 A;  1EH6 A;  1Z6T A;  1B59 A;  4G6T B;  1WI9 A;  3E0J B;  3MMY B;  4B3X A;  2EPF A;  4S0H B;  2GXB A;  3MKL A;  1KU7 A;  2COM A;  3M3Y J;  3C2B A;  3OV8 A;  3OYD A;  1SFX A;  4ENN A;  4M6Y A;  3K69 A;  2M8E A;  3QYF A;  1AOY A;  2JPC A;  4EM1 A;  1HQC A;  4S04 A;  3K4L A;  4M6X A;  2CO5 A;  3IHU A;  3F0C A;  4E7Z A;  3RCO A;  3IRR A;  3CUQ C;  1JUM A;  3CCM I;  1V5G A;  1FOW A;  1MNE A;  3K2A A;  1ZHF A;  2VN2 A;  1O4X A;  1ZRC A;  2LF8 A;  4MNU A;  3JSO A;  2VAS A;  5IT9 Z;  4RS8 A;  1FSH A;  2XF6 A;  2M4G A;  3ZMS A;  1POG A;  3SFI A;  4C9Y A;  1LPQ A;  4XN3 A;  4N0B A;  2HTJ A;  5D5X B;  5HS7 A;  2FML A;  3PUF A;  4CCL A;  3H9Q A;  1N75 A;  3IAM 2;  5DYM A;  5ILV A;  1DP3 A;  2BXY A;  2KDO A;  2IAI A;  1I6H J;  3BPV A;  4A3E J;  1BR2 A;  1MDM B;  1LFP A;  5FO5 A;  4CGZ A;  5JHU A;  1T6S A;  4WWC A;  4XLP F;  3FIW A;  1J09 A;  1HOM A;  4YFX F;  1G2H A;  1MBK A;  4GGG A;  4FQG A;  4BE0 A;  3FXL A;  2CQN A;  2QWW A;  1XSX A;  2ID3 A;  3OSG A;  1OCO H;  1K4S A;  1WFX A;  3BG6 A;  4F91 B;  2DTR A;  1TZL A;  3SZT A;  2LNB A;  5KVR A;  3GTO J;  1DGR M;  1O3T A;  3BTL A;  1XMK A;  4RM2 A;  4IRG A;  2E5N A;  2K40 A;  1QA6 A;  4BAC A;  1Z6R A;  4V2F A;  3JSP A;  3KFW X;  3JTH A;  1SFK A;  2NYX A;  2GIZ A;  2QQB A;  5IOY A;  2H27 A;  2GA1 A;  2WY8 Q;  1G3T A;  3DKY A;  2F5E A;  5EEA A;  1Y56 A;  3WTV C;  1Q1V A;  3I54 A;  2XIG A;  3OYE A;  4CCN A;  3QWL A;  3QP5 A;  3J7Y J;  2V7F A;  2CW7 A;  4V19 K;  3ZN1 A;  1WJ5 A;  1J9I A;  2HFH A;  1JKR C;  4GDF A;  5J1R A;  2QQ9 A;  5H2F C;  1ZG3 A;  5DDG A;  1RR8 C;  1Y0N A;  2QZ8 A;  4BBR J;  1AWC A;  2ZJQ F;  2K9S A;  2F5C A;  5HOO A;  1ZG5 A;  1YIJ I;  1MMS A;  1XN7 A;  4AM3 A;  4ENJ A;  4M3F A;  4RAG A;  4DYR A;  3QPS A;  2PBI A;  3ZR8 X;  5TIS C;  2X4H A;  1YFH A;  3OSF A;  3G3Z A;  3MWM A;  5DV5 A;  2ZSI B;  3I9V 2;  4HNU A;  1YJW I;  4ABZ A;  3O8G A;  3KP3 A;  4FE4 A;  3WTW C;  3M4O J;  3S3O A;  4BH9 A;  5IP9 J;  2JA2 A;  1IAW A;  2VKH A;  3G1M A;  5FD5 A;  2W57 A;  5EZG A;  4HF0 A;  5GAE J;  3GX4 X;  1ZR4 A;  3I3L A;  3WGI A;  3JRD A;  1ENH A;  3BZ6 A;  1VTN C;  3CMA I;  1GT0 C;  5ICE A;  2MH2 A;  4HBL A;  1H9T A;  3GZ6 A;  1OR7 A;  1FLI A;  3BDD A;  5L3C A;  2JUG A;  2ZJR F;  3JAM K;  4HEA 2;  3TOA A;  5K5R A;  4HV6 A;  1Y1V J;  3E6M A;  1O3Q A;  3WE2 A;  5K5Q A;  4A0Y A;  3S1M J;  2L4M A;  1IJW C;  4BE2 A;  3OOU A;  2H6C A;  2W25 A;  1MGT A;  3FHN A;  2NRA C;  2ZSH B;  1I1S A;  2ZCW A;  4N4N B;  4JX4 A;  4G8X A;  2HZD A;  4RLQ A;  3DV8 A;  3CDL A;  2A69 F;  2EQR A;  3SDB A;  4CH7 A;  3IH4 A;  3KE2 A;  3RYP A;  4EGZ A;  5EDN A;  4C3H J;  3H0G J;  4U87 A;  5J8C A;  3F21 A;  2WAQ N;  2J5O A;  2X6W A;  4G7H F;  3R61 A;  3CJQ B;  4ENK A;  3GFL A;  2IXS A;  4HRI A;  2OAZ A;  2DYR H;  1UHM A;  3VYT B;  4WXC A;  1CF7 A;  3SZG A;  1JUP A;  2FUG 2;  4RLF A;  2Y30 A;  1OYY A;  4X1E A;  4AVP A;  2W4S A;  2IT0 A;  3FM3 A;  3BR1 A;  3CME I;  1V3F A;  3GFI A;  2QEX I;  1S7O A;  2DT5 A;  2M34 A;  5IOZ A;  2R4G A;  3S2D J;  3RSN A;  3CCS I;  3E1S A;  3BRO A;  5LHG A;  2Q0O A;  2P4W A;  3IUO A;  4HQM A;  3GTJ J;  3QQA A;  4HW0 A;  5B1A H;  1X3U A;  2JUC A;  2DA3 A;  4IEJ A;  2BW3 A;  4BAY A;  1YJ9 I;  4I09 A;  1JJ8 C;  1IN5 A;  3GTL J;  5CVJ A;  2M7A A;  1NTC A;  1QPI A;  4P96 A;  2GOM A;  2HXI A;  2PEX A;  3ASO H;  2LRE A;  3M8F A;  3DU6 A;  4JP0 A;  1QBJ A;  1S3J A;  4EJO A;  5CVI A;  3OYL A;  4FHT A;  1VQM I;  2PMZ A;  1IN8 A;  5IP7 J;  3BTJ A;  2CQQ A;  4IRH A;  3UNG C;  2VI6 A;  2WWY A;  3VOE A;  1WHU A;  1E0E A;  1P9Q C;  3PFI A;  5HS9 A;  4HNT A;  3EUA A;  4F7Z A;  2KLO A;  4CXF A;  1LE8 B;  3PO3 J;  2Z99 A;  5K7F A;  4D0P A;  3QPL A;  2QYO A;  1EJ9 A;  1RKT A;  2VBY A;  3ABM H;  1KA8 A;  3K10 A;  1OLT A;  1JI8 A;  4C2T A;  2E60 A;  2DA6 A;  2DU9 A;  2L5Q A;  2MLK A;  3QYE A;  3DP7 A;  3DPT A;  4OWR B;  1ZTR A;  2G7U A;  3VOD A;  4BEH A;  1J75 A;  3TO9 A;  5E1Z B;  3Q0V A;  3S16 J;  9ANT A;  1Z9C A;  4A12 A;  2LG4 A;  3AFH A;  1FC3 A;  3K7A J;  1LEA A;  4E7S A;  3SFZ A;  4HYE A;  2GXA A;  4BEH B;  3I55 I;  4WX9 A;  2KQR A;  2ISZ A;  3BWG A;  4XKV A;  1U8R A;  1GDT A;  4P9U A;  1RUO A;  4FX0 A;  5KK1 A;  1R58 A;  1S29 A;  2N8G A;  5GPA A;  3CCR I;  5E1X A;  3TDU C;  4G6Q A;  3LOC A;  4XN0 A;  1LEB A;  1R9T J;  3VSL A;  4IVN A;  1P7I A;  1IXR C;  1W7P D;  3VDX A;  2DCE A;  5C4J J;  4A3G J;  2XC7 A;  3CCV I;  3MD2 A;  2ZME B;  3O8H A;  1AHD P;  3ASN H;  3WTT C;  3JR9 A;  4A93 J;  2ECC A;  3WU2 C;  2M1B A;  5LGU A;  2MBF A;  5E18 F;  1NG6 A;  2H09 A;  2VE9 A;  3BZK A;  3BPX A;  5GTH C;  3WTS C;  3MVP A;  1FZP B;  4UHT A;  1UB9 A;  3OYJ A;  1SC7 A;  4CCJ A;  1VQL I;  3Q5F A;  3H1C A;  2LF7 A;  2ZBK A;  4A2U A;  3ZQC A;  3KYD B;  1W36 C;  3D1N I;  5F0F A;  1L0O C;  2X1C A;  2LK2 A;  2DA2 A;  2FU4 A;  1LDK B;  4E7H A;  3RKY A;  3HSF A;  3RKX A;  2W85 A;  3M8E A;  1R4N B;  4BQQ A;  2DDB A;  2CW8 A;  3OL4 A;  3PFY A;  4A0Z A;  3J81 K;  1ON2 A;  2MAB A;  2CS3 A;  2K3P A;  3H9J A;  1QNT A;  3M07 A;  2DXI A;  4I0B A;  2ZXI A;  3N05 A;  3LSH A;  3BC8 A;  3NRV A;  4UVB A;  1TLH B;  1DU6 A;  1U5T A;  4XLC A;  1R36 A;  2W84 A;  4EM2 A;  3R60 A;  1VQ5 I;  3CP8 A;  2X6O A;  4HLX A;  3FKI J;  1UJ8 A;  2QLZ A;  2XPW A;  2XRN A;  4A69 C;  2IS2 A;  1Z67 A;  3OOP A;  5LGN A;  1BW6 A;  3I58 A;  3SEZ A;  5LBQ A;  2R93 J;  4WF2 A;  1XC5 A;  1Y8Q B;  3HB9 A;  2L3D A;  2EH3 A;  1RKW A;  3GFJ A;  2UXX A;  1VQP I;  1YE9 A;  2FA5 A;  3CLO A;  2R5Y B;  1ZLK A;  2RNJ A;  3Q9S A;  3BG5 A;  3HOS A;  2NXN B;  1HKS A;  3N4M A;  1JGS A;  3RQ4 A;  2ADU A;  4IXA A;  3TO6 A;  5M5Y J;  4AID A;  3ABL H;  4YII A;  1IRZ A;  4P1W A;  4ETS A;  5DUI A;  1V4R A;  3VEP A;  3GXO A;  3I71 A;  4G6D A;  2Q8K A;  2LY2 A;  5B1B H;  4ZTF A;  2EV6 A;  5BMZ A;  5L3E A;  1XGO A;  2UV1 A;  2X1E A;  5E3L A;  1YW7 A;  4HST A;  4BGD A;  2XHK A;  2MC3 A;  3DLA A;  1QVU A;  2LTP A;  5E8G A;  4YFK F;  2CUF A;  1IV6 A;  3RQI A;  3E5U A;  5IT3 A;  2VBX A;  2DQL A;  1X19 A;  4AYB N;  4D7N A;  2M8G X;  1MMN A;  1ZGW A;  5TGT A;  1SVL A;  1MMA A;  4Q4Z F;  1BI2 A;  2VT2 A;  5ICF A;  5B66 C;  5HDK A;  2XSD C;  4XOT A;  1E2X A;  1S7A A;  3SDG A;  1BBY A;  2A61 A;  3GME A;  4L0Z B;  1XX5 A;  3EDP A;  2DT7 B;  4R8H A;  4XOP A;  2LH9 A;  3TDZ C;  3BG7 A;  3GVA A;  3G1L A;  1USS A;  3ZQH A;  1D5V A;  2WAQ A;  3RPU D;  3TW6 A;  3ZQI A;  2DFH A;  2EZL A;  1YIT I;  1LDJ A;  2HQR A;  2VPR A;  1STZ A;  1P4W A;  2WTE A;  1FOY A;  4UUS A;  4QLC U;  3DKW A;  3S2H J;  5J8F A;  1L3L A;  5FLM J;  4D1Q A;  1W5C C;  1O3R A;  3WTZ A;  4IJA A;  3K6G A;  1W0U A;  3P9I A;  1Q1H A;  1KU9 A;  2A6T A;  3Q3S A;  5FKM A;  4A6D A;  4B48 A;  3JRF A;  3IL2 A;  4QIW N;  1T8I A;  4BXF A;  2E1C A;  1ODD A;  2ZNY A;  3FMS A;  1YW8 A;  2FRH A;  4BQA A;  2KDZ A;  2ETH A;  4ZYE A;  2HPM A;  3A2K A;  3W6J B;  5L3F A;  3J80 Z;  4DQ2 A;  4YIF A;  2IGK A;  2CV0 A;  4MHG A;  2R7O A;  3COA C;  2PMU A;  3DEU A;  4MTD A;  2Q2E B;  4AC0 A;  3K4J A;  2OTL I;  1OCP A;  3EET A;  1AU7 A;  1D0Z A;  5CQG A;  1DPU A;  1S7E A;  1OYI A;  3P7N A;  3BCB A;  1G3W A;  4IQ4 A;  5FD6 A;  1KQ9 A;  4EAT A;  1YOV B;  2JT1 A;  4FET A;  2KP6 A;  3GZN B;  5CPR B;  5IYB J;  4ZYG A;  1REP C;  2OQG A;  2ELK A;  2GWR A;  3B6C A;  4GO1 A;  2BY3 A;  2B7E A;  2FX0 A;  4MIM A;  5EYR A;  2QQA A;  3F23 A;  1RPW A;  1FIA A;  2LY1 A;  2GM4 A;  5CQE A;  2VE8 A;  4FCY A;  2YS9 A;  3T1B A;  4OIR F;  1K78 A;  1ZK8 A;  3QOP A;  5GAG J;  4B3A A;  1G3S A;  1KQ0 A;  1FYL A;  4GYI A;  1R1U A;  4IHX A;  1HDD C;  4I01 A;  4XM3 A;  5J4Y A;  1YO5 C;  4RAY A;  3K70 C;  2STT A;  4LB6 B;  4Y33 A;  3O6B B;  5DCM A;  3NAR A;  2ZFU A;  4Q5S F;  2DYS H;  4UVA A;  4M74 A;  2R7Q A;  4IHY A;  2CW0 F;  3HEF A;  4GXO A;  1QQI A;  4LFU A;  4DYQ A;  3LSR A;  1TW3 A;  2MC4 A;  3MZY A;  5DCM B;  2HYG D;  4AUX A;  3LSP A;  3I4N J;  3G2B A;  5KCM A;  2B0L A;  2RGV A;  1X4O A;  1ZRE A;  3QPH A;  2HWV A;  1T95 A;  1XGS A;  5ILS A;  5DD8 A;  4D5F A;  1B4A A;  1SMT A;  4L5J A;  4EJU A;  3BT9 A;  1YG2 A;  2NAZ A;  1KQ8 A;  1F5T A;  1V55 H;  3V7R A;  3EUH C;  1J7K A;  2IGN A;  1VQK I;  2JA6 J;  3F6O A;  3E97 A;  5KAF C;  3AG1 H;  1TP4 A;  1TQP A;  2JN6 A;  2RV8 A;  5L3D A;  4M72 A;  3ISP A;  1ETV A;  1YIO A;  2NVU B;  3VWB A;  3OMY A;  5D6E A;  2WV1 A;  3Q0U A;  3ZMU A;  1ZQ3 P;  4V2G A;  3F72 A;  1GV2 A;  4XLA A;  2DBB A;  2UZK A;  2ZFW A;  2Z1D A;  2E2J J;  1YYV A;  3BQZ A;  1RI7 A;  4F92 B;  5L3B A;  2FXA A;  5HDN A;  2LP0 A;  1MJA A;  1Y0U A;  1XCB A;  4A3L J;  4AVZ A;  1UFM A;  2P5K A;  1HA8 A;  2HDD A;  2FF4 A;  3LSK A;  1ONV A;  3J7Z I;  1R5G A;  1TBX A;  4XKC A;  2DA5 A;  5E17 F;  4UXN A;  3PSI A;  5JVT A;  5LHH A;  2O3F A;  4XSZ F;  4IHS A;  1JKP C;  2AHQ A;  1VND A;  4XLE A;  1MZB A;  2K86 A;  3CUQ B;  1IZ1 A;  5ED4 A;  2LFB A;  2K9Q A;  2KIM A;  3BLY A;  4L9N A;  4M3D A;  3KYC B;  1YRN B;  3G71 I;  3WU1 B;  2YR2 A;  4C30 A;  2OV7 A;  1JT0 A;  4EMS A;  2V9K A;  1APL C;  4KNY A;  4XKW A;  1MSF C;  1B72 A;  1EKE A;  3DU5 A;  1IGN A;  3I59 B;  3H5A A;  3GLX A;  3F22 A;  2R7T A;  3U2R A;  5F0C A;  2JVH A;  5DM6 F;  3CCY A;  1UEL B;  4I0A A;  4A3B J;  3OR2 C;  4HZF A;  4N9I A;  2HOT A;  1A04 A;  1U2W A;  3LMM A;  5EZH A;  2JK3 A;  3FWE A;  1ULY A;  4LGW A;  1H8A C;  2COB A;  2KPM A;  3K2Z A;  4LIV A;  5HVQ C;  3JCU C;  3HOY J;  4DBQ A;  2OPT A;  4IL6 C;  5F1R A;  2X6X A;  5HOD A;  3TW7 A;  4AD9 A;  3T8T A;  5J1U A;  5LEK A;  2G9W A;  5FRO A;  3S14 J;  2D5V A;  1E3H A;  1C0W A;  1FIP A;  3FXJ A;  2PN6 A;  1BOA A;  4HPQ A;  4XR6 A;  4CCM A;  2QBY A;  5GPC A;  2HYF A;  5LD2 C;  4FT8 A;  1VQ4 I;  2A6E F;  5LLQ A;  3HOZ J;  6PAX A;  2WC2 A;  4XON A;  2I10 A;  1F9N A;  1HW5 A;  1XMX A;  3D0S A;  4D7M A;  3RI4 A;  1IN6 A;  3CDH A;  2VB6 A;  1BR1 A;  3ZMV A;  3J7A O;  3HKZ N;  4DBR A;  1R5I D;  4IKF A;  4AYB A;  2HQ5 A;  3TBI A;  2E34 A;  2E36 A;  2W82 A;  5HDG A;  3JRE A;  2VJJ A;  2F5D A;  1NH3 A;  3C2H A;  4XLH A;  1X2N A;  2CRG A;  1V5F A;  4XLN F;  2BVM A;  1FBS A;  2L9N A;  3S3N A;  2DOD A;  4HG2 A;  1FY7 A;  4H4K C;  3CC7 I;  1HF0 A;  3KEO A;  2LKX A;  3VYS B;  5EEH A;  2QA4 I;  2Z3Y A;  3W6V A;  1R23 A;  2K85 A;  3ZOB A;  2VL8 A;  3E7L A;  1SFU A;  3ELK A;  4IHW A;  3DTI A;  1ZKG A;  3D5R C;  4JX6 A;  4JQF A;  5BPD A;  2L01 A;  1FPQ A;  3WE3 A;  2C6Y A;  1MDM A;  2HOE A;  4PCQ A;  3CF5 F;  4Y15 A;  5TRD A;  3LWF A;  2Y0S N;  3CES A;  2RDP A;  3SQN A;  2IBD A;  2J5P A;  2ZC2 A;  4BHB A;  4LG3 A;  2XGC A;  4XKB A;  2EIL H;  2OU2 A;  3L7W A;  3SHF A;  5HLH A;  4PJN A;  4IX7 A;  2EA4 A;  3I0T A;  1IW7 F;  2H6B A;  2BHZ A;  5D4S A;  3FZV A;  2XGD A;  3AG2 H;  1JE8 A;  2JA8 J;  2V1X A;  4KT6 A;  4BKX A;  2DFI A;  2VC1 A;  3KP4 A;  3PM1 A;  3PNV A;  1EA3 A;  1SFE A;  1GLN A;  2CG4 A;  4P55 A;  1WJD A;  1JUS A;  1BW5 A;  4NHJ A;  5D4R A;  2E1M C;  4IPA A;  5EG0 B;  3T0Y A;  2FOW A;  5E3O A;  3CZ6 A;  2XB5 A;  4L18 B;  2AQE A;  1DU0 A;  3FIS A;  3DEE A;  2GZW A;  3K4K A;  3RYR A;  1GHC A;  2IJL A;  1W4M A;  3GZ5 A;  3T5X A;  1ETY A;  3ZPL A;  4CUG A;  1OQY A;  1GVJ A;  3TOB A;  3PIO F;  3GW2 A;  5A2Q Z;  2XVC A;  3DBL B;  2LSO A;  2RRE A;  5J1Y A;  1G6N A;  1P6R A;  5ERI A;  5EJC A;  1SEU A;  2F6C A;  2XB0 X;  4EJV A;  2M45 A;  4IRI A;  3TP0 A;  3ABU A;  2A07 F;  4FAS D;  3RIR A;  4RMN A;  1UZC A;  1VI0 A;  2A3S A;  4MEX F;  2XAU A;  1Z77 A;  2K5C A;  2L0K A;  1IXC A;  4XRF A;  2O9L A;  1WCM J;  1TWA J;  1IC8 A;  3A01 B;  3KPH A;  2JSC A;  4ON0 A;  5J47 A;  4A3I J;  1PVE A;  1Z7L A;  2VLA A;  2VBZ A;  4EM0 B;  2R7S A;  2GLO A;  1WPK A;  2VOP A;  4RDU A;  3ML6 A;  5C4X J;  3IRQ A;  1JGG A;  4LD5 A;  2LYC A;  3LA7 A;  1BM9 A;  4PGG A;  4LLL A;  1Y39 A;  3H3V K;  1R49 A;  4ESB A;  2L2O A;  2HR3 A;  1X2M A;  3A4C A;  1P4X A;  1N78 A;  3HRS A;  1BIA A;  1IF1 A;  2K9M A;  2VJ5 A;  1QHH D;  1HW1 A;  4ZDP A;  3DLL F;  5IYC J;  3LQR A;  1SVO A;  2FJ1 A;  3DWL E;  1T33 A;  1X1D A;  3D5L A;  1Z7U A;  1J2X A;  3L00 A;  1U8B A;  2W7N A;  1VZ0 A;  1LVA A;  1D1A A;  1MD0 A;  4FX4 A;  3RZO J;  2H1K A;  5CVU A;  3CCL I;  2FD5 A;  2HTS A;  2M0C A;  3IWZ A;  2V1N A;  4WXD A;  2E5Z A;  2XAQ A;  2P5V A;  2HKX A;  4WCG A;  5DM7 F;  2MH9 A;  2G0E A;  3BJA A;  1WWX A;  1OCC H;  4YRV A;  4JK1 X;  1CQT A;  4BJ5 C;  3OYB A;  1S6L A;  3GUD A;  1U3E M;  3ZMD A;  1MMG A;  1HBX G;  2LD5 A;  4KDP A;  1U0J A;  4NC7 A;  3DFG A;  3TO7 A;  3GTP J;  2FNA A;  3FM5 A;  1XGN A;  4NUB A;  1Z3X A;  2AS5 F;  1B8I B;  1ETW A;  1X1P A;  5FKO A;  1BA5 A;  2PX9 A;  2XUB A;  3REO A;  1ZH5 A;  3F8F A;  3BOQ A;  4CA0 A;  2VPL A;  3QU6 A;  3FHZ A;  1FSE A;  1BN5 A;  5FLX K;  2FNP A;  4C3I J;  4RGU A;  2KZV A;  4BY7 J;  2XGX A;  4MGR A;  2YX4 A;  5E1W A;  4JBA A;  3IKT A;  3DPL C;  4MQ9 F;  3E6D A;  1D8J A;  2BE5 F;  1OIS A;  4JYK A;  1JKO C;  2LBF B;  4KIC A;  3KLO A;  3B73 A;  2X9D A;  1VQ6 I;  2V1U A;  2JRT A;  2BVL A;  4IOC F;  2IEK A;  1MH3 A;  2UXN A;  3E6B A;  1KU2 A;  2WB1 N;  3ZQG A;  3L2U A;  1WI3 A;  1NHA A;  2VQH A;  4HDU A;  4B8X A;  2M5W A;  1O7L A;  2L7M P;  4ZYH A;  4A3K J;  1YS6 A;  3G73 A;  4LB5 A;  5F64 A;  3HOV J;  2DA4 A;  3CF2 A;  1LE8 A;  3GTM J;  3TL4 X;  2LOO A;  3LSI A;  4EGY A;  4KN4 X;  2MW8 A;  1BI0 A;  3UKG A;  2IA2 A;  3HKZ A;  4L5I A;  1E3P A;  3FXO A;  2YUS A;  3L2R A;  1QVT A;  1HST A;  2L4A A;  4I76 A;  2CU7 A;  5AIQ A;  5JLX A;  3ABK H;  4YFN F;  5AIP A;  4HSR A;  4B44 A;  3CCU I;  1WGX A;  4A3D J;  5F1J A;  3FXR A;  3J80 K;  5H6R A;  1ZRF A;  5L3G A;  4XK4 A;  3FK6 A;  2JJ7 A;  3KZY A;  3ESW B;  2O8K A;  2CUZ A;  4KN7 X;  2V6E A;  3GO5 A;  2IGM A;  3ECO A;  5FFX A;  3KP6 A;  3I53 A;  3T8R A;  2H1L A;  1W1W E;  2EIJ H;  2CQ7 A;  2ZB9 A;  3H5R A;  1B6A A;  1XSV A;  3HRM A;  2STW A;  2JWT A;  2WAD A;  2KRF A;  4I99 C;  4KIF A;  1OR7 C;  2ZME A;  2Y0S A;  2MLG A;  5CLS A;  2RQP A;  2VKD A;  3BTC A;  1SD5 A;  4Y7N J;  4FE7 A;  2ME6 A;  3KEQ A;  3A1Y A;  3OWT A;  1GV5 A;  3KZI C;  3IP4 B;  2I8D A;  1T2K A;  2FSW A;  4LIU A;  2BGC A;  2RNG A;  2YSR A;  4KMF A;  3V7S A;  1WJE A;  3BP8 A;  3TP3 A;  3E6C C;  1QZE A;  1TT0 A;  3F9K A;  1H0M A;  5M3F J;  3LFK A;  2DTZ A;  4QSH A;  4PJJ A;  1AKH B;  1Z3Y A;  1JHH A;  1V54 H;  1PP8 F;  2IRF G;  3M9A A;  2R7W A;  1KGS A;  4NB5 A;  2HPI A;  2H8R A;  2PJR B;  2Y0M A;  3MN2 A;  3BY6 A;  4U88 A;  3S17 J;  2VBW A;  2JPB A;  1ORK A;  2VQL A;  3EYI A;  1WH7 A;  2DPU A;  5FKK A;  3O2P E;  3BJ6 A;  2ICW G;  2OC6 A;  2CYY A;  2OZU A;  4BQN A;  2QCO A;  2P7V B;  1U9N A;  1MBJ A;  3DKX A;  2R0Q C;  2P0W A;  4P5O A;  1YHQ I;  1GXP A;  1BOB A;  2M7B A;  2RKH A;  5J6X A;  3OYI A;  4E7L A;  4GCV A;  2V26 A;  4CZZ A;  1EV7 A;  1K6O A;  3ECH A;  3EQL F;  2FOK A;  3LL7 A;  3H3Z A;  3SZP A;  4E6K G;  3S2W A;  2EFN A;  2OQR A;  3H0D A;  2ZXH A;  2R5Y A;  1TWC J;  1MBE A;  2BZT A;  3CO6 C;  2LDU A;  5F0H A;  1D1C A;  3HDD A;  1MJ9 A;  1XMA A;  5CKT A;  4L5E A;  2Z5U A;  1FBQ A;  2PQ8 A;  1DPR A;  2OZ6 A;  3HRU A;  4G12 A;  2HVQ A;  3FF5 A;  4EV0 A;  4A3J J;  2IS4 A;  4UV8 A;  5E20 A;  3F8C A;  5M5X J;  4NC8 A;  1SMY F;  2QSF X;  2HNH A;  4YEL A;  5K7Z A;  2LR8 A;  1X58 A;  1JKQ C;  1ERD A;  1I6X A;  2XKP A;  4W1U A;  2ZXJ A;  5K7H A;  3AKZ A;  3DQV C;  1HSJ A;  5LRS A;  2MD0 A;  2HZT A;  4XMY A;  3CMM A;  4MLO A;  1B1B A;  2EWN A;  1XD7 A;  3WGG A;  4CYC B;  4G7Z F;  1TQI A;  2M87 A;  5K5O A;  1VQ8 I;  2WV0 A;  1NK2 P;  3OY9 A;  1OPC A;  1AA7 A;  3ZXS A;  2NVQ J;  3U1K A;  1IXS B;  3ERE D;  4WXH A;  2OTJ I;  4QPO A;  2IA0 A;  3JRA A;  1F1Z A;  4U7D A;  4IO9 F;  3KEY A;  4QWQ A;  1XS9 A;  3FMR A;  3OIO A;  2KJB A;  3FKJ A;  3HRT A;  4UV9 A;  5D6F A;  3TED A;  2ELJ A;  2GOX B;  2CUJ A;  1HLV A;  1ETQ A;  1JHF A;  3P9C A;  1W7P B;  2VIX A;  5BS6 A;  3RPQ A;  4R79 A;  4CZC A;  1PUE E;  2Y69 H;  3WTX C;  4E4H A;  3FXU A;  1UAA A;  2FQ3 A;  4PSW A;  2PG4 A;  4HA8 A;  1A6Q A;  1SFO J;  1ZRD A;  5ILU A;  2UWM A;  1XG1 A;  3PQJ A;  4B47 A;  2DAO A;  1Z91 A;  4XIC A;  1X1B A;  2CV1 A;  3BR0 A;  1RNL A;  5FRN A;  2DMT A;  2JMW A;  4CYD A;  2OJE D;  4NQW B;  4KIT B;  4KIB A;  3FMQ A;  1ETX A;  3HBL A;  3CDI A;  2Q2E A;  4IOA F;  1UHW A;  2EIM H;  2NS0 A;  2XPV A;  2DO7 A;  4EEF G;  4ANJ A;  4BL0 B;  5JLW A;  5BPI A;  4XL9 A;  1T0F C;  3WG9 A;  2FE3 A;  4DJA A;  3X2Q H;  2EFO A;  1A5J A;  1S9H A;  2R7D A;  4J01 A;  2KIU A;  2TRT A;  4ZJZ A;  5LGT A;  3R4K A;  3ZQL A;  1I3Q J;  1P4A A;  3HXL A;  3DF8 A;  2X85 A;  3TKY A;  5EF6 A;  2P7C B;  4M71 A;  1K7A A;  3ZN0 A;  1TT5 B;  3SJM A;  2Y31 A;  2K3F A;  4BHC A;  3VSK A;  4G94 A;  2O8X A;  2L7Z A;  4BY1 J;  3NWT A;  1ZYR F;  3VYU B;  1G59 A;  1GUU A;  2G7H A;  3E5Q A;  3KCC A;  5KNL A;  1U5T C;  2E1N A;  1DQU A;  3CMY A;  1F4K A;  1I1G A;  2OCE A;  5IT9 K;  4UB8 C;  2BHY A;  1LJ9 A;  5KAI C;  5E79 C;  2VKE A;  3BZC A;  3SXY A;  2X6Y A;  3E5X A;  3RKW A;  4LMY A;  1FTZ A;  1TNS A;  5E3M A;  5DTD A;  1A35 A;  2P6S A;  1IO2 A;  4KA4 A;  4BJ6 C;  5D5W B;  5KHD A;  1FYK A;  2HEO A;  2AQF A;  5JR3 A;  2HS5 A;  2KZG A;  2ZJP F;  1U9O A;  3GBG A;  3LSM A;  3OR1 C;  2CUE A;  1MW7 A;  3K4N A;  2JVG A;  3H5N A;  2X1D A;  5CVV A;  5LRR A;  2IS1 A;  2BY0 A;  1FBU A;  1UST A;  1R22 A;  1YX5 A;  3BR3 A;  4I02 A;  2KIQ A;  3ERM A;  2TDX A;  2LLK A;  2JTV A;  1I39 A;  2RC4 A;  1LUJ B;  2XF5 A;  2E71 A;  2EV5 A;  3L09 A;  4I2O A;  3OS1 A;  3I56 I;  5ICG A;  2K27 A;  3K4C A;  2R5Z A;  1PUF B;  4XQF A;  5A2Q K;  4A3M J;  1WKM A;  2JA7 J;  2PFB A;  3OYH A;  3U9G A;  4B4C A;  4BYY A;  4CHU A;  3I64 A;  4KMU X;  1XPX A;  3LFU A;  2R5Z B;  3IKV A;  5JI6 A;  4RAF A;  3L9F A;  1FMV A;  3C3W A;  1B9M A;  2EFP A;  2F4M B;  5FRM A;  3HC7 A;  1TL8 A;  3JRH A;  2LY9 A;  3J81 Z;  4M9X A;  3VB2 A;  2LKS A;  3DBR B;  3HM5 A;  2NVT J;  1V5E A;  3CUQ A;  5B5E C;  1ZGA A;  3LSJ A;  2EB7 A;  4U7B A;  2D2W A;  1FP1 D;  2BYV E;  2MGQ A;  4Q47 A;  2XAJ A;  1YRN A;  4OU0 A;  3HOU J;  3G4S I;  4AU7 A;  1JT6 A;  3HOT A;  2JSP A;  2DMP A;  3MKZ A;  4ESJ A;  3EPZ A; 
#chains in the Genus database with same CATH homology
 2KLO A;  2F6C A;  3K4B A;  3OYM A;  2KL4 A;  4FAS D;  4RMN A;  1ZEL A;  3K10 A;  1OLT A;  2LRD A;  2XAU A;  1JI8 A;  4C2T A;  2E60 A;  2K5C A;  1LVK A;  2L5Q A;  3U21 A;  3QYE A;  2HDW A;  4J00 A;  3DPT A;  4OWR B;  4X0G A;  4II2 A;  4BEH A;  1FMW A;  3OYC A;  4XNF A;  3TMO A;  4OAY A;  2L7K A;  2LG4 A;  4E7K A;  3AFH A;  4E7S A;  1Z7L A;  2VLA A;  2R7S A;  4BEH B;  4E7I A;  1R6R A;  2KQR A;  4XKV A;  3MKY B;  2WB1 A;  1PYV A;  3VYR B;  2E1M B;  4PK4 A;  2LYC A;  4XN0 A;  4DIQ A;  5JHF A;  2L2O A;  4CCK A;  3FBI B;  1N77 A;  3VSL A;  4BJT A;  1NG7 A;  3A4C A;  4ITV A;  2MFZ A;  3VDX A;  2VQC A;  3L2W A;  2DCE A;  4IQJ A;  1N78 A;  3OYG A;  2XC7 A;  3MD2 A;  1WJF A;  2K9M A;  3L2Q A;  2VJ5 A;  1QHH D;  4ZDP A;  4CCO A;  3HPG A;  2W00 A;  3DWL E;  3V42 A;  5HNF A;  2K9L A;  1X1D A;  3D5L A;  2W7N A;  1VZ0 A;  4F52 A;  1NG6 A;  1D1A A;  4Y3O A;  4BDZ A;  3M1C A;  2V1N A;  2E5Z A;  3OYJ A;  4B43 A;  4CCJ A;  3QOD A;  2F4I A;  4YRV A;  2DJI A;  4BJ5 C;  4PSX A;  3OYB A;  1W36 C;  2WBM A;  3PL8 A;  4PUS A;  2X1C A;  1WJC A;  1MMG A;  1LDK B;  4E7H A;  1U0J A;  3HG9 A;  4NC7 A;  4NNJ A;  3OS0 A;  2KMU A;  4BQQ A;  4IZZ A;  1IRX A;  2CW8 A;  3OL4 A;  3PFY A;  1Z3X A;  4NUB A;  2CV2 A;  2Z16 A;  3W2W A;  2MAB A;  2CS3 A;  3FDY A;  4PJL A;  3H9G A;  2K3P A;  3H9J A;  2DXI A;  2ZXI A;  4CA0 A;  2VPL A;  3N05 A;  3LSH A;  3BC8 A;  2R7X A;  4BQO A;  4XLC A;  3CP8 A;  4Y4R A;  2KZV A;  3DPU A;  2IS2 A;  3W2A A;  3DPL C;  3PNT A;  2UUZ A;  3K4M A;  3HL2 A;  3SEZ A;  2WA0 A;  2LBF B;  3S93 A;  4BU2 A;  1DGW Y;  3H35 A;  3S3M A;  3ZRG A;  1KON A;  2BVL A;  1YE9 A;  3W2V A;  3HOS A;  3L2U A;  2BOL A;  2VQH A;  3QOE A;  3ZCO A;  3PSF A;  3RQ4 A;  2VXD A;  2W1O A;  1BR4 A;  4P1W A;  2M4K A;  1D0Y A;  3CF2 A;  2LY2 A;  3TL4 X;  3HPH A;  4ZTF A;  2RQQ A;  4PJM A;  2LOO A;  3L2V A;  3LSI A;  3J7A Y;  2UV1 A;  1MMD A;  2X1E A;  2WAF A;  3QYB A;  4HST A;  4BGD A;  4XLF A;  2HQA A;  2QKL B;  3RTR A;  3DLA A;  3HKZ A;  2CH0 A;  3L2R A;  1LKX A;  1X19 A;  1WJA A;  4DOZ A;  3OYK A;  3AL0 C;  1MMN A;  2LC2 A;  1MND A;  5TGT A;  1MMA A;  4HSR A;  4B44 A;  2A5W A;  4PFP A;  4XOT A;  4GRI A;  2DT7 B;  4XOP A;  2LH9 A;  3BG7 A;  4E7J A;  3ZQQ A;  1PJR A;  2VJ4 A;  2CUZ A;  2V6E A;  2WAQ A;  3RPU D;  2IGM A;  2Z2S B;  1Y6I A;  3OYA A;  3D5S C;  3H5R A;  3OIQ A;  4D1Q A;  2WAD A;  1OR7 C;  3K6G A;  2Y0S A;  1K6Y A;  3FBN B;  2VKD A;  1W36 D;  4F55 A;  2A6T A;  4B48 A;  4BXF A;  4DGW B;  3OL3 A;  2R7R A;  4II3 A;  1D0X A;  3A1Y A;  1QU3 A;  3OWT A;  3IP4 B;  2I8D A;  2HPM A;  3A2K A;  1X4P A;  3IAS 2;  3KX2 A;  4LIU A;  2RNG A;  1SAU A;  2IGK A;  2CV0 A;  3CP2 A;  1WJE A;  2R7O A;  2HU9 A;  2Q2E B;  1TT0 A;  3F9K A;  4JOM A;  3K4J A;  3OYN A;  2Q1Z B;  1D0Z A;  5CQG A;  2CFO A;  4PJJ A;  3AL0 B;  5HLT A;  2HVR A;  3BCB A;  3C2G A;  4IQ4 A;  4BUP A;  1Z3Y A;  3ONQ A;  5HNH A;  4EAT A;  4RM3 A;  4ZYA A;  3CJR B;  4FET A;  2KP6 A;  2R7W A;  5CPR B;  2PJR B;  2HPI A;  4D9J A;  2F5V A;  2OUM A;  2IGO A;  3ZGK A;  4BS9 A;  2LY1 A;  2VQL A;  5CQE A;  4C2U A;  4CSW A;  2OC6 A;  4G6T B;  3E0J B;  4BQN A;  3MMY B;  4B3X A;  4XM3 A;  1D1B A;  3DKX A;  3K70 C;  4Y33 A;  2P0W A;  4P5O A;  3S32 A;  1BOB A;  2ZFU A;  2M7B A;  2XSJ C;  3OYI A;  4E7L A;  1Z21 A;  2V26 A;  2DOA A;  3OYD A;  2LBF A;  1X1C A;  3QYF A;  2R7Q A;  3LL7 A;  4E6K G;  3H0D A;  3K4L A;  4E7Z A;  2MC4 A;  2ZXH A;  3RCO A;  2KRH A;  1V5G A;  3G2B A;  5KCM A;  1X4O A;  1MNE A;  1D1C A;  5CKT A;  2VAS A;  1T95 A;  2XF6 A;  2M4G A;  4ZDL A;  4ZTJ A;  2HVQ A;  4BE1 A;  3EUK L;  2IS4 A;  4C9Y A;  4NC8 A;  2HNH A;  4XN3 A;  4YEL A;  3EUH C;  2IGN A;  4CCL A;  3H9Q A;  1N75 A;  3IAM 2;  1DP3 A;  1ERD A;  2KDO A;  1BR2 A;  3VWB A;  1LFP A;  3AKZ A;  3DQV C;  3OMY A;  3NWS A;  2MD0 A;  4XMY A;  2VQG A;  3SEQ A;  2R7U A;  3CMM A;  4MLO A;  4XLA A;  1J09 A;  2Z1D A;  4F92 B;  4KJZ A;  4BE0 A;  3OY9 A;  1AA7 A;  3ZXS A;  4AVZ A;  1WFX A;  3BG6 A;  4QPO A;  1HA8 A;  3KEY A;  4F3Q A;  3LSK A;  4N4O B;  4F91 B;  1TZL A;  2BW3 B;  3FKJ A;  1UG0 A;  4XKC A;  1DGR M;  2ELJ A;  2GOX B;  2CUJ A;  2KRC A;  3PSI A;  1YX3 A;  4RM2 A;  2E5N A;  2MYS A;  2VIX A;  4XLE A;  4R79 A;  4BAC A;  4CZC A;  1WJB A;  4E4H A;  2O5R A;  1UAA A;  3KYL A;  1SFK A;  3BLY A;  4PSW A;  3MKW B;  4PFO A;  2WY8 Q;  3DKY A;  3OS2 A;  1Y56 A;  2OV7 A;  2WAE A;  4C30 A;  2UWM A;  2V9K A;  4XKW A;  4BDY A;  4B47 A;  3OYE A;  4CCN A;  2DT6 A;  3DU5 A;  2CV1 A;  1X1B A;  5FRN A;  2V7F A;  2CW7 A;  3H5A A;  4LIT A;  4KIT B;  1WJ5 A;  4NQW B;  2HVS A;  2R7T A;  2JVH A;  2V4J C;  2R7V A;  3M8J A;  4KIS A;  1UEL B;  3OR2 C;  3BCA A;  4ANJ A;  4BL0 B;  3LMM A;  4XL9 A;  4ZDO A;  1T0F C;  4DJA A;  5HOO A;  2KPM A;  5HVQ C;  4LIV A;  3OYF A;  4DBQ A;  1S9H A;  4J01 A;  2X6X A;  3ZR8 X;  4ZJZ A;  3DTK A;  3K70 D;  2CMP A;  3HXL A;  2X85 A;  2ZSI B;  3I9V 2;  5FRO A;  4HNU A;  2PJR A;  3VSK A;  4XR6 A;  4HPQ A;  3S3O A;  3NWT A;  2JA2 A;  4CCM A;  3SYT A;  3VYU B;  1X1A A;  1G59 A;  2VKH A;  5LD2 C;  2NOJ B;  5KNL A;  3I3L A;  1DQU A;  1G8X A;  4XON A;  2WY7 Q;  2VB6 A;  1BR1 A;  2VXZ A;  2JUG A;  2X6Y A;  4HEA 2;  4DBR A;  4IKF A;  4AYB A;  3TBI A;  2W82 A;  4BE2 A;  3OOU A;  3FHN A;  2VJJ A;  2ZSH B;  1QHG A;  4N4N B;  4BJ6 C;  5KHD A;  3C2H A;  2AQF A;  4XLH A;  2HZD A;  1V5F A;  2BVM A;  4RLQ A;  2L9N A;  3SDB A;  3GBG A;  3PNY A;  2XDV A;  3LSM A;  3OR1 C;  4HG2 A;  4H4K C;  4CH7 A;  3S3N A;  2L9S A;  1MW7 A;  3K4N A;  2JVG A;  3H5N A;  2X1D A;  3VYS B;  3DTE A;  3PUB A;  4XOR A;  2IS1 A;  3S8P A;  2M3A A;  4U87 A;  2VL8 A;  2X6W A;  4YEJ A;  3CJQ B;  4HRI A;  1YX5 A;  2IXS A;  3D5R C;  3DTI A;  4JQF A;  3OIP A;  3VYT B;  2XF7 A;  4ZC3 A;  2XF5 A;  3CES A;  3SZG A;  3OS1 A;  3W3C A;  2FUG 2;  4RLF A;  3K4C A;  4LG3 A;  4XQF A;  4QPQ A;  4XKB A;  2W4S A;  3UR3 C;  3OYH A;  2QKM B;  4PJN A;  2R4G A;  4IX7 A;  2M0M A;  3RSN A;  3LFU A;  3E1S A;  3HUG B;  5LFA A;  3IUO A;  4KT6 A;  3PNV A;  1EA3 A;  1FMV A;  1GLN A;  1WJD A;  2BW3 A;  2IS6 A;  2KHM A;  2E1M C;  5FRM A;  3HC7 A;  3CZ6 A;  2M7A A;  2AQE A;  4OAZ A;  3DEE A;  2GOM A;  3K4K A;  2LRE A;  4F93 B;  1V5E A;  3DU6 A;  3LSG A;  3OYL A;  2VJI A;  2PMZ A;  4CUG A;  4U7B A;  3UNG C;  3PJR A;  1E0E A;  1P9Q C;  4AU7 A;  2RRE A;  3HOT A;  2JSP A;  2X51 A;  4HNT A;  3MKZ A;  3EUA A;  3EPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...