3FBKA

Crystal structure of the c2 domain of the human regulator of g-protein signaling 3 isoform 6 (rgp3), northeast structural genomics consortium target hr5550a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
138
Chain Sequence
QGAGQLRLSIDAQDRVLLLHIIEGKGLISKQPGTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHFFFPVQEEDDQKRLLVTVWNRASQSRQSGLIGCMSFGVKSLLTKEISGWYYLLGEHLGRTKHLKVARRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C2 domain of the human regulator of G-protein signaling 3 isoform 6 (RGP3), Northeast Structural Genomics Consortium Target HR5550A
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Regulator of G-protein signaling 3
total genus 32
structure length 138
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3fbkA00
1GMIA 4IQHA 4L1LA 4A55A 1YRKA 4MJJA 2YOAA 2CM6A 1TJMA 3JZYA 4ANVA 2K3HA 2WXPA 3TJPA 4DK5A 3GPEA 2WXOA 1QATA 4XZ4A 3QR0A 1DJHA 4WEEA 3LJ3A 3F01A 3FDWA 4ICXA 4J6IA 3KWTA 3CSTA 3QARA 3ZIMA 4F93B 3HIZA 3APDA 4G11A 3IM1A 2D8KA 1DJZA 3PFQA 4WWNA 3ML8A 4WWPA 3L08A 3ENEA 2WXKA 4QJ4B 4URKA 4NPKA 4F92B 3RDJA 3L13A 1W16A 4PS7A 2WXLA 1CJYA 2RD0A 4QJ3B 4OVUA 2CM5A 3MJWA 2K4AA 4WAFA 1E8ZA 1E7VA 4FHKA 2BWQA 4ANWA 4BFRA 4PS8A 5JHBA 3L17A 3IBEA 2WXFA 4FLHA 3RPBA 2CJSA 2FJUB 4GB9A 4V11A 5H4YA 4BGDA 1E8WA 3T8MA 5G55A 3FBKA 1E90A 4LDCA 4HLEA 4TV3A 2ISDA 3SD5A 1E7UA 4QJ5B 3R7QA 1DJWA 4L23A 5CCGE 1E8XA 4EZKA 1RLWA 5JHAA 2R83A 2WXGA 3QAQA 2WXNA 4NPJA 2Q0ZX 3F05A 4WWOA 1BDYA 1DJIA 1DJGA 3CSFA 2ENQA 1UOVA 2CHWA 4OVVA 2JQZA 4ANUA 2B3RA 1BCIA 4KZCA 3B7YA 3L54A 4FULA 3W56A 1DJXA 3ML9A 4JPSA 1RH8A 2A4ZA 2Q3XA 2V4LA 2WXQA 2WXIA 3NZSA 4TUUA 4HVBA 4F1SA 3QR1A 4TS6A 2DMHA 3OAWA 3PYCA 2KI6A 4XE0A 3TWYA 1RSYA 1A25A 2WXRA 2WXHA 4FADA 2ENJA 2K8MA 3APCA 3DPDA 3KWUA 2LHAA 3W57A 5EDSA 3PREA 3P2BA 5CCJA 2WXMA 2X38A 3QK0A 4L1BA 4EZJA 4LCVA 2A5UA 3DBSA 2K45A 1DSYA 2NCEA 3HHMA 4Y1TA 1HE8A 1UGKA 4LT7A 3APFA 4FJZA 1WFMA 2UZPA 2CJTA 2NQ3A 3ZVVA 4EZLA 1UOWA 5G2NA 1TJXA 2Z0UA 4AJWA 2YRBA 2Y3AA 4ANXA 3TL5A 2QZ5A 5KJ7E 2FK9A 2N1TE 5T8IA 1K5WA 4FA6A 5CCHE 5H4ZA 4Y1SA 4QAMB 2NSQA 3M7FB 2CHXA 4FHJA 2QZQA 4AOFA 1DQVA 3PS6A 4NP9A 4NS0A 4KZ0A 3L4CA 3F00A 4PS3A 1W15A 3NSJA 3S2AA 4F91B 3HN8A 3QJZA 1WFJA 2WXJA 3NZUA 4FJYA 2DMGA 3PRZA 2CHDA 3L9BA 1V27A 2ENPA 3F04A 3N5AA 2CHZA 3OHMB 4GNKB 3R7RA 1BYNA 2EP6A 1E8YA 2ZKMX 4L2YA 4XX5A 4DNLA 4ICWA 1QASA 4KITB 3L16A 3ZW3A 1DJYA 4IHBA
chains in the Genus database with same CATH superfamily
1YEIL 4JB9H 5TF0A 5B38G 1OAXH 3ARGA 3LKNA 3IVKA 2XWDA 3JYCA 3G5VA 3GS4A 5EU4B 4ELMA 2BNRB 4Z77B 2AITA 1JZ6A 1QBMH 3BX7C 4P4RA 4GKSB 3F7YB 4NBZB 4I4WA 3U82B 1R75A 3QNFA 5GGTL 1YC8A 5J56B 2IFGA 3LZFL 4Z7OB 1PY0A 1FAIL 1N8ZA 5DFVD 4JZNA 2PNDA 3C5SB 4W9LC 3L5WA 1MY7A 2MH4A 1O6TA 2R2HA 3FOLB 3MV8D 5D5ME 3RVUC 3IFNL 3FQ1A 4QJ4B 4EI5C 1KC5L 4OQ1A 1GRWA 4KMQA 4R7LA 1D7DA 1Q9LB 3MV8B 4LMQE 1UT1A 5AYQA 3KS0J 2OXHA 3UGUA 4A2GA 1JDCA 3DMMA 4LCYB 3MV9B 4XE5B 4OCMC 43CAB 3PHQA 1ZA3B 1Z32X 1U8KA 4ZUSB 4GB9A 1OM3H 4HJGB 2FDBP 1QW9A 3MV9D 5FW8A 1AGEA 3L3JA 5AVWB 3B83A 1JNNH 2PABA 5FDYA 4QNPE 4QIRA 2VKWA 1NCHA 3ARSA 2VDKB 2XVBA 1KCUH 4NKDA 4F8NA 4OGYH 3GGWB 2JTDA 3LY6A 3WEMA 1G9MC 3AREA 4DGYH 3C60C 3VTAA 4EEEA 1DVXA 1MW1A 3GMRA 1YMMB 2Y36L 5SWZA 4FTVD 3PCYA 3V7MA 4D0CA 4JVPA 4HZLA 4DO5A 3QXAB 3L1OL 4Q6IA 1TFPA 4GKOA 2W59A 4OF6A 1T0NA 3F7VB 3JT0A 3MZGB 2EKJA 4XH2A 3QAZC 4RBPK 2QQLH 2YHGA 5EHFA 3HNSL 3VFSA 2HN7B 3B2MA 5HI4D 3FPXA 3MRNB 4GXVL 2NY7H 2C1PB 4M1DH 5KYWB 3ULSB 4CMHC 3V4PB 3UPCA 4FNUA 1XVSA 5DVMA 3V4PL 3QQ4A 3L3GA 2VIRB 2GTWA 4NKMA 4E9XA 3BFOA 1TJGH 4MXWH 1S7VB 4LSSL 5G5DA 3T4AB 4R5VA 3N9GL 2D31A 4OZIF 5DQ9B 2IDUA 3N42F 3DX8A 1K8DA 1G5AA 5TH2B 1ZLSL 3S2CA 4U6HB 2BP8A 3D3VD 4X4XA 4B97A 1AO7D 4ZXBC 1BECA 1NGPL 1DJYA 2EH8H 2AC0A 3EJTA 4CGUB 1MI5D 3OMIB 1RIUL 4JFHE 4I13B 5D71H 1NMCC 3CX5J 3VG9C 2DLFL 2CPUA 5DRWB 2ETWA 1FSKB 5FW7A 1R0AL 1RZ7L 5F93C 3GZQA 2UWEE 1OSPH 4Z3EA 2ARWA 3CFCH 1JN6A 2A9DA 1PLAA 1UM6L 3IJEA 3CFEA 4NO2B 5GRUH 1BD2E 1SXNA 4TSBL 4BK8A 4ZO7A 4WW1A 4MJIB 1EDHA 2JH2A 3MRJA 1ZLVH 2AEOA 4TOYH 2NCMA 5FGBA 3MLVL 5ITFA 1OAZH 4BELD 1MCCA 2VM9A 5EFIA 5MEQB 2X4OB 4PJ8A 4ERSL 5T1DL 2A9MH 2WLHA 1PG7X 2AP2A 3K8LA 3O6FA 1INQA 1E8WA 1IILE 1PFOA 5E6SB 4K3DL 1DYZA 1ED3A 3AWEA 4NERA 4PJFF 1S7UB 2AXWA 1OWWA 1JPST 2ICEA 2HWZH 3ULUE 5GJTL 2HX9A 5E5MB 5E2TL 2PYEA 3KVDD 5GSVA 3SQOL 2EDYA 5D5MF 3PHOB 3BW9B 1I85A 1DQLL 4DQAA 4GAGH 1T5WA 2ZWKA 3HW7A 1OQOA 4O02B 2JQZA 3BUYB 3ZK0A 4FC3E 4L9LC 2P5WE 2XJKA 4L37B 1A6AA 4TVPH 4KVNL 1F58L 3QH3A 3BXNA 3QZWG 4U7MA 2OZNA 2G9HA 5F89A 2OL3L 5ACZB 3I9GH 4B9YA 2K0RA 1V7MH 2Y5TA 4Q0XH 1RZQA 2CU9A 1UB6B 2R7EB 43C9A 2ZF8A 4LHUD 3WKML 3PDOA 1HXMA 2FWOB 2Y6TE 5JYMA 4CN4A 2BOLA 3SO3B 2Z91B 4RISL 2VDQB 4ORGA 1RPUA 2OP4L 1E2WA 5I6OA 2G2NA 2DQFB 4HD5A 2QZ5A 4XPFL 2CDGB 2FSEA 4FA6A 7PCYA 4RETB 1P53A 2OR8A 2TSAA 4MNGB 4M03A 1MFAH 2BNQD 4QTIL 2D3LA 4NS0A 1KGCD 3JV5A 4NO2A 1NINA 4TNFA 4X7EC 4M6ML 3T2NH 4KTYA 2H1PH 1ZGLP 2DQHH 2QV2A 3KCPB 3TO2A 3C87A 2IG2H 5EEZA 3HZMB 4HXAL 4Y88A 1MRFL 3IDMB 4KKZA 1ADQL 1U8MB 1MDAA 1AHWB 4G7RB 4TXVB 4X7FC 1Q9WB 3SDAD 4A37A 2GT9B 4PJ7A 3GXIA 4C4UA 1KPUB 4X5PA 1Y0LA 4FNTA 3N91A 4R0LC 4ZW5A 2CR0A 1OSYA 1MFBL 2OZ4H 2W81C 3B1TA 2H0PA 3ZIMA 5JPNB 2YA1A 3FTUA 4XVSL 2DQEL 1D5BA 2IO5A 3I3DA 4L4TB 5DI8A 3MC0A 2UZYB 1YCSA 2Y72A 3A4EA 1EDQA 1ROCA 4JRXD 5IVNA 2BSDA 1Q0XH 3B5GA 3N1GC 3RY5A 2GEQA 3S5LB 3S98A 4ILDA 3QWNA 1A0QH 1YPZF 4ELKA 1E9OB 1M1XA 5HI4C 1LLAA 5I66B 3RZCB 2VDOL 1TVHA 5TE4L 1HQRA 2I9LA 2WAHA 2Q10A 3EJPA 1R3LA 3MNZA 2PP8A 2D0GA 2XX1A 4ZD3L 3DVGB 1KIRB 1XGYH 3MLRH 3O6FD 1P7QB 4Q6IB 4FLQA 2CHNA 5IOKA 2HP4A 1E5ZA 3IMTA 5E5MA 4LARL 4YH6A 5BRZB 4WUUE 4D0CB 2FX7H 5BNXD 4F58L 3OBAA 4PG2C 4HCRL 4EQ2A 3H2PA 4H0GA 2H9GA 3AW5A 5FGRA 1FL3B 2QJDA 1J8SA 4DGVH 4NDMA 5HD8C 4K7PH 5I15L 4GP8B 1OCWH 4OZFG 2FECL 1ZA6B 1VZIA 4R3SA 3T65A 5TDPA 3QEHB 2YQ2A 1HDMB 4N3UA 3KEHA 4IU3A 4JY5L 5TK2A 3C6SA 2YGNA 1OW0C 3TH4T 3BEVA 3SCMD 3FB5B 4OZFH 1LD9A 3IDIA 4FI8A 4QO1B 4HC1H 3GNMH 1PZBA 1PKOA 2W9DH 2F19H 4HEMA 2XV0A 5JLZB 3G9AB 3ARDD 5DRXB 2DICA 2B4CH 2P5EB 5A3ID 3CZFB 5I8KL 1ETJA 2F54E 4CC4A 5KTEH 4PVBA 2WPGA 4GBXC 3V6FA 4LEEA 2QZQA 3MNMA 5E4EB 5TE7L 4NQED 1T2QL 4WNQA 4GT0A 4J8QA 1IJ9A 3FRPA 3VXPB 4PJBF 1AHWC 3EH5B 1S8DB 2VAAB 2XIDA 4XMZA 2VDML 5ICYB 3R7RA 3MHZA 2D7TL 3UCQA 1G6RB 3MCKB 4G7VH 5HGDA 3CVIH 3LKPA 5ANME 3REVB 1T1XA 3BI9X 1BQLL 3RKPA 2VDNH 5FO9A 5GSRB 3COOA 3PV6A 2X70B 2QKIB 2EEDA 4PJXF 4GI9A 2D9CA 4JLRA 4OGQC 1LO4L 1QKZH 4XBPB 3TOPA 3O11A 4I88A 1LK3H 3BFQG 4AZ8A 3OKKA 4OCXL 1CGTA 4LF3B 5LB1A 2PCFB 3VDBA 1A6UL 3ML8A 3K6FA 5F1OB 2VZUA 4O02H 4AYBA 1RPKA 2P7TA 5JHBA 2OA9A 2VO8A 4Z78A 15C8H 1F45A 1MIEL 4A7UA 3DDGA 2XFXA 4L4VD 2HXAA 4WGWB 1IQDA 3BAKA 1YY9C 3FCBA 2VT0A 5KG9B 4J3XA 4PRHD 4JO8A 3GSOB 4HUVA 4U6XA 4F9PC 2WO3B 1SOXA 2O30A 4YS4A 1F4WH 5LCVH 5CEYB 5EO1B 5C07B 2WYTA 5BZDA 1P4UA 3U83A 4A2EA 3TJEL 2ZOLB 1QD0A 3DXAD 2F0CA 5D1XD 5IESH 4NQEB 3DUSB 3IKKA 3WOVA 1CF1A 3OQRA 4BWTA 4HETA 1QRNB 5FGBC 4UAOC 4YDJB 4MBRA 1JGLH 3FRPG 2BSSA 1YAZA 3D08A 4I3SH 1SDYA 3H3BC 2BSBA 3PGDA 1QRND 1E65A 4IGBB 5CSZB 4JFOB 1TQUA 1UCBL 3UOAB 4HDIA 5T1KB 5DUJA 4K0OA 5ELIA 3HB3B 4B53A 4TQ8A 3GJFB 4KK6D 4C56B 4BZ2H 1K2DA 1QWHA 3QDJA 4K9JA 4AKQA 1BBJB 2DL2A 2DI8A 3FTVA 2FK9A 3U4BH 3O81A 5JA8B 3MXVL 1ONQA 4TNWF 3ME0B 4R84A 1IKNC 3VXTB 3UXFA 1G6RL 1ML0A 1SVBA 3B2UD 4JKNA 1N7ML 2JKSA 1UEMA 1WFNA 3F3HA 4JRYA 3BAEL 2X4PA 1D9KD 4FJYA 2WO2B 4JDEB 2YSSB 1SMDA 4M5YH 1QSED 4WJG3 3QUXC 4DW2H 4OIFA 1INDH 5FKAB 2BY1A 5IROC 3D07A 5I9QC 4YXKH 1N70A 1QSEB 1MRCL 5C09D 1LWJA 5GS1C 2JB5L 4OF5A 4BKSC 1XF1A 3MLUH 5ID1A 1QTPA 3HCVA 3BFWA 5C0RL 1QO3A 5IEKA 5ISZE 4QXUL 4A7GA 2VLJE 4DAGH 1HESA 4Z7NB 4YSQA 2HG0A 2W07B 4OJCA 2XTLA 3ZDXF 4P3DB 3L4WA 4QHUA 2GAZA 5J5EA 2IAAC 4FCAA 5CHNA 3GXNA 4JFYA 2QHLA 3M1CA 4B3EA 2ATPA 2B7DT 2NY3B 3OZ9H 3QRBA 4L8CA 3QWOA 3WU1A 3ZR6A 3APMA 4BCXA 4EE2A 1DR9A 4TPRH 5GS0C 2KYIA 3QUZB 3VXRB 3L3DA 2APWA 2WANA 1Q4NX 2K4AA 3KCWA 4QTFA 3KDMA 1VKXB 3EH3B 3ZZSA 5FC9A 1QR1A 3NEXA 2BVEA 2X4UA 3RY6C 2YPLD 4Z78B 1WC7A 2VLLA 4Q9BA 3VB8A 1SOKA 3MDJA 5BZZA 4YHLH 2F5AH 1MOEA 1ZVNA 3CBRA 1UQSB 2XPGA 4IDJH 3S96B 1I8AA 1J5OH 2K6YA 4QJ5B 4HUWB 1W72H 4O2FA 1WIPA 1JZ2A 3I75A 4X6EB 3FQUB 4LKCA 3PP4H 2AKRA 4FTDA 3WN5B 3BIAX 1C5CL 1BF2A 3QA3A 2R15A 4QHLB 2WBWB 5HDWA 4GRLA 1NEPA 3Q44A 4WWOA 4MA7L 1YEJL 2IWGA 2CHWA 4IRSB 1AI1H 3ORJA 4IRSA 4ANUA 2UXFA 2Z4TA 2IDCA 4PTUA 1IEBA 3R8QA 1AQ8A 2DZEA 1QSFB 3GDCA 4GS7C 3PUUA 1OO2A 3TXAA 4JJHA 3N50A 4LSRH 4HVBA 3RIFK 5T33L 3TF7C 1UM6H 1BGXH 5DURD 5EN2A 3UBXB 4UUJB 3LQMA 4K2UL 3HTLX 4TVSa 4UM8A 2D4DA 1UA6L 4XN5A 3K91A 1LP9A 3L7FA 4NQSA 3APCA 5CGTA 1RZJH 5KANI 1XCTA 4FP8L 1ZGLB 2NXYB 3GMPA 4Q7DA 4DFHA 2ZUQC 4P49A 5CCJA 2XN9E 3HB3C 3HI5L 4G80B 4ZQTA 1S8DA 3QI9C 5I5IA 3QIWB 1DLFL 3QORB 1WBZA 1IGIL 1L3NA 3LKPB 2MCAA 1HZHH 1WFMA 4PH8A 3R19A 3NAAL 1L9RA 3ES6B 5JUEH 4MB5A 4Y5YC 5AKVA 5IWLA 3VD3A 2XWXA 5T8IA 5MEOA 1JP5A 1WFIA 2OMVB 3CFDB 2P5EA 3PXHA 1MZYA 3CN0A 3CLEH 4EJ1C 3V6FB 2UXTA 3QWQB 4MMYB 2X4SA 3NSJA 1HU8A 4PS3A 3K1DA 1L0YA 4JREB 1SQMA 3FF7A 2YRPA 5FYJU 5I6LA 2AFNA 4JHWL 2DMGA 2EDRA 5EU6E 3IGLA 2KBGA 5KBLA 4OD1H 2F53E 3FFCA 2EVHA 1KFAH 1FFNA 1QSEA 3J07A 4LHJB 1PW3A 4NZJA 2IQAA 2J5LC 3VXOB 3DK0A 3NSCA 1IVTA 4Q0XL 3CU7A 4PB0L 5AB1A 1NPUA 2C8NA 2H9GB 4TVPE 4NGHL 1I1FA 2IV8A 3HG5A 3QEUB 1ZAGA 3O4LE 3HAEB 5HHXL 2VL5A 1XAUA 4HUNB 2CKBB 3JUYA 3EGXB 3UAEA 1S7QB 3WS6A 1TETH 1AGCB 1ASPA 4NJ9L 3QRFM 4ZUWA 3EOAB 3ESVF 4OCWL 4PLOB 1MRDL 4TQIA 4DVRL 5AYTA 3VXMA 4U1LB 4WO4B 2UV3A 3EUUA 5HDBB 4KH9A 5LXGH 3UC2A 1CU4H 3PQYA 3ZT7A 4PJHA 4PFEA 4PGEB 1OB1B 2OFQA 1CR9H 1EVUA 3C5JB 3Q3GA 4ZUUA 3ZE1E 3TBCA 5KVFH 3BUDA 1G7MB 1AKJA 3K2UH 1M1XB 2AV7A 3E7JA 5JXAH 3AU1A 1PPIA 3RVVC 4P57A 4Y4FB 1HFUA 2YO3A 4PJDF 4FFWD 4XHJD 5CD5D 2PP7A 2R4RH 4X5XA 4DP1X 1BZ9A 5KN5B 4NQTA 3DVIA 2WP3O 1XH3A 1ADWA 3IRCA 2F7OA 4X9YA 2D0HA 3UBXI 1HHGA 1UOVA 5ETUB 3MLPA 3RUGA 1M05A 3ULVH 1VACB 2UZYA 3FUMA 2DQUL 1QG3A 1U92B 3Q8AA 3D30A 3O0RH 1YEKL 1SHSA 3GBNH 1KTKE 4N8CL 1RUQL 1TJIH 1XV8A 2CLRB 2GABA 2WXRA 4DPBX 1PEZA 1S7TA 2EC9T 3N42B 4HUUA 5DMJB 1U95B 5CZKA 4MJIE 3FYIB 4LRIC 4N0CC 4QLRA 1T20A 2HFGL 1E27B 3PAYA 1J9SA 4EZLA 4X4MA 1G0DA 2O5YL 4N0FB 5I30L 3RG1C 2BINA 1CZ8L 2NW3B 3C6LD 3MJ8B 4ADIA 1DN2A 1FI8C 2EDMA 2A99A 2A9NL 4W9FC 2HJKA 4NRYB 2R69L 4XCYA 4GJTB 5I6KA 3ASOB 1XB6A 1OF2A 2ZUWA 2CDGA 2CUAA 4EO5A 3GKWL 1NC4D 4GO9A 1N19A 4MD4A 1JF5A 5DVNA 3WNNA 1QHPA 1SDDA 2IXQB 3IKCA 1I7RA 1DE4B 3OWRA 5DYFA 2P5WD 6FABL 4JFQA 4O00A 3TYFB 4N5ED 3QUKA 1BMGA 5EEUA 1WWCA 3MCKA 4YDIH 3RQ3A 1A8JH 2VR8A 4L37A 1QABA 2H32B 4HLZH 5I1CL 4EIUA 32C2B 3QRLA 2WZ5A 2F2HA 2WQAA 3OLIA 4MAYB 2HT4C 4OGZA 4F93B 1W8OA 2J2ZA 5KJRH 4G7YH 4N2IA 3L5HA 4Q2ZB 5EZOH 5J8OA 3D39B 5CGYC 4CL7A 4ZMWA 1R33A 1RSFA 4O02A 1DUYB 4HJUA 2J6EA 4NPKA 5DUML 4WK4B 3P73A 2Y7QA 3D39D 4WAFA 4PJAB 3IDIB 3MRQA 1AE6H 1PZ3A 3IS1X 4FJ6A 3B6SA 3BHBB 1RUAL 1U8OB 4ODVH 1UJ3A 1ZHKB 1PL3A 1WE5A 3REWB 5E6RB 2VZ1A 4JW3A 3V0EA 5AL0A 1QLEL 5INCA 4XT1C 4MAUH 3BP5A 5SX5K 2C9AA 2VXQL 3R06B 3ZYOA 4NLHA 1QZ1A 3AXLB 3BPOC 1T4WA 3OHXC 2PXYC 3K8MA 1EO7A 4MJHA 1IC1A 3QGVA 3BJLA 4G6FD 3UYPB 4PRPD 1LEIA 1AH1A 1M2VB 2BRQA 2BVOB 3NFNB 3D51A 3ZL1A 2X09A 4Y4KD 2OQJB 5E00B 1BPVA 3P4MA 1QBML 2O26U 2WNWA 2Y22A 5FGCB 3D5OF 1L6XA 4E9WA 5F6IC 5LGKA 4P3WA 4D8PB 2XT1B 3BKYL 3FQRB 2LLNA 1BVKB 5HPMB 4NQCB 4P05A 3KWWA 4Z7UB 1BIIB 3LQAH 3B9KA 3A22A 2BP8B 4AIOA 3QORC 3Q8BA 4NZUH 4O9HH 2ED6A 2YWYA 5DUBA 3S36X 3DBSA 3SKNB 2AJXL 3RVXC 3FULA 3VD4A 4K3HA 1DQML 4OQTH 2VZ3A 4FJZA 4WWKD 3T3ME 4YLCA 3IDYB 3T4AA 1F11A 4LASH 3CQQA 1EO8L 2G4EA 1CD0A 3T5WA 3QQ4B 2Y1VA 3ISRA 4ONHA 5EEWA 1JPSL 2NSQA 3UDWC 3GT6A 4AH2A 1EFXD 5L7XL 3F6JA 4ODXA 4ODXB 3T0ED 1DQVA 1ZV9A 5IB1A 4P5TB 1JD7A 2ZOTA 1X4ZA 1Y6NR 5KN5A 3DV6A 4GMSL 5IVZB 4N2CA 1FORH 3GMMA 4X7SH 1RK0B 1TDQA 2XKNA 2CHDA 3KPRB 2MJWA 3QI9A 3SDXA 3HE7A 4NQVA 3N43B 4Z0BL 3UCRA 2FECI 4IRZH 2NTFB 3B9KB 2G75A 35C8L 5D93B 3OVUB 1TYRA 3E9UA 2WBJB 3L3KA 3RHWK 2F7QA 3WMSA 5FHBH 5C0NC 1QQDA 3LZOA 4Z5RB 4LOVA 3VH8G 3HJ0A 2VISA 4DK5A 5DRZA 1KIUB 2R1WB 1E9PA 4V2BA 5C97A 3ISWA 3SOBH 2QDVA 3Q6GH 3VM7A 2IADA 3K0WA 5GQBA 4BCZA 3BH8B 2NY7L 3VXSD 3WIHH 2FSEB 2Z93B 3RGVC 4APQA 2WOBA 5EOCJ 1KYFA 5DU7A 2IOMA 4DEPB 5AVUB 4Z7WE 1Q8MA 1VIWA 2P24A 4Y8DC 3RBGA 3SE8L 4GI8A 4F8OA 1H8LA 4O5LL 3KYNA 3OJMB 4Q56A 2BWIA 1NM9A 2UZXB 4G8FA 2F54B 3WY1A 4D7PA 4LIQH 2WHVA 2E8YA 3WD5L 1LO5A 3V0WH 2Q3AA 1WJ3A 4M5YL 4U1MB 3VCLA 2QL1A 1K4DB 2C3VB 2VLKA 2V9RA 1TZIA 1YMME 4MAZA 4HG4J 3NIGE 4QRPE 3VVWA 3G08B 3O3AB 3KH3A 1RUML 1S5IL 1ZIAA 3L5WB 1CIUA 2KZWA 5FCUL 1N6VA 2F53D 4DAGL 3WFEH 2E9BA 4JO3H 4CC4C 2OTUA 4AW7A 1A7OH 4UB0L 4UQ2B 4I4WB 1X9QA 3DRTB 4OM0H 2V2TA 1HVXA 1X9RA 2APBA 4ZOEA 1LILA 5JDSA 4MJ4A 1E0OB 4P2OC 1I75A 1NFDE 4KNUA 4L5FE 3DWTA 3IVKB 4KROB 4KNQA 3RP1A 3RWDA 4KWUA 3RFZA 1JNHA 1ZLWH 2PO6D 4OSUL 1SXCA 5T1DH 2NXZB 4Y16A 1FG2A 2IXQA 3IKCB 2M2DA 4NXSA 5T1LB 2CH8A 2Z0UA 1F6AA 2DL9A 4WVRA 4KK9D 1D5MB 4RDQF 1LWRA 5EZJB 4GSDL 1INEL 4RMSA 3V4UH 4XN9A 1R3IL 1J5OL 4Y5XA 4TNVF 2N7BA 1NMBL 5E2TH 1R34A 1ET7A 4QLWA 3HNTL 3VXSB 4N28A 5C0FB 2ITFA 4DK6A 2GJ6A 3US0A 1EFXA 1BJ1J 2WYIA 3E8UH 3TN0B 5IHZA 5L4MA 5FS5A 2EVGA 3SZKC 3MRCB 4ZFOL 2C9QA 3QI9D 4UZSA 3C12A 4WFHE 3KJ6L 3U7AA 1F3JB 2C34A 2DQIH 4YDLC 2IAMB 2CR3A 4PJ5D 1C1EL 2HT2D 2BZCA 1T1YA 4JB9L 5C0GA 3BMVA 3S3DB 1DDTA 1K8DB 2EE9A 3A67L 4DWHA 5B8CB 3CX2A 2H1XA 1YMHB 1I9JH 5ETUA 2A83B 3RDTB 1DQJB 2I07A 3LS5H 3P9MB 4YSSA 1QHOA 2RB8A 4JUTA 5ADPL 4PRNA 5E9DE 3UABA 3M88A 5TGBA 3L3GB 3IAQA 4Z3JA 4PRDA 4NFCA 4P23B 5EUOF 1HI6A 4A7QA 4MYWB 3OL2A 3IDJA 4WWKC 1VJSA 4NUJA 5HDQL 4H1LG 1KB5A 5J12B 3ILEA 1EXGA 3KL3A 4ZO9A 4TUOB 4RQQA 5I1KL 2DYPB 1F2XK 2W95A 1B3IA 4OJYA 1MCWW 3T0BA 1S7XA 2IAMC 1HK6A 5K9QG 3KPLA 3VGBA 4NN5C 3QP3A 1S9XB 3D18A 3VRLF 1V10A 4XNAA 2RIKA 4HXAH 3OPZL 1FC2D 3T2QA 5IFAL 2ADGA 2A6KB 5JIQA 3ARFD 1CICD 2L3BA 4PRBB 4I9XA 4XGZA 4A38A 3MOBL 3C60D 2YPLE 4HK0B 1I1FB 4J3OC 1A7BA 2GTQA 4RGNE 2A9CA 5AVYB 4LCCA 5D96B 3S3JA 1W9XA 3CH8A 1FYTE 2DS4A 4PB0H 1JTOA 5DJ6B 5HYQA 3EBHA 1KYOJ 1T80A 2NZ9C 2PP9A 1KJ3H 4OD2B 1KBVA 3GSWA 3CSPA 3D12B 4G83A 1MCDA 1AQMA 2R2EA 4FFZL 4GUPB 2PCYA 4FTVB 3DX2A 1WA2X 4HJJH 3HAEG 3WAJA 4AL8C 3AFLA 3LPGA 5C86A 4CW1B 5D72L 2VUOA 1EZVY 3GZPA 4PLKD 3U9PL 1XGUA 4DVRH 5KSAB 4MNGE 5KVDE 4ZUSA 5IQNA 2FLBT 4KTDH 5I2IA 4AEHL 4YE4L 2IALA 4FDWA 5T1KD 2K6ZA 2NX5E 4GP4B 1YDPB 3HRPA 4R26H 3C08L 2B5IB 4G7SB 5MERB 4ZUVA 3DHJA 1RI8A 5JW3L 5F3FA 2R2HB 5AL8A 3FFCD 3PJLA 2XU9A 2Q6WB 1DVSA 4YHKH 3WN6A 1M9WA 3V4PH 3D9AH 1BLNA 5I82A 2IANE 1MHCB 2QELA 3ZRCC 3NZUA 4P4KD 4RAVA 2OYKA 1AG0A 1NFAA 1ZRUA 2Y7NA 3QQ3A 2JKLA 3SN6N 2X4RB 4HEPA 2WMPA 3F04A 2W0LA 4TF4A 1IMHC 2EQDA 3X14A 2FTAA 3N9GH 5ECJE 5KUKA 3MX0A 1RJLA 3S3CB 3MYZA 3VMNA 3BGMB 3UYRL 1CGUA 4LCCB 1ZLSH 1LP9B 3L7FB 2CRYA 3ARVA 5HJ3A 4G9DA 4DGVL 1T83A 3THMH 3S34L 1L9TA 1TJIL 1NBZA 5F7KC 4BD4A 1FFOB 1NFDF 3X1GA 3LHAA 4NC2B 3FCTB 2AEQL 3P30L 3ABZA 5HI5D 5I19H 5C0BE 4QNPF 3NACH 2Z3FA 1YEFL 4LHUG 3DROB 2XQ0A 4J3VA 3EG9B 5F7YC 3SE4C 1A4KA 1T5KA 2DYPA 4RGOL 5DJYA 2A6IB 1WCBA 1WIOA 4LESA 2DBLL 2P8PA 1R5IA 1N10A 2BSTB 4LDLB 3L4YA 4JFXB 1F8TH 5DD1L 4MKTA 3GC3A 3L13A 1CXLA 4O2FB 1XQ4A 4MHHG 3K72B 1OK0A 2EICA 2H0FA 4NFBA 4ZW7A 4TYUA 4FFVD 4Z7OE 1FWXA 2ICWA 3DYMA 3BVNA 3OB8A 4O4YH 5DZLA 1FE8L 3M45A 1X5FA 2JB6B 1OZTG 1AR1D 1AR1C 5GZNC 2LU7A 4HKZA 5I1GH 1WYJA 3KDMB 1VKXA 3MV9E 3CZLA 2J55A 3QDGE 4WI4A 5E24E 2FWUA 3F12A 5SX4I 2EIZB 3FO1A 1P2CB 1KLFB 5SWSE 3SDDB 4YHZL 3DURB 5FPIA 1CLOH 5F1IA 5GS3A 5I8EB 4YDIL 3L9EA 1DQLH 3D2TA 4RMBA 1J8HB 2YEZA 5IBUG 3VQ2C 3SODB 5I74C 4Y7MA 3SDDD 3WSQL 2NPLX 3CUPB 3GSRB 4DKFL 4WHTA 4TS6A 5IHZB 5KJRL 3ARQA 4LXFA 4UYPA 3TFKC 2FIRT 2V2WB 4TVPL 3FT0A 1NIBA 4OCXH 5AYUH 1RHHB 1A6VH 4F33A 2WB7A 1KENL 5C0FA 4RWYH 3TIDB 1NBVH 5JHLL 2OCCB 1LM8V 2XX0A 5E2WH 3U7WL 3V6BR 4CA4A 4ETQB 5KBDA 3I9GL 1KNOA 5F9OH 4D9LL 5DC4B 3HHMA 3OKNA 4XMPH 4UQ3A 1HT6A 3PXJA 3JV0A 4R7VA 1KJ2A 1AIFB 3SE6A 3BEWA 3GSUA 4XPTH 5I16A 4I9WE 3DC0A 3EH1A 3SOTA 4X9FA 5D2NC 1T0OA 2C3XA 2FNWA 2VXQH 4JO4L 2E75C 2V17L 5ANMB 4GW5A 1RLBA 3C2AL 2EINB 3L4CA 2OJZL 2WUCH 2NY1C 3K2MC 4HS3B 3RWFA 4ENZA 3V6OE 3QW9A 3MCLH 4N2DA 4BUQA 2V9QA 3RURA 1N3NA 4LCUA 3NFPA 3T2NL 3HBPA 1JGUH 2FIKB 3H85A 5EC1A 4CDGC 3RWIB 3CLFL 3ZDYF 4GIAA 3V95A 5KZCB 2ZCHH 4O58H 2B1HL 2WZAA 1I9RL 4NO0D 3T6ZA 4YDJA 5KEZA 3JWDC 1SLUA 4OH2A 1JTPA 4Z6AT 4U31A 5I75B 1PDKB 3CVHH 5E95B 4HIIB 5AVXB 5JHDB 2XPYA 3I84A 1HI6B 3TCTA 4IDLA 1WA0X 4ABUA 5HVHB 1HKLH 2P26A 1MFUA 4ABQA 4YMPA 1CDYA 3QARA 1FZJB 1LO5B 4HIHA 4W9HC 3X3GL 3TBWB 3ATDA 4J6RH 5E8EB 1YMHA 2QQKH 3ARED 3FPYA 4UV7L 4LASL 5FKPA 4AEFA 2VCOA 3VMPA 3FZUC 4PS4H 2PLTA 1FF5A 2BMKA 5E0QA 2GT9A 4PJ7B 1HX0A 4PY8I 2F54D 1G9NC 4PCKA 1FO0H 3PIQA 3QC6X 1B6UA 3TBVB 3AMKA 4O2CA 1N7MH 4P9HH 4UT9H 4QF1B 1B4RA 2J1YA 2XFXB 1QFPA 4JJ5B 2ISDA 4X0KA 4H20H 1U3ZA 1WBXA 1JV2A 4MASA 4Y19B 4Z18A 4NQEE 5JR1L 1RLWA 4FA8A 4DKEH 1UB5B 1O7DC 3EKCA 3W0WA 3W1ZA 4AZ8B 2Z35B 1IGCH 3FHQA 5KVGE 1JIBA 1U6AH 1VPOL 1CPUA 2O6CA 2RAMA 4DFIA 4LF3A 1IE4A 5BZXA 2JNZA 1T1ZB 5JDJA 2XC8A 1CK0H 3DIFB 2YD1A 4GSRA 5DR5L 4PYGA 3FU0A 2WTOA 3AG1B 3Q6GL 3ZQWA 3OZ9L 4FI7A 5CAYB 3H54A 1QEXA 3UACA 4ZZFA 3L3OC 3SKMA 3U6RA 4EDWH 5IVXE 5T1LD 6TAAA 3JUZA 4OT1L 1MFVA 4H44C 3QHTC 1DSYA 2GJPA 3UTQB 2OAAA 3EYSH 3NIDF 4FN0A 1CG9A 4JANA 5AUMB 3SE8H 3HI1A 4EI0A 3QFDB 4YQXH 5JMOC 1OCRB 1RZIB 2AEWA 2W60B 1S3KH 3ZKNC 2HJFA 2WWMC 2AEPH 1NGXB 5CIPA 2Z92A 4OZFB 4LLUA 5HVFB 4S0HA 1OAYL 1HINL 1IC4H 3IETA 4R0LA 1T5WB 4DO6A 2VLRA 1KB5H 3CIQA 1FL6B 3IJYB 3ROOB 4KQ3H 3BD4A 1A4BA 2EUWA 5IV2B 3D85A 1FNAA 3C8KB 4EIGB 4U1MA 4DVBA 3MA7A 1KGCE 5GGVL 1IM3A 1C12B 4JDTL 4OZ4A 4R3SB 3DETD 1I7TA 4MDJB 3GFUA 1T0MA 4C83B 4QR7A 2A6DB 2GPZA 5IB2A 2J72A 5BO1L 1OK8A 5E2JA 3LQAC 3TZVD 3GMNB 1EGJA 3LZQA 3T65B 5BW7A 2MPVA 1MNUL 3Q2CA 5GISH 3FQ2A 4URTB 1OGTA 1SLXA 2AAVA 1T0MB 4MJIA 2OX5A 1ZE3H 2X0WA 1LEGB 4ZTEA 3VFUA 1QSZA 3MV11 4S1QH 2PR4L 5KOVC 3UZEC 3GBLA 5GGUB 3G5ZB 3ENEA 1IGYB 5L2KD 1W0WA 4J3WA 1HSBA 1YLBB 4Q14A 2A4EA 4HS6B 4XO5A 5T3ZH 1DL7H 3S6CA 3U46B 1UKSA 1MPAH 3KHOA 1LK2B 3W0WE 4OZFA 3ESPA 2C4FT 1AY1L 3H6AA 4LCWD 5JOFB 4KZDH 2NTFA 5BRQA 1JE6A 4KROD 5IW1A 1J1XL 1ILSA 2Y7LA 3CH1B 4ZJ9A 1T1WA 4J3OH 1AQKL 1H6FA 5JIMA 4IOSA 2DPKA 4UNVA 5HHOB 1OM3L 1BZEA 1X5MA 1TZ8A 3MV7E 2E7MA 4OD1L 5E9AA 12E8H 3LKQA 5GZOC 1ZPUA 4HCFA 4PJEF 4BQ8A 4LOEA 3PJSA 1UYWH 1MN4A 2EIKB 1PX3A 2R0ZL 5C09E 3N04A 2NZ1A 2DQIL 1DBKL 1H8NA 1SJXA 4G71B 2ZCKH 3EJSA 3FQNA 2H47C 3II1A 1BJMA 2NY6C 3W81A 2VGLM 1PNCA 3A67H 3HI6L 4ODTL 4NZ8A 1PLGL 1SYSA 4JO1L 4L4TA 1XTLA 5A16B 1T22B 1SEBA 5E1AB 3GSQB 4ZSOB 3NQIA 4HWBA 1X5JA 2NNAB 1Q9WA 3S88L 1PZSA 1ZT4A 1HH9B 2Y36H 3L2NA 4MA8L 1Y0LB 2HT3C 4M3HA 1JTTA 2VR7A 5E7FA 4NJ9H 4XH2B 2FLMA 4IJ3B 2IOOA 2EZ0D 2RQ8A 4PRID 3MJ8A 5EZLA 4ELDA 5B38A 3B8SA 2O6DA 3D4YA 4U4IA 4AVHA 3KEDA 1JWMA 4MTMA 4BRVA 1EAOA 2HFFA 3F58H 3M8OH 4WTZA 4HCGA 3T1FA 5I1KH 5D7JA 1JGDB 1FUNA 4UI2A 3STZB 2DOCA 5JXAL 3LPWA 4BZ2L 1M7IA 2NNXA 4IS6B 3O3BB 3HMXH 4FHJA 2JKJA 4ZOBA 3Q9QA 2Y06H 4Z7AA 1NEZB 2QQQA 3MXVH 5JYLA 1IGFL 2JELL 1IC5L 1BQHB 1JZ3A 1KCRH 3BDYL 4MXWL 4W6WB 4RMQA 5FHAL 1Q90A 1V27A 1HXMB 4K23H 1WZ1H 3OPUA 1NANH 5C0ND 3UC0H 4K07A 4QHNA 3GJEA 1NQBA 1F90H 4OLYL 2WAQA 3B3BA 3WEXA 1DFBL 2DQDL 4QKXB 4F57H 1TTRA 4B95C 1E5UI 5DVPA 3II2A 2R29A 3B9KD 2JV6A 4FFZH 2G9KA 2R23B 2ZXQA 1YEEH 1BSIA 5DZAA 3CZJA 2UWEA 3NSDA 4PIBA 3ZLQC 2H0EA 2MSPA 4MDIB 3APDA 4JZNB 1N8ZB 4R8WL 1AZNA 3LEVH 5GJSH 3CFCL 3BUYA 5GRUL 3C5JA 4G5ZL 1KB9K 4KMTL 2NY0B 5HJGA 4AM0Q 3VDAA 3Q7JA 1BZ7A 2QQNL 2XIBA 4HUMB 4K94C 2R29H 3QZWB 3B2PA 2KQMA 4P2OD 3ZDXB 3AGWA 1ZLDA 2A9NH 1DBBL 3T3PB 4JCLA 4WLCA 3HAEA 2A9ML 1ED3B 1N8OE 1NSNL 5F44A 5IWLC 4FLSA 2BSEA 2Y07H 5JIIA 3B37A 3A5VA 4WQOA 2A0LD 3UYRH 1A7PL 4DT2A 3QUGA 4CC1A 2GKIA 3FFDA 2EXWD 1MHEB 5FYKE 1G4RA 4W9JC 3RFZC 4JRXA 2PXYB 1I8IB 3QDMD 3QNXB 4PG9B 2EE0A 2BCKB 3LIZH 1KV7A 5DK2A 4F20A 1RL1A 3RYMA 3S8FB 2GIMA 3PWVB 1BV8A 1TTFA 4Y7OC 5DJDB 4ORZC 3MA7B 4LP4A 5JIDA 1UJ3C 3TVMB 4NN7B 1SXBA 1G7LA 2FJGB 3I9IA 3T6WA 1M3IA 2HG5B 4N0RA 1YQVH 4NUQA 1UA6H 4DF9A 1OXYA 3HFMH 3UIZA 4APXA 3VNYA 2Z92B 4POUB 1VRSA 3NIFB 4IRZA 1QRNE 4JKLA 4X6BA 2HJFB 4XC1H 4MRCA 3WHE1 4GSUA 4PRIA 1L9QA 3MBWB 2KDGA 1GS7A 3RIAF 3DX8B 1A02N 2KPWA 4KJWD 1BVZA 1NCBH 3OKEB 3NAAH 3HS9A 1K5WA 4F15B 3BVNB 4POZC 2QADB 3STLB 2EUVA 2GTWB 4NKMB 5I74B 2W0FB 5I5RA 2Y7OA 5CSGA 3G6DL 3BPNB 3MBEB 3MRNA 1RKRA 2FJSA 4M8VA 3PP3H 1L0QA 1CLOL 3QXTA 2CWRA 4GXFA 4P2QD 1G4MA 1A4KB 1ZK5A 1LE9B 3VFMB 1ROWA 2P8MA 3ARFC 1PGRB 5CN3A 5FEBA 4KDTC 2Y7SA 4ATWA 1X9UA 1Y6MR 2WSDA 3BKYH 3FF8A 4MDIA 3GBEA 1UB5A 2K7QA 1KENH 5JHLH 3QA3B 1AD9A 4ODWA 3TM6A 1WUZA 4NNPH 3UMTA 1FNSH 3RHWF 2YUVA 5BCAA 1YEGL 3WFBL 4FQCL 2BXYA 4PJAE 5EO9A 3AAZA 3LN4A 1ZS8B 1WLHA 3VI3A 4HHGA 1OEZW 2ERJC 4XZUB 2ADJB 4HGWB 3BPCB 4OVUA 1LO2L 4YSUA 1ZE3C 2DAVA 1QFUH 1TETL 4WEMB 2X12A 3ZUCA 4MAYC 1RY7B 2BRRH 4MNHB 3RNQB 5DHMC 3HR6A 4YNYA 5G4OA 3SPVA 4WV1A 4FNLH 1EJ6A 2WXFA 3I6KB 1U8KB 4HQQL 4LL4A 1OP5H 3RVVD 3US9A 3QS2A 4NJAH 1MCBA 4MRBA 4PLJD 5BW7C 3EFFA 3MACH 1MDTA 3NABL 4JFYB 5LNEA 2H1LM 3OGCB 2NY4B 5HYSG 3CSYB 2EEBA 2BVUA 1YO4A 5I2IB 3VD0A 5D7JB 3X17A 1HHKA 1XGYL 3AU0A 4KOCA 5IEKB 3FH8A 2J6EH 4AX3A 1R19A 1DEDA 5KVGL 4M29A 1J5CA 1T66D 2DQ6A 4V1DA 1VGKA 3AQDA 4X83A 4WW2B 2ZSWB 1AKJD 5LWYH 4LBEB 4AV5A 4P4RB 3O2WH 5EIIG 4JFSA 5BOJA 3JZ7A 5DHVA 2L04A 4CVZB 1QNIA 4MJ5A 1VFMA 4RCAA 4YPGB 3TWYA 1RSYA 4U7SA 3BP7A 1J9TA 1YEKH 4ZUTB 3RPKA 4HGMA 5DVLA 1SEBB 4QRSA 4Y5VC 2J12B 2RFXB 3I6GA 5JQ6H 3BD3A 3EYVB 1QSFE 4JPVL 4M6AA 4AYEC 1OY3B 3DNKA 2NTSP 3QEQE 3BESR 4WGKA 4JMNA 4KHTL 2NCEA 1P69B 2VH5L 3EJYC 3F83A 4J3BA 4OCNC 1QI3A 3KPLB 2HFGH 2UVEA 1TZOA 4FNRA 4PJBE 1A7QH 2YA2A 3HS0A 4XVTL 3UJIL 2YQGA 2O5YH 5HI3C 1ZY9A 3ZZLA 3MAWA 4XP5L 5A43C 5FYJH 2Y7MA 2YJQA 1I4FA 4EI6A 5IOPA 3Q1SH 1IAOA 4WHTB 4NQDB 1VPOH 2C7FA 1OIOA 4X8XA 3WJLA 4ICWA 3GKWH 3FYEB 3RDTA 1AZUA 1QR1B 4QRQA 1GC1H 5DR5H 3JQOB 5KSVB 5CEYA 3QJRB 4JN2A 4AUYA 3WKNA 3IJHA 1UM5H 2ZICA 4PUBL 1DLHA 4EN3B 2PUQT 2HCZX 1OAQL 2IPKA 3ZZQA 4HHAB 1ZTXH 3KVPA 4LLVB 2GBAA 3AWGA 4X8JB 5I0DA 2GITA 4NKIH 3L3IB 1GGIH 2IBZY 1LO4H 1QKZL 1U2YA 3NCYP 2X4QB 1SLWA 4XNXL 2QKSA 1F1DA 2YAOA 2E7LA 2FQEA 3IT8D 4IKJA 5FM8A 3JWOH 2HT2C 1L9NA 2A74A 3HMWH 5CLXA 2B0SL 3MRGA 1P4IL 4LAQH 2VUKA 1OOWA 2YBRA 1R3HB 5E6IA 3NG5A 2YFOA 2CO3A 1RUAH 4JJOA 1R3KB 5DMYA 5J1AB 3E3QC 5E08L 4NHCL 4NPYA 2CIKB 2PYFB 3DO4A 1U8PB 4I85A 4NQQA 2WC7A 3RFZB 4YHOL 1Z5YD 4Q58C 4MQSB 3RWGA 2FYYA 5KS9E 4NT6B 1C5DA 3MBXL 3BZFB 3C09C 1NFDB 3X12B 2H3NA 3RTQD 4BDVA 5BUGA 5I73B 4CRPA 4DZ8B 3TF4A 3IF1B 2VDNB 3SBRA 4KRPC 1OAKL 3LRGA 3PWJA 4MCZA 4OIIH 4X8GA 4AENB 1TEGA 1H3XA 2QR0B 1CFSB 4JN1L 1M3JA 5IMKA 2W0KA 1PY4A 1X5XA 1XF4B 1T1ZA 3D2UB 4AK2A 4I3SL 2FATH 4U1SB 4WFED 1ZOXA 4XAKE 4F2ME 5CLTA 2RA1A 5FK9B 5IM7B 3B5TA 3TBTA 5BRZD 1GYAA 1YDPA 1P7BA 3ELAT 1AY1H 2VDLB 4QO1A 2VDPH 1DQIA 1NEUA 1YN6A 2Q86A 3AREC 1ACXA 4R4BB 4APQC 4R7XA 5F9JA 1QPKA 3WFDH 3P2DA 4Y2OB 3AUWB 2DQCH 5H35A 2PPCA 2Y0SA 4CGTA 1KWGA 2AABH 4R2GB 3KPRD 5CF3A 3OPZH 5IFAH 3SJVA 3QYMA 4DO4A 5KVMC 1WFJA 1HKFA 5EUKB 2R2EB 2VN3A 3QCVL 3TA3D 3MYJB 3WTSA 2BMKB 1RK7A 4GMSH 3VWKD 4J7RA 1GZQA 4D0DB 3BVDB 1FZOA 4F37F 1CD8A 1U58B 2F58L 1KJ3L 1L3WA 1D6VL 4EN2A 4IEFA 1UWGH 1XX9C 4ISVA 5T5FH 1A22B 1JK9B 4TLTA 4G8GE 2H6OA 3H9HB 3ZE0F 5GIRA 2VMCA 5C7ZA 3IDUA 4OIBA 1KIRA 3WTYA 3RU8H 2C7UB 5D1QA 3KL5A 4LPCA 1FYHB 3ATFA 5D7LE 3IDYC 2DLHA 4TUOA 3QRGH 2B15A 2BVQA 4L8BA 2EYTB 8FABB 1WVZA 3CGTA 3DX7B 2FJFB 5DT1H 3UBXG 4AQ8C 5JPNC 5FO8B 1NLDH 5ERWB 2C5DC 4TPRL 3CHQA 4DZ8A 1Y07A 4YOKA 4X6DF 1JZDC 4A7VA 2WSKA 1T1XB 3D9AL 2J1XA 3FUJA 2FYYB 1IC5H 4F7PB 3GSNA 4NXKA 3BDYH 1LNUB 3Q13A 4PRIB 4HW6A 1OAUH 1JI1A 3T0XA 5F7MC 5D7KD 1OF0A 3H9ZA 3B9KC 1F90L 2UUDK 3QUMH 4D0BA 3AQZA 3HC3H 4RZCA 4NPJA 1URZA 3F05A 4M6OH 3GHBL 5E2VH 1U93B 5EOCL 5DLLA 3GMOA 2BHZA 2FZ3A 4H88H 5JLZA 1DVUA 5DJZB 2V4LA 3MI6A 3UADA 2XWBB 1U30A 1S78D 3FMGL 5AW4B 4HK3J 2EVJA 5HI5C 2PETA 4WV1C 1CVRA 4PLNC 1JPTL 3O9WC 1HE7A 2WY3B 1S9VB 1Q38A 2WQVA 1T7ZA 5SWQB 1TUPA 5GS2H 4NRXA 2BC4A 3GMLA 1XCXA 4LLVA 3MRKB 2DQFA 1BWMA 2XVGA 3MQIA 4E9LA 2YPVL 3FO1B 4UCFA 3UJTL 4XOAA 2ICEC 5JW4M 5K39B 5KSVA 4LLMB 4JM2F 1JF1A 5AVSB 3DYOA 3SDXF 1NDGB 3DO7B 5A2KH 2VDQH 4NBXB 2XZQL 1A1OB 4JM2D 3KPOA 5DD3L 4KZ0A 5C8JA 2OMTB 2IBZX 2Z1PA 1YJDC 4PJ9C 1A3RL 1RV6X 4BRJA 5AAWC 2WTRA 4K3JH 4I77H 1G9NL 2OTUB 2XTJE 4KI5C 3MNZB 1NUFA 5I71B 3V0VB 2QDWA 3E8UL 3ALWA 1MCOH 4AIZA 1QWUA 1XMWA 4AG4H 5F88B 3VXUE 1U8CA 4DETA 4XNMB 1OT4A 4Y4HA 5FB8B 4H4NA 2YD5A 3EG9A 3JV6A 4JRLA 4RGND 5ACLA 5HTSA 3NCCB 1NCAL 2ZOKB 1YA5A 3BW9A 2VO5A 2DQTL 2E27H 1UZ6E 3D69A 5DC9B 5F1NB 4QY8B 4MB1A 4QHKI 5IBTL 4ZSOE 3T04D 5K9OA 1A6PA 4Y4KC 3OHXA 1E67A 4DEPC 3STBA 3IE4A 1JNLL 2MHAB 3RVUD 1EJOH 2P80D 1P1ZA 3B56A 2AJSL 1I9JL 2AS5M 4BFIA 5FWRA 1SOQA 4XRCA 1OD7A 5FAAA 4M5SA 4QJ3B 2XYCA 1MJ8H 3MYJA 2G30A 1JYVA 4M7ZC 2FEDC 2B14A 2CJ3A 4QGTA 5C1MB 4TQEL 3WKQA 2YJLA 3QJXA 2X5PA 2ENSA 3EOTH 1HWHB 4XMTA 1CR9L 1RUPH 3MOAL 5ICXA 4YXHL 1U4EA 1XF2A 1I1CA 2ZUYA 3G5YA 1FH5H 5D93C 3VUAA 3A21A 1HAWA 4MSWB 4Z7WB 2PW2B 4ZNEE 4P2RE 4KRPD 1QPXA 2I5YH 3PE9A 3WKPA 5DO8A 3DX1A 3IDXL 1KN4L 3NCWA 4OZHA 4P3CH 3VI4A 2B08A 5IM7A 2JJVA 4WDIB 1J1OL 4OVVA 2NY2B 2A74C 2LW3A 3AT8A 5TF1L 3NCMA 1UENA 1U3HB 5DJXB 4TLSA 3WLWC 3LRHA 3CCHB 3EO1B 3O4LA 2DF3A 4M62L 1A6ZA 4YBQC 2ADJA 4HGWA 1IBZA 3DXAA 3QHZL 1M05B 2R2BA 2VYRE 3FQNB 1JI2A 3SDAA 2AZUA 2Y5QA 2L8AA 3EYFA 1A14H 2K4WA 4M7ZB 3SDYL 2ODIA 2VSDA 4X6DA 2BIHA 2VIRA 4G8IA 3VMOA 3DBXB 4HV8B 3JVFC 1TTBA 1P5VA 2PCXA 3R0NA 1H6TA 1XL6A 3T2PA 4OU3A 2YGQA 5D4QA 3EJZD 4QOKE 1T1WB 2I60L 4HT1H 4IOSD 1F41A 4F7TB 2K1MA 3KWXA 5AW1B 5MENA 1P6AB 2ZJSH 3VWJA 2GJZB 1UG9A 1S7WB 3ZE1B 4E5XA 1GZHA 1TVDA 1M53A 4R97C 5FUZH 3SQBA 2CKNA 5IQ9B 5GGRY 3DECA 4DP6X 1A9VA 3M6DA 3U79A 1UURA 4NUJB 3VI3E 2R8SL 1X3DA 2X9YA 5SWZB 4AW4A 1OTSC 4XX5A 1ULVA 4DNLA 2W65A 4M48H 1I82A 3V0JA 1IAIM 5DEZA 1MF2H 4GXUM 2KPNA 4FA7B 5M7QA 4JGJA 3BGFC 4WWKA 4GBXD 3S3SA 3GRBA 4WI6A 1WFTA 3A6BH 3AUVA 3FTGA 4JFPB 4X6CE 4QRTB 3V4VA 1KZYA 4WFHD 3KLHC 1PX8A 2KLTA 3D50A 1NCJA 2AEQH 1F1GA 3SCMC 1FPTH 3T0EA 2AQ3A 4JR9L 5C0AE 2AJVH 3CFBA 4N0YH 3BSHA 1FQ9C 3ZPDA 1RJZB 3VYPA 4ZFFA 3M1BA 4YQXL 3E1ZA 1P4BL 4LLDB 4HFUL 3MRCA 2NXZC 4FEIA 4PS7A 3SZ6A 3VD7A 1DBML 5DYOB 1AQDB 4YLQT 5FYLL 3K81A 5ENWA 1E7VA 4AIXA 2PO6C 5E9DB 1KWKA 3U2SB 2QGEA 1KSRA 1J05B 4IOFD 4LU5L 4V1DD 1EEYA 3A3YB 2HFTA 4X4XB 3EUDA 3FW6A 4JRWA 3MODL 5F9WC 1SEQH 5D1QC 2ED7A 3E1F1 4X80L 1N59A 1F6AB 3UP1A 1XR9B 2BNRA 4HWBH 2NZIA 3GIZL 5C70A 1DJIA 1BJ8A 4DN4L 1NZRA 1RAMA 1IM9B 2VN5A 4I5BB 4APQD 3LDBC 4LFHD 4LK4A 4E5XG 4JM4L 4D9QE 3U2JA 2WXQA 5LHDA 3LKSA 3IFLH 3QUYA 4NIYE 4NKIL 2BFVL 4ZFOA 1ZK9A 1A4JB 1PKQE 2WIIB 1UA3A 3LKOB 3O4LD 1A7RL 1MW3A 4UT7L 3PAUA 3F7VA 2WLMA 5T3ZE 2EE2A 2BW5A 5D6CB 4R90H 1Q72H 2PWEA 4XPHH 3G08A 3I75B 3O3AA 3WYRA 5F9OL 5ENWB 1OE2A 1JCVA 2ZE0A 4IMKC 3L1FA 3O6MH 5B39B 3MJ9L 4QF1A 2X88A 1CIDA 1AQKH 1GYUA 1EO8H 5CN2A 1YEDA 1U95A 4AI7A 3DTDA 3GGWA 4NP9A 5E56A 5LN4A 1CLVA 3O2DA 2NY2C 3T3MF 2Y2TA 3LAFA 4GW4A 4LOUD 3SEPA 4YHOH 3WY4A 3MZTA 1AHKA 2YEQA 2MTAA 4J3TA 5FWQA 2OR9H 4OI7A 2OJZH 4WGVB 3QWRD 2ATPB 3FTGB 2WWNA 2AQTA 5CEXB 1ZANL 3FUIA 2YGVA 1YEDB 1JZFA 3NIDE 1U2CA 1WGOA 3QUXB 4BH8A 1JGIA 2AW2A 2ZIDA 4PY7B 1ZXKA 1AMXA 2NY5C 1HL8A 2GBTA 1GGUA 3CLFH 4LCYA 1HCVA 4AE0A 2WLIA 1FA4A 2X89A 1UH4A 2RBLA 5BUPA 5I8OL 1JL8A 2R9HC 2G3MA 4YO0B 5B3JE 4HOZA 2Y6SD 1H3UA 3FDWA 4NUMA 3ARBC 3AU1B 1CL7H 2FO4B 3A6OA 3ZSSA 5FW6A 3AROA 1J0JA 2PTTB 1NCTA 2VERN 4P48A 3ATEA 1VFAA 4MJ6B 4HBCH 4HF5L 4OF7A 1CVSC 1JWUA 3LRKA 1O6SB 3ZDYB 2G75B 4DGIH 4FCHA 1CGSH 2Z1KA 1NH6A 1AXTH 5CBAA 3H7BB 3VXMB 1SY6H 4R7DB 3CE1A 4KFZC 4MMZB 2ROXA 1AFVH 4PJDA 2X1PA 3U9UA 5DEJA 2X40A 2Y06L 4G8IB 4WHCA 3KMDA 5CZRA 2VDKH 4PRHE 2FX8L 1OTTD 3GYRA 5C3LD 1X6LA 4DSYA 1K2DB 3OJVC 4KK5D 4LIQL 3RI5F 3MRMB 3B2XA 1FL5B 5I71C 1WAAE 2DQDH 1JG9A 3KPQA 3TNMA 1S46A 1AP2A 3K6NA 2IH9A 4PBWD 3UAFA 1UKTA 2VN4A 2AQ1A 2Z7UA 3MFFA 1OCCB 4UQDA 3TONA 1P5UC 2VR3A 4WDIA 5FFGA 1IE5A 2V9UA 1X5YA 2LTQB 5DLMH 3MGOA 2A4ZA 1HHIA 2VZSA 3LEYL 4HS6A 3VQLA 1C16B 5IUSA 1S5IH 3OX8A 4WHDA 4PJCF 5EUOE 4HH9B 1BVKA 3FQRA 2B8OT 3AY4A 5SWSB 3TVMA 3V5DB 5ICXB 1N18A 1UXLA 4MMYA 3TBSB 1VZGA 4X4ZA 4EUPA 1GGBH 1IC7H 5DK2B 4KI5D 4OZIB 2EIZA 3SO3C 3ZDWA 4DP7X 5HXMA 3KW7A 1MCPH 4ZPTB 4GIPD 1Q9KA 3WNIA 3WUWG 3DX0A 1FFPB 2LFEA 1BFSA 1DBBH 4N0UB 3UAJA 3H8NA 4Z9KB 3BKJH 3VTTA 1WBZB 1NCCL 2RMNA 3GSNH 1LYQA 2LGNA 4HCIA 1S3KL 3CMGA 2ICWB 3C5XA 4NM8L 2AERT 2EXTA 4GSDH 4ZFZA 4L3FA 1D6EB 4Z0XB 4BFOA 2YZ1A 5T3XL 3IGKA 1KCLA 2LU5A 2CAKA 2HLAA 1O5DT 5EN2B 1C5BH 3UBXA 2XXGA 3BWZA 2E7LC 4G8EB 1BQRA 1P9MC 1PNDA 3N06B 3PHSA 4PP2B 1TYJA 2NUTB 2J3SA 3P9LB 2OLDA 3ILPA 1X5AA 1MREH 3MROA 4X4YA 4OB5H 2V2XA 4XBEL 3K71A 2IMNA 3JZYA 3HI1B 4IMLA 4G8GA 3WNPA 5EEYA 3EHBB 4ZT1A 5I1EL 4J3OG 2ZWYA 4UTCA 4Z95H 3T0AA 2OMTA 1I9IL 1UQSA 2XPZA 4GAFB 5E99L 4GKNA 5DJ8B 5IHUL 1CC3A 4ZW3A 3X14B 1B4TA 1UTDA 2ZF9A 3QE5A 3ARTA 1EUUA 2VLRE 4UIMB 3V9CA 1UZGA 1OPGL 3BKCH 3GS7A 1E8ZA 3QG6B 1NGZA 4ONGH 2XZQH 3G6JF 4OJEH 4YXLH 4ZMLA 2WJ7A 5DD3H 1CLYL 4MKMA 5TDNA 4CN1A 1N67A 1TR7A 2J7LA 3HPLA 4BGDA 5C0AA 3ECBA 2WCSA 4NP4L 2ZX7A 1BF5A 3L3OA 1DBAL 1TLKA 3L2LA 3MLXL 2ADFL 4ZTOH 5L4IA 3T71A 5B4MC 4Y2DA 5F6HJ 1TYEB 2ADIB 2Q20A 3LDBB 1KXQA 4N0FA 3O4OB 3AG2B 4LSPH 5EWIL 1VESA 2VW7A 2QFPA 2F5BL 1E6JL 2ALAA 2ESVD 4JY4A 1E27A 3CV5A 4L05A 2AQSA 2XKUA 4Z7NF 5KBNC 3PFUA 1HSAB 1H5BC 1JPGA 5IEHB 1KZQA 3B7YA 1KLGA 3HN5A 4JFFB 4PWHA 4W70A 3NESA 5IBTH 2ZCKL 4Q6IC 1FNSL 3ABMB 4X99A 1T2JA 2VXTH 3ATBA 2EDQA 4N2BA 3TTYA 3W39A 1G87A 4BWUA 1XXFC 2AF2A 3CFQA 1EMTL 4RRPG 3KWUA 5CMAA 3QXDB 2MHAA 1ASQA 2A6KA 1LO2H 4I0CC 1J88A 4X4KA 5D7LB 2BRRL 1UGKA 2OTWB 1ZEAL 3AC0A 3T6XA 4PTTB 4NO0A 4TQEH 1KT2B 1ZHNB 5F7EH 1CI3M 1BXVA 5T3XD 4YDKH 4ALAL 2JXMB 3MTRA 3ZTJH 5LUMA 1D3CA 5C7XL 3US1A 1ZHLB 5EA0H 5FYLD 1CGVA 3VFOB 2DWXA 2ZSVA 1RUPL 5ISZA 2DQGL 3FO9A 5D1ZA 1E9OA 4IGBA 5CSZA 2UUDH 1FRGL 3HN8A 4AQ1B 4Z7QE 2IQ9H 2JCCF 1HS6A 1OP3H 2KZKA 3FB7A 1ZVSB 5JOEA 3DJ9A 2A73A 3P9MA 4K23L 1E5YA 3T8VA 3UC0L 4W6YB 4UTBA 5I16B 1AAJA 3BEWB 2CGYA 3GSUB 4HIEB 1PQZB 4MZRA 1SRDA 2OX5B 5HD8D 1T1YB 1WAEA 2DM3A 4XN2A 1QOKA 2EKSB 4BSJA 2VSKB 4B96A 4Q8BA 2WQ8A 5J6GB 2QMJA 5HYEA 1RIHH 1AOZA 3BWAB 2HYMA 3KL0A 4JG0H 1BQ5A 1L9MA 3QO0A 3R0MA 2GBUA 4RX4D 3MJ9A 4R5XA 5BRPA 5ICZA 2WZ0A 2VR6A 1DDHA 3LN9A 4GLRI 1HSAA 5A6IA 3LNHA 4QHPA 4C83A 5DFTA 3D09A 1IBFA 5KVEE 5L9DL 5FYLE 4N68A 3GRWL 5DD1H 5DD6B 2BHUA 4FHKA 2BNRE 3AXHA 1RZGA 3D85B 4XP5H 5K9JL 1W80A 5FYJL 1DVFD 4YLBA 3F65A 1R5VB 3F7PC 1MVYA 3QHFL 4GAJH 5KSAD 3EYOB 3K4AA 3ULAB 1DUZB 3OC5A 2FD6H 3HZ3A 2CE6A 2G3ZA 1Z3GL 3HG3A 4XNQB 3BO8B 3PWJB 5HHNB 1QLEB 2NRDA 1IZKA 4QRPA 5EPMA 4F7PA 5FFLA 5IHBA 1UD3A 4MA3A 2H3NB 1A7PH 1NMAL 1X5IA 3RILA 3MLZH 2NYKA 4NT6A 4OR1A 3IAGC 4UBDD 5ACZA 4YHZH 5AVZB 2P47B 1Z7JA 3V0IA 4QWWC 1ETA1 3TYGL 3WSQH 2F53A 3FRPB 5H2BB 4HEPG 4FADA 2VWEC 5F2FA 3GTTA 3HBGA 3AXIA 4XNXH 5MEND 1W0VB 4KUCD 4UILH 2WJ5A 1MQKL 3K5SA 1A6VL 1D7FA 3FO2B 4FOMA 3FBQA 4EPSA 1TZGL 3T77B 2ODHA 5E2WL 7TAAA 2PYEB 3NCEB 2Z35A 1K4DA 2C3VA 2W9EH 4PP2A 1A7NH 2DRUA 5DD6A 4JQIH 1PAMA 1AS6A 4N6RB 4Y16D 5C9JA 2UZXA 3QPXL 4LKCB 1G9HA 3CN1A 1Z5HA 4Z0XA 5E08H 2NY6D 4IU3B 4FXTA 5HVHC 3BGMA 1SEQL 2O61A 1F4HA 3UZEA 2JIXA 4XP1H 3WY2A 2YQBA 4UINH 2MFNA 4NWTL 4UTAH 4FQ1H 4XX1E 1O7SA 3NN8B 4ZPTA 4CADB 5F9AC 3S35L 5L88L 3BH8A 1VERA 2OKMA 3MBXH 2ZQKA 3ZUNC 1OAXL 2OS7A 3WV0A 4XO4A 4P9MH 5I6XC 4N2MA 5KYYB 1DO5A 2DI7A 1VFOA 3P0VL 4X5QA 3VFNB 1FYTD 1J8HE 2IWKA 4GT7A 4ZBJA 1SY6A 4OZIA 2DBJA 2WWKO 3V5KA 1IBBA 3SDCA 4UF7C 1R3JB 1BD2D 2HFEB 1SHWA 3AADB 4EDXA 3PDGA 5JHLA 1MW0A 2W07A 3CN2A 3K3QA 3VRIB 3BKMH 3WE6A 2RCSL 4AGMA 2VQUA 2QPDB 2CUHA 1SYVB 3TEYA 3K6IA 2LABA 2FEDD 4U6HA 4G3YH 4DP0X 2GSIA 3CVCA 4UOW1 3L5IA 1BFVH 2JCCB 3L81A 4FRWA 4ODSH 4K94H 3IXAB 2WOYA 3CHXA 3P77B 1Z0NA 4P2CG 4PB9L 5G5DB 1WA1X 2N4IA 2OSWA 3VFGL 3WFDL 1YN7B 2BOBB 3AT9A 4JRYD 4Y0GA 1AGFB 1KCSL 5IG7B 2CJSA 2EDHA 5EIIB 1DCLA 2ZPKL 2AMGA 3S5ZA 5BVJB 1Q0YH 1XIWD 3H7BA 2BJML 4LHUB 3VW3L 3QCVH 5C0CB 5I28A 2DMCA 3RLSA 2DWTA 2VZOA 4JG1H 4D9RE 3OJDB 2VDOB 3T3PF 1PZDA 4G6KH 4OZGB 4PJCA 5HY9A 4CVUA 3MR9B 1D6VH 1HOCA 3WJMA 3UPRA 4IHOB 5D7JD 1AHWA 2ED8A 1VFBA 4BK5A 1QUPA 3KLAB 1KNOB 4FQJL 1VFAB 5AKTA 5D2LB 1XFPA 5HPMA 2QTVA 3Q5TA 3WMPA 3PHAA 4W9IC 5JHDE 3OR7B 3VFWB 5I0XA 4TUUA 2C4FU 4M6NH 4Z3HA 2X3BA 3PLYA 5ALBL 2ZD0A 4OLEA 4YO0A 2NW2B 1NEZG 5TGBB 3LIZA 5DUPL 5AW6B 2WZPA 5ESQB 2O5ZL 4QXGH 5E0FA 4M93B 5CJBA 5C0AB 4WFFE 1CBVL 1J11A 2J8UE 5E1QA 3HE6A 4F2FA 3QAZB 3RL1A 3KXFD 3ARDA 1MH5A 2OMUB 2YRZA 3RKDC 1JK8B 2FWLB 3QZBA 3BP5B 4EDWL 2AMUA 3L3JB 1ANUA 1SXZA 2BSRB 4NM4H 1X4XA 3D0VB 5DTFB 3ZGIA 4P4KC 2HT3D 4JHAL 2X87A 3B6SB 3BHBA 4MCNA 4YHPB 3SE9L 5FYKU 5D70L 1BEYH 4QYOA 3SYPA 1Q9LA 3MV8A 2P44B 1TO5A 3ARDC 2G9HB 2HVJA 1RZKC 2XXCB 4WI0B 4XI5C 3KM2A 3BXNB 1AYRA 3DVNB 1ZPLA 3Q1SL 2V2XB 2N7AA 4TLUA 3JT2A 4KITB 2J2ZB 5GGVH 1XZ0B 1U3JA 4EBQL 3L6FB 3CD4A 4LIQE 4PREB 4I48A 3FMGH 1P7KB 5IHHA 1LMIA 4G8EA 2QSVA 1OSPL 3O11B 5L4FA 2BSED 2BP0B 4I7ZC 3WNMA 3ZQ9A 1FLRL 1SVCP 2E74C 3NOIA 5B1CA 1D6EA 3LNGA 2ZP8A 1MCPL 4JAMA 3BUTA 2MEJB 2G2PA 4KXCA 4XCNA 4F9LC 5FCSH 3FUKA 5LO7A 1HL4A 4M7JL 4U1JB 5GGRB 3UJTH 4IIZA 1JHKH 2V2TB 4LFHG 4HJ1A 4XCCL 4CVZA 5B7FA 1H19A 4B3VA 2PR4H 1SN0A 5D6DA 4NAMA 3F6IA 3F7LA 3MRDB 1UVQA 5L8JB 1TTUA 3HG1E 1BYPA 4JZJC 5FA3A 1DL7L 3JWOL 1RHFA 4TTDC 3TX4A 3FQ4A 5GJTH 2B0SH 1FH2A 2ZG2A 4G6JH 3EO0A 5DJ2B 2YRLA 3CFEB 3QJFB 1S6NA 2X3CA 2Y23A 1JDAA 3V5DA 2FGWH 1I3RB 3L1GA 5EU7E 1OB0A 4PJHF 1ZSDA 5D1ZI 3E6FB 4GRWH 5HSFA 4OFKA 4OLVH 5GGTA 1XSIA 4WI2A 3KGSA 3QBTB 2BX5A 4YNYB 5HDRA 4H5SA 1BOYA 2OXGA 4RESB 3WO4B 4LRNL 5J13C 5CP7B 1B6DA 4M1GH 3QZMA 1CF8L 3ZBMA 1V7NL 4APQB 3HC4L 3PYCA 5EUOA 4GH7B 5EORL 2JKRM 3HE6B 1MWAL 3QISA 5DQ9A 5FGSA 1OAKH 2WXHA 4JZJB 1HHGB 2ENJA 1X5ZA 1WWWX 2HTLC 2Y24A 3D3VA 2ROYA 5EO9B 3AY4C 4RFOH 4KDTA 1MCFA 4RMUA 3O8XA 4P9HC 4HK0A 4PW4A 2UY7A 2X3AA 4NRZB 1MFEH 3OMNB 1BYOA 1WEJH 1HEHC 3I2CL 4U3SB 3LN5A 3KXFA 5DS2A 4LSVL 4M9PA 4OFVA 2TRYA 3MLXH 4AQ8A 3ZYIA 4M6MH 2VDPL 2YLHA 1WUNT 1YY8B 2PTTA 4HIQA 5LGJA 5HHOE 1L6PA 1KYDA 2VITB 2UY7B 4NRZA 3HMXL 1FV1B 4N0CD 3R4DA 3RZCA 1RIVL 3LN5B 5FO2A 3IDJB 2VL5B 3M46A 1KCRL 4KXZH 1PSKL 3EYFB 4J12A 4FQ2H 1U41A 2BH0A 2YPKA 3ALPA 4P23A 4EZJA 4HPYH 5EH1A 4NN5B 4M62H 1IGTA 5AB2A 2QFRA 1R4XA 3NZ8B 2P9RA 4YR6A 1IAKB 5A2BA 1SPDA 4MD0B 5HDLA 5I1HH 4NQDE 2YXMA 2QVMA 5ESVA 1R24B 3VWKA 1I3GL 4OLZL 3S37L 1XF5A 3V6ZA 4P46A 4PMFA 5C92A 3AB0C 4QOKA 4OGAC 1U3HA 1C08B 4IRJA 1CXEA 3E6HA 3D0LA 5K59E 2WINB 2AVGA 4B27A 1BEXA 1VEMA 2BO0A 3IDMA 4FFWC 4IK6A 3CSGA 4X6DE 5AOZA 3QYNA 4WENB 4XVOA 5EULV 4G5ZH 1MCKA 4Z3IA 2J5WA 1BZDA 1NWPA 1ZSDB 4N0UE 3TN0A 4AJYV 4E9TA 1AIZA 1KXTB 3MCG1 4P2RB 2CUIA 3UYPA 2NT1A 4X5WB 1MHEA 2CPCA 4YAQA 4Y5XB 1HNGA 2AXHA 5CLZA 1T3FB 1I8MA 3F7YA 3HVNA 2IGTA 4M48L 1CBJA 2ZXDA 5LBVA 1IAII 5F7LB 3DX3A 2W8CA 3ASWA 3T08A 3IE9A 1QFOA 1CE6A 1RMFH 2ZKHL 4GRWE 4J8RA 4UAHA 4PGDB 4PJ5E 3ILDA 4U1JA 5I15H 3MKKA 4J39A 1UA7A 2B39A 5F1NA 4P5TD 1KBGH 3MNVB 1H3VA 3QR1A 4H88L 2LU3A 4GQ9H 3HNVL 3CVHA 1AZRA 3DHPA 3FO2A 3QIBA 3D39A 1PZAA 2JJWA 3ZO0A 4PREA 4W68A 3RWHB 1T04A 2CGRH 5H2BA 4WNSA 3F6LA 5T5FA 2V5SA 5CR8A 5B1JC 3DSFL 5CO1A 4GUOA 3VD2A 4F3FB 5AWNL 2Y3AA 3CPUA 3N44B 5GRJL 5C6TH 5AB0A 4LB8A 5KJ7E 1WC7B 2YPVH 1GL4B 3BMWA 3M1BB 3MRHA 2WKOF 3ZT6A 2IFFL 2FD6L 1SDDB 1K6QL 4D8OA 2O5NA 2DB8A 4TUKL 2Q8BH 5KAQG 1S78C 3L3DB 1INQB 1PYWB 2D7TH 5DSCA 3TWCH 2XUWA 4ACTA 4CSSA 2P4AB 4QRTA 1B0RB 4TM9A 4KAQH 2MCG1 1TTAA 2VDNL 3TO4D 2IGFL 1JK8A 4L2YA 3RJDA 4F8TA 3MNDA 4N85A 1CFBA 5F96H 1NA8A 2PPFA 4RX4A 2A6DA 2NOYA 3LKRA 4HJTA 4WW1B 3D4ZA 5JW5A 1AVAA 1WIUA 2XWBA 3B9EA 1TJMA 2K3HA 4YIQB 3HHSA 4Z76B 1JWMB 4HH8A 3KHQA 2X41A 4UT7H 5IQ7L 2HKAA 1V05A 4S1RL 1FFQA 1NCAH 3VD5A 3UAJD 4JKMA 1AGBB 4NNPL 3DPBA 3UO1H 3SQBB 3DX6B 1Q72L 1R46A 3GF8A 4FI6A 1BQKA 2EO1A 4MS8D 4JQIL 1AJ7L 4O2EA 5LAXB 1TIUA 4JRYB 2AJSH 1HOCB 2WXLA 4F7TA 2BS8A 2E7DA 4N87A 3NGBB 3VVVA 4H8UA 5JW4Q 3MUUA 5L2KB 2DKUA 1VACA 1NICA 3U7YH 1I9EA 5B21A 5ABZA 3RJQB 2VXQA 4W9EC 3NJMA 4UNTA 4HGKC 5ICUA 2M8XA 1DZ0A 3W2DH 2VW6A 4UT6A 3QDJE 3TCXA 4OM1H 1MJJA 5DEFA 3WI9A 4DEWA 4ODUB 2GSIB 4N5UA 2VJ0A 2BZDA 3ALXA 4YXHH 5EV7A 2CRZA 3GHEH 5D2NE 2JQAA 2WGXA 3B3IA 2GFBB 4KRMB 4JFED 3FSZA 4N2KA 1RZ8B 3CX5K 1YPZE 4JPSA 4S1SH 5D1QB 4Q9RL 3L1OH 3RWCB 1HSBB 4B0MB 5LWYL 3SJVD 4PTTA 4L4JA 3MXWH 4HJ0C 4MQXC 4NQCA 4UOJA 1IL1B 5A2LH 4HBCL 3CPLA 3HZKB 4HF5H 3DPDA 4XNYL 4XPAL 4ODSL 5IJKA 4AMKL 5DEGB 2O93L 4UANA 1JCKA 1NJ9A 4LCIH 4OZHE 3RNKA 1F5WA 4G72B 2YD0A 4XP9L 5JQ6L 3L3HB 3BQVA 3SYCA 1IQDB 3CDZA 3ZSTA 1BBDL 2JJTC 3GMNA 4UZUA 1Q0YL 3BVVA 3VW3H 3RTQA 4FXGA 2EC9U 2WIMA 2I60H 4HT1L 1NGWA 2WLKA 1HAUA 3H4HA 1CD1A 4JG1L 1N0LB 5CS7A 1R17A 5DFWH 2IPUG 5T3ZD 3ZZ1A 4ZG1A 1IM3B 1IBDA 4DW2L 2G4GA 5HYJD 5FUZL 5F7NC 3T77A 4I3RL 4PYHA 2ENPA 1TU2B 4D7BA 1OGAD 2D7MA 3LH2H 5BO0D 2ZUSA 1SN5A 2VDLL 3IS0X 2E4TA 3DXAE 3MLUL 3ARYA 4S1DC 2R8SH 1NBYB 2DLFH 3SJVE 1IGMH 5EC1B 1KJMB 2GC4C 3IN0A 1CN4A 2WUBH 4YSRA 2DTSA 5DUPH 1QATA 3QEGH 4AQAA 2YMXH 1IC7L 3SKJH 1T7XA 3A6BL 4Z77A 1J10A 1ZTXL 3EF4A 1JVOA 3IM1A 3L48A 1DJZA 4JQVA 4KFMA 1MCQA 1E30A 1OCZB 5FM5M 3DOIA 1NFDA 4BDVB 2FHFA 3DO7A 1FNLA 1JF1B 1E28B 4KI5F 2XWJB 3W9EA 1EV2E 4OKVA 4X6FB 4URKA 3P4NB 3WENA 1ODUA 1AC6A 1ORQB 1S9WB 2COVD 4DP9X 2VXSL 2NY0D 2ZUQB 5IT2H 2BFGA 5BXFA 4GSQA 4K3DH 4P2OB 4WRLA 1G1YA 4GQRA 3UO8B 1NBYA 2Z31B 3RX7A 5FLUA 4H8VA 3L2MA 3B8YA 5E6IB 3PP4L 4U05A 3SBWA 4WFGD 1P4IH 4LAQL 4Q89A 1E7UA 1DJWA 4Q4IA 3ULUF 4LLYB 4BKLB 2WNGA 3N40F 4UDTB 2A74B 1E4XH 2IAND 3HG0A 5EOQL 3TEWA 1IKNA 2DDQL 2VN6A 2J88L 2HVKA 5AW0B 5J7CC 5HDBE 5DDHB 3KD4A 3NEOA 2VZTA 4XBEH 5DD0L 2FVNA 3WFHB 1X7SA 4P2YA 5ITBH 3DV4B 3V6OA 5I1LB 2OK0H 3HE6D 3QO0B 3SO5A 3V0AC 4HP5A 1VSCA 5JZ7C 1I9IH 4M02A 3TT1L 1IUZA 4HIEA 2HLFD 4HKBA 1J5HA 1NC4B 1IKOP 4QHKJ 1PYWA 3LS4L 4ADJA 4L4VA 1B4LA 3SBPA 1JHKL 3FL7A 5DS8A 2WLZA 4PJ7F 4XCCH 1EHXA 4HK3N 1FNFA 3BKCL 2RALA 4BA8A 1XGTA 4X9BA 1ZLWK 5JUEL 3PJNA 4GAAA 5B22A 3VM5A 4OZGF 2Z8RA 3U30C 2JSFA 4MCYB 4YHIA 4BH7B 2YARA 3AACA 4EI6B 3H9SB 1U91B 3HCVB 3IFNH 5CJXA 1U8QB 4XXDB 1I7ZA 3JWNH 2VRKA 5EBWA 4BFNA 2W80C 4UQEA 2EXSA 2EDEA 3HS0B 4UNUA 3LRSB 3SPJA 3GO1L 2CLZA 1HHHA 2AV7B 3N40P 3FO9B 3JWNE 5D1ZB 3ZT5A 4AGOA 3ULUC 4JHWH 1ZHNA 1GYVA 4ODUA 1GGCH 3WTUA 1U9KA 2IG2L 2LV4A 4UOW0 4N2LA 4OCLC 1MHPH 4HSQA 2WBJD 4X7DC 5IVXF 3V9FA 4ONOA 4OZGE 1BVOA 1GA2A 4Y4FC 1ZCRA 3FHEA 5JHDD 4QTHA 3H2WA 1CF8H 3VQMA 2FB4H 4Y19E 3HC4H 4PJXB 2WQUA 1ZXQA 4DGYL 2F58H 3FU5A 1FLTX 3BP7B 4OJDH 3OKNB 1P0SE 4OUUB 1WS8A 4AGPA 3V5HB 3MRLA 2XQBH 1TTCA 3FT3A 1Z9NA 3EOBB 2DEYX 5HHME 4HKJB 2CDEB 3EDJA 3GZKA 4FG2A 1MFEL 2NQCA 1H0DA 3WAKA 4LCWE 5TE4H 4G70B 4Y2DB 3EFFB 4LSQL 5JW5B 4Y1AA 1KV3A 4HC1A 4WO0A 2BVYA 4DGIL 5KVFL 5F8QC 1CGSL 3BD5A 4MNGA 5EF0A 2X6MA 1Y18B 3BZ5A 5H4YA 4WV1B 4BH8B 4PGCA 2NR6D 5G55A 3TPUA 2ORBL 5EEXA 3TJHC 1DQTA 2I9TA 1PSKH 1SHMA 3QG6A 3CDGA 4LKXB 3CXFA 2XICA 4GKNB 1ZLEA 5EIVA 4Y19D 1ZS8A 4B9GA 2G5UA 2IANA 3BZFA 3O0RL 4I0PC 3TASA 3X12A 5IW6B 3FN9A 1ZVYA 2PMZA 3SB3A 2HMID 4G8GB 2EH8L 4MJ2A 4PJEB 2VM3A 2AXGA 4H8WC 3HJEA 2CK0L 3EGSB 2YKLL 1FV1A 4JFXA 5CBEB 5HHMD 5C71A 3G5XB 4JRFA 5DJYB 2X6UA 2ZYHA 3QJVB 1QSFA 1IQWH 1QSVA 1YYCA 2YBRB 4MA1C 2BNQE 3AABA 4WTQA 3TO4C 5I0YA 1FVEA 3TJHD 3UBFA 1S3RA 4E9SA 2D2OA 1TNNA 1GY2A 2F19L 1CQYA 1A5FL 2FHCA 1CZ8H 4A6YH 1SBBA 5DJCA 2MOGA 1CFQB 3MLSL 3BZEA 3ETBF 4U2YA 5DRNB 3P0GB 3FCGA 4Z7QB 4X6EA 2WB1A 4GAJL 4RFNB 5E5LA 5B1BB 4BYHA 2YN5A 1OKEA 1RJLB 3GXFA 3NUKA 4GMTH 4K71C 1G6RA 2JFCA 2QKIC 4DTGL 5FR3A 1SJHA 1P5UB 1W15A 4RGMC 3EH4B 1MHCA 3MA9H 3ULVD 2QV4A 3O41B 1EGJL 4YPJA 2CHZA 6FABH 4KVPA 3KLQA 1UT9A 1F1AA 1FFPA 4A67A 3SQOH 1EEYB 1CXHA 3OAYK 1TQTA 2HG5A 4I77L 3U2SA 4AYSA 4HAGA 1HYSD 1PLBA 5BV7H 1G7JA 5AZUA 1X5KA 2NY1B 3ZX1A 4AG4L 1D5XA 4PGZA 1JZIA 2P52A 4FXKB 1DSFH 1NPJA 2CR6A 4G7YL 1EZLA 4P3DA 4X5RA 4XZ4A 3LB6C 2NY1D 4UILL 5G4MA 4AMXA 4MMZC 5A2JH 3MGTB 1H3TA 4XN4A 2IC2A 3CFBB 1U33A 4QXWA 3EZJB 1BZQK 5I1EH 2F1BA 2XN1A 4WWNA 1FBIH 1NUNB 2NQDA 3QJTB 4MXVF 1J0ZA 3C75A 1JGVH 4FFYL 3RA7H 3FFDB 4OJAA 4MNQA 4GKLA 5DK0A 2IFFH 4RISH 5GS1A 1F3RB 2L7JA 1YQ2A 1QAWA 5C9KA 4XB3A 3KGRA 2H3KA 5CEZE 3BQUC 2BW4A 4N9OB 4XP1L 5EO0A 4PJFE 4PRBA 3P3YA 3U9UB 4ZTPL 2UZIL 1E40A 2AJUL 2DMKA 3ARRA 1ZV5A 2R27A 4K5OA 1KELL 5I1IL 4L8SB 3KGUA 1OPOA 4QYAA 3VXME 2Z4QB 3TFKD 1UOKA 2G5RA 3GBDA 1O6SA 1CXIA 2E6JA 3MOAH 2GC7C 2XG5B 4PRHB 1BZ7B 3NSYA 3VXUB 1F0LA 1VDGA 2GJZA 3NQKA 5F7AA 1K85A 4PJ6A 2ITCA 4HZLB 4X42A 1UACL 3F7KA 4FYQA 4BZ1H 2V3FA 4HX1A 3IFPB 1RK1B 1B4JH 1FVCB 5I1DA 2PYEE 3MU3A 4CNIA 1RZKL 1LDPL 4KO9A 1ERNA 2BSSB 3M17B 3BLKA 3TEZA 5DWUH 3VCLB 4G3YL 1F18A 3BAIA 3C6LC 5D7LD 5GHWH 1I8LC 3BUIA 5AAPA 5CEXA 2F54A 3HKFA 2WXMA 3T8XB 5HYIA 1GAFH 3F8UB 4OFIA 1L7TH 5BJTA 2M1KA 4PW3A 1MJUL 2P5WA 3WJJA 1HE8A 1A14L 1RP9A 5EUOB 3SDYH 1EZUA 1UZ6F 3TU6A 5D7SH 1DVTA 4U6XB 2WVSA 5IJBC 4NWUL