3FBKA

Crystal structure of the c2 domain of the human regulator of g-protein signaling 3 isoform 6 (rgp3), northeast structural genomics consortium target hr5550a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
138
Chain Sequence
QGAGQLRLSIDAQDRVLLLHIIEGKGLISKQPGTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHFFFPVQEEDDQKRLLVTVWNRASQSRQSGLIGCMSFGVKSLLTKEISGWYYLLGEHLGRTKHLKVARRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of G-protein signaling 3
publication title Crystal structure of the C2 domain of the human regulator of G-protein signaling 3 isoform 6 (RGP3), Northeast Structural Genomics Consortium Target HR5550A
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 32
structure length 138
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3fbkA00
2YOAA 2A5UA 3OAWA 3GPEA 3SD5A 3W56A 3F01A 4ANUA 5KJ7E 3IM1A 3QR0A 1K5WA 3RPBA 4L1BA 3R7RA 1DQVA 2NCEA 4EZKA 1QATA 2CHZA 3HN8A 4IQHA 4OVUA 3NZUA 1E8WA 2KI6A 3ML9A 2WXGA 3W57A 2CJTA 2WXIA 4EZLA 1E8XA 4NPJA 3TJPA 4ANWA 3L9BA 3F04A 4ICWA 2QZ5A 1BDYA 2A4ZA 4GNKB 4ICXA 1BYNA 1E7UA 3L08A 4G11A 3TL5A 3F05A 4QJ3B 4MJJA 4DK5A 4L1LA 4PS3A 3L16A 4F92B 2R83A 4WEEA 2LHAA 2CHWA 3RDJA 3F00A 2N1TE 4AJWA 4DNLA 1UOWA 1DJGA 2UZPA 4KZ0A 4BFRA 4EZJA 2Z0UA 4L2YA 3QJZA 3ZIMA 2WXFA 2X38A 3FBKA 1DJXA 2Q0ZX 3CSTA 3QAQA 4F91B 1V27A 5CCHE 4A55A 2B3RA 3OHMB 1CJYA 2ENQA 2WXJA 4KZCA 4URKA 4FLHA 2K3HA 1RSYA 2WXMA 3L17A 3M7FB 1E7VA 1DJWA 3JZYA 4HVBA 4IHBA 4LT7A 3L4CA 2WXRA 2ZKMX 2JQZA 2K8MA 4AOFA 2CM5A 3APFA 4LDCA 4FULA 4J6IA 3PS6A 2Q3XA 3APDA 4OVVA 4QJ4B 4NPKA 2FJUB 3B7YA 2FK9A 3QR1A 2DMHA 2ENJA 2WXKA 4F93B 2WXQA 3L13A 2Y3AA 3IBEA 3PYCA 3ZVVA 4WAFA 1HE8A 1TJXA 1A25A 4WWOA 4Y1SA 4Y1TA 3ENEA 2NQ3A 5EDSA 4NP9A 1WFMA 2NSQA 3L54A 2WXLA 3PFQA 3P2BA 3ML8A 3DPDA 2CM6A 1RH8A 4PS7A 4ANVA 4XZ4A 1UGKA 2CJSA 2WXHA 4TUUA 3FDWA 5H4YA 2RD0A 2WXPA 3T8MA 1DJZA 2DMGA 3KWUA 4QAMB 3KWTA 3S2AA 4PS8A 4FJZA 5G55A 3LJ3A 1YRKA 2YRBA 1DJYA 3MJWA 2CHDA 1DJIA 4FJYA 5T8IA 4BGDA 1UOVA 2D8KA 4FADA 5JHAA 4TV3A 3HHMA 4JPSA 5CCGE 4HLEA 3NZSA 4WWNA 3R7QA 5CCJA 1RLWA 4L23A 4F1SA 4GB9A 4WWPA 2BWQA 5H4ZA 2QZQA 4FA6A 4KITB 2K45A 2WXOA 1QASA 3APCA 4NS0A 4V11A 3DBSA 2EP6A 3HIZA 1W16A 3CSFA 2ENPA 4TS6A 4ANXA 1GMIA 1BCIA 4XX5A 4XE0A 3N5AA 4QJ5B 2CHXA 1DSYA 1WFJA 5JHBA 1E8ZA 1E90A 4FHKA 3QK0A 4FHJA 3NSJA 3TWYA 1W15A 3PRZA 1TJMA 2V4LA 5G2NA 3QARA 4LCVA 2ISDA 3PREA 3ZW3A 1E8YA 1DJHA 2K4AA 2WXNA
chains in the Genus database with same CATH superfamily
3QEQE 2F68X 2ZXGA 2XWJB 4ETQB 3IFOB 1EJOH 2NPLX 4OF5A 3SO3C 5GRJL 4R7LA 4JM4H 3L3KA 3ZL2A 2EACA 3NA9H 4JG1H 4PSRA 5D2NE 3ZYJA 3ABKB 3RTLA 4XXCC 3TH2T 3P30H 2A4CA 4ENZA 2V3DA 2H5UA 1MREH 5FB8A 2JJSA 2Y1VA 3NACH 5CGTA 3B8YA 1TCMA 2A7BA 3L3DB 3QR2A 1KDIA 3IN2A 4H2AA 2HLAA 3H2QA 1BX2B 4BFIB 1ZSDB 3INOA 1BYNA 4KY1L 4N6QA 2NY2C 4NKOB 4F7EB 1YMMD 1NLDH 1UVQA 2BSSB 2Y7SA 4W9DC 5L2KD 2DH3A 2MEJB 4G71B 3RWHB 3SDYL 3OKLA 5JORB 4IM8A 1HSBA 3FHQA 4KZ0A 2AJXL 4P48A 4W1TA 4JDVA 5DC2A 1WD9A 4LXFA 5FCUH 3NSXA 4U4BA 5EF3A 3QAQA 1UZGA 1N12A 3AXHA 3L2MA 5KOMC 2AJUL 3RL1B 3U6XS 2G5BA 2FQEA 2Z4TA 3LZRA 1OARL 2YWYA 3I6KB 2XNAA 2O5ZL 2CPCA 4ONGH 3HJ0A 5HI3D 1MCOH 1G6RL 3O6LH 4ZFZA 3A22A 4HZ1A 1PDKA 1DJSA 3KCPA 3U46A 1OD7A 2ERJB 1HH6A 2C3XA 5ECJE 5TQ0H 1TVBB 3I02B 3KPPB 4YVUA 2EO7A 4AIOA 2X4PA 2XWCA 4FEIA 2WBJC 2ZWYA 5CEZD 1IB5A 2Y22A 1ZGLP 1AS8A 2RA1A 2VSCA 3MRLB 3PFQA 3QULA 5KW9H 1G84A 1CE6B 3ZKMC 4JREC 3VCLB 4Y4FB 4Y4KA 4U2YA 2YFNA 3TPUA 3NZ8A 3W5NA 1C7SA 3N43F 2OR8A 4YHKL 4K07A 2WXPA 1U92B 4UANA 3NFNB 1IAII 5EOCL 2ED6A 5EA0L 3NCCB 1WGOA 4PBWD 3TTSA 4NRZB 4FD0A 5HHOB 1P7KA 1A4BA 1MNUL 3QNZB 3DRTB 4L1DA 1IGFH 2O5YH 1BM3H 4K5NA 3GSNH 2D0GA 2JKNA 5GRUL 1D9KC 4U6YA 1S7RB 1C16A 5ICXB 1OAUH 4A7QA 4KMLB 5ABAA 1UJTA 4RNRA 2R8SH 1A1NB 1D5ZB 4PJEF 3QYMA 1U91B 2EP6A 3K80A 5DD6B 3QI9D 5E9DB 5KVDH 4L8CA 2GG1A 1ZPLA 4NQVB 3DV4B 2WKLA 3DO4A 1JRHI 4NUMA 4GFXA 4QXUL 5ID0A 5L6YL 4X6CB 1MAKA 5EBMB 2AEIT 1P84J 4HKJA 4S10A 2EVIA 3RKPA 3SODB 1S46A 4F15B 3WFEL 3V4UL 3DK0A 1IKFH 2ROYA 4OT1L 1S7QB 2HT2C 2QKIA 1YMHB 3U30C 2DMCA 2VDOL 1AS6A 4JFFB 4G5ZL 4JHVA 4JM2F 4G8GE 4ZS7L 2EVJA 3ARGA 1PQZA 3QXVA 4BZ1L 3QJSB 2HXAA 4G1MB 3BD3A 4YBHA 4PGDB 2R0ZH 3CNKA 3BYTA 1ZEAH 5T1DL 4FFZH 2O6DA 4GAYB 1PZ5A 4HG4K 4LLMB 3MGTB 5GZNC 3RWDB 2EUWA 1PVHA 4AWJC 4F3FA 4KNUA 1JHLH 4PW9A 3UBXA 5FYLD 3QJZA 5FHAL 3N3EA 4ZYKB 5DQ9A 3EYUH 2A4EA 2EIKB 2NY2D 3MRNB 3JWNG 3AACA 4XTRC 5FO7A 1RUQH 1ETB1 2IPTL 2WTOA 5IB2B 4MXVE 5C0BB 4GG6F 4LMQE 4G9FA 1MUJA 2YSTA 1P1ZB 1Y0LA 5LCVL 1F5WA 3RX5A 1JI1A 3FN0L 2F19L 2VDMB 4QIRA 1W0WA 1RJYA 5IW1B 4P57A 1GCFA 3HJEA 3V5DB 3U82B 2HLFC 2XVKA 2G9KA 4LGRB 4IRZL 5BQ7B 2F6AA 4XNAA 4DP9X 3UPRA 5FOBA 3CXHK 4XPFL 4OLEA 2FJFB 4LLUB 4Y2OA 3NIGE 3B5TA 3DGGB 2BY3A 5FKPB 3IJ8A 3T77B 3T3PE 4ANVA 4IBUA 1CICA 2MQGA 5HHOE 1E28B 1JGEA 1JGDB 2NT1A 4G8AC 3MOAL 3M1BB 4FMFA 1MW3A 1O9ZA 1J8HB 2YAPA 5DVNA 3EOAB 1ZVNA 1OAKL 1D5BB 2BSDA 3KM2A 2DQIH 2WBJD 4TNWF 2ED7A 1VGEH 2G0LA 2ED9A 5EC1B 5F88A 2HX8A 4NUJA 1ONQA 2JI1A 5K9OB 3ZKMD 3KHOA 1N6QH 1LL1A 1KIRA 1FHNA 5EO1B 3MLYL 1N9PA 2AABH 3B83A 2MCPH 1WIUA 1AQ8A 1BIIA 4DO5A 2VGLM 5EU5A 4EN3B 5EUOF 1SOKA 1N59B 3JV6A 2OI9C 4GSXA 3DROB 1II4E 2RQ8A 3N6YA 1UM6H 3EYFB 5EDXA 5I1IH 2BIQA 2CHXA 3N06B 1RJZB 4OV5B 1CPUA 3X3FH 3RY6A 2VQ4A 3G04B 1D9KD 3HNTL 3PWVB 2XY2A 5FYKD 1E4XL 1SHSA 1SM3H 3CN4A 3ESMA 2DOCA 5I1GL 1RVFL 4ZD3H 2W0FB 2X4SA 4CMHB 4N8PA 1GC1L 3PJSA 4HK0B 4I77H 4KKBC 1NIFA 4GUPA 2Q2EB 4Y88A 3LN9A 1HZKA 4AQAB 1DN0B 4DZ8A 1YY9C 3EYVA 4FQCL 1EDYA 4M6OL 4NP4L 4QRSA 4RGNE 5GJSH 3IETB 5J56B 4PCSA 3QDMA 3G9VA 1DSFL 1A7OH 5IIEA 3II3A 4NJ9H 5E94B 4TL4A 3QJOA 2HT2D 3OX8A 3FQNA 4CA4A 1N8ZA 3I6GA 3DETC 5J9PA 3V0VB 2D4FA 3CMGA 2J3SA 3WLWC 3ESOA 5C0BE 1FZKA 2D7PA 3P3YA 5DHEA 3DYMA 3BH8B 1LGVA 1F3DJ 3QWNA 5GZND 3PQYE 1RFDL 2L7JA 5BZZA 2MPVA 2UY7A 1AE6H 3AY4C 3LRKA 1VENA 2YD3A 2BIMA 4NQXB 4HH8A 5E8EB 4B27A 3P73A 4B0MB 4MMZA 5KYNA 4XB8A 2Z0BA 2NUTA 3FSOA 1HHJB 3QQNA 5D96B 2Q7YA 4TUOA 1T7YA 2DLGA 3DX6B 2A1WH 1HCYA 4XTRD 2ENJA 3IEAA 4QT5A 4DAGL 1H5BB 4MMXA 1J8HE 3L2NA 1I7UB 4LDOB 4PI0A 1G7IA 4PJIA 2G3NA 5C0AD 5C6TH 5F3HA 1H3GA 4JZJC 1TLKA 4Z78A 1ZK9A 1WHOA 3GSWB 2E74C 1A3RL 2AJVH 1ZCRA 2G0KA 2VDNL 5LWYL 3V4PB 5IFHH 1DQJB 2HLFD 4IKKA 3H7LA 4O02B 5DZLA 1IZJA 2XXFA 2HX7A 5B1CA 4YNYB 2FIRT 1IGIH 1PF3A 5F0MB 1T5KA 1N5YH 1O75A 4L8SA 2Q9OA 3EOBA 3QQ9C 1GJWA 4BCZA 4LESA 1LO3L 1IAMA 4OLXH 3FUNA 2R23B 3BGFB 1CS6A 3MREB 2VDPH 2C9AA 2X9YA 2QVMA 4PJDF 4GW5B 1SY6L 4UNVA 2VRAA 2PPAA 3MRFB 2AJYH 2OXGA 1ZXKA 1C5BH 2EE2A 5IROC 3SKNA 3W82A 3Q9PA 3NMEA 3SDAA 5BO1L 5LCVA 2B3IA 3C60C 5KANI 3N5AA 4QJ5B 1MCKA 2JCCF 1IGMH 3QCTL 1ADQA 2VO8A 3Q9QA 2WBWB 4BQ9A 1GTFA 1E27B 4G42B 4HG4J 1OCZB 3LH8A 2EYTB 3VXOA 5DFAA 4Q9QH 2NLJA 5SWQA 3TFBA 2JELH 1UOLA 3BSZL 1GGTA 5D5ME 1J5HA 3RHWK 1MFCL 4KI5C 5AOJA 2NUPA 1E3XA 4ZAKA 1M2VB 4WDIB 5D1XA 3U2SB 3QI9B 2DW5A 4KO7A 4MASA 1DUZB 1MH5A 4KFZC 1I3VA 1J1XL 3SQOH 3EO9L 4UNIA 1XBRA 2CJUL 1AYOA 1A4AA 3N40P 4XCFH 5TE6L 2X4QB 5I73B 4KKBD 1P0SE 6PCYA 5DMYA 4LU5L 3ZE1F 1MCEA 1IIKA 5CN1A 2OAAA 1KLFB 1YY9D 4F7KA 1KYDA 1RULH 1F4HA 3VFGL 3RFZC 5IBTL 2BW5A 2WQXA 1DJGA 1QFUH 4P3CL 3TN0C 1OE3A 4LLDB 4POZD 1XR8B 3CXHJ 1LVEA 1KB5L 3M1OA 1NINA 4R0LB 4XO9A 2GTZA 3T2NH 4LNVA 1NWOA 3DETD 3SO3B 5DTFB 1RSYA 3W0WD 3M7FB 3J7HA 4XPGL 5J13C 3WLWD 1XR9A 1PZSA 2XFGB 4NUGH 3ZZSA 1BF8A 1E2ZA 3PP4H 4PJGE 3K8KA 4OZGE 5I5MA 4J8RA 1I9RL 3CVHH 3PS6A 5DK3A 4ABQA 1TO5A 4P3DA 4TQIA 5JIQA 5F1IB 3N9GL 1E9QB 2P5WA 1DL7L 5EDSA 2Q86A 5SWZA 2ZP8A 1MZZA 1S7XA 2JJTA 4OZ4A 1HC1A 2Y36H 1H3WM 1KZQA 2YAEA 2ZE0A 4NERA 3VFTA 1FZMB 5CEZE 3PWJA 2GTWA 3L4UA 5F7WC 1IBBA 1MRCL 3ZJAA 1IBYA 3QJHA 4QGTA 3ZTNH 3ZGHA 4WENB 1ZMYA 5ESVB 3C08H 1KBKA 2QFPA 3K72A 1G4MA 4TOYL 2GBUA 3V6FA 4FQIH 2L04A 1DVTA 4QTHB 3GMNA 4AGMA 1KN4L 3DTXB 5E7BA 2OMUA 4IMKA 4R90L 4X0NA 4JAMA 3D0VB 3MV8D 2EDDA 2WSKA 5KJRH 5BVJB 3WSQH 3VWKA 5DUBB 2XDHA 4JFPB 3NZSA 3RWEA 3G7TA 1GRWA 4R6UA 4NYLA 4TQPA 3UGEA 5G5DA 4HFWA 3QQ9D 4AL8C 4H0LC 1MCCA 2RTTA 2Z4QA 1Z5LB 3HIZA 4P2CG 2AC0A 4E5XG 3EHBC 3LXUX 4PJBE 2ATKB 4JREB 1UD6A 3CFJB 1RUML 4AL8H 4QHLA 4ELMF 3Q7JA 1CUOA 4GSRA 3RBGA 3L5HA 4NB7A 4OGYL 4EI6A 1ZHBA 5EUKB 3CC1A 1P4UA 4BWUA 3GSNB 4DO4A 1JZ7A 5IROD 5KYXB 1F02I 4DGIH 1IBDA 3C60D 1ZANL 2ICWA 5D72L 1ET5A 2CKNA 2MOQA 2VERN 4G3YH 2R7EB 5GGRA 5AB0A 1KT2B 3MVSA 4PYGA 5IFJA 3RB5A 2AEQH 5JZ7C 2XV2A 1D9KB 3SKOB 1K8IA 5AVTB 1T7VA 2XETA 1G7QB 4MX7B 4X7SL 2VLRD 4KDVA 4KI5D 4A2EA 1OPGL 4TSCH 4ZQTA 1S5HA 4YN3A 5ILTH 4OUUA 1LD9B 1TQVA 1QEWA 5BOZG 3R0NA 4GQ9L 4UQ2B 5ITFB 3IJEB 4JY5H 4XVSL 4Z3TA 4APXA 1RKRA 3TBYB 1SY6A 2WLIA 2PW2B 2IOIA 1K2DA 2J2ZA 1XFPA 3K2UH 4S0TD 3HC0B 5AVZB 1XH2A 2CA3A 5KVFE 2WQ8A 1PZDA 2BOCA 4J39A 2ZCHL 4A7GA 4MZ3A 4MKTA 4QCIA 1L3WA 1U93A 1QSEE 3KBEA 3VFWA 5IWLA 4GG8A 5HDOA 3IU4H 4EIUA 4X6CF 4TL5A 5JW5A 2YIHA 4LOVA 2AK1H 5D2NA 4ZK8A 3L4CA 3TN0D 2DYPA 1ET7A 3L1FA 4EMZA 4PJXB 5C0EB 3BSZA 3BRDA 1WFNA 4N8CL 3WFBH 4U6HB 4N8VA 4NQSB 3VNZA 3HC4L 3WXVH 2EJ1A 5J1AA 2IH3B 2PWGA 4OD2A 5IEKA 4PBDA 5FA3A 3UTSE 4AXWA 4PFEA 2Z1PA 3EIFA 2EEDA 5CBEB 4LSVL 1LEKB 4R83A 4X42A 2YMOA 4K73A 2QVIA 2EDXA 4CSZA 1UXSB 2DIAA 2JCCA 4JPIA 2FWOB 3U0PB 3LQZB 2Q7AA 5F9OL 5C0AB 5AD0A 5HHME 5AVXB 1OV8A 5C7XH 4K3HA 3B2UD 3BLPX 3T09A 3IKCA 3CSPA 5DA4A 5LXGH 3WS6C 3FB5B 3L3IB 3RNKA 1RIUH 5CMAA 3BT0A 3I9GL 2YD5A 2IALB 3LV3B 3ZTEA 1Z5HA 4KQ3L 4QRQB 1IEBB 1UH2A 1H9DA 2WAHA 4YHML 5A7BA 3VFVB 3FH8A 3NN8B 3D52A 5KVGH 1QP1A 4JRFA 5EBLA 5C0GA 6TAAA 2O6FA 1TZIA 4G7VL 4LAQH 2MCAA 5F9WC 1T04B 3EGXB 3OXSA 2BOLA 3VXUE 3OSKA 5DJ6A 3IPBA 3V5HB 1MHCA 3X12B 1I4FB 3GKWL 3O45B 4FZ8L 5TJWK 3ARQA 3QWRD 3H54A 3ZW3A 1EANA 5DD0H 4JL1A 5DRZB 2MNWA 3U1QA 4AYMC 3EHBD 4BRVA 4U3HA 1O5DT 1F56A 1IC0A 2QHLA 3VXPA 3MNVB 1X7TA 4XCCH 3TOPA 5I0YA 4L9DA 1QATA 2DZEA 1YN7A 3Q2LA 4M62H 3ZZ1A 4YO0A 3MC0A 1UCTA 4MNQD 1M42A 1YG9A 4GAFB 3FONA 4NHCH 4ZO7A 2RGSA 3FSAA 5LBSL 3UJIL 4Z7NE 4ICXA 4S2SB 4WU7B 4ZFQA 2X05A 1VRSA 5ESAA 4AKOA 2LFGA 3MZGB 2XWJA 4N0UB 3IFOA 4ETQA 5JZ7D 12E8H 1CR9L 3V6OC 3QHZL 4TSAH 2AEPL 3QP3A 2WP3O 1HS6A 1CB4A 2R29L 4UDTB 2VSMB 4JFOB 3L3DA 5LNGA 3ISYA 1BX2A 4UT6H 4BFIA 1ZSDA 1NEUA 1ODAA 3SHSA 1OGSA 2FSDA 5CEYB 4NKOA 1U2HA 4Y89A 4F7EA 4CDGC 2AMUA 2BSSA 2VR3A 3RWHA 5ITBL 5JORA 3IF1B 2VXVL 1ZPUA 4KQ4L 5D55A 2J5LC 3RWCB 1I7RB 5JW3H 5AENA 2DMHA 4X9GA 3GDBA 1UH4A 2X9ZA 1HL8A 3W0WB 3RL1A 5FECB 4EIGB 4WWOA 2DL9A 4WTZG 1KPUB 1R34A 2D9QB 4GSDL 4ZPTB 1PG7W 2CG9X 3I6KA 4RAHA 1KXTB 1KBWA 1JUFB 1S5IL 4GBXC 4DETA 3QJVB 3PWLB 5CGYD 5BW7C 5JIDA 3AROA 3LY6A 1EAJA 4E36A 1E5BA 1QQDB 1BVKA 2V3EA 1G9MH 3I50H 4EUPG 5KSAA 3UAJC 2CE6A 1TVBA 3C6EA 3GXPA 3I02A 3KPPA 3GMRB 4KKPA 4R26L 5HHVH 4A6YH 3F7QA 3OZKA 2YD6A 1RZIB 2B0SH 4HCGA 4JKWA 2JJWA 2WQUA 3MRLA 2E27H 4UQ9A 4U1IB 1A7QH 2EZ0C 3F83A 4HEPG 3U36B 1CE6A 3BPOB 4Y4FA 3VCLA 4JQVC 4PREB 3WNJA 3DIFB 3MRMB 2I24N 1YUKB 3MJ9A 1QSFE 4KITB 1H15B 1U92A 3D2UD 3NFNA 4JZJB 4ZS6C 3IGLA 1IQDB 2PN5A 2YD9A 4NRZA 5HHOA 2QQLH 4I89A 3ABMB 3MV8B 1OK0A 2WQSA 3DRTA 3QNZA 1NICA 3H0TB 3L4WA 3T1FB 2K78A 2MKWA 4U1LB 2FR4B 4R4FH 1HXKA 2NW2B 4EO5A 3GRBA 1QTSA 4Q6YA 3W11C 3RG1C 1S7RA 1CGVA 2F9BT 5ICXA 4X7FC 2OV0A 4OCXH 4YHLL 4XN8A 1A1NA 2NTSP 1D5ZA 1FWXA 1U91A 5DD6A 5E9DA 2X0VA 2J88H 4GXVH 2IPUK 1SQMA 1UKQA 2P8MB 3DV4A 3FOMB 4XWGH 1MKFA 5F7YC 2ZCLH 5EZIL 4X6CA 4Y19E 5EBMA 4N22A 2CPUA 2FX7L 2B4CL 3TM6A 3U4KA 4CN6A 2QQQA 3CHRA 3LXAA 1ILSA 4AYEC 3ARVA 3C60B 1A14H 2VIRB 4WEBH 1S7QA 1YMHA 3D25B 4N2NA 3UJTL 3DUHA 1WIOA 3CC5B 4WUUE 3CJJA 1FFOB 4UQCA 1AGEB 2F74B 1JWMB 4G1MA 3B56A 2VLRB 3ZDYB 4PGDA 5I15L 4FC3E 1RZJH 4YFDB 1SJVA 3TF4A 1IBZA 3BI9X 2VN7A 3V4PL 1NKRA 4N2FA 2WWNA 5DHMC 4GAYA 4Y4HC 5B3JF 2Y06H 3EO1B 4LLMA 4O02L 3MGTA 1HFUA 3ZDZB 3RWDA 1I8LC 4K3GA 5JHLL 3GKZA 2F58H 5EN2B 4W9FC 3ULVC 4MB5A 4JUSA 2Z8WC 3V9FA 1J10A 1HQ4B 2EVFA 5H8DA 4ERSL 1HNFA 4JPVL 5TD4A 3S36H 1A6PA 2YKLL 4ZYKA 2E7BA 3ULVH 4XZUB 4NQCE 1F4YL 1O6VA 1MF2H 1NGYB 3RFZB 3MRNA 3CAFA 5IB2A 4ONFL 5C0BA 2BFGA 3H7BB 3O6FC 4HIHB 3TN0B 3WKPA 1P1ZA 4I1RA 2D7TH 3P0VL 4MS8C 4F9PA 2R0LH 1EO7A 1QR4A 4NX0A 1R75A 5LBSA 2EDKA 4B5ZA 5IW1A 5KBDA 3QVAA 4JO2H 3V5DA 4FQXB 2D2CC 5T1KD 3CVHB 5J13B 1UM5L 1JHKH 4X9IA 4A7SA 3II2A 5BQ7A 2C1PB 5CP7B 3DYPA 4ADJA 4GBXD 1HKFA 4I0PC 3RWGB 1DBJH 1WAAA 2FJFA 4ATWA 2X10A 4LLUA 4XODA 2R29A 3MCKB 3DGGA 5FKPA 1K5NB 3T77A 4K7FB 3BZEB 4P59H 2LVCA 2FCBA 4XT1C 3UAJD 1JGDA 2GSGB 1GVIA 3GSOA 4JM0A 4UV4L 3MV8E 1VLXA 1D7DA 1IAOB 3M1BA 1J8HA 4F1SA 3EOAA 1YPZB 3I3EA 1ECZA 1D5BA 4OZIF 3ZDWA 2EC8A 3BN3B 4M9OA 2WNGA 3C8KB 4XE0A 2A6IB 2DWYA 5EC1A 4BWTA 2CR6A 2EZ0D 4NCC1 3AXLB 1XGYL 4NQQA 4ODTH 4X6EB 5K9OA 4JFDE 1TVDA 4I7ZC 1JCKA 5EO1A 1KBVA 2KZWA 5TPWH 1UT1A 1H6TA 2V9RA 1W72B 4KMQA 1DJHA 4ZS6D 1B0RB 1E7UA 1UKSA 4EN3A 1N59A 4QRRD 3P30L 4KMTH 1M7XA 5EN3A 2A73B 3DROA 3RPBA 1MREL 1TJHL 3EYFA 4JRXD 4OV5A 4XHQA 1RJZA 3KVQA 1A7RH 3NCYP 3W11D 1FH2A 3G04A 3PWVA 3HFML 3B7UX 3VTMA 1IQWH 4PVMA 2EH7H 3HG1D 1E4KA 5FYLL 1NLDL 3QQDB 3JWOL 5J6GB 2W0FA 8PAZA 3EHBB 3PAUA 4HK0A 4XNZC 3WHXB 3U0WH 3FRPG 2NNAB 4GPVA 3ZO9A 4ODWB 5FGBA 1OAZL 3B3IB 3CVDA 3NP4A 1DN0A 4AQAA 2QPUA 3LEVH 2JQMA 4F2ME 1JNNH 3ZDZE 4BDVB 3JWNH 4F7CB 3IETA 1IC4L 2G2PA 3CFBB 4OCWL 5IFAL 3T2OA 3MGOA 1HT6A 1SYVB 5DZVA 2A74C 3CU1A 5E94A 4DGWC 3VFUA 3E9TA 3VXSD 3BQVA 2DDQH 4PV1C 3V0VA 5TQ0L 3LH2H 2OYKA 3FUJA 2FLMA 2R1YB 1MLBB 3P4MB 4OF8A 1G0XA 3RJDA 2P49B 4M48L 5KSBF 3HG3A 5EBGA 4O2FB 2EDQA 1KWKA 4LRIC 2ZYSA 2EDHA 2AI0H 3BH8A 3LYRA 4Y4HD 1E4JA 2LLNA 4AKQA 4NQXA 5F1SA 5E8EA 1GPOH 4P2QE 2X1QA 3ULVD 1U8MB 5DZAA 3BEVB 4PI2A 1HHJA 3F2LA 3R18A 2OW6A 3DX6A 2RJMA 4RCAA 5SX5H 1BD2B 1S3KH 5D6DA 3GWJA 2DD8H 1SOQA 1H5BA 4N5UA 1I7UA 1SXZA 2FATH 1YPZE 1OLLA 1HK6A 1BEXA 3O6FD 2G5UA 4MS8D 3II1A 3Q2NA 3D34A 3AUVA 3GSWA 1OAUL 2R8SL 3DUUB 3H6JA 1UWGL 5KVDL 4LPWA 3LZNA 3V4PA 1DQJA 1KGWA 1BA9A 1YYMH 4Z7UB 2EO1A 4O02A 1R4XA 5FYKL 4PGEA 4RMSA 4F37F 4PRPD 4P8QA 2BWIA 4I0PD 4YNYA 5JHLA 1OZTG 3K5RA 3WFHB 4PJXF 5LNDA 4U1JB 3VB9A 2R23A 5BS0D 1JXFA 5DHVB 4JQXA 2M83A 3MREA 2BP0B 3SBWA 3D50A 3HA0A 5FM4A 1N10A 4GW5A 3WO4B 1UXLA 2GI0A 2XN1A 3WGUB 3BVVA 4NRYB 3MRFA 5GGVL 1L0XA 4ZFFB 2C1OB 3D2UB 2AQ2A 3UEQA 1NGWB 1UKTA 5HJ3B 2FLRT 1A6TB 2P42B 1CK0H 2LTQC 3HI5H 1E27A 4G42A 2YXWA 4ANWA 2EYTA 5CNHA 1Q4NX 4MJIB 5DJDA 1JHLL 1M2VA 4Y8DC 4WDIA 3QI9A 4K9EC 3LKOB 1DUZA 4TNWK 4B9YA 1XEDA 2F1EA 5C08D 2SEBA 2WM0A 3KVPA 1IARB 2NY5C 1E5CA 2X3AA 4Z7AA 1RUQL 3AGWA 4LGSB 3SDCC 4K9EH 1RZ7H 2X4QA 3WY2A 5I6OA 3HR5B 2ZCKH 2B3RA 4AV0A 1SDAB 3K2MC 4J3BA 4TNGA 3R1GH 2OSWA 4GKSB 3NSCA 2GQHA 4WK0B 4KO9A 4MZIA 3TF7C 3OSVA 1KLFA 3RUGB 1IAIM 4JO8A 1DBML 4RFOL 4YLQT 2ADGB 1YC8A 1FO0B 4HWUA 4UBDC 8FABB 3FH7A 1UD3A 2G75B 3APFA 3L1OH 4C59B 4LLDA 3SKJH 1XR8A 2FJUB 4NQDD 3F65A 4PJ7B 3OR7B 4R0LA 4TRPH 4TM9A 1BD2E 3QJRB 5DTFA 1SJHB 3IN0A 3OPUA 2XTSA 4GKOA 3K2KA 4MB1A 5IY5B 4FI6A 4L1TA 4XXCA 1RH8A 3UBGA 1F8TH 2DQIL 1WS7A 2CBPA 3MXWH 3K6SB 1JZGA 2L7UA 5IG7A 5EFIB 4WNQB 2YARA 4FMKA 1OWWA 5F1IA 2MRYA 4UAOC 4Z7UE 1E9QA 3RIFK 3N0AA 4M02A 5EOCJ 3IXTB 1QNZL 1QO3B 2M2DA 2MCPL 4X4XB 1CBVL 1MY7A 5EF1A 2J5LB 2OMWB 1CDUA 1FZMA 5F2FA 5AKRA 2GIMA 5H4ZA 3QXAB 3D4YA 5I1IL 2H1PH 3B7SA 5ESVA 2AJSH 5T1KB 2RAMA 1X4YA 4M6NL 3BSHA 4KK6C 1QVOB 2EIDA 2B14A 4QTHA 4A6YB 4GBXB 3EFFB 4OLUL 4OLZH 2WYZA 3DTXA 4E41D 1DBBL 5KVGE 2O6EA 3D0VA 4I77L 5BVJA 2YPLE 3FUKA 5LBVA 5DUBA 4JFPA 1WWAX 4DT2A 3HZMB 2NCMA 1HNGA 2CCWA 3VE0B 5DJ8B 2NNCA 1U8KB 3PWUB 5GJSL 4X4KA 3QG6B 3W56A 1Z5LA 2Z8SA 3MNZB 5FWRA 3S88L 4J27A 3KS0J 2IBZY 4MJIE 4EN2A 4B9PA 2ATKA 1A7OL 3ROLB 3CFJA 4OJEH 3NABL 4AM0B 2FBJH 5I5IA 5GHWH 2WUCL 5EUKA 3O3BB 3H9HA 3GSNA 5EU6E 4MNGE 5KYXA 3DDFA 3LN4B 4LLWB 4RMQA 5CJ5A 4Z3JA 1YN6B 4QRRB 3DI2B 3VXUA 4BK5C 2R7EA 3S35L 2N1TE 1KT2A 3CBKB 4JRXB 5KYYB 1UEYA 3JZ7A 3RUGE 3PHOB 2G30A 1D9KA 4UNUA 3SKOA 4X4ME 3RVUC 5DZJA 3MV7E 1G7QA 3HG1B 1PMYA 4MX7A 4HU8A 1WT5C 1R47A 3OHMB 1AKJD 5HI5C 25C8H 1AS7A 1OXYA 3FXIC 3GLAA 3NJXA 4FLQA 2Z91B 4MCNA 3RWJB 4GG6E 1LD9A 2WD0A 3TH4T 4PGCB 1GGIH 4UQ2A 5ITFA 4LNRB 3IJEA 4X4ZA 4Z7VF 5IZ7A 2GT9B 2DQCL 3DUSB 4N86A 3TBYA 4AGPA 3SDCD 5C0RH 1NC4D 2PW2A 5C6TL 2IGLA 3HC0A 1RZGA 3LIZH 2QLVB 3IBEA 3I2CH 5EIQA 3HBPA 2X4OB 1W0YT 3UTQB 2AJVL 4NC1C 2HVKA 2F7PA 5IFHL 5ESQB 4FFZA 4KQ0A 4UBDD 4XPTH 3RU8H 1KTRL 3BZ5A 2OR7A 1CL7I 4UV7H 3ZT6A 3US1A 4PJXA 1IGIL 1GGCH 4XNQA 2IEPA 5C0EA 2GJPA 3RZCC 1AD9B 4HUWA 4IDJH 4L4VD 3PGFH 4OLXL 4Y4HB 3QUGA 2ZYRA 4U6HA 3BUPA 4NQSA 1AHWC 1ZDSA 2IH3A 1MCLA 2MQCA 3Q06A 4WO0A 4ZPVB 1SJXA 4IRSC 3ZDYF 3US9A 3ATBA 4FS0A 2KC0A 1ZWIA 1C5BL 4TUKH 5CBEA 1J9TA 1LEKA 4NSKB 3MSPA 5FO8A 1UXSA 4KRMB 4K3DL 1IGML 2FWOA 3U0PA 3VWJA 3LQZA 2UV3A 3IJHB 5AALA 4FG4A 1JGIA 1PIFA 2XX0A 3O6FB 4G6KH 1V54B 3KGUA 3GS0A 1GGUA 3FB5A 3L3IA 3MA9L 5DT1H 4OW6A 2LW3A 5DMJB 3LV3A 2IALA 5ESAB 3UPCA 1SOSA 1CE1L 1IEBA 4KK6D 3VFVA 3NN8A 1MJJB 2TSBA 1AHKA 3LOWA 3SQOL 4PRPB 4XMLH 4I0PB 3SGDI 3TYGH 3K6DA 1OLZA 4M1GL 4XCFL 4KXBA 4KXDA 3VRLE 2JKXA 3EH4B 4Q74A 1T04A 3FU3A 4UTAL 3EGXA 4WFFE 5DA0B 4XMVA 5I1AB 3V5HA 3X12A 3ALXA 1I4FA 3O45A 5D8JH 3VA2C 3IJYB 5CINH 1UCBH 2R4SH 1RULL 3QG7H 2VDKH 3MJ8B 5DRZA 3N85H 2EAEA 1KJ2B 3F85A 4LCUB 1L7IH 3MNVA 3MO1B 2X2JA 3UC2A 4DHLA 1KJ3H 3NYKA 5AAWC 1KCWA 3AS1A 4IOFC 2YRPA 4XP5H 1ESOA 3WN6A 3MODH 2ODHA 3F6LA 3KPNB 4YXKL 4BJLA 4NUGL 2ZJSL 3B2MA 2VITB 2WUBH 3KG5A 1OQXA 4WU7A 4FXLA 5F44A 4FNUA 4UM8B 1DLFL 4HIJB 4N0UA 5AL8A 3M8OH 4S1QL 3NIDF 3TBBA 4BSVB 5C08B 3GGWB 4LP4A 3RVUD 3W39B 1KENH 1X9QA 3LQAC 4HC1H 5HI5D 5KVEH 5EEVA 5DHYB 1OCCB 4EEEA 3EOTH 4UDTA 4KTDH 3T6ZA 4AEHL 4XNZB 3A47A 2P46B 2Y36L 1Y6NR 2JVUA 1QFOA 4JFOA 3UJJL 3HZVB 4KZEH 4YPGB 3S6CA 2KS0A 1JFQH 2CDGB 3O2VH 2Z93B 2EQDA 3MV9E 5CEYA 5SV4A 3P2BA 5CLZA 4FF9A 3Q6FB 4W9EC 3O2WH 3IF1A 5ALCH 2GK2A 4L3EB 2A74B 2N1KA 3N41B 4JCLA 5BOPA 1I7RA 4R2GC 1QA9B 4QWWC 1AACA 2WIMA 3W9DB 5CCKL 3U7YH 2YGQA 3W0WA 1J18A 3WEAA 3D9AL 1ACXA 4PJHF 3T2QA 3WSQL 1W72L 3D39D 4AEIL 2EABA 5FECA 1KPUA 4ZPTA 1KXTA 2VRKA 1JUFA 3X3GH 2XG4B 3RZCD 3QZLA 2CRIA 2D7QA 2E0PA 3CFQA 1QQDA 2WYTA 3IMSA 1AI1L 1R19A 3AY4A 3ZTJG 2ZT9C 1WP6A 3GMRA 4AL8L 5T5FH 2ENSA 4IRSD 1RZIA 3KE0A 4PLJC 2C3HA 1B9KA 4A2FA 2VMEA 3ATFA 2XBTA 3R8BB 4LIQE 2KHAA 4U1IA 4DGIL 4FZEH 4DN4L 2YAMA 4HA1A 3U36A 4G3YL 3OB0K 3UERA 4HGMA 1T2XA 2H41A 4PREA 3DIFA 5M7QA 3A4AA 3MRMA 1OAXH 3P9MB 1RURH 2BSTA 2W9EH 1S4IA 2VQ1B 4ABWA 2AEQL 5E9NA 2J7LA 4JZJA 4JG0H 4OGAC 1IQDA 4E41B 4X98B 3FTYA 4TSCL 3VXMB 5ILTL 3MV8A 1QKZL 3H0TA 3T1FA 3VQMA 4L0YA 3OKYA 4U1LA 2XWBB 3PABB 4WI5A 2NW2A 1TR7A 1M7IB 5HDBF 4AUJA 3Q05A 2CHNA 2QZ5A 3QQXA 4OJCA 1BDYA 3WCYA 4ZMXA 2XIDA 4IKLA 4CSPA 2A9AA 3K2UL 3M17B 1NBCA 3ZKSD 1XF2B 3EJYD 3FOMA 2P8MA 4BCYA 2P1YA 5F7EH 2A6JB 2Q0ZX 3IU4L 5GJTH 5C08E 1UTDA 5LN4A 1XEUA 4Y1AE 2AK1L 5IROA 3O4LD 2CNYA 3ZL4H 3HPJA 3JWNE 3C60A 2LTQB 2VIRA 3O6KH 1D5MB 3OJDB 3VSVA 4Z8FH 1FL5B 5D7LD 4IOFD 1IL1B 3D25A 1G7JB 3WFBL 5K69A 1TTUA 3CC5A 4JFTA 3UTTD 4PV8B 3FNKA 3WXVL 1MXGA 1FFOA 2ZNXA 3L4ZA 1AGEA 1O6TA 1PLCA 1JWMA 2F74A 3BAYA 3CH1A 3ZXAC 2H0FA 2VLRA 4X80H 2XV3A 1AKJB 3FB8B 5JPNC 4RRPA 1HE8A 4DEWA 5IQ7L 4L3EE 3E0GA 4TULH 3EO1A 2C9VA 1V5JA 4EUPH 1NBZB 4OFDA 4GIAA 3AQZA 2ALWA 5DZNA 3OKKB 1WO2A 4U0QB 5EN2A 2PETA 3E1F1 4AQEB 3SDCB 1NC4B 1JV2B 3S0PA 1HQ4A 1Z6JT 3ZHLA 4OLWH 1DR9A 5C7XL 4R96B 5ABZA 2J1ZA 4UILL 2H1LM 4M6AA 3SBRA 4XZUA 3TT3L 1P69B 3S34H 4AVIA 1NGYA 3RFZA 2HFEB 3L3OC 5EWIH 4ACTA 1NCJA 4MDIB 4A04A 2NNFA 2XQBH 3H7BA 3TN0A 4HIHA 4R2GD 4E9VA 5FOJA 4HFUL 4QWWD 1E5YA 1EWHA 1WZ1H 4L4VB 4LAQL 3NEOA 3TONA 2VN3A 5I23A 3V52H 4FQXA 1UURA 3CVHA 1KEMH 1NIBA 2C1PA 3MV01 1I3GL 5CP7A 3N2JA 3GTVA 1MOEA 4ELME 3MRDB 3PGCB 4JVUA 3RWGA 2XZZA 3HZ3A 4PPTA 4EAEA 4J3WA 3FTWA 3MCKA 3BZEA 1K5NA 4F2EA 4K7FA 4NNYB 3S4SB 1NAMH 2GSGA 4JO1L 1KYOK 5PAZA 3VXME 4BFGA 3NJGA 1IAOA 1ZLVK 4UAOB 1YPZA 4KJYB 2D7OA 1BFOB 1HILB 5E6UB 3HZKB 3RI5F 4M62L 2EIEA 3C8KA 4B9JA 3QYCA 2E47A 4BE5A 1XMWA 2A6IA 2NY7H 3KLSA 4HPYH 4XP6H 5KSVB 4NHCL 2DQFB 3AXLA 2XWEA 4X6EA 1JGUH 1HWGB 1K72A 2KI6A 2XJLA 2KZBA 3EDEA 2BMKB 5BQDA 2FJGB 4KV5E 1GIGH 1FO0L 2Z92B 1W72A 4X5QA 4YIQB 4OGAD 2ZXAA 1B0RA 3S3DB 3GO1H 4OB5H 4TSAL 1JPST 3WJLC 4IK7A 4KNSA 1CT8A 2A73A 3GZOA 4JKKA 1P4BH 4G80B 4M3KB 4XMUA 3ZE2E 2UZPA 3VSTA 4YSTA 9CGTA 1WCBB 4KXZI 1WFTA 4OFYD 3WMSA 3H9SD 4CVXB 3QWRA 2DPKA 2MTPA 4KX9A 3QWQB 4PJCB 5AZEH 1A1OB 1U33A 3QQDA 4R5TA 5J6GA 4X8CA 1T0OA 4XPHH 3JZYA 1T7ZA 1O7SA 3WHXA 2FEEI 4HS6B 1A7NH 2NNAA 2IFFH 3JT0A 3C2AH 4ODWA 1JZEA 5JW3L 2XQYG 1PKQB 3B3IA 1X6NA 3BAIA 3GHEH 5E2JA 1CGYA 2ZP0T 4PVLA 2D3LA 1ZLWK 4HDIB 4BDVA 4F7CA 2DYRB 1L9MA 3CFBA 5CLYA 4OCSH 2D7NA 1U8HB 4HEME 4ADIA 1RK1B 1SYVA 5A6IA 4QUOA 2YAOA 2BRRL 1KDJA 1KELL 1OT2A 1X4ZA 4X7DC 2NSQA 3PXJA 2WLZA 3VXRD 1JK9B 3I50L 2R56H 4HJGA 5LDUA 4UOJA 2R1YA 2FX8H 1MLBA 3P4MA 4A6YL 3UG4A 1Z66A 1OHQA 3P54A 3TYFB 3KL0A 4PU2A 4O2FA 3QHFH 4K7PY 4WK4B 4YQXH 3ZHFA 3U4EB 1J0ZA 3C8DA 5D2LF 2W80C 4ZNEE 3QUKB 5C07D 2E27L 4L4VE 5T5NF 2J20A 2QTEA 2QMJA 3BE1H 3EBGA 3SE9L 2DQEL 1U8MA 1IRAY 3QNFA 4PJFB 3BEVA 4AJVA 1MG3C 3OGOE 4B9FA 5FUCE 2V9TA 3F12B 5T33H 4RMWA 1BD2A 4QRTB 3UOAB 3UBHA 2QQLL 1BXVA 2PXYC 1HSAB 4GFTB 3D39B 4R4FL 5E4EC 4Z7QE 3RZCB 1MDTA 1MRDL 3DUUA 5DUPL 1U8LB 2J88L 4GXVL 1BZOA 3C5ZC 1AHWB 4XWGL 4Z7UA 4AYFB 4U7KA 2A9NL 2ZCLL 3APMA 3EF7A 3VXNB 2BS9A 1K5WA 3WFHA 5SX4H 2VAJA 4U1JA 3DOSB 3KYOB 4NO3A 4HOWA 1HHGB 4UAHA 3O3EB 5DHVA 4XVTH 2BP0A 4OM1H 2ICEC 4TKWA 3FPXA 4AI7A 1YEFH 1A14L 1SJEA 1D5IH 1TNMA 1NOFA 3H3PH 4WEBL 4N90E 4LEOB 2A4ZA 4GNKB 2X3CA 4F7TB 1A4JB 4NRYA 4XXWC 5D9SB 4ZFFA 1FGNH 1PX3A 2C1OA 1OCWH 4I3RL 3D2UA 3NSFA 4P06A 5D71H 7FABH 4Y2DC 3WS6A 1BMGA 1NGWA 2V5YA 5HJ3A 1IE5A 3NP3A 1A6TA 3WNIA 4GT7A 2YPLA 4I4WB 3KBFA 2DYSB 5D7SH 4ZTEA 3FFCE 1BAGA 3FKUS 1KGYE 4YDKH 4NKQB 1ZV2A 4YX2H 3DDGA 2JCWA 3HBGA 4ZZFA 2AQPA 1IM3D 1X5FA 4MJIA 4ZMOA 1NA8A 2VDKB 1SEQH 4XNXL 1KBBA 3LKOA 1OALA 1HI6A 2XN2A 4Q2ZB 3CFUA 5FV2A 1ZLDA 2K8MA 5CSBA 3ULVL 3QFDA 1CFMA 3B2VH 3CWGA 2FK9A 2OMNA 3IJSB 3HR5A 3O4LB 3FCBA 2JJVA 5C3TA 3SQRA 3VMOA 4XI5C 1CFQB 2D7TL 1M3JA 1BXXA 4GKSA 4M7JH 4CKQA 2B5IC 3P3RA 4WI4A 2JQAA 3RUGA 5D7LB 4IK6A 5FV1L 5K59F 2ADGA 1FO0A 3SJVD 3SZKC 3EH5B 5IVZB 5TDOB 2YD4A 1JHKL 3UTTB 8FABA 4TF4A 2QMKA 2WTRB 1OGAE 2Y3NA 3KLKA 3SPVB 2QL1A 1CFNB 2BNRE 4PJ7A 3NUKA 3OR7A 2E7LC 4MQTB 4ZX4A 1SJHA 1UD4A 3EGSA 1XX9C 2EVGA 3SDXE 5DMGC 4UT6A 2NQCA 1KYOJ 1X5XA 4BGDA 3P0GB 1FN4B 1R3IH 1KXHA 4KJQC 4J3UA 4TV3A 4MA7L 4ZO6A 1B4RA 3MACH 3S37H 1DDHB 4TLTA 3SY0B 4ESKA 4F33B 3VGDA 3K6SA 1MJ7H 1AJ7L 1SLVA 4Q97A 4ODTL 4BQ6A 3HG5A 3MBWB 2VNCA 3U25A 1DVZA 3L4VA 1YNKL 4JRLA 4IBZA 2WZPD 2ZCZA 2VKXA 4KWUA 4EKJA 5TPWL 3IXTA 3AM8A 1QO3A 1E90A 2NZ9C 1KJ2L 1HCZA 3ZQXA 4X4XA 3HAEG 4AT6B 1BVZA 2OMWA 3PRZA 4R2GB 2GABA 4ZOEA 5D7IB 4M61B 2VLJD 1N67A 2PXYD 4V2CB 1PY4A 3QXAA 4CADB 3RVVC 5T1KA 3NRQA 4WNSA 1ICTA 5KANG 1N5AB 3AS0A 4NBYB 1ERNA 1IQWL 1IC1A 3ECUA 5GRYA 4A6YA 4GBXA 2XVLA 4TLUA 4ZSOE 3N41F 2P9RA 4KHTH 3C5ZD 3U0WL 3UAJA 1WEJH 5AOKA 4WTQA 3HZMA 3PLYA 1QFWL 3VE0A 5DJ8A 5GRXG 5E1HB 3ZZQA 3LEVL 1NMCC 1U8KA 3P0YH 1JNNL 3PWUA 4JDZB 3QG6A 3VJ6B 4TVPD 3MNZA 5K1NA 3SSGA 1UOWA 4BXVA 2QFRA 4Y5VC 1WBZB 5AWNH 2VW4A 1AGDB 4HJUA 4JQVA 1YYLH 1R3JB 3FRUB 3FT4B 5FCSH 4AM0A 4RGOL 3UMNA 2DDQL 2YEZB 3VD7A 1M1XA 4Y2DD 3LN4A 2JXMB 1H8SA 4LLWA 3MUY1 1YN6A 1CZ8L 4QRRA 4F37K 2MFNA 2AI0L 2XWTB 5KYYA 1Q0XL 2FT8A 3D05A 5T3ZH 3PHOA 1KFAL 2Y5QA 5HVHC 4QJ4B 4BKLB 3NAAH 4MWFB 1WH0A 5AVWB 3HEIB 3HG1A 3UTTE 4EOWH 1BIHA 3WEOA 1TJIL 2O72A 3GIZH 3ROOB 2FWSA 2BIPA 1F11B 3RWJA 2Z91A 5KVEE 4PGCA 5E8DH 1EUUA 2V17H 1QBBA 4LNRA 1P2CB 4DP2X 1EHXA 1G0DA 2DD8L 2GT9A 3DUSA 4KVCH 3G6JB 4O58H 3HBQA 1EDHA 2OJ1A 3KL5A 3O11A 4AW4A 4W9IC 4JGUA 4XI5D 4DUXA 2X4OA 1H6UA 3WDJA 3RJQB 3UTQA 1OWRM 1BVNT 2I60L 4NO0B 3VXRB 1YYML 1H8OA 1FFRA 3ASWA 4OBRA 4WQOA 1I1YB 1TSRA 5JW4Q 5JPNB 1P5UC 3EH2A 1AD9A 4FA6A 5D1QC 1THAA 4Y4HA 3THML 1KC5L 5C07B 3O0RH 4PJ9C 3PUUA 1SXSA 1I8LA 5DMGD 3E7JA 4KJQD 1YEHH 1F4XH 1GYWA 2ZUYA 2IADB 4ZPVA 4HSAC 1YY8B 4FERA 5CU9A 4ZNCD 4EZMA 3WL9B 2J4WH 1W0VB 4OKVB 1J87A 2WKOF 2W0PA 1CK0L 1CYXA 3E8VA 4H13C 3DIVA 2QHRH 1OM3H 3O3UN 1EFXD 5G4MA 3IJHA 1LM8V 2W81C 1H9VA 4GKLA 2NZ9D 4JE0A 1WTLA 1VDGA 3PL6C 3O6FA 4H8HA 4OVUA 1WA2X 5FHBL 1N4XL 3MRIB 4B53A 3OLIA 3BIBX 2CLRB 2EVHA 4BUQA 3A6OA 3RVVD 4IIQC 2PTTB 4BQBA 1BVOA 4L4TD 5DJ0B 3N40F 5AOIA 5C97A 4K8RC 1YNTB 1MJJA 1KY7A 3DVNB 4WZ9A 4PRPA 4I0PA 1EHKB 2X4NB 3KPLB 2UX6A 1OW0C 4K9EL 1RZ7L 4HLZG 3D48R 2ZCKL 4K8RH 3MCLH 4HETA 3R1GL 2IGTA 4YUEL 2E8YA 5FYJE 2NY5L 3IJYA 5CZKA 1KTCA 1CJYA 1I31A 3MJ8A 4HV8B 1KJ2A 1SQ2N 5DR5H 1Q38A 4LCUA 2C26A 4UM9D 1U8PB 4FAAB 4G8FB 3MO1A 1TEYA 4Z7IA 4TRPL 5MI0C 1MFEH 2AXWA 3HG2A 2ZKYA 2ZOKB 4EVNB 2DAVA 1U9KA 1COBA 2GC7C 2Q8BH 2BP3A 3DI3B 5T3ZD 2VM9A 3BUDA 1OP5H 3TV3H 5AYUL 4RBPH 3KPNA 1IM3B 1F8TL 2VITA 1R1CA 4X8GA 5ALBL 2Y4SA 4BZ2L 1ZSHA 4F1ZA 3MXWL 4ZO9A 1XXDC 3R06A 4HIJA 3NGBB 5EF2A 1U41A 9PCYA 1TUPA 3KWWB 4BSVA 5C08A 3GGWA 3W39A 3VXRE 2FQFA 3TFKC 1JOIA 4NM4L 4QTIL 5DHYA 1PJWA 2EE9A 5C8JB 1HZHL 1IE4A 1NCCH 3V0HA 4OH2A 4OLVL 3HZVA 1TTGA 4YPGA 4QR7A 3RURA 4NZUL 2CDGA 5GGQH 5F6IB 1MIEL 2Z93A 2GIYA 3O81A 1YEIH 3V0AC 4YSAA 4AITA 2H1PL 1Z9OA 4PJ5B 2AJSL 3SJVB 5KN5B 3Q6FA 1A3QA 3FQUB 5DDHB 1C5DB 2H6OA 4L3EA 2A74A 3EBIA 5I66B 4OLZL 1QSVA 1QASA 1QA9A 2L8AA 1G7MB 4JZNB 2ZIDA 3VXTB 3W9DA 4M7KH 5E5MB 5I82A 1CI5A 3MLZH 3CZGA 4MA8L 5CN3A 2XG4A 4LRIA 3S5LG 3BLBA 3DGDA 5D1QD 2IDCA 4WHTB 2YD8A 4PJ9D 1NCWL 4JFEE 4MTMA 3L5IA 4NJAH 4EBQH 1S9KC 5F3BA 1MI5E 1HIMH 1FBIL 4QRAA 2RBLA 5FC9A 1VPOH 3HRZC 2EYSB 3ES6B 2ARWA 3S3CB 1T0NB 2VUKA 2IWGA 2P24A 4M8VA 3UMTA 5TDPB 5D4JA 4U1GC 4E2OA 4ICWA 2VLJB 2FYYB 2PXYB 1CYGA 1JWSB 2FX9H 2O5XH 3AMKA 3P9MA 2G5RA 4K15A 3PL6D 3GB7B 5E4EB 1D7FA 5I5JA 4J2QA 2COQA 4UIKH 3ZE0F 4J3OG 4EDWH 4E41A 4X98A 3T2LA 2R0KH 1JXDA 3R8QA 3VXMA 2WOBA 1PEWA 5A2KH 1YEGL 4XX1G 4K8RD 4ZUSB 2XWBA 3PABA 1M7IA 1DUYB 1MEXH 4EE2A 1YO4A 3SGEI 1FNSH 2CXGA 3WG7B 1Z7JA 3M17A 1KGJA 4MAZA 4ACPA 3AZUA 1XF2A 5F0LB 2IDSA 3LIZL 4YLBA 3FQYA 1Z2KA 3MJ6A 5DMIL 3BWUF 3VB8A 5CLWA 1GYCA 2A6JA 5FEBA 2H7WA 4AGOA 4JGJA 3K6NA 1JGVL 4XPTL 1MCIA 3LEXB 4Y2DB 2RR3A 2UXGA 2VZUA 3HOGA 4NKDB 4UV7L 4LCYB 2DWTA 4X5RA 4B0MM 1GGCL 2WTPA 3MX0B 3ULUC 3BAXA 1D5MA 3OJDA 5DD1H 3PGFL 1FL5A 5IVXB 1IL1A 1KGUA 1G7JA 2FUQA 2ADYA 4HUUB 3V7MA 2OSLB 4PV8A 2DN7A 3BLKA 4M1DH 3WTTA 3LSOB 1TZHB 4PJ5E 4PVNA 4RISL 3EJUA 3SJVE 3ULUH 3BRFA 2HFTA 4XGZB 5C09D 5K1VA 1AKJA 2P7TB 3FB8A 3WDIA 3GUTB 3D85D 5FUOH 1GAFH 2DQDL 1EO5A 3F64A 5AG8A 4J3VA 3HW7A 3VH8B 1OF2B 1NBZA 3ZTJH 3TFKD 3OKKA 3ALPA 2XWZA 4AQEA 2YEQA 3SDCA 1RLWA 1NC4A 1JV2A 4HEMA 4WIQA 3AB0C 4O00A 4G7YH 5I1HL 4QF1B 4G6KL 4R96A 1GS8A 2ATAA 2B5IB 1TMQA 5IB1B 2VR5A 5E0QA 5DT1L 1DQLH 1AGFB 2HFEA 4HIEB 4KTEL 3SYCA 3RWIB 2CDFB 4MDIA 5JIHA 2X6CA 4DESA 1KYAA 2IXQB 2DS4A 4DEUA 1QZ1A 2YQBA 3IVKB 3B2PA 4L4VA 4XCYB 4AGNA 3IJ7A 4XP1H 1LWJA 1FP5A 5LB1A 3TJEL 2P44B 4I13B 1CLCA 5D8JL 1WUNT 4D3CL 5CINL 5SV3A 3MRDA 2CHZA 3PGCA 5EHFA 3MLUH 3N85L 3GMQB 3O2DH 3QEGL 2QADC 2AKRB 4NNYA 5E6SB 3S4SA 4Y9CA 1L7IL 3RKDC 1SXBA 5I0ZA 2XACC 4Z0BH 2YD2A 3V0FA 4KJYA 5FO2A 1BBJB 1BFOA 1EFXB 1HILA 2EEAA 1UATA 4FYQA 2R83A 1CXLA 3HZKA 4N25A 4BFRA 3MODL 5KSVA 4ALAH 3UTPD 2WUBL 5C6WH 3QJXA 1AYRA 2BMKA 1T2QH 2FJGA 4LCWE 4NXKA 3KNBB 3ZK0A 3UYRH 4HAKA 4Q58C 2Z92A 2KDGA 4YIQA 1KENL 3AXIA 4HC1L 5D7IF 5KVEL 3KXFB 2ZAIA 3SYAA 3EOTL 1OE1A 1PTZA 2PWEA 3I3DA 4G80A 2FHCA 5B38B 1WCBA 3ZPDA 5I18L 4KZEL 5IVXE 3LQAL 4CVXA 1NMCB 1V10A 2BVPB 1IIIA 1CLOH 4PJCA 4FABH 1A1OA 4DVBB 3CLWA 2MSPA 4WW1B 5JHDE 1GY1A 2LLGA 3A5VA 3K8LA 4HS6A 4Y5VB 2ZG2A 4DOHE 4UM9B 3VDAA 3JUZA 5JPMC 1GHFL 1PKQA 2VAAB 3I9PA 1J1OL 2EDNA 5AZ2L 5HGDB 3FL7A 4HDIA 4PJ8C 3U7YL 1LK2B 2WY3B 5K93A 2QSVA 2RALA 1DVXA 4NWUL 1ACYH 1LDPH 4B9ZA 1AC0A 1JVOA 1RK1A 1G43A 2Y1ZA 1DQDH 3ULUD 4AYDC 3OKNB 1NIAA 2YA2A 3U7WL 5ADOH 2B2XL 1E40A 1DJIA 1IAIH 1JK9A 2F8IA 5HVHB 3UP1A 5IUCA 5F8RC 1WT5A 3MNMA 3TYFA 4B9IA 1B0IA 4C56D 3TCLB 1UC6A 3MRGB 3U4EA 1CTNA 3FFOA 3GBEA 4FNQA 3QUKA 4GAGH 1WAPA 4FZEL 3LIZA 4YDIH 3WY4A 2OBGA 2KQMA 2RCSH 1DBKH 3F7PC 1FDLH 3E6FB 4PJFA 3QC6X 5FW8A 4YXHL 2W9EL 1W6WA 3MLXH 1JRHH 3GT6A 5E6IC 2J44A 1DO5A 3F12A 3NJKA 3GI9L 3D18B 4AV5A 3NG5A 2IANE 5IR1B 1UD2A 1ZVHA 2CBMA 3F01A 4BUHA 1TTFA 3SDXA 1HSAA 3G6JF 3KGRA 3V5KB 3D39A 5J57B 3AITA 3LTVA 1B0WA 3QEUB 2VCOA 2Y25A 3MA7B 1G7LB 1PZUB 1CFVL 3RZCA 4EZLA 3TJPA 5D1QB 3WDHA 3H2PA 2AW2A 4NUPA 5I1EL 1RAMA 1U8LA 4PJ9B 3C9NB 2X88A 4E5XA 1DCLA 1AHWA 4AYFA 3F05A 4GO9A 1MHEB 3RFRA 5F7EL 3U83A 2Q1EA 4WUKH 3O3AB 4MJ2A 5F96L 3NJHA 3VXNA 4NZRH 4W4NA 3DOSA 3KYOA 3ARXA 4A2GA 1KEGH 2QADD 3KH4A 3O3EA 1OQOA 3ZL4L 3KXFE 2V2XB 3NIFB 3RKDD 2DLFH 3REWB 4CVUA 3VDBA 3O6KL 4Z8FL 3ETBF 4LEOA 4QLRA 1A4JA 3PL6B 4W9LC 4KAQH 5D9SA 5SWSE 5CD5C 1ACZA 3GD1C 4F24A 2J56A 4HS3B 2C5DC 4OZHF 4I4WA 4F58H 4IIQB 3LXCA 1FA4A 4TULL 5AW6B 1YQVH 3WIIH 2QGBA 2WP3T 3JTTB 2DL2A 2EDLA 1TCRB 2OCFD 2EDJA 3U1PA 1M7DB 1SZNA 1I9EA 5E8OA 4BFJA 1H3TA 1KPRB 1XVSA 1SOXA 1WC7B 4OLWL 2ORBH 1UGKA 4Q2ZA 4FDWA 1YNTF 4Z7OB 4PS4H 2V33A 3FO0H 3S34L 2DQGH 5EWIL 4TLSA 1OE2A 4QYOB 3KYNB 3IJSA 2Q2LA 3O4LA 4OM0H 3M88A 3RY5A 2XQBL 4FJZA 4U49A 3NJVA 5GS1C 1CFQA 4GIOA 4A7UA 3OKMB 1LP9B 2VXQH 3INUH 1WZ1L 2FEJA 5MI0B 4PJ8D 5D7LA 5AAWA 1DEEB 3V8CA 3S48A 2N3JA 3L6FB 2L7QA 3WBDA 5IHHA 1KUMA 1KEML 4G6AC 4L23A 5IVZA 5TDOA 3UTTA 3QUZD 2RFXB 1UM4L 4XP9H 4R97C 2YK1H 1ADWA 5C09B 5JIIA 4HC1A 3SPVA 3W2DH 1CFNA 2V5SA 3F7YB 5HHPB 3D85B 3CQQA 4EPSA 4CILA 5IHZB 1DSYA 1JZ6A 5AVRB 5DRWB 1QUNB 2OKMA 4GT0A 1NGZB 3DV6B 1FN4A 4XCEB 4XC1H 2I07B 2R59A 3TBTB 2BSRB 1WZMA 2DWDB 3TWCH 2VZTA 3PV6B 1X5YA 3SY0A 2FIKB 4F33A 5DC4B 4EQ2A 4AK1A 3ESNA 1IGJB 4UNTA 1JGUL 3MBWA 3S36X 4A38A 1KZYA 4FQHB 3AUWB 3BKCH 3QZWG 1AQKH 1KCUH 5E6ID 2N0KA 4KUCD 4P5SA 4AT6A 4POUB 4AG4H 3GO1L 3WNMA 4OB5L 2PABA 2Y07H 3AS2A 3KHQA 5D7IA 3S5YA 4M61A 4JO3L 4RESB 3TXAA 2E9WA 4CADA 1HXMB 4MHHI 3NJMA 4MJJA 4DPAX 2VN4A 1N5AA 3ZKXC 4AEEA 2OP4L 4HXBL 1MCPH 3U1SH 2PWHA 5T5FA 1TETH 1NPNA 2WLHA 2Q87A 3EOYG 1XB3A 4XPHL 2YPVH 1URIA 3MU3A 4NC0B 3FYEB 5DGRA 2WZ0A 3C2AL 4WY7H 4JFSA 2BY2A 5IKCA 4JN1H 2QELA 3HRZB 3CHQA 2VXUH 4JDZA 4NZTH 3VO0A 2EE6A 3VJ6A 2BM3A 3V0WH 4OCSL 4X7EC 2CM5A 4HH9B 4NPYB 4U1GB 1WBZA 4ZUVB 1AGDA 4UTBL 1R3JA 3FT4A 1PPIA 1L0YA 3GSVB 3GJFK 4YSOA 1KY6A 2YEZA 4N0RA 4Z7OE 5CD5D 2R56L 1EMTL 2FX8L 4KDTC 4WGKA 2JXMA 3UTZB 3CN0A 3QHFL 4MZ2A 2MKLC 4OV6F 2R39A 3SO5A 4YQXL 5KAQF 2XWTA 4OQ1A 1X5MA 5F8QC 3ZX1A 1LP9E 3OQ3B 4HUKB 4OFYA 3F7VB 4BKLA 1TDQA 2CMRH 4OTXH 2VDRL 3ROOA 1UADC 5E2VH 1ZGLB 1F11A 5C09E 3HFFA 4UB0H 4L18A 1JZIA 5T8IA 4DP8X 1JZ4A 4KUZH 1P2CA 2ZQKA 1PG7L 2ADFH 4C4KO 3BPLC 2B9BA 4M43H 4PBXA 4OY9A 3KJ4C 4M93C 1LWRA 1KJVB 1R24B 3HAEH 4WTZA 1B4JH 4LHUG 3CFIC 4J1UB 4WFGE 1BOGB 4NO0A 3OVUB 3VXRA 4FHJA 1AHMA 4NM8H 1MCFA 1JN6B 1NFDB 5AW2B 3UCQA 1HU8A 1NGQH 4NI6A 4QDGA 4TNEA 4FXGC 1J8RA 1I1YA 5MEOB 1RPKA 5B21A 1FPTH 1U21A 2Q3ZA 3ME0B 1Q9LB 4JFHD 5JPNA 1SLWA 3GRGA 3PXHA 1L9NA 2J8UF 5C07A 4OM1L 4EIZC 2CBTA 3H3PL 4HEPA 5CKAA 4KZDH 2IV8A 2IADA 4J12A 5IMLB 3AB0B 1VADB 4HS8L 4TVPL 4FYRA 1GMEA 2TRYA 4JKMA 1YY8A 3N50A 5CLTA 7FABL 5D71L 5TQ2H 3UFIA 3WL9A 1X5IA 2HVBA 1W0VA 1WDAA 2XFXB 1L6XA 4OKVA 3QJUB 1Y18A 1BFVH 4KFMA 3TL5A 2AQSA 3CFTA 4KKLC 4M00A 3QIWD 1C8PA 3HN3A 3OMAB 1P7QA 3FO9B 3MRIA 4P49A 5FYJU 1INEL 3OAZK 4JFEA 2NQDA 4LKXB 2CLRA 2CR3A 4W9HC 4CN4A 1SEQL 1K3ZA 4E9SA 1MI5A 5CD3B 2HLEB 1SN0A 2PTTA 2X2HA 1JPSH 5DJ0A 2JI2A 5GPRA 3QDJE 4GRWF 1GOFA 3DVNA 2AMGA 4P2AA 3CXDL 3ZR5A 3UGXA 5E2WH 4RDQF 2X4NA 3KPLA 1IEAB 4LLVB 1CYWA 5EEUA 3G6DH 4CJ0A 2QADB 2OJEA 2J57A 3NSDA 1NEZG 4NPKA 4QRPE 1ND0B 2AK4D 3CU7A 5FYKU 4OQTL 1XGZA 3MI6A 4HV8A 4PJAB 4I1NB 3NTCH 2B15A 3QBTB 3TEYA 1MHHB 4S0SD 1U8PA 4G8FA 2HB0A 5LGJB 1G9EA 4MMZC 4XNYL 4AH2B 2ZOKA 4EVNA 4N87A 3OJMB 3GJEB 2K8QA 1QWNA 3T5WA 2WQAA 1DZ0A 5E5RB 3FU8A 1R3IL 4MDRA 1IM3A 2AV1B 3MACL 4X4YA 1S9YB 1F18A 3QFJD 2Z9TA 1EEUA 1NKOA 1BQSA 3HB3C 3LPGA 2WIIA 4YHOH 1EXUB 4MMXC 3T08A 3KWWA 5D4IA 2QEJA 3PUCA 3TNNB 1NFDE 3MLWL 4BHUI 5C8JA 3C12A 4KPHH 3B9VA 4RWHA 1A9EB 2W8CA 3EJZD 1IVLA 1NUNB 4LF3B 4K94H 5JPMB 2V8LA 1U6AH 2AZUA 3QW9A 4PJ8B 4BXSV 3MLRL 4KK8C 4W6WB 4PJ5A 3BH4A 3SJVA 5KN5A 1YEEH 2DTMH 3TS8A 3QUZB 3FQUA 5DDHA 1C5DA 3TC9A 1C08B 4A37A 5I66A 2YOAA 4L8DB 2GAZA 3MN8A 1G7MA 1A3LH 3O6MH 3VXTA 5L88H 4NQUA 5E5MA 2AQNA 2P5EE 3KWXA 4O9HH 5KBLA 3CSYB 2YA0A 5H37G 3RX9A 1I1AC 3WNNA 3SDAC 3P0YL 4FNRA 3OG4B 4FNTA 4HLZH 3FU5A 4WHTA 1A5FL 4QEGA 5AWNL 2Z65C 1YYLL 4E9XA 2WZPA 2WLYA 3L5WB 5E6IB 2EYSA 3ES6A 2FNBA 5F21B 1T0NA 2WXFA 5IM7B 2EUVA 2CRZA 1ZS8B 3CX2A 1YEWA 1MG2C 1NLBH 3ZBMA 1TKWB 3O9WC 1VSCA 4AE0A 2VLJA 2FYYA 2PXYA 2ZAHA 2VWEC 1JWSA 4HXAH 1VFOA 3GB7A 5T3ZL 1BW8A 3VGFA 2BO0A 5GGRY 3M46A 1U30A 1BQKA 3NAAL 2EEFA 4EOWL 4NQEE 4I85A 1N26A 3GIZL 4XNMB 4H8QA 1QX1A 3Q2VA 2M26A 2YOCA 1CLZL 3VACA 4OIAA 4XWOC 4GKZB 2QV2A 4ZUSA 3FRPA 3FBQA 2V17L 1DUYA 3B37A 3LHPH 1XAKA 3BSGA 3HC3H 4LCIH 2BJMH 3CTTA 2EC9U 2EDRA 3GMLB 5K59E 5DWUH 4M7LT 1ZHLB 2HG5A 3S8FB 4YZWA 2WXHA 2R69L 1HYSC 1B2WL 4WCYL 2EH8H 3PIQB 5DJZB 3DMMB 4XXWA 4ZMLA 4F7PB 2LABA 3RTQC 3QUYC 2VQTA 3LEXA 4Y2DA 4NKDA 1JYWA 4MCMA 4G70B 4LCYA 3BAJA 1TJGL 2VMCA 2EDOA 1SMDA 3MX0A 3NIFF 5I6XC 3DYOA 3S97C 4JPSA 4FE9A 3N04A 5IVXA 4UMGA 5IUSA 4HUUA 1PJ9A 4WKXA 1WJ3A 2VSDA 2OSLA 3HS9A 4GMTH 4LP5A 5K39B 4W9GC 4E9QA 1T4WA 1TZHA 3LSOA 1F4XL 4DKAA 3FHEA 4PRHD 2BIOA 5CM1A 4XGZA 2Y6SC 3HB3D 1NCUA 4GP8B 2X89D 1YA5A 2N7SA 4H26B 3VH8A 2J4WL 4NT6B 1OF2A 2J25A 3QAZC 2F1AA 4WGWB 2WINB 5IJKC 4OQTA 4HLJA 4MXWL 1HJBC 1B6UA 3C09C 2QHRL 1ZLUH 2E7HA 1TLMA 3BAEH 3FSZA 4QF1A 3V2AR 3IDMB 2OSXA 5GS1B 1AZZC 2MOVA 4D2NA 1ML0A 1P6AB 4YHZH 1KCRH 4J3OC 1E6OL 1AGFA 2OMTB 2WHVA 4KK8D 2ZXEB 3WUWG 4HIEA 2PPEA 5B1KA 3G6AB 1L3NA 1HE7A 3C6LD 1OK8A 3RWIA 3UXFA 1EGJH 4R97B 4U6XA 3IMVA 1P7HL 1NBQA 3V9EA 3QULB 5HYQB 2ZSVB 2IXQA 4BFEA 2HRPL 2BCMA 4J3OH 4S1RH 3SEPA 2E7LA 3T0EE 3IVKA 1CXEA 4OJFL 4PS3A 3TX4A 4K8RL 3MCLL 4TN9A 1JERA 4KXCA 4QD2E 3RDJA 1I1AD 3SDAD 1SUJA 3N42B 4L2YA 5TE4H 2IH8A 2JTYA 1F45A 3GMQA 2JJUA 1K4DB 2IANA 2ARJQ 4Y7MA 2AKRA 1M56B 1L4IA 1MQKH 3JBG7 2K3HA 4U6YB 5I26A 4DZBB 1ZT7B 2HFGL 3L48A 4L05A 2MCMA 5JXEA 1BBJA 4GAAA 1NAKH 1EFXA 4IGBD 3CFEB 3ZKQD 1IVTA 4L8CB 3QIWB 3WNLA 1HEZB 1I1RA 3IGAB 1Z3GL 1RUKL 2QQNH 3O9WD 4QOKE 2CO6B 2X4UB 4H1LG 3CPUA 1YECL 3WKQA 4CBZA 3S3PA 3KNBA 1F4WH 4FOMA 2ZP9A 1F6LL 3ZKXB 5HXMA 5FA4B 4PWKA 1VF5C 4FNLL 2OK0H 4MD4B 2QSCL 2IO5A 2IDFA 3KXFA 4ZMWA 3AS3A 1IJNA 1FG2A 4AZUA 2CKBH 4H5SB 4XWOD 5IGXH 4H8PA 3L1GA 5B38A 5D2NC 1UACH 2AK4B 3QHTC 5GGQL 4YSCA 5E24E 4N2CA 1FE8L 1YEIL 2XZCH 3NCEB 4ZRGA 3L9YA 3DHUA 4NNPL 3V7AG 3VI3F 2BVPA 4DVBA 3AG3B 1NFIB 2JLPA 2I25N 4WW1A 5CGMA 4OI8A 4Y5VA 1HYSD 4UM9A 5JHAA 1JZ3A 1HKLH 4JRYD 5EIVA 2DWXA 2VAAA 1PFOA 4NIYE 2XSKA 2WNXA 2PF6A 4P46C 1TZGL 1WHPA 2WVVB 4WI8A 5HGDA 1NH6A 4M7KL 4ZTPH 1LK2A 5JOFB 1LHZA 3RTQD 2VXSL 5DRXB 2FECL 3QUYD 4TQEL 1RZPA 3DBSA 1KV7A 3MLZL 3NK4A 2VW6A 1HAWA 3KPRE 3OKNA 1J5OH 4J7RA 2P5WD 3QFJB 5E23A 3WLBA 5KYUB 5SWZD 1TQBC 1YEJL 3UZQB 3U4BH 3F58H 2CRYA 2WYIA 1F4AA 1CVRA 1TJMA 1HIML 2EECA 1Q1JH 2XA8H 3QCVL 2P8LB 2Y6SD 3NCWA 1W80A 1J05B 3MRGA 3TCLA 3F7KA 1LK3L 3GBML 5FS5A 3PNWB 4G7QB 5AOZA 3UL4A 3A3YB 3HAEB 3DPBB 5BRZD 4ZTOL 3BGAA 2DQJH 2PYED 1A21A 3A21A 5KBMA 3BPLB 4DKFH 2FX9L 3E6FA 1OM9A 3KJ4B 4OU3A 5DS8B 2E7MA 3L9BA 4UT9H 1QHPA 1LE5B 4ECNA 4M9PA 4WV1C 4OD3H 4GKNB 4J3OD 5DO8A 3ZDXB 1ORQB 3TNMB 5IR1A 3GBDA 2YQGA 3I9IA 1RIVL 3HMWL 4K5PA 5DURD 3V5KA 4HIXH 4D9LL 3DNKA 7PAZA 1MHPL 2ZX6A 3QEUA 2ZG1A 4FXGB 3QEHB 3MA7A 5AAPA 1G7LA 1KACB 4MNHB 3WKNA 3BFOA 5D1QA 3P11L 2QVTA 2GBTA 3W1ZA 4PJ9A 3C9NA 4NFBA 5AYTA 1UB6B 2W59A 4LSDA 4KX8A 1BFTA 4RETB 1MHEA 4KOBA 4O5LH 4LBEA 35C8H 3ARZA 1GS6X 2WXRA 3O3AA 3H9ZA 4LSSH 2K7PA 2XC8A 3QNYB 2CGRL 4N3TA 1KJMB 1X9LA 5JOPD 1NMBL 1VCBC 4UF7C 5DWPA 4KHXL 1DQML 2V2XA 1S78C 2G4GA 2WXKA 4F8TA 4IIZA 3REWA 4LPYA 2RQEA 5C86A 5EU4B 4OGXH 4OLYH 3T6WA 4BBWA 1E5AA 3DO7B 1PAMA 2AK4E 3L3HB 3LEYH 4LOUC 1RJCA 3BOVA 4DP7X 3MLPA 3VD2A 4FLOA 3DPDA 1S7SB 5KS9B 4HS3A 3ULUL 4XVJH 1XL4A 2DTSA 4OJDH 5CJOL 2VRQA 4Z3EA 4QRSB 4G1EB 1ZXQA 2PWDA 4IIQA 5FUOL 1QNIA 2OYMA 3BO8B 4C55A 3NCMA 4ZUUB 3QDGD 3JTTA 4HSCX 2PYFA 4M5ZL 4QHNA 3WNPA 1UZ6F 1TCRA 2A77H 2VMDA 3QEQD 1M7DA 1MFAH 1JZ8A 3ARYA 3HMXH 4G7YL 1KPRA 3EJPA 1WC7A 5E08H 5GXBB 5TE7L 2NY6C 4YDJB 4PHXA 2FO1A 4WEUD 1MFDL 1DANU 2Z8RA 4X7CC 2EDEA 1CI3M 4YR6B 4QYOA 2CLVB 3KYNA 3ZMRA 3QRFM 3B1TA 1OSPH 4KRPC 5J1SC 5KSAC 2AITA 2DLIA 3Q3GB 4LSUH 4JJHA 3OKMA 1LP9A 3TEZA 4P46D 4MBRA 4DEPC 1JNJA 4GUCA 1FFNB 2CNZA 3L6FA 3K3QA 1XH3B 4A2MA 1B4TA 3FUMA 2RFXA 2I9LB 3ETSA 3O41B 2H2PC 4PRHB 3LRGA 4UQIM 5C09A 1HINH 4FCAA 2VDQH 3HB3B 5HHPA 4Y4FC 3D85A 2IWFA 4MMXB 5HYIA 2ICES 5IHZA 5ICZB 1KWGA 2PR4L 3PF2A 5DRWA 1GSKA 1CDBA 1FLRH 1NGZA 3DV6A 2B20A 4XCEA 4Z0BL 3DJZA 1FNLA 2I07A 3TBTA 4M1CC 2DWDA 1YEKH 2B16A 3PV6A 2A0LC 3N91A 1AGCB 4M3JA 1RZ8B 2FIKA 1SHMA 3ZE0E 1IGJA 3QJTB 1N0XH 3L16A 1KIQB 5HVWA 4LQ1A 3ATEA 2PNDA 3OHXC 4H8WC 4OZFG 4FQHA 4D0BB 5DEZA 1GGBL 3A6CL 3C6LB 2X1WL 4FI7A 2OCJA 5C2BH 4X83A 3WYRA 4KVNH 1T0PB 5DLMH 4YFEA 1A6ZB 3BXNB 1HXMA 1JPFB 1ED3B 2APXA 3GDCA 3K5SA 1I1AB 2C9SA 1QG3A 3SDAB 3U2JA 2WSPA 1S3RA 1ZA6B 3IFNH 2F54E 4FABL 3KLHC 2XV6B 2GVYA 4LEEA 1NIDA 4U6VL 3NJIA 3GLEA 3L13A 1X44A 2MOGA 4PCYA 4XBEL 5IQ9B 4LSRH 2NLJB 1IT9H 3WKML 3NCJH 5HDWA 3TJHC 2NDGA 2WJ5A 3HRZA 4IGBB 4QRUB 3U2IA 2N7AA 2HH0L 3WFCH 4IYKA 1LDPL 1F3DH 2AGJH 1U2YA 4Z7WE 3OR6B 2WLNA 1S78D 1AANA 3O9WB 4HH9A 1MIML 4RGNC 3X11B 4DN3L 4ZUVA 5FUZL 2G3MA 4KKAD 4LOUD 3DLQR 3GSVA 4UU9B 2I9TB 2WN2A 1IAIL 1HCVA 3A67H 5AKSA 3VI4B 2K0RA 4F8NA 1C8QA 5HDQL 1PLBA 3UTZA 3EFDL 3GYRA 5CR1A 2Q3AA 2OJZL 3IJ9A 4G8GD 3NA4A 1UG9A 1BWMA 3N55A 5CJXC 4GAGL 5IREA 3BMVA 1XV8A 5CO1A 1TO4A 3F7VA 3FTGB 5E6YA 1EVUA 2I5YL 3Q6GL 4HWBH 1FDLL 1VIWA 1W6LA 4F9PC 1UOKA 4OCRH 3QDAA 3TA3C 3MLXL 1JRHL 1ZGLA 5J89A 1RUAL 4CDHA 1E4WH 2NY6D 2JV6A 1CF8H 3EBAA 4JRYB 4YZFE 2BHYA 3CIAA 2DY2A 4B41A 2C9RA 2BFVL 4GQQA 4K5LA 5GISL 4NAMA 3RTQB 3VD4A 3QUYB 1KJVA 3DX7A 4GXUM 3ZQWA 1R24A 4KRPD 5KSAD 1J0KA 2VC2H 3KM1A 5I6XB 1NBVH 4QHKI 4NKIL 4AMWA 3ABZA 4J1UA 3ESVF 1BOGA 1HWHB 3NZUA 1OY3B 4B7IA 3KZ8A 1CD1B 4HHAB 1NFDA 2IG2L 2XN9D 2H2PD 2Z31C 3IGFA 4APQB 1I8IB 5MEOA 3PWJB 2WWOA 4WUKL 3CBRA 3ME0A 1Q9LA 4X5XB 4Y4FD 5E2UH 1FVDB 3OM3B 5HYSG 2VH5H 3MRJB 5E00B 3QZBA 4NWTH 2YUXA 4WF7A 2EO9A 5BRZB 3FT2B 3QAZB 4EI0A 2PYEB 1TTBA 3C09B 4WO4C 1OP3K 2VDLH 4U1MB 3ZIMA 3LNEA 4RH4A 4M1CD 5HHOD 5IMLA 1VADA 5L4JA 1G5AA 2A0LD 4KAQL 4PV9B 3Q8BA 5A40E 5C3LD 1RCYA 2QLYA 4OR1A 4UZSA 5JA8B 4HK3J 2IMNA 2VTFA 2XFXA 5GSVA 5ERWB 5F9DC 4V2BA 2Z4QB 4D0CB 1I8UA 1SBBA 2F5BH 2ZXWB 5DURB 4ZUWB 4CMHC 1OVZA 1UWEH 1N64H 5F7BA 1LO4H 1V3KA 1SYSB 3PXLA 3FO9A 3TZVC 4M6MH 4LKXA 2CO1A 5CD3A 2APWA 5LAXB 1NL0L 2FJHB 3O2DA 1QI3A 1ZTXH 4W70A 1F58H 4WW2B 2HP4A 2ORBL 5DD5L 4CMMB 3NRFA 1PAZA 1H3UA 1S9XB 5KJ4A 4PQXA 4JKPH 3VI4E 1IEAA 4LLVA 3KLHD 2ZX8A 4OM0L 4N0CC 3B9AA 4PG2A 4HJ0C 4GY4A 3LRSB 2XXCB 2VXQL 3GLDA 3INUL 2CBQA 3TJHD 2APVA 2XPZA 2MQ3A 1XGRB 3UBFA 4AIXA 4PJAA 5A2CA 4JZOB 5D7HA 4MJ4A 4XP9L 4HOMA 3CVCA 4GO6B 2XWXA 3J07A 4RGND 1MHHA 2YK1L 2HCZX 1BQHG 2L7EA 1ZLSH 5LGJA 1D5RA 4L5FL 1MJUH 2CKBB 2HJKB 4AH2A 2ZKXA 2FE0A 1WBXB 4G6ML 4JPKH 3GJEA 3QDGB 3F3HA 3SGJC 3QEQB 1BCIA 4K3JL 5JUEL 5DK0B 2AV1A 3MBXL 3WXWH 1S9YA 3IE9A 4HQQL 3TWCL 2DLEA 2K6WA 1H5BC 1EXUA 2ZPKL 5C0BD 2D03H 2GUOB 3NH7H 1MAML 2B08A 4RMUA 3CPLB 3T8VA 3TNNA 1BG1A 3D69B 3PQYD 3VG0H 2H32H 3EDDA 3TA3D 4YSPA 2FO8A 1A9EA 3UAAA 3CZJA 3QR0A 1SFHA 1NUDA 4AG4L 4JQIH 4LF3A 5K1JA 2Y07L 5JPMA 5EORH 5GGUB 3QPKA 4P46B 4PJ8A 3S3JA 3FK3A 4MS6A 3LZFH 1IBGL 3S2CA 3QUZA 3KBPA 1FYHB 2CO4A 2H6PA 1DVSA 3CHOA 3U1SL 1RL1A 1C08A 1FAIH 1ZY9A 4AY0A 4L8DA 4L1LA 1T03L 2OCCB 5AD0B 1TQBB 1BG9A 5DYOB 2H0JA 2YPVL 4PJ6A 4HKZB 1AC6A 4DW2L 1W9XA 3CSYA 2Z31D 4FJ6A 4WY7L 1LE9B 4YSEA 1CDCA 1FZOB 4XX1E 1ZLEA 5L9DH 5C70A 4S1SH 1XB8A 4HKXB 4NZTL 4Z5RB 1I3RB 2P45B 3ZYIA 4BCXA 2WVSA 1PZ3A 1DVYA 3RVWC 2QJDA 4WO4D 3S37X 2WW8A 2APFA 3MOBL 5I1KL 1IKNA 4HULB 5BOJA 2EDYA 2F0CA 3NEXA 5E6IA 4J6IA 2Q3XA 5IM7A 2ZUUA 4GSUA 4WV1B 1ZS8A 3IDGA 5CZVH 5DQDH 5HYJD 2WQWA 3L4TA 4LPUA 4X9BA 4HCRH 5L2JA 4OSUL 1MJ8L 5I73C 1BYOA 4JKNA 5F0PB 5HGHB 3NRPA 3LAFA 3TZVD 2ESVE 4ZMNA 2EXYC 1N3NB 2DEYX 4YDNA 1S8DB 1IMHC 5E2VL 4XNMA 4J2XA 4H2CA 4G82A 3H56A 3ZDXF 4R4BB 2YEVB 4JFXB 4DFIA 2XA3A 3ETBJ 4GKZA 1LMKA 2WB1A 3ELQA 4JFVA 4FQJL 4R7XA 1TYRA 2XQYA 1EA9C 1R3HB 3GMLA 2F15A 1J1PH 1A6UL 5A3IC 15C8H 1VERA 3TCXA 1KTJA 4N0CD 1ZHLA 4HJ0D 4GAJL 2LFEA 1L6ZA 3ASOB 3R7QA 4BYHA 5ACLA 3IDJB 1QW9A 4JRWA 3ET9F 4AVJA 3PIQA 4KO5A 5GGVY 5DJZA 3A4EA 3DMMA 3G5ZB 4KRNA 4F7PA 3AT0A 4NM8L 4N2EA 4CSTA 4UTCA 1QBMH 4Y9FA 3VVWA 3ZYOA 2A9DA 2NNXA 5KVFH 1IFHL 4G8GB 1SVBA 2H0EA 3TGXA 2Q5BA 5HDRA 5DK2A 1RMFH 5K39A 5GS0L 5H37H 3IMRA 4QI3A 2WLLB 5IMMB 3P4LA 4W4OA 5I8KH 5AKTA 1I3UA 3Q5YA 3DX8B 5TQ2L 3SGDH 2NY6B 4X9YA 1F86A 4H26A 1KSRA 2ADIB 4NT6A 3ZRSA 4ZXBC 3MFGB 2WINA 3IAQA 1BFVL 2NT0A 2VXQA 4NIKB 3ECQA 4LVNC 1GY2A 3CG8A 4TNFA 3ARFC 1AMYA 3WU1A 1BVKB 4C8XA 5EOQL 3KLAB 3IDMA 4KRPB 4RFNB 5GS1A 4DO6A 5KSAB 2HX9A 2BSED 4PP1C 4DEPB 2VDQB 4HIIB 1FC2D 2OMTA 4U05A 5FW6A 5C0CE 1