3FBKA

Crystal structure of the c2 domain of the human regulator of g-protein signaling 3 isoform 6 (rgp3), northeast structural genomics consortium target hr5550a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
138
Chain Sequence
QGAGQLRLSIDAQDRVLLLHIIEGKGLISKQPGTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHFFFPVQEEDDQKRLLVTVWNRASQSRQSGLIGCMSFGVKSLLTKEISGWYYLLGEHLGRTKHLKVARRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of G-protein signaling 3
publication title Crystal structure of the C2 domain of the human regulator of G-protein signaling 3 isoform 6 (RGP3), Northeast Structural Genomics Consortium Target HR5550A
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 32
structure length 138
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3fbkA00
4GB9A 4WWNA 5CCGE 5CCHE 4EZKA 3W56A 2R83A 3L9BA 1DJGA 1A25A 3ENEA 2CHZA 2A5UA 4FULA 3L54A 2X38A 1W16A 2CHXA 2CM5A 3PS6A 4NPKA 3KWUA 2V4LA 1UOWA 4F1SA 4PS8A 1RSYA 2UZPA 4FHJA 3F05A 3L13A 1DQVA 3L4CA 3ML9A 2K45A 4L1BA 1YRKA 4ANUA 2CHWA 2WXKA 3RPBA 4ICWA 3L16A 4FA6A 3CSTA 4BGDA 5EDSA 1DSYA 2K3HA 3TWYA 2WXJA 2WXOA 3IM1A 5H4YA 4A55A 4L1LA 3HN8A 2KI6A 1CJYA 1DJZA 2K8MA 2A4ZA 4OVVA 1W15A 1QATA 1BDYA 4ICXA 4ANVA 2Z0UA 3FBKA 3QR0A 1BCIA 4QAMB 2CM6A 1K5WA 2WXFA 4NPJA 3ZW3A 2D8KA 2NCEA 5KJ7E 3NZUA 1E8WA 4IHBA 1TJMA 2ENJA 1E7VA 4IQHA 2FJUB 4EZJA 4EZLA 3HIZA 4HVBA 3IBEA 1QASA 1V27A 4ANXA 4Y1SA 4WWOA 2CJTA 2WXNA 2WXLA 1DJWA 4PS3A 1E7UA 4WAFA 4WWPA 4Y1TA 4ANWA 2ENPA 4HLEA 4AJWA 5H4ZA 2RD0A 3QARA 3LJ3A 4PS7A 3GPEA 3R7RA 4KITB 2LHAA 2DMHA 3APCA 2JQZA 2EP6A 3M7FB 4V11A 4WEEA 2NSQA 4FLHA 4TUUA 4LT7A 4NS0A 1DJIA 2WXPA 3PREA 3TL5A 2N1TE 1E8ZA 3F04A 1DJYA 4KZCA 2YRBA 2ISDA 3ZVVA 3QR1A 3RDJA 3MJWA 1TJXA 3P2BA 3DPDA 3OAWA 3HHMA 1E90A 3L08A 3QJZA 2Q3XA 2NQ3A 3QK0A 1GMIA 3ZIMA 2Q0ZX 2BWQA 3L17A 4FHKA 4QJ5B 4F91B 2CHDA 3ML8A 4TS6A 2WXGA 4J6IA 3NSJA 5G55A 4GNKB 3R7QA 4XZ4A 2YOAA 4TV3A 1DJXA 3OHMB 4AOFA 2DMGA 3DBSA 1BYNA 3B7YA 2B3RA 3F01A 5CCJA 3APDA 4OVUA 2CJSA 2ENQA 1RLWA 4XX5A 2WXHA 4FADA 1E8XA 3N5AA 3QAQA 4F93B 4URKA 4LDCA 4LCVA 2K4AA 2QZQA 2WXMA 5JHAA 4DK5A 4KZ0A 1E8YA 3F00A 2FK9A 1DJHA 4L2YA 1WFJA 2ZKMX 3PYCA 4L23A 2QZ5A 2WXIA 1UGKA 2Y3AA 3CSFA 3NZSA 4QJ3B 5JHBA 2WXRA 3JZYA 3S2AA 4XE0A 3TJPA 4FJZA 4F92B 1RH8A 1HE8A 4NP9A 2WXQA 4FJYA 3W57A 3SD5A 4JPSA 4QJ4B 4DNLA 1WFMA 5G2NA 3PFQA 1UOVA 4MJJA 3APFA 5T8IA 3FDWA 3PRZA 4BFRA 3KWTA 4G11A 3T8MA
chains in the Genus database with same CATH superfamily
3ATDA 4ZX4A 4CVUA 4MMYB 4JO3H 2VM3A 4KHXH 4NLHA 3SCMC 1RUKH 4YHPB 2B9BA 2H41A 4KI5F 5FA4A 1SHMA 5D6CA 1CO1A 4JM4L 2VDKL 4UYPA 3Q5TA 4GKSB 5KG9B 3PGFL 3BD5A 3QAZC 4UZSA 5CZXD 4RA3A 1FFOA 1IVLA 3CFBB 2DWYA 3GJFB 2C3VB 4DKFL 3N1FC 2L7QA 4P06A 1F0LA 3VYOA 4C54A 2O93L 1UG9A 1ZSDB 4JY4B 3WNNA 3TJEH 1FL6B 1Z66A 4NENB 4Z77A 3BAEH 2G9KA 3EYFA 3RNQA 3FB8A 1QR1A 5E6RB 1NCCH 3HN3A 4O4YH 4GAJH 3FCBA 4YDJA 5E9DD 1KPUB 4TVPH 4KK8D 1JZ5A 1VCBC 3EGXA 4K71B 2RB8A 3RWFB 4TOYL 3V0AC 3QUZD 5FUCC 5G4NA 3ZX1A 1B0RB 1U91A 4FQQA 1DN0B 3TBTB 4O2EA 4NUMA 3CZGA 2WIIA 4XGZB 3L5WB 4BK5C 3BJLA 2XZAL 3BVVA 3T6QC 5ICXA 4ONGL 4PGJA 1J8HB 3MRNB 4MZ2A 3GZKA 1U8OB 3ARDB 3N41F 3D1MC 4G3YH 4LCIL 1A6WH 3QEQA 3AU1B 3GO1L 4QCIA 2F7PA 3DYMA 2OXHA 1A66A 1DJYA 2G5UA 2YPVH 1VACA 1A9EB 3MRFA 2D3LA 3HI5L 1I1AD 1TPXC 3Q8CA 2BCKB 1J9QA 2CUHA 4HC1A 3HMXH 3MJ9L 2P5ED 3P9LA 43C9B 3ARQA 5CEXA 3SGJC 4XMPL 4YJZL 2JIXD 4GRLA 1QACA 3EADA 2AHIA 1LXMA 2WO4A 4AX3A 1U2YA 3PCYA 4WGWB 1NKGA 2NY3C 3F12A 2ENQA 3UTSA 5AZ2H 1OT2A 4NQDD 2P80A 3UP6A 5I1AB 1DCEA 5I18L 3X11B 4YO0B 5DJ6A 1ZA6A 1QTPA 2GUOA 5I8CA 3NQIA 3LDBC 3PQYE 4LLYA 5KJ4A 5EU6B 1AZUA 3C6LC 4L9DA 4XWGL 1T22B 3I6KA 3CDGB 2ZUXA 1ZY9A 2QVTA 1QWNA 2XN0A 5C07A 1LP9B 5CAYB 1PEWA 2ICEC 1HH9A 3V6OA 2Y5TA 5B1JA 5I71C 2ATPA 4HHGA 1HHJB 5F0PB 4MJ6A 1XGQB 1HXYB 1LO2L 1DQQB 2Z7UA 5J1AB 3LZQA 1S7VB 1J5CA 4JRYD 1T03L 1OARL 3BZFA 4K7PX 3GGWA 1JGDA 3WFBL 1N8OE 2X38A 1MCEA 3GMMB 2XQBH 1N64H 3MRDA 5D7IB 3DVGA 2AKRB 3NCJH 1GIGL 2JNZA 1R24A 4H25A 4N2CA 4GLRH 1QPKA 2M1KA 5JDJA 1MRFH 3AAZA 4BA8A 2FQDA 2J88H 3KAAA 1NBZB 5JHDA 2XRAL 1B0IA 5CEYA 1UGNA 5CZXC 3WJMA 3MXWL 2ZX7A 4YGVA 2ZUYA 4IOSA 3HS0B 1ACYL 5IM7A 5DQDH 5D1ZA 2R69A 2A4ZA 5LGKA 3STLA 8CGTA 3ESUF 1FGVL 3MGOA 1KTKE 3GXIA 3MN8A 3PWNA 2Z3FA 2F8IA 5C2BL 1UD8A 2J5LC 4JRFA 5TQ0H 2GBTA 4EN2A 1RD6A 2BSED 3I9GH 1BMWA 5C6TH 1I3RA 1AGEA 4YDVB 4R4FL 4HOXA 4I88A 1Q94B 3RWCB 1OP9A 1CVRA 2QADD 4YXHL 2R2EB 3IJSA 1IL1A 1GS8A 2OM5A 4FLRA 4GG8B 4LVNC 1UXWB 4F8TA 3U0PB 4YVUA 1QWUA 4ELMB 1QFWI 5A6LA 4J4PD 2E8YA 2HTKC 3DARA 4I48B 4WEEA 3IK2A 4AXWB 3JYBA 1DVSA 1E8ZA 3AT9A 5I1IL 3HG2A 2EC9U 2UX7A 4DJMA 1UKSA 3CFDB 4HIJA 2Y25A 5AVSB 1NMCC 4U1HB 5C0CA 2NY7H 1IGML 3QHFL 3VFNB 5ACZA 5E5MA 1DFXA 4FFZL 3WE6B 1TNMA 4ZNEE 1FP5A 2BNRB 1F00I 1FG2A 1L0YA 1YJDL 2OYMA 2RALA 2YOAA 3CC5B 1YY8A 2B77A 1ANUA 1ACXA 2I9LA 2IGTA 1X9RA 3BO8B 2TRYA 3ET9F 4P3DB 3ZMEA 4ZAKD 4AEIH 5GS0H 5KUKA 4X50A 5DEGA 3GC3A 2CBOA 3IAPA 2KPWA 4LOUC 2WYTA 4HH8A 3UAJC 2Z64C 5CJQH 3KPSD 2BNQB 3CDZA 5HDBB 3SCMB 1I8KB 2J21A 1X7QA 4DK5A 2F7OA 4JVUA 4NP4H 3MRPB 4UNIA 5DEJA 1ZANL 1F3DH 3LEVH 1JYXA 5KVMC 4L4TD 1HC1A 2CGRH 1FZJB 2X70B 3JV4B 3SBWC 3ROLB 3D85D 4PI2A 2FVNA 3MZGB 3FQXA 2EDRA 3GM8A 5CP7A 3VTAA 1PZ2A 2YN3A 2X2UA 4FRWA 2NY1D 1GH7A 1QLRB 5C08B 3P40A 1JPSH 1FV1B 2WLJA 4YDIL 2HJKB 4PJIB 3VXNB 1OAJA 2H1XA 1AZCA 2DI7A 2AEPH 4NQXB 4P05A 1QO3A 1QUNB 1KGUA 2VAJA 4M8QA 4BQ6A 2ZP9A 5F9OH 1QNZL 1E6JH 1QSFB 3JWDH 3ATAA 3MUUA 2AJVH 4L3EB 3S3PA 3CZNA 1MCQA 3LRHA 3VMOA 2BSCA 4MXQC 1WWWX 4QRUA 4IHOB 1R0AH 2YBGA 1YY9C 2NRDA 1FFQA 3HNTL 3MJ8B 3TVMA 5I1HL 5KSAD 3WN5C 2OULB 2NY5C 1DJZA 5LBSL 2IFGA 1GGBL 2DQGL 4LCCA 5I0WA 2KZBA 3IJYB 3RX9A 2ZUWA 3FBKA 4TNVK 4D9LH 1XHHA 4F33B 4IGBA 5TFSL 1ZV2A 4HIEB 1I4FB 1TJMA 2VLRA 2F54A 2ZOOA 3E3QE 4HJ1A 4WHTB 2Z7YA 1MSPA 1I8UA 3O3AA 4GMTH 4Z7OE 4P5KB 4LHJB 3A22A 3DROA 3RUGF 4RFEB 3CVHB 4JCWA 1OPGL 5E8DL 4NKMB 4JM2D 4S0SD 1CMOA 5C09A 1ETJA 1TU2A 2MNWA 4FN0A 4HCFA 1MAKA 4XVSL 1OAKL 4FOMA 1C8QA 2GCYA 2AEIT 3RX8A 2YD2A 1GPOH 2NY3B 3RPKA 4N6RA 4WU5B 3SGKA 3MRRB 1KELH 3O2VH 3UTZB 2IAND 2G2RA 1LK2A 2A6DB 3IMTA 3B1UA 4UWQB 4N9GA 4BSVB 3VM5A 3MYJB 3LDBB 4OM1L 3C6LB 2VO5A 3KPOA 3V0FA 1SDYA 2VC2H 4WJ5B 3RUGA 1E4KA 2ICEB 4JFOB 3LKQB 5I71B 4Y5XA 5FYJE 1R9FA 4PRHA 4MJID 5CCJA 2TSBA 1N8ZB 2D4DA 1A0QL 1ZGLB 2ZPKL 4WSJA 4PJ8D 4PJ9D 3CX2A 1Q9KB 4ADGA 3FULA 3T2LA 1NGPL 1DBKL 3LVTA 3T09A 2BVEA 1WK0A 4B0MB 5DMJB 1KLUA 1UVQB 1IFHL 5JHDE 3WFCL 1ZT4B 3ARRA 3WMPA 5J6GA 4S1SH 2HRLA 1FL3B 2VDPB 1J1OH 5DVLA 4ZMYA 4JZJC 4UNUA 4PBVC 4IBLT 2QDWA 1ZVSA 4F92B 5CCKH 3KPLB 3LTVA 4X7SH 2YK1H 3B2VH 2VXVH 5E2UH 3X13B 2Y7QB 1IBGH 2ZAHA 1ZD6A 3L4WA 1XZ0B 4PJ5D 2I85A 2IPTH 5C6WH 3RGVB 4Q58C 3CXDH 5D7HA 5JNYA 4Q9CA 3LRLA 3M1OA 4JZOA 1YEEL 3IXAB 3QXTA 2J5LB 5LCVL 4MA3B 4XP4L 3OMIB 1S5IH 4C8XA 4JKMA 2VR9A 2JVUA 3S35L 1IIIA 4Y16A 4MZ3A 3GS4A 4ANUA 1KB5L 3LH2L 3NJMA 1UC6A 4DP1X 4S1DD 3NJKA 1UUNA 2BHUA 3P4MA 4WO4D 4CBPA 2ZXBA 4HUVA 3OSKA 3I75A 2Z4QB 4LVNB 3KLHC 2K3HA 3P30H 4K7FA 3MCLH 5I76B 3NA9H 4PQXA 3QXDB 2BP0B 2Z8SA 4K07A 4P48A 2XA8H 3FHQA 2KERA 5GGRY 3D0LA 1YYML 5C86A 1RUPL 5AW9B 2CIKB 1MLCA 2CDEB 4ZTPH 1C1EH 1T3FB 1UB5B 3ABKB 3T3PE 4ZUSA 1CTMA 4LE8A 5F7BA 4OBSA 2D03H 1NMCB 1MPAL 4P46D 4FMFA 1S3KH 5I66A 1KBKA 1TZIB 1CIDA 1G7LB 1OLZA 4FA8A 4NHUA 1F1AA 4G42A 3CUPB 5JPMA 1ZGLM 1N10A 4XXCA 4X7TB 5JXEC 2V5YA 3LXAA 1WZMA 4LSRL 2N3JA 4B0MM 4QHNB 3U1SH 1KFAL 3WN6A 3R19A 3RZCA 1IAII 1U93A 4MXVF 1S9KC 3REVB 4DGVH 3DO7B 3IXTA 4MB4A 3IRCA 4Q8BA 1U21A 3LZPA 3RL2B 3N91A 4HSQA 4R97C 2QV2A 4KC3B 5C0AB 5D6DC 2OMVB 3DO4A 5MEQA 4LMQI 3BVWA 3PIQA 5FCUH 4XN8A 1EEYB 3HR5A 4FQHA 4OGQC 3IKCB 3RVUD 1FHGA 2XKNB 5ICYB 4A6YL 2CRMA 4OBRA 3QWRD 3LQAC 4L3CA 2OMXB 1UOKA 3B83A 2DKMA 3UADA 2RQEA 1EO5A 2F8VA 3NFNA 2N59A 2Y2TA 3PG2A 1TZHA 4GQQA 4PJ8C 3VRJA 5CHNB 4ODTH 1JWSB 2ZAGA 1F4YH 3VW3L 4XE0A 4RRPA 1PZDA 2K78A 3NA4A 1R3HA 2BINA 3LS4L 4NUJA 3W57A 2VLME 3WXVL 1AFVH 4KKAD 4DO4A 3DX8A 4FNUA 2APXA 2E5EA 1IJ9A 1NLDL 2CCVA 1CDUA 3WN5B 3DOSB 4BFRA 4OLVL 2AC0A 3T8MA 5IWLC 1XF2B 1FPTL 2BSBA 1K2DA 4MDRA 3ROOB 3ZTJH 2CM5A 1K8DB 4X5WB 1TXKA 4TL5A 3U2JA 2YD9A 4KX7A 5FFLA 3WV0A 1FVCB 2H26B 5IUCA 3MRBB 3Q6GL 1N3NA 3GSNA 2WCSA 5AYQA 3PQYB 3X12B 3ZT7A 3RA7H 3VAEA 1NFKA 4YEFA 4XBMA 4R4NC 5AD0B 3B6SA 4GAFB 4HS8L 1BBJB 4TSAH 4ZO6A 3IU3A 1CYWA 4WNJA 3LPGA 4S1DC 1HWHB 3QUXD 4LLWA 3H9HA 1YPZE 4WO4C 4JFDD 1OTSC 4I77L 1CLZL 4NNPH 4WTQA 1SOXA 1CIUA 1HKFA 3MJ7A 4EDXB 4J3UA 5IT2H 3KYAA 5L9DL 2F7RA 5BXFB 2XNAA 1SYVB 1OAUL 2J25A 1CGSH 4KXCA 3GT6A 4PRHE 3SYQA 2XVLA 5A16A 2ZXQA 1MF2L 1I85C 4PJ6A 5DFVC 5KBMA 2MWCA 5LGJB 1TFHA 3VFSA 2ZWKA 4P2OB 2YC1B 3ILEA 2XETA 1F18A 5LG6A 4AKPA 1TTAA 4LEEA 2P8MA 4BM7A 1UCBL 3PXLA 2H2SC 3P3YA 2YOCA 4R96B 4ZUTA 3WIHL 4DZ8A 1D9KD 2V2WB 4Y9BA 3FQNA 2X09A 4QHPA 3DURA 2DWEA 3BYYA 3FUHA 4S1RL 4YN3A 4J3OC 2G3MA 3MRGB 3C5ZD 1BM7A 3GMOB 3L2NA 4X8GA 1G7IA 1U3HC 4JZJB 3BQUC 2F8OA 5KVGH 1CFNA 3TC9A 4EN3A 1Z0NA 2ZUQC 3DYPA 3FB5B 3HCVB 1M4KA 4WEBL 4ZTEA 3F65A 3HC3L 1MQKH 2JE8A 1NPUA 1IU1A 5DI8A 1FNGA 4HXBL 3TO2A 3FRPA 3WHXB 2R7EA 3H9SA 5MENA 4X7DC 2ZXGA 4G8FB 2VLKA 4KZEL 4OKVA 2Y7MA 2B20A 4A7QA 1UT9A 3U83A 2XICA 4WHYH 3ZK0A 1OK0A 3M45A 4ZFFA 1X44A 5F6HI 1MFCH 2I5YH 4N0UA 4K73A 4DNLA 1S9VA 4XO5A 3IGUA 1BJMA 3C5SA 1QKZH 1NCAH 5T3XL 1DZBA 3SQRA 5I15H 1Y18A 4U1SB 3GSQA 5IQMA 4KKAC 3FQWA 2H3XC 3KNBA 3L9YA 4B9JA 4KK5D 2YD5A 1NDMA 4BSJA 4YHML 1A4BA 4BZ1A 4FQLH 4I5BA 4M5ZL 3A67L 4YNYA 3V0GA 2J8HA 5LUMA 2NZ1A 3ZUNC 3I2CL 2YHGA 1A2YA 4RDBA 4HKXA 4QIRA 1ZE3C 1CK0H 3D3VB 1B6DA 4P3CL 4CDGC 4U05A 1DBBH 3CN2A 5I5JA 1NH6A 1F5WA 1G5GA 2A6KA 4BK4A 3TN0A 4IS6A 2OYLA 2UUDK 5DD5L 3ABLB 2OMZA 2L0DA 4S2SB 1ZKAA 2BSSB 2F7IA 5B4MC 3QO1B 3EGXB 3ZIYA 5K39B 2CCWA 5D7JA 4N90D 4R2GD 3F2LA 3FONA 4EXPX 3WFDL 2R0LH 3TGXA 4UTAL 4FQQB 4LOVA 1JRHI 4L0YA 1WFOA 4G71B 2WIIB 4TSBH 1GKEA 3PV6A 1BZ9B 4FFWD 4HUXA 1KCUH 2NW3B 4XP6L 3KWVA 1PJWA 5FYKU 5TE7L 4D0DB 4B9CA 4XWOD 5I75C 1MVFA 2QPFA 5L4JA 3GI8H 2APVA 3WNPA 1UXSB 3GSRA 4P9HC 4I7ZC 3IPFA 2X4QA 1HQ4A 1IUZA 1QEWA 3NP3A 1T83A 4WV1C 3L3GB 5TDNA 3EDKA 1UHVA 2XZQH 1P4IL 1M3IA 1MKFA 1YSOA 3IU4L 2D0GA 3GBMH 4G6FD 4HAFA 4ZQKA 3EYUL 3AREA 3NGBC 4AE1A 4FA7B 4PYHA 1SDDA 2PW2B 4GXUN 2EDXA 2FATL 4OFKA 2WXGA 4W93A 4WIQA 5B7MA 2K7PA 2XY2A 4Z7OB 4Z3EA 1I7UA 5DRWA 1QBLL 2JI2A 4TVPE 4A68A 3DETD 4PCKA 3C5ZC 3O81A 5DS1A 3F12B 1O5DT 3EAKA 4K94C 3LCYA 2WN2A 3NUKA 3RTQA 3NPZB 1ZLWK 4OH2A 5GGSA 4MX7A 4P4KA 5MEPA 1YC7A 1X9LA 2X1XR 3UAAA 2JB5H 2L7EA 3EGSB 5EWIH 3RGBA 4ODHH 2CGZA 1F58L 4LBEB 5FR3A 5J8OA 3W5MA 5TDOA 2H32A 1OP5K 1JGUH 5E2WH 1Y1UA 1NOAA 3TCLB 2Y5TB 4TMPA 4TQ8A 4UT7H 3WCYA 5C92A 3FO2B 5CR1A 4MAYD 4MJ6B 3JT2A 3U6XA 4WEMB 3GXMA 3T0EA 1XF1A 1FLRL 4YXKL 1KCSL 3UYPB 5EUKB 1NAKH 4MXWL 4YZFE 2APSA 3HRPA 2AJ3A 3UTTA 3ES6B 1VFAB 1CZ8L 3PAYA 2NNRA 3AWFA 1R33A 4O02H 2MCPH 1PLCA 4Z8FH 1MHPH 3IKKA 3UTPE 4PSPA 2BVQA 3MOAH 5HYJE 4QI3A 1MCPH 3MRDB 1EDYA 4M5SA 4K8RL 2FLBT 5M94B 3DSNA 1EDQA 1HKLH 1H3XA 2G3XA 2UY7B 4NKIH 3C5XA 4GT7A 3RY6A 2WVSA 1UACL 2EXYD 3CCHA 3I50L 3ME0A 4X4XB 4YGVB 2GSGA 2MSPA 3UYRH 1M05A 3D18A 3K2KA 3KPNA 1KTCA 1NEZA 3CNKA 2Y3NA 2DJ4A 4AIZA 3MGOB 3KEHA 4XXWA 3KXFE 2F53D 3RAJL 3Q6FA 15C8H 5CINL 2XX0A 1KLFA 2QFRA 3A47A 1PX8A 1TQWA 2HX9A 1D6VH 4HJJH 3HBZA 3SDAD 2ITEA 4X98A 4EVNA 2VXQH 1ZVHA 3S98A 4V1DD 4R2GC 3FTSA 1EJ8A 1A6AA 1YNTF 4ANWA 3NCMA 4KJYA 1U3HB 3BP7A 3BQUB 4GKNA 3DMMD 1FDLH 3B8YA 2CZNA 1N19A 4UINL 2CR3A 2EXWC 3P69A 1QVOA 2ZUQB 4OCWH 5F88B 5D5MF 1NOLA 2VLKE 1JZ3A 3F04A 2YKLL 1DDHA 3DGCR 1S7QA 2H1PH 3B7SA 3FU6A 4UDUB 3QFJA 1HYSD 4NQUA 1X6NA 3KPPA 4B9IA 1MI5B 3V0HA 4B9ZA 1F4XL 4ELDA 1LK3H 5BS0E 2BVOA 3IETA 2X2YA 1U8MB 2IWEA 4E9SA 4N0UE 3OL2A 4BE5A 2I60H 3JTBA 2VXTL 4NT6A 3T3PB 2NY0D 1IEBA 2HVJB 5C0JB 4S10A 5HYFA 1FQ9C 1YNTA 4NKDA 5ID0A 3O4LA 1QQDA 2XIIA 1A7QL 5C0RL 1XTMA 3QDGD 3C6SB 2DQEL 4P0DA 4ZUUB 4R83A 1Z5LB 2WLNA 5D5MA 3GBNL 3EBGA 5BZWA 5L7XH 1WAAF 2KMWA 3IJ9A 4E41E 1THCA 1C12B 4QR7A 2OMWA 3CSBA 4OCXH 1L3WA 5DS8B 4O5LH 3FUFA 2FJSA 1QAWA 3LIUA 3FOLB 4JG5A 3ZDYE 1KYOJ 5EC2B 1HL9A 4Y7OC 3VXRA 3E7JA 4OFYA 1EEZB 4N9OB 4AGLA 4KKCD 2DS4A 3N1MC 1KDIA 2WLLA 4PBWD 5FM5M 4IIZA 4CC0A 5DZOA 4ONHB 3N40F 4DVRH 2LLGA 2RFXB 2WN3A 2A9NL 4R7VA 4U1IB 2G9HB 4XN9A 3VFWA 5I0YA 2CO7A 3AFLA 4PJFB 2HXAA 1ILUA 1WH0A 3NFSL 4WNSA 3IVKB 4XOEA 3SE4A 3SDCD 1ORSB 4OZ4A 1MFNA 1WAAA 3DRQB 1D7FA 4G5AA 5KZCB 1WA1X 2AVGA 1RK1A 4QPEA 3WKYA 3KGRA 1ND0A 1TETH 2QT6A 1CICC 2VUOA 3P0GB 5ANHA 3NIFE 4Q9QL 2VLJA 1EANA 3HNVH 1NC4A 1FO0L 4GXVH 1O5PA 3MA9L 4H13C 5EPMA 5I75B 5JOPE 4G5ZL 5JIPA 2VAAB 3D34A 4N0FB 3HN8A 4X8JB 2J55A 2KZ1B 2BXZA 3CFQA 4H8WL 4YSQA 1W72H 5EOTA 4Z76B 4WV1B 5TH2A 1UKQA 3NN8B 2EINB 2VN5A 4X5QA 4EZJA 4WLCA 3GXFA 4BFGA 4GSDL 1W91A 5IQLA 1HJBC 3BWAA 4GSRA 5J5EA 4JG9A 3QIBC 4B60A 3LNGA 3LZNA 3CMGA 4R5TA 5BW7A 2YZ1A 1F6AA 5F3BA 4UQ2A 3NIGF 3CFJA 1AOHA 3LS5H 1FN4B 2F74B 3JTSA 4MJ5A 4HHAB 1MRCL 4HOZA 2ZOKA 3RVXC 3FT3B 2E4TA 2ITFA 1FIGL 4E42A 1MJJB 2KZKA 2HH0H 3BVNA 5CSZA 5DC9B 4GFTB 1SLUA 3POHA 3OAWA 4N9GB 1YPZB 3B9KC 5ITBL 1QPPA 1KLGB 2E59A 1RZKL 3CU7A 3PNWA 2OMYA 4QT5B 3EH2A 2IDSA 3T0EE 3U9PL 1VESA 1UASA 3MV9A 4LPYA 4AKQA 4NM8H 3RKPA 2APTA 3EJRA 4UIKH 4XMUA 2CO6A 3SDXE 5DGQA 5L88L 1KYDA 2X4NA 4DP8X 4JL2A 1AAJA 4UV7L 1HXKA 2VRQA 3O11A 3IDYC 4QHUA 1KXQA 5DJCA 3MBXL 1F6FB 3MACH 5EU4A 2FBOJ 5E8OA 3ULUL 5J11C 1D6EA 4A63A 1JMXA 5LDUA 5I6MA 5DO8A 1MWOA 2EUVA 1BEYL 1JERA 2ZKMX 4L23A 4JR9L 2DI8A 6PAZA 4PGDB 4FX5A 4XVTL 3X1FA 5DK0A 1RUQH 2YXVA 2DH3A 2CKNA 2X1QA 1YAIA 2AGJH 4UQCA 2DDQL 3WKNA 3ZQ9A 3G9AB 1ODUA 2AXGB 5DTFB 1J8RA 1E2ZA 3D39E 4XBPA 1E5ZA 3ALXA 1P4UA 4LCYB 2WYIA 1S4IA 4DAGL 3TA3C 3EGDB 4W4NA 1SY6H 5I2IB 3HFMH 4PGCA 2AP2A 1PLGL 4JZOB 3US0A 5E1AA 4KZDH 4HDIB 3AG1B 3GHEH 3OR7A 3V10A 3ALPA 4FQXA 1YEHL 3L4ZA 4W9EC 3WGVB 4LL4A 3KCPA 5EO0B 4O58L 3OR6B 1LO4H 4PJXF 4XP9L 5AKSA 5LN8A 1E67A 4Y4KC 2OCFD 4XN4A 5T3ZH 5LQBL 1NGWB 2W0LA 2AK4B 1X9QA 5IV2A 5ESAB 2AITA 3FW6A 3IFPA 5E8NA 4PVLA 1HHIB 4OCSH 4ANVA 1M9SA 2AJUL 1OCWH 3GSVA 4LEOB 3FT0A 1FLTX 1P1ZB 3EJYD 1HINH 8PAZA 4AI7A 4PY8I 3V0VB 4DPCX 1KPRB 2DM3A 3ZUCA 5E00A 4ZPTA 2FWOA 1O6TA 4YHNA 1CXIA 2E6JA 3B3BA 3AS0A 4GG6F 1OSPH 4PS3A 1FYTB 4QKXB 3RIAK 2XPGB 3T0BA 5C0BA 3PJNA 1SYSA 2Y5QA 1T0PB 3P73A 4GUPB 2LLNA 4IRSD 1RK0A 1P7KB 1E9QB 7FABL 3BEWB 1XSOA 1SFDA 1J0HA 4Q6IA 2XX1A 1MIMH 1X5MA 2Q0ZX 1UD6A 5AYUH 3PV7A 4JAMA 1JZGA 1AIFA 5D1QA 4IEFB 2BM3A 1PQZB 3TH4T 4PBDA 4WWKA 3D0VA 4GG6A 3ARFB 3V9FA 5GS0C 3ISYA 1TCRB 2BVYA 4X4KA 5AVWB 3VB8A 4X8XA 1Q9OB 3PIQB 2PWHA 2X2HA 3VFRB 1HTYA 5J12B 1HWWA 1ID2A 4PVMA 2ZKXA 1WAAE 2G3NA 4H8HA 5SWZA 3QDJB 1OY3B 5DD0H 4PCYA 5FYKD 4YHZL 3FQ1A 2IPKB 4NPYB 4OLZL 1U41A 3EH1A 2VLJE 1U8HA 3D87B 4G7QB 3BZDA 4UUJB 2LU4A 3JVGA 3IYLW 5DJXB 4BWTA 3AM8C 8FABA 1X4YA 3FT4B 4W6WB 5SX5H 2LQRA 3WTUA 5F96L 3QH3A 3AY2A 5GISH 3WTVA 3BKJL 2FJHB 4QRFA 1VGEH 2VZ1A 4F9LA 3MVSA 4XPHL 5KYWB 5INCA 5L0QC 4NJ9L 4G9FD 1QTSA 4NBYB 2OR8A 4K2UH 4DO6A 3TBYB 4FQIH 4YFDB 3OG4B 3WEOA 4AUUA 3F6JA 1T04B 3JWDC 3RHWF 2VDPL 3PPEA 4XH2A 5DQ9B 1N3NB 2MHAA 2P52A 1WLHA 4TQHA 1FI8C 2VISA 3QIBB 3IDMA 3L7EB 1H9DA 2EUXA 3FOMA 5T1KB 1C08A 1KJVA 1Z9LA 2QR0B 3RQ3A 4DHLA 1IGYA 1KGCE 1QRKA 1U8JA 4GUOA 2Q76B 4XPGH 5IOKA 3H9HB 2R2HA 4UOW1 1LGVA 1T5KA 3BPOC 2PCPB 5FKAA 2C26A 2HRGA 2W88A 5IJDC 1GTFA 4UTBA 5L2KA 1GS6X 2BNRD 3B9KB 4P57A 2AERT 3MV9E 3DJRA 2DQUH 5CGMA 3T2NL 2AXJA 4PV9B 3LRSA 2F19H 4UOJA 4NO0D 5HYJB 1MCSA 5CJBA 2X12A 3QORC 1JN6A 4RBPH 3RFRA 3WU1A 4QTHA 2P5WB 3RRQA 3SDYH 4KH9A 3E6HB 4K23H 3Q8EA 2CK0L 4WJG3 1ZCRA 3IDYB 2WQXA 3QJHA 1GYCA 2NW2B 1J12A 3I6GA 3VFGL 1DLHB 1W8NA 2NDGA 3TBVB 3WAJA 4GQRA 1E9OA 3X2QB 2IO5A 3OMNB 1BQHG 3KXFB 3VU1A 3RX5A 4LLQB 3SQBA 3EUUA 3VO0A 1GR7A 4APXA 2NYYD 2BFGA 1UWYA 2HTLD 4HJGB 4BQ8A 4HALA 3QEUA 4ZUVA 1VFOA 1U8IA 1JXKA 3VH8B 3W82A 2AZUA 5C08D 4K3HA 4P2RA 3ULVH 3UC2A 5JORA 3PHAA 3LXCA 5FOBA 1EFXB 1BD2D 1H3PH 4PTTB 1QRNA 5ECGA 1WEJL 4OFDA 5DURB 5KS9F 4ONFH 5TQ2H 4A2FA 5JUEH 3F7PC 2HYMA 4AH2A 3TA3B 1FNGB 3GK8L 4UOZA 3B2UC 5PAZA 2YKKA 4KMTL 1QSFD 1MAMH 4L3ED 2VLKB 4X5XB 4GQZA 5J6GB 1T66C 2H3KA 5GS3A 2AXWA 4UOW0 4JDTH 4JKWA 1MFEL 5IY5B 4X0KA 5BS0B 1TVHB 4ZFFB 1JV2B 1RH8A 4P59L 5KOVC 1UYWL 4N0UB 1DZ0A 1ZHNA 1S7XA 1EERB 3QG6B 3QDAA 4NHCL 2Y2YA 3C5SB 6FABH 1XIWC 4F2EA 1UM6H 1JF1A 5HHMD 4ZS6D 4ZX3A 1G6RH 4O51A 4WWNA 3P2DA 5F1SA 3Q3GB 3SOBH 5KS9A 3SGDH 3BMWA 2PNDA 3VFTA 1G7QB 4JHAH 5FW7A 3OQRA 2X9WA 2RCSL 4AYDC 2K70A 5KVGE 2WGNB 4FDWA 4DW2L 4TVUA 1DBML 1RZ8A 2P7TB 3TASA 3TO4D 4E41B 1SXAA 4JPKL 5I1KL 1DUYA 1OSZA 2ARJB 1RQ5A 2YPKA 3VX0A 4M6OL 2YRLA 2CKBL 2DLHA 2C9SA 3NESA 1UEYA 3ZDYB 3TT1H 2BW5A 3CBRA 1E3ZA 2J12B 3BHBB 4DP7X 4ZO8A 4TUOB 2A6KB 4P3WA 1URIA 4KNTA 3TEYA 1ESOA 3FCGA 3ALWA 3CPLA 1EXHA 1FORL 3D12B 2K4WA 4YHOH 4QAMB 2WNXA 4ALAL 1JD9A 4JKPH 1ZHLA 5I1JH 2F7QA 4WDIA 1ADQA 2PXYA 4RAVA 4IQHA 3LKOA 2KUTA 5D1QE 5AZEL 1LYQA 3VSQA 5JIMA 1YMMB 5FYJU 1X3DA 5DLLA 1GZPB 3K4ZA 4NZTH 1DR9A 3IGKA 3S34L 3QRGL 1NEZG 4YAQB 1VSCA 2LFGA 2J43A 5AW5B 2AQTA 1EEUA 3VGFA 1O0VA 1AGDB 1SOSA 4G83A 3CMOL 5A6IA 3I6LE 3NIFB 4GAGL 1BQHB 1KF9B 5HGBB 1HQ4B 1P9MC 2Q8AL 4BH7A 3K71B 4L05A 3D52A 4UAOC 2Q3AA 2HCZX 2WV3A 3AUWB 1FHNA 3ARTA 4OGYL 4KO7A 5DEZA 1E2WA 5FA3B 3T77B 1HIML 5FO7A 2IJ0C 2UZYA 5AFAA 1MZYA 2Y24A 4OCNC 4AUYA 3HHSA 1S9YB 5B38G 2WYHA 1GOGA 5EF0A 4JPIB 2QMKA 5A2FA 3RGVD 2IH3A 1YAZA 4AOFA 5DJZA 5T33L 3QNYB 1DUZB 1ZTXL 5DZJA 5GRYA 1EZLA 1TG8A 2YSSA 4X4MA 4XN7A 4F8LA 5KSVA 2VZOA 1RZPA 3U0TB 5BQ7B 5KW9H 5L0QB 1YECH 2R1XA 3W37A 1IKNA 4NIKB 1YEGL 1HDMA 1A7PH 5SX4I 5L6YH 3FU0A 2DZEA 3FU7B 1RMFL 2DH2A 4JRXE 3WHE1 2WQRA 1PG7L 3BAWA 2D31A 1AR1C 3P4LA 3NMEA 3W39B 2AJZA 1LDPL 2TSAA 2E9BA 4MVBC 2MOQA 2ZKHL 5B3JE 3LYRA 4LBAA 1QI4A 3T0EB 3APFA 2A9BA 2Q5BA 2XQYA 3RWJA 5FGBA 1QEXA 1T7VA 2R56H 3FQYA 3MQIA 3LHPL 4NYLA 5E99H 1RUAH 3O3DB 1J0ZA 1ZS8A 1RIVL 3SDXB 3NTCH 3RG1C 2VMFA 3PAZA 4JEGB 1ZWIA 1XGUA 3BPOB 2FJGB 4FTVA 2AW2A 4N8PA 5IR1B 3NSYA 1QP1A 4OUUA 2YAPA 5DVPA 3O6ML 3T0DA 4YX2L 1CR9L 2DD8L 1RJLB 3L13A 1BZDA 3VRLE 2B1HH 1PZ5B 4TQPA 3LEXB 2DWTA 4YBHA 2YR3A 5D70L 1F90L 2VOTA 3QORB 1DE4A 2YS4A 1YEJH 3GKZA 1PNDA 3T4YA 3D18B 3UPAA 1QNIA 5FF6B 1WFUA 1MIEH 1QYGH 2VDRL 5CP3H 1BSIA 1A3LH 5DQJA 3D39B 1KJ2H 5ISZB 3Q6FB 4YLBA 5H35A 3S37X 2AAAA 5EOCH 1LMIA 3UMNA 1U95A 3G5YA 1IGTB 5BRPA 4BFOA 3BWUC 1WZKA 2IDCA 4FTDA 4JFPA 2DLFH 3NK4A 2DKSA 4DP5X 2VC2B 4KRMB 1EGJA 1LE5B 1DVFA 4AV5A 2D7QA 1QRNE 1HHGA 2ZUVA 2DIAA 5I1LA 4B7LA 1L9RA 5C0IA 4HT1L 4PRIA 1B3JA 3BE1H 1QVOB 1EA9C 3T08A 3WHE0 1CBJA 3MRKA 2Z6FA 5B38B 4HPYH 2J6EL 3BD3A 1S7QB 3MLUL 4IRJB 4JZNB 5EIIG 1R3JA 4XRCA 5ENWA 1D5IL 3N42F 1BPVA 4F7CA 1HS6A 4F7TA 1JHLL 4EI5C 3TWCL 5IJVB 2C4XA 3QEHA 4G6MH 2C1PB 3G9VA 1X5XA 1IC5L 4QNPF 2IGFL 3OF6D 2B15A 2ITDB 2RIKA 1NGYA 4GO9A 2CLVB 5FWQA 4XNMA 2IIJA 3SBQA 4MD4A 3SKJL 1TJIH 5KS9E 1AGCA 3ARXA 3B2MA 3ZMRA 4CBZA 3MUZ1 4JGNA 2W9EL 2NLJA 2P1YA 3NJHA 4JQIA 4TVSa 3SE8H 1SF5A 1XIWB 3DXAA 5IGXL 1L0PA 3K6DA 3IFOA 3LQAL 3MNWB 4JPQA 3PDOB 1ZDQA 3V5HA 3NACL 3NCBB 4HMEA 2V2XB 2BOLA 4XO4A 4KBPA 5DD6A 2VDKH 3NZSA 4MWFB 4EMZA 4LCUA 3PGFH 4RMSA 3SKOA 3UJJL 4EOWH 2F1AA 3PWJB 5E2TL 3K7UA 4QHLB 4Y4FC 3VGBA 4ZW8A 3GMQA 4L29A 3ZTJG 4DKFH 1BVLB 4JPSA 3U25A 3QUYC 2HFTA 4HF5H 3ZYIA 4BZ2L 2IV9A 4M7KH 3ZHKA 4GMSL 5IBTL 4IKKA 4FG2A 1KTBA 1CLOL 2GVYA 1KWGA 3VWJA 2DI9A 3QUMA 5IQOA 1BWWA 2C7UA 2OX5A 2ED6A 1CTNA 3KD4A 4JFXB 1U6AH 4LU5L 1RSYA 1S78D 3HPJB 5GHWH 4EI0A 4TOYH 1ND0B 4M03A 2JF1A 5IIEA 3FK3A 3LN5A 4HHWA 2IH1B 4Y8DC 1BFVL 5ANMA 4DUWA 3PGDA 4P2OD 2XZAH 1V3KA 3HE6D 5BVPL 3BGMA 4ONGH 3W2DH 4QWWC 5K59F 5D9SA 4LCIH 1CU4L 4LGRB 5KVEL 5AOIA 3RVTC 3GO1H 3GZOA 5EOTB 4S0TD 3IF1B 4NGHL 1DL7L 1SN0A 4JN2B 4UAOB 3WJLA 2ADFH 4Q6YA 3DUUB 5BVJB 4WUUA 3HIZA 4KH2A 5DVNA 3HI5H 3M8OL 4JFFD 4RQQB 5K33A 3KYOA 5D7EA 1SBSH 2Y07L 4XP5L 3A6CL 5EIIB 3GUTB 3ZKMC 3TV3H 3BVTA 3K4DA 3LZFL 4ODUA 1HK6A 1P5VB 3CFJB 4RA0C 1C7SA 1UH3A 1T5XB 2XN9E 4XMPH 2AV1A 5EU7C 3GPEA 4XHJC 5ITFB 4I3RH 3CQQA 2I07B 3W9DA 4AYEC 2ESVD 1NBYA 4LARL 5AKVA 4I18A 3QNXA 3ZDZB 1JHKL 3EG9B 2ICES 4NQED 1CG9A 4R84A 4PWKA 3LXBA 4LCWE 2NUTA 5I18H 3GMLA 5EC1A 3KM1A 1CXKA 2A2QT 5AKRA 1NMAL 2R59A 3EYQD 4YS4A 4EIBA 3B3IB 4BIKA 3UJTH 4XWGH 3ZGIA 5INDB 3BPLB 4GNKB 4JK0D 3I9PA 3ARBA 2Q6WB 2XQ0A 1AR1B 1W8EA 3FB6B 5EG6C 1T0NB 2FSDA 4NWTL 4IMLB 4N2MA 2WINB 3BP6A 3RKDD 4FTVE 3IMSA 1A4KA 4HIPA 4WHYG 2N1KA 4J6RH 4PJAB 4CKQA 4G80B 3MJ6A 2PTVA 4LLMA 1T03H 1BFTA 1K3IA 4UT6H 5ALBL 7CGTA 1JYVA 1PYWB 1D2OA 3P9WB 4LL9A 4YR6B 3LZRA 4H0GA 4UB0L 3NZHL 2XFXB 4DVBA 3BXNA 3H4FA 1Z0MA 2P44B 3TESA 5E7BA 4NCC2 2W07B 4E9YA 4GJTB 2C9AA 2Y1VA 5J1SC 4UCFA 3MBEA 2FX7L 4XI5D 3T6ZA 1QA9B 2ARWA 3HZVA 4BQBA 1IKOP 3MXWH 1DSFL 2F1BA 5GGTL 4G11A 1ACYH 2MQ0A 5GGRA 1TTFA 1EMTL 5KUMA 3EFFA 2NYZA 3SE3A 1GGTA 4GBXB 4OJFH 5C2BH 1DTUA 5C70A 2X9ZA 2E9JA 3OR7B 4M4RA 2D2OA 3VJ6A 4NRYA 3ZQXA 1A64A 4BFKA 5E7FA 5AEAA 4PRNA 2ERJC 4Z7QE 3QEQD 2ATKB 1S9WB 2E46A 4IRZA 4R4FH 5HHVL 3UBXI 1C16A 2VW7A 4HUCA 3RIFK 3CFIC 2PMZA 3UBFA 4YE4H 4XVUD 1OAXL 2QQNL 4PP1C 4HG4J 1C5CL 3IFPB 4NN6C 4GY4A 4NNYB 1FBIH 2IQ9L 1MW1A 5TDPA 4YOKA 5I23A 3PWVA 5IBUG 4QRSA 4M61A 1EJOL 4MNGA 1VCAA 2FWOB 4GRLD 3MODL 1EXUA 3E9TA 4ZMZA 5A1AA 2IDQA 2AJSL 1LNUA 1UADC 4Z7VE 1T1YA 2XG5A 1GZQA 3UTSD 4FFZH 2P80D 5HHOA 4ODXB 3VXMA 2AMUA 1I8LA 2X44D 1XEUA 4G43A 4OIIL 5DRNA 1IM9A 1O7DC 4OQTL 5MEOB 4R3SA 3T4AC 3PREA 2BRQA 4MCZA 5DT1H 4MSWA 3FAXA 4C56E 4R8WH 4Q6IB 1HCFX 4MD0B 4QYOA 3VCLB 4AYSA 5C07D 3T5WA 1KEGL 3JXAA 2OAAA 2UXFA 5EB9A 2EH7L 2OR9L 4QNPE 5T3ZE 4M7JL 1ZANH 4I9XA 2KT6A 1ETZB 2YRPA 5BRZA 3ASOB 4YDMA 1HEZB 2A6JA 5C9JB 4Y4FB 5D7KE 2BZ7A 3RX7A 1BG9A 2J73A 2EC8A 3K1KC 1WTGT 5FYJD 1MFVA 3QUYB 1H3UA 4K94L 2J6WA 4KO9A 5AUMA 4LMQE 3ZTNL 2VIRA 4PGBA 1VZGA 3U2SA 4OZFA 4UZGA 4YDIH 3WDHA 4HCRA 2VM4A 3RKDC 2LW3A 2WY3B 1BOGA 2JKIS 5ANME 2H4EA 1U8HB 3AWGA 3D25B 2ZE0A 1IO4C 3OTTA 5JHDD 1VF5C 3CSFA 5FECA 2NSMA 4FL4C 4IU3B 4IOSD 5D1ZD 5D71L 4LSTL 3HG3A 2V6HA 4KDTA 4LVOC 4HH9B 5F7KC 1DVXA 3O3BA 4YSTA 5CD5C 4F37K 3HNTH 4PFEA 5I1HH 2OJEA 2V9UA 1KCKA 1M71B 3O6FA 4WUUE 5JHLA 2ZT9C 3T6VA 1JTOA 3F7KA 3GXNA 5F8RC 5LBSH 3WD5H 1GGBH 4Q9RL 1BGXL 3BDBA 2A5UA 1W0YT 2QMJA 4WFFE 5E94A 3W1ZA 5C0EB 4KI5C 2X0VA 3S97C 2X28A 1S7UA 4U1MA 1A47A 3HC4H 1I8MB 1TDQA 1EHAA 1JG9A 5BZDB 4ZG1A 2RA1A 3BZ4A 4X4YB 3MRJB 2BCMA 4DOHE 1PX4A 4JRXB 2PYFB 4U2ZA 5K59E 4HIXL 1GSKA 1IGYB 4RGMC 3QFGA 2KZWA 2WBJA 1T0MA 4V2CB 4QXGL 4RX4A 1OAKH 1ET5A 3H0TA 4DKEL 1NCDH 5J06A 5H37A 4FCHA 4HFWB 2M8XA 5C0CD 1BJ8A 5JW5B 2Z35A 5TK2A 3OJDB 5EHFA 12E8H 2BP8B 3S88L 2BOCB 4LPWA 1S7WB 4GS7B 4QXTB 3ZOAA 5IMLB 3S3CB 4LFHD 2V17H 4CRPA 5IEHA 1FFNA 1N59B 3QJRB 4X6EA 3SY0A 1J5OL 1V05A 2OQJA 4JUTA 2GJZA 4MJHA 3L4YA 3US9A 4BWUA 1TZGH 1LL1A 2RJMA 5IB2A 1I9RL 2AQ1A 2EO7A 1MOEA 4NO2B 1A0QH 2ZPKH 3IS0X 3G08A 1JUFA 4D9QE 3SQBB 3OKDB 4ZS7L 3HG5A 1N6QL 2CK2A 1IFHH 1KT2B 2XV3A 3OKYA 4CC4C 3MRLA 2CHNA 1U8IB 1XD0A 2VDLL 4AYBA 4OIAA 1QBML 3PHSA 4K5MA 1FC2D 2A9AA 3PWUA 4U7KA 1BAWA 4I4WB 4BSWA 4O02B 3OKMA 4OV5B 1KYOK 4JY5L 1SFHA 1WIOA 1XB6A 3WAKA 1E4XL 4UDTA 4YSDA 5DJ8A 4QEGA 2BMKB 2O5XL 4EQ3A 4NN5B 4XP4H 2B4CH 5IG7B 5J1TC 2GI0A 3TVMD 4JFWA 4YSRA 2E76C 2ERJB 5EIVA 1P7BA 3RWDB 1CGTA 1KB5H 3LH2H 4NC2B 2VLMD 3WS3B 4P4RA 4KHXL 1RUKL 1E4WL 1MJ8L 4IGBD 1JF1B 1USQA 2E9WA 2W5PA 4XCYA 2VLRD 2F54D 4LDEB 4NN6B 3W56A 4A39A 1N18A 2YGNA 3CFUA 2COQA 5FHBH 2P8PB 4PN6A 1ICTA 4I0PC 4NPKA 4U1LB 4XNQB 5DR5H 5DRZA 1JJUA 3ZLQC 1YYMH 2HVBA 4B9PA 5KYNA 4GPVA 1CBVL 5C09D 3ULVE 1OF2A 2D7TL 5F1IA 5HGHB 1OB1B 4NC0B 1HSBA 1XAKA 4JE4B 5HHOE 3RI5F 35C8L 3VXME 1MPAH 2JKWA 1Y7VA 4NO3B 1NGQL 5DD1L 3C5JB 3TH2T 3F84A 4O4YL 2WXOA 3INUH 5KBNC 1YEFH 5AVQB 1BIIB 3MV7E 4Z18A 3VFVA 1JTTA 2I25N 3DVNA 2X4PA 1PY9A 3CSYA 3L81A 3C9NA 5C7XL 3T4AB 5FOJA 3K6SB 2WM0A 1S7RA 4FQPA 2HKFL 1JNJA 4XNYL 3ZZ1A 4CDHA 4JS7A 1A3QA 4NQVA 1KBGH 1ZIAA 2NR6A 4QDGA 4OFIA 4PRHD 4G3YL 1A6WL 2DQTH 2OFQA 3MREA 4R26L 4PM1A 3FUKA 5L8LB 3KVQA 3VDBA 4M4PA 3HTLX 2VRAA 1D5ZB 4N2DA 4OGAC 2R15A 2YPVL 1PZSA 2EYTA 3WEBA 4XNDA 3X1EA 3VSTA 3N6YA 3A5VA 3QWNA 3NK3A 3ZRFC 1XH2A 2HT4D 4ACTA 4ZUWB 1E3FA 1KULA 3HMXL 3RFZC 3TEWA 3UZVA 1EJ6A 1WBYA 2V5MA 5DK3A 2IBBA 4FHKA 2Z8WC 5AL8A 5BRQA 2VQ4A 3E6FA 3DIVA 4N2KA 4FL4B 4WNQA 5D7LE 3TPUA 1IGJA 4MA8L 3QUHA 4PR5A 2AVFA 5AZ2L 1G7MB 4LVOB 1JNNH 2X3BA 4TXVB 3WXVH 4NRXA 3KJ4C 5KSVB 1YNLL 2WXHA 4K5LA 5IW3A 1AHWC 2XN9B 4N2NA 2YPLA 5F7YC 4OLVH 1JZDC 4LSQL 4GSQA 4Y16D 4Y4HA 5EZIH 4MNQA 1FPTH 3WOVA 4HS6B 1GVIA 2EDHA 2AJXH 3MRMB 1U8CA 1K4CA 1OCOB 2CPUA 4OB5L 3JYCA 3LXUX 5CJ5A 3BEVA 4UZUA 4AC4A 4ZFZB 2FLRT 4MA1C 4LCWB 2CIIB 5F9WC 4HUNB 4X6CE 1KN4H 3AITA 3N9GH 3SD5A 2JXMA 7PCYA 3PXHA 4PJ7E 2HX8A 2J8UE 3MFFA 2NNCA 3PRZA 1SN5A 3Q8BA 5IBLC 1W72B 1NKOA 3CN4A 4PYGA 3T1FA 4GRMA 5CFAA 4AQ8C 1CDYA 1XGUB 4FTVB 1JIBA 3NCJL 2WHVA 1MNNA 2FT8A 2CJ3A 4I77H 1CLZH 1MRFL 3EYVA 1KPVA 1U58A 5C2UB 5L9DH 4CNIA 1KJMA 4WI0A 3MJ9A 4I13B 2XFGB 5FW6A 5IROC 1FCCA 5LKNA 3DTXA 4Q74A 1NANH 3HAEH 3MV01 4FQJL 5FYLL 5LGYA 4ZOCA 5DZAA 1MF2H 2ADGA 2F2HA 4ES9A 4HJIA 4L1LA 4YH6A 5I17B 5A3ID 4LSPH 3VQMA 2ZWLT 3RZCD 5TQ0L 4OT1L 4ABVA 3KLLA 3I9GL 5LNEA 1O6SA 1BAGA 1EFQA 4XE5B 1D7BA 3T3MF 3DGGA 4IOFD 3KPRA 4GI8A 1B9KA 1KXTA 3NDYE 5FFOA 3PP4L 4L8SC 5GGUA 4N3TA 5JYLA 3V5DB 3RY4A 3BYTA 3LX9A 1H6TA 3F7QA 4S1RH 1E43A 4WSGA 1B0GB 3UO1L 1JF5A 1INEL 5CBAB 2FBJL 5LGHL 1E4JA 5B1CA 3NSCA 5I9QC 2ZOLB 4Z7QB 2NZIA 1H15B 4P99A 3NJVA 43CAA 2HT2C 4WEBH 3C08L 1XR8A 2VRKA 1P1VA 3WIFB 1R3JB 4XRCB 2YMTA 5ENWB 1M6OB 2NY7L 3W81A 3MLWH 3K1DA 3RDTC 1H3WM 4F7TB 5JA8B 3H85A 3HVNA 3H7BA 3QQXA 2QTVA 4KZEH 1NBVH 2GY5A 3F6IA 3L95A 3ULVC 1HH6A 4AQ1C 1MLBB 4RGND 4DFIA 3MTXA 5DMYA 4W70A 1EAQA 3LRGA 2GJ6A 3BDYL 4Z7VB 2CDFA 3QFDA 3M1CA 3NEEA 2B8OT 1JPFA 2JV6A 3ASNB 3ZR6A 1JD7A 3P4NB 4HUWA 5BUAA 4E9WA 3LEVL 1H6FA 4KZ0A 4JFYA 2L3BA 3RY5A 2MTPA 3IDJB 3MO1B 1HHHA 2EIZB 3IB4A 4I0PB 3ZKNC 1X5GA 3HZMA 3I6SA 4HJ0D 4C56B 1D5BB 4LCUB 2HAZA 3W9EA 4YHMH 2Q86A 1KOAA 3A67H 2YFOA 4M5ZH 5K9OB 3NIDE 1ZOXA 2Q7AA 3PJSA 4UBDC 4Y1AA 1JPSL 4KFMA 3QJFB 3WEMA 4HJSA 2ZYIA 3RURA 4WHCA 3QUKB 3R0MA 1XSIA 3VYNA 4G8GE 2WVVB 2CD0A 4JMXA 4POUB 1WG3A 2X41A 3MNVB 2Z93B 2VH5H 4P23C 1XD1A 4QRTA 1ZLUK 4OZIE 1L5GB 1CD8A 3UABA 2C7UB 2OX5B 2F6AA 3L48A 5F9OL 3UTPD 4G9DB 1FFPB 2BSTB 2J56A 3JWDL 4G72B 5DRXA 3CH1A 3WI9A 3WFDH 2IBZY 5JO5B 3ARZA 4UTAH 4ORZC 4E5XA 2FZ3B 1R0AL 1A14L 1VGKA 4G6AD 4MNHA 3D06A 4FFZA 3PGDB 4U0RB 3ZHFA 4TUJA 2VJ0A 5D9SB 1CJYA 4XXCC 6TAAA 3IJHA 2IBGA 1AKJB 4JPWL 1QOKA 2ZKYA 3IGAA 3MXVH 4GRWF 3FUMA 1DQIA 1NGZA 3I02A 3RFZB 1F4AA 1I1FB 3G6JF 4KVNH 4AYID 3IU4H 1XCWA 1NFIB 4F57L 5C9KA 1UA7A 4EN3D 1SJEA 3EYUH 5CZVL 3LRKA 2X6AA 4PHXA 4BK8A 2A0LC 5B3SB 2YQGA 2AV1B 4LRIC 4EI6A 4DOHB 1QBLH 3TNNB 2EP6A 3H9SD 5MEND 4F2MB 1CD0A 1H8NA 2VLKD 2BIHA 1SVZA 2I26N 5TDNB 1EAOA 1XMEB 1AHWB 3QNXB 1D5XB 4AE0A 1JZ2A 4MASA 4HU8A 2OTUB 5G5DB 4PW4A 1JZIA 1MQ8A 1BLIA 5TF1L 2VC2L 1JXJA 4OM0H 1IARB 1UXMA 4GP5B 3G6JA 4EF3A 2Q7YB 5K9KB 3TNMA 4MA1B 2EIBA 5IB4B 1GYAA 3G6DL 4NX0A 4LP4A 3IMVA 2ZAIA 3IE9A 1ES0B 1WBXB 5FO9A 3OKNA 3A4FA 2YO3A 5DC4B 1VADA 2HFEA 1QMUA 4I9WD 1FLRH 4YXKH 5B8CC 1E8XA 2W65A 3Q8FA 3SKNB 3BAIA 4MXWH 4GAYA 1Y6KR 1CZ8H 2VB5A 3WLWD 3BSGA 4WTWA 3MLVH 4TL4A 2B3IA 2WBKA 9CGTA 2VUYA 1CC3A 1TQUA 3LNDA 1QSZA 2PW1B 2YK1L 3B2VL 3EZ8A 1UQSB 3BC9A 2O6CA 4K8RH 4DVBB 1MCFA 3TN0D 4V2BA 3U82B 1IBGL 1JCVA 1UEMA 4JHVA 1UACH 4BUGA 3EJUA 4Y2DA 5D7JD 4QY8A 4MKMA 3CD4A 1BQRA 3O41B 3KPRE 2QSCL 2DLEA 3L9BA 1A25A 1S5IL 4U0QB 3L5JA 3QXWA 5F7AA 1CGUA 1I9EA 1HVXA 3M6DA 1RL1A 3M1BB 4I2XE 3BSZL 4AQZA 4KTYA 4XC3L 2BFVL 2K45A 4L8SB 5IEKB 3MV8A 3QP3A 5AENA 4HP5A 5HHPB 4ABWA 4CJ0A 2VL5B 4ZPVA 3ABMB 4OD3H 2BVUA 5H4YA 4UINH 4ELKA 1HCYA 2QEJA 4OVVA 1FNSL 3BDXA 2H2PD 2CPCA 5K1VA 4ZTPL 3T3ME 1WZAA 5D4HA 2WNGA 3ARED 3P9MA 4I8DA 3BISA 2EYSB 4F7EA 1G7PA 1HL4A 3ZE1B 2V3EA 3RDTB 5FEBA 2BDNH 1EXUB 1F4XH 1OW0C 3GMRA 3AS1A 4OSUL 1LNUB 1NOFA 4WI3A 4JO2L 4WWPA 4AQ1B 3RTQD 2VXTH 5HHOB 4OLYL 2HFFA 1Z2KA 4NO5A 4Z7NB 5IFHL 2NUPA 4QF1A 1FAIL 1MWAL 3MNMA 1IQWH 4P4KD 1CI5A 3U1SL 1X5FA 2KS0A 5LG1A 1A7QH 3F7YA 4JGUA 2V7NA 5C0RH 2N1TE 2DQEH 3QNZA 5DZLA 3ZTDC 4WU7B 3MV7B 3OKOA 5EZOH 4DGVL 1B4LA 3GBNH 4NFCA 3VI4F 2QQKL 2YA0A 5LCVA 2EDWA 4HKJB 3QIUC 3QRBA 4KNQA 4M3HA 2FIKA 3KMDA 1OAZH 5FCSH 4AT6B 4XP1L 3T0ED 3CIQA 1RIUL 3DYOA 1BLNA 4IKJA 4LQ1A 4YSAA 3UTTD 4FAAB 2R1YB 3GJEA 3VFUB 1J5IA 1G6RB 1Z5YD 3WTTA 1O9VA 4ZXBA 2Z31C 3G5XA 4RMBA 3MLTA 1AZVA 5GRXG 4P23B 4NI3A 2ZKWA 3NFSH 5B39G 1HNYA 2NY6C 5HJGA 4PLOB 3L1FA 4N26A 1AGFB 5HYEA 3VI4A 4JANA 3RL1B 1WAPA 4Y5VA 2QPDB 2HP4A 1BF5A 4IOIA 5FECB 4JQVA 4NRZB 3ZE0B 1AFVL 4MDIB 3VG9C 3MRHA 2MJWA 1A1OA 2JTDA 4Q9QH 4FC3E 1FO0H 2ZCLL 4HQQL 5D7LB 1ZDSA 3HN5A 3IMWA 5BOPA 2FL5A 5ID1B 4G5ZH 1YO4A 3GPSA 3O6FB 4I1NB 5F2FA 3TN0C 1UD3A 1WIPA 4A2DA 5CCGE 2K9FB 3HJEA 2MNUA 3VX1A 1PW3A 4H8WH 2LE9A 1NC2A 4ENEC 2VITA 5SWSE 4JQXC 1LO5A 3BIAX 3OKKB 5LAXA 5CR8A 2BIOA 4GSDH 2O6FA 2C5DC 3NDZE 4PLJD 3SJVE 1AZBA 3KHOA 3C8HA 5F89A 3H56A 3P0YL 1T6VN 4OLXL 5I6PA 4KJQC 3UTQA 3H6AA 4JO5A 4XPBL 5HI4D 3QFJD 4X6CB 2EDBA 4M7LL 4LPXA 2DV6A 4EIGB 3QIWC 4PJ7B 2MCG1 1I8AA 2J8UB 1FIGH 4A6YA 3WIIH 3G6JE 1WFTA 2HUEA 2Y72A 3I3DA 4YSUA 3NSXA 2IAMA 4W9IC 2X4SB 1E4HA 2PO6C 3BT0A 4XTRC 2YD7A 5ITBH 3FT1A 4XNZC 3O4LD 2BHFA 5EBWB 3MGTB 1G0XA 1RZKH 2JK5A 4PTUB 4F3FA 1BF2A 4A1RA 3U9PH 5CLXA 1IAKA 3DTDA 5DMKA 1FZKB 5M7QA 4M9PA 1M7DA 3FN3A 3LD8C 3APCA 2Y69B 3S5YA 5L88H 2X9XA 5DC2A 4UV7H 3TIDA 2XXFA 5B8CB 1QABA 1VFMA 3DLQR 1EJFA 5E4EB 2VXSH 4P4KC 3TZVB 4LSDA 2H9GB 3VXRD 3FFCA 3QB7C 3ULUH 3US1A 4OFYD 2V3FA 3G08B 5I0ZA 1IFGA 3SGEI 4N4YB 3TEXA 2I9TB 4ZFOA 3QJTB 1VZIA 4IBYA 3S35X 4ENZA 1BYOA 2FQEA 2W59A 3MBWA 2XWCA 4X9HA 2FCBA 1NLBH 5B39B 1MQKL 3HUJE 2DDQH 4A7UA 3JSSA 5JLZB 3GEWB 3APDA 4JFZH 1PAMA 4XZUB 4JCMA 3UEQA 3OHXC 4PRPA 4GKZA 4ESKA 4DAGH 2IC2A 1KB9J 3LKRB 3ZGHA 3BP5B 1PKQA 5IVXE 2E7CA 2VLJD 1PLGH 3MV8E 5AB0A 1NC4D 4UQAA 3MLRL 2GT9A 4PLKD 1J5DA 2A74C 1MFCL 2I5YL 4UANA 3SYPA 3ZO9A 2E8ZA 2P45B 3FO0L 5E6IA 4PGEA 3ATBA 2C3HA 3RY6C 3VE0A 1ASOA 1NCAL 3VFPA 2DY2A 2YAOA 4XP9H 4NQCA 5A2KH 2DQFA 4XCNB 5T8IA 3QZPA 3OXSA 2QPSA 4JREC 1KJ2B 1WIUA 4QRPA 3RLSA 3O2DL 1DBAH 1UH2A 2G4EA 4FQLL 1KV7A 2H3NB 3OAUL 3O8XC 1M2VA 5DZNA 3CDFA 3WIHA 4PS8A 1HOEA 2HLAA 1R3KB 2RMNA 1CK0L 5D2LB 3SYAA 3VD7A 3LKPB 3Q01A 3PXJA 1DBBL 3NJIA 3L16A 3ZE2F 2GITA 4HGWA 3G5ZB 5DGRA 2EE0A 3CHQA 3PAUA 1KGCD 4YDNA 5CBEA 3IDGB 3NIDB 1MCDA 3U4EB 4PLJC 4DEWA 5BV7L 1DBJL 4P2QA 2NSXA 1AOZA 2WQ8A 2RAMA 5AG9A 3WO3B 4G8GB 1WWCA 2AI0L 3NJNA 4PD4J 4OZIB 3PDGA 4HK0A 2A83B 2GJPA 1KCUL 1F2QA 3MV9D 3QIUB 3IFLH 3UAFA 4R5VA 3TH3T 2R1WB 3GI8L 5EBMA 1I1YA 3MREB 5F1NB 1MVUA 4RZCA 1AQMA 3UBHA 1INDL 1A4JB 4DWHA 4E9XA 4D94A 3DV6B 3HS9A 3UH8A 5AZUA 2VN4A 4R0LA 3VXSE 4BV1A 5K9QG 2IDUA 4HBCL 3VI4E 4ZDHB 2R23B 2Z31B 3UERA 3SPCA 3N04A 5G4OA 1TQVA 3LB6C 2NY6B 4AQOA 2OZNA 4YHZH 2VDKB 4XOBA 5IMOA 3E6FB 4PBXA 5GZNA 5ICZA 2CJUH 3GIVB 1Q90A 4WEUD 2Y7OA 1IGJB 4JN1L 3VG9B 3QHZL 4PR5B 3ZDXF 3IMBA 2AK1H 3EJSA 3EJZC 5F96H 4FLSA 4NNXA 5DK2B 5AAMA 2NY2C 3Q1SH 3S4SG 3ZZSA 2JB5L 3BKJH 5F44A 3MCKB 5EWIL 5HPOA 4FQXD 2K4AA 4XPHH 3O45A 3EO9H 4K4KA 2EDMA 5JPNA 4NJ9H 3CZJA 5E2WL 3QQDA 1RZFH 1DYZA 3BEVB 3IMRA 3OJ2C 1G9NH 5HYIA 1GMEA 3N85L 2NX5B 1NUFA 1U4EA 3EF7A 3GINA 2DWDA 1JZHA 1I9IH 3FQRB 1CS6A 1UWFA 3NABL 4QKTA 1KG0A 2WP3T 3B9EA 2ZF8A 2GC7C 4O02L 5GSRB 2MCPL 5IB3A 1MHPL 5GS1C 3H2WA 3ZL4H 3REWA 1RHHA 2NNAA 3MOAL 4AM0B 2QGEA 4UU9A 3QIWB 3KLAA 3TBWA 4ZYKA 3DC0A 4WI8A 1HKLL 1TT6A 2O30A 3C8KB 5JIIA 2UX6A 1N12A 4HKZA 5CSBA 2YAFA 1DQVA 2PO6B 4OF7A 4PU2A 2H8PA 4WI0B 5C0BD 4XNZB 4CNIB 4PRDA 3UYRL 1L3NA 2FEJA 2R2BA 1TQCB 4JHUA 1CFQA 5LBGA 1U3YA 1HQRB 1WUNT 3LH8A 4IJ3C 4M3JA 4ZFGH 15C8L 3DX3A 2H45A 1MFBL 1P53A 4UQ9A 4A7VA 2FWLB 4M7ZC 4HJJL 4Y9GA 1UA6H 4XN1A 4ADIA 2CK0H 1YDPB 1O6SB 2NCEA 3PUCA 5E8EA 4JJOA 2SEBB 5D1QD 2VXQL 1KY7A 1Q72L 2BVTA 4WWKD 5FGCE 2OXGA 1MW2A 1KXTB 2H47C 4M3KB 5L8JB 3WL9B 3X17A 1ZJBA 4QLRA 1FDLL 3AXHA 3MYZA 2F68X 1DJWA 5KBPA 3THML 4Q2ZA 2GUYA 2OYPA 4I2XB 4LPUA 4KROB 3FCTB 1KSRA 1QLEH 5IW6A 1UJ3C 2CWRA 3I6LD 5SWZD 2V33A 1K4DB 1JZFA 3FL7A 3V4VL 5ETUB 5H2BA 4GKOA 3B43A 2GTZB 43CAB 2WLIA 3EYOB 2XTJE 3OHXB 3S2CA 3UBXA 1RUML 3UGUA 1HSAA 3CSGA 3GK8H 3T3MB 3GWJA 1QLFA 1AD0A 1M1XA 4KMTH 3S4SB 4NQCE 2A74B 4RESB 2YA1A 5EZLB 1OV8A 1MFEH 3DRTB 1XCQB 1XF5B 2AJYH 2LU7A 4TV3A 5KYYB 2KLRA 2X6VA 3L7FA 5E0QA 3QJQB 4P59H 2RR3A 4CVZB 1UYWH 4TPRH 5L7XL 2EEBA 3C2AL 2HPOA 2JCWA 4MMYA 4NHCH 4OCXL 4XO9A 4YHPA 3OJMB 3BH9B 4F2FA 1ZT7B 2XBTA 4HUWB 2FSEB 4ABQA 5F6IB 2B4CC 4GKSA 5KG9A 3AABA 3O8XB 4X5PA 5I6XC 2X4OB 4FI6A 4FQ2H 2RCSH 3CFBA 1DANT 3GJFA 2C3VA 4QJ3B 3V5KB 4LRNH 1KTRL 4HWUA 1ZSDA 4JY4A 2DQDH 4JPKH 5I1KH 3MOBH 1I82A 1KUMA 1FL6A 4ZMVA 2CKBH 1A5FL 3EO0B 3W3BA 2OTWB 1WA0X 1KPUA 5L2KD 2OMUB 1V54B 2UZIH 1S5HB 4BDVB 3DBXB 1WE5A 3RWFA 1JMZA 4ALAH 1TETL 3O3EB 1B0RA 2D7OA 3TBTA 3SSGA 5DRXB 4XGZA 3GM0A 3L5WA 5F9AC 1E5AA 5AZEH 1KGWA 3WFEH 4GXVL 3ZE2E 3ML9A 4LB8A 2X7LB 3S34H 1J8HA 3MRNA 3ARDA 2Y22A 2OP4L 1WUZA 2XN1A 3KYMB 4QTFA 4LHUA 2DTML 4TUJB 2Z92A 4HIIB 4NZRL 2ICCA 2JKNA 4GAGH 5ILTL 3FUDA 5J3HC 4LL1A 1EVUA 3FSAA 4WUKH 4BFIB 4ERSH 1A9EA 4N28A 1BCIA 3IGAB 3D48R 7TAAA 3ARYA 2BCKA 1L6ZA 1ET7A 5BQDA 4M6MH 1ETB1 4UYQA 5LN4A 1LP9F 4K3EH 4P2RD 3B4NA 1YNKL 2A99A 5SWSB 1QRND 4WWKC 3P02A 4LLAA 5KSBE 3VI3B 5LLIC 3FUNA 4FXKC 5CN3A 5I8EB 3QJSB 4G7VL 2HH0L 2JFCA 3SJVB 2NY2B 4AQAB 1ZTXH 5I1AA 4FI7A 5FWRA 3X11A 3SPJA 5CS7A 3F64A 4YO0A 1BFSA 2MIZA 2XWTB 3TT3L 4TSCL 4ZBJA 5HP5A 5D7IF 4O9HL 1XV8A 1Z6JT 2F61A 4YWGL 5EU6A 1T22A 3CDGA 3IDXL 5E6ZA 1T6WA 3G6JB 1YN6B 1RMFH 3ZDXE 1LP9A 4NM8L 3TJHC 3JT0A 3VXQA 1MHHB 2SODB 3WG7B 1PG7H 1U33A 1UWEH 4JRLA 5AW1B 1HHJA 2LOEA 3OKNB 1EUUA 1XGQA 1HXYA 2JJSA 4QD2E 5C7ZA 4KV5E 1A6TB 3VWKC 2ZKHH 1S7VA 1MRDH 2HFEB 2X42A 2RBLA 3BJ91 4AG4H 5GS1B 3MUGB 3LHPH 2ARJQ 1HZHL 2MKLC 4HEMA 1RIVH 3BT2L 3GMMA 2NTFB 3FBQA 3HLAB 3QQ3B 3NCFB 4CSSA 5D7IA 3UZQB 4CN6A 4ZMAT 4JKNA 2AKRA 1O75A 1RUQL 4GIAA 2PP9A 4AMWA 4G8EB 3O6MH 2DD8H 2CMRH 5DDHB 2AABL 3Q43A 1NBZA 1EIBA 4MAZA 2WZAA 4LK4A 2R4SL 4PMFA 4B5EA 2DAVA 3HS0A 4WQOA 5D70H 4IMKA 1SY6L 3HFML 2PXYD 4UM8B 1JE6A 4IJ3B 5HI5C 2RHEA 2FR4B 4KZDL 3HUJB 1SLXA 2G0KA 3BH8B 1WD8A 1A3RL 3GHEL 4PG2C 5DFTA 4AL8H 4M7ZB 2VDRH 3VSVA 1RFDH 4EUPH 1XH0A 1IM3A 1MFDH 4LSSH 3VMNA 1OEZW 4NC1C 2UZPA 3HRZC 4YDVA 4D8OA 5IVXB 5T3ZL 3MV8B 5IHBA 2R2EA 4ICWA 1AE6H 1JDCA 1UXWA 2CRZA 4IKLA 3U0PA 3D0AA 1UJ3B 3BD4A 2ALAA 3CE1A 3GSWB 4GLRI 4I48A 4AXWA 2Y36H 3HZKB 1QR4A 5HDBF 2IMNA 2GC4C 2A6IB 1K85A 1RSFA 3CVDA 3CFDA 3FSWA 2EZ0D 1A6PA 3MLUH 2WTOA 3B34A 1DN2A 3AADB 4U1HA 3VFNA 2DB8A 3GMRB 5DD3H 4B3EA 3WE6A 1JHLH 1BZOA 3TWCH 3CC5A 4OTXL 4G8AC 3MROB 1C5BH 4RSYA 5CF3A 3R06B 1IC5H 3CHXA 3G04B 1EZSA 4HV8B 2OMBA 2IGFH 3QQ4B 2OKMA 3BO8A 4NO5B 4P3DA 5EO1B 4PS7A 4KJPC 5F9JB 3VD4A 1GGYA 2R39A 2ZYSA 3SKJH 3TA4D 3EFOB 1SQ2N 1CFTA 4PJIF 2W9EH 2BNQA 1MIML 3RHWK 3SCMA 3OX8B 3UGXA 5IGXH 2NXYB 3HLKA 3X14B 5KANG 3O6KH 3MRPA 2Q3XA 3KDMB 3CVBA 1UTDA 1BREA 1OP3K 2X0UA 3SDDC 3NJFA 3NACH 1FZJA 2CA3A 2X70A 3P3TA 3ROLA 1ZXKA 3DV4B 1R4XA 5DS2A 5I6NA 1KB5B 2GHWB 3HMWH 4Y88A 5AVXB 2VJXA 3UJJH 5E2TH 2DKUA 4FNSA 3FHAA 3B7YA 4FTVD 1BZ7B 1QLRA 1X9UA 1FV1A 5HI3C 4FQ1L 2EAEA 2J1KA 2HJKA 5AAWC 1KYAA 4F8QA 2VSCA 1KZQA 2D9CA 4PJIA 5EO9B 4H26B 3VXNA 5IBTH 3ZL2A 4NQXA 2DN7A 2ED9A 3D9AL 3VXSB 1QUNA 3FC8A 1HX0A 4ODSH 3KL3A 3TONA 4KTEH 4L3FA 4IOIB 1U2CA 4LU5H 4CSTA 4U1KB 2X4TB 1Y0LB 1YUHB 2GTWA 3FSOA 3I9AA 4RLDA 2M26A 2Y1AA 5I1GL 3MJ8A 1BFVH 3ESPA 1LMKA 1DVQA 5J89A 2L7UA 2XWRA 1RK7A 2FL5B 2YFNA 5BVPH 4K2UL 3EJQA 3IJYA 3TLRA 1P7QB 4G7YH 4HSAC 3IJEB 1CU4H 4F33A 3CAFA 3HAEG 5KVEH 5DJ0B 4HIEA 1GAFL 1I4FA 1DVFD 3AW5A 4WHTA 3V6ZB 1NC2B 4I3GA 2VNCA 4NGHH 1DL7H 1UUSA 2Y6SC 2NT0A 4P5KA 1XH3B 4WFGE 2W8CA 2O72A 3CVHA 4RFEA 4ISVB 1W8OA 4NKMA 4PRID 3M8OH 3L9EA 1ASPA 3SGJA 4KXBA 4KXZH 3V0WH 1IBBA 5F7HA 4FXKB 1TEYA 3M17B 3AZUA 3WS6C 4HAGA 3MRRA 3MMEB 3UTZA 1B9ZA 2A6DA 4ZOAA 1Z7JA 1U42A 1VFBB 4LARH 3CH8A 3WO4B 4BSVA 2LVCA 3MYJA 4FERA 4HWBL 1DLFH 2F19L 3C6LA 1GW6A 1QUPA 3AT0A 4JW3A 4XHQA 5FUZH 1NMAH 4WJ5A 4J3OH 1MAJA 2ICEA 3LKQA 4JFOA 1R46A 3RJQB 5L2JB 1KCWA 4B5ZA 3DXAD 1CDCA 4FJ6A 4RISL 1I1RA 5CD3B 3EO1B 1N8ZA 2JQZA 4HEME 4IJTA 1FJ1B 1CLYL 1ZGLA 1KGJA 2OR7A 3QCTH 5D7IE 3QI9C 1Z9PA 2J1WA 1Q9KA 5BOZG 3BGFB 1QWHA 1DEEB 1IKNC 4O2CB 3HI1B 1UVQA 4GQ9H 4DESA 1ZT4A 5ALBH 3Q2NA 1FL3A 1SF3A 5KYUB 1T5WB 2EECA 2UUDH 3ULVL 2EH8L 4I3SL 3NSJA 4UB0H 3NZHH 5FGCB 4WENB 4JLRB 1O7SA 5D7KD 1LD9B 1BXUA 2PPCA 3X13A 3U48A 5JUEL 2Y7QA 3JVFC 2NQCA 1TZ8A 1XZ0A 1YN7B 4MGXA 3VWJD 1GOFA 1L9NA 1DSFH 2QSTA 5GGTH 2EE9A 5KN5A 3IXAA 4CW1B 4RFOH 4MA3A 1ZV9A 5DXWA 3GI9H 4JDTL 4KK9D 4X7FC 5E6UB 1LEIB 3RWIB 2HMIC 3BKML 1KEMH 4WI2A 5T1LA 5GPRA 4K8RC 2A4CA 2QGBA 4DQAA 1YEIL 3HRZB 1WCQA 2FEEI 2ZXWB 3D4ZA 5HVGB 3FRUA 5EFIA 2R29H 4KGLA 3HAEB 3VRIB 2VL4A 1NDTA 3ULSA 2Z4QA 3Q9QA 1ZE3H 3X1GA 1UM6L 4BUQA 4AMKH 5HHVH 4NQCB 3KWXA 2DQFB 3D07A 4IK7A 3SOBL 4MJJA 3IAGC 2BP0A 3ULUE 4WUUD 2QQNH 2H6PB 5JW4M 1QG3A 1C5CH 4BJLA 2JCCA 4Y2OB 2K6YA 4OR1A 3S3SA 2CIKA 3T2OA 2CDEA 4KQ4H 5TTRA 5D1XE 2AAVA 1T3FA 1UB5A 1HCZA 1M2VB 3O0LA 3P2TA 4M43L 2HLAB 1F3JB 3VXOB 2FB4L 1M57B 4L1BA 2XQYK 3MR9B 4ZK8A 1BX2B 3MODH 2W0FB 1J9TA 1G7LA 2QVFB 4N2EA 4HGWB 3RJOA 3CUPA 1O9WA 5I1EH 1XB8A 2AXFB 4HMCA 4X7TA 1PF3A 5I1JL 1RP9A 1XF4B 3BFQG 5AWNL 2XYCA 1OP5H 3S96B 3TBSB 1IKFL 2Y7LA 4Y5YC 4QHNA 5SV4A 3UAJA 5FC9A 4NZTL 3PNRB 4PREB 1MY5A 2EIDA 3D2UB 5ADPH 3REVA 5IJBC 3DO7A 3ARBD 4L1HA 2IADB 3SDDB 1KEGH 1T1ZB 5CGBA 1WVZA 3RL2A 4Z3FA 1AXSB 3SBWA 2EH7H 3EOAB 1IT9L 4M7JH 5C0AA 2EDYA 3W11D 2OMVA 2AFNA 1ED3B 1F56A 1PLBA 4KKQA 4N86A 1JNLH 1EEYA 2VR4A 1GJUA 3IKCA 4DP9X 3ZO0A 2OJ1A 5FUCE 4EZLA 3B56A 2XKNA 2ISDA 5ICYA 1OTUD 1G87A 2IVFC 2OMXA 4CN4A 1YYCA 5J56B 2VXUL 3L08A 4S1QL 2UXGA 3BH4A 1ZK9A 5CHNA 3MBED 1JWSA 2WZPA 3P3RA 5ICZB 4IM8A 5C0GB 3UBXG 4JRWA 4YPGA 2XWEA 3H2QA 4X6FB 2ODIA 3DWTA 4F7PB 2W0KA 3WN5A 3DOSA 1JNHB 1RZQA 4M8RA 4L5FH 3S36H 2PCFB 1YECL 3QGVA 5KSBB 1XF2A 1G0YR 4URKA 4Z9KB 2V7HB 1VZHA 3ZU8A 3BUDA 3ROOA 1K8DA 4X5WA 3T65B 1BGXH 1A1MB 2FK9A 4P5TC 3DIDA 1FVCA 2H26A 3ARGC 2W95A 2P8LB 1H0DB 3IGFA 4WZ9A 4F80A 2DL9A 3HPLB 3PQYA 3OLGA 1CF1A 1OGAA 2YWZA 2WQUA 1GGUA 2VLLB 4AQEB 5AD0A 1HILB 4DZBB 4EBQL 4A7TA 1RUAL 2FX8H 1BBJA 3B9AA 5HGDB 3ZDXB 4HIXH 5E95B 4KY2A 3R4DA 1N4XL 3F7RA 4H8WC 4CILA 1DQDL 3U9WA 1RHHB 4QXGH 1NL0H 1BECA 25C8L 1QD0A 4DKEH 5EZJB 3BSHA 4EDXA 1IBZA 2YQ2A 4NERA 2DMBA 3WGUB 1OHQA 1SMOA 1SYVA 1I53A 2EADA 1INQB 5HHOD 2XVBA 3C60B 4Z78B 1FC1A 4JDZA 3VXMD 1CL7L 5IOPB 3S88H 3PWPE 4MJ4A 4N1CA 4Q7DA 5EU5B 1IM9D 5HGAA 4CVWA 4PLNC 1O9ZA 2VE6B 4K0OA 2QHLA 1J5OH 5LGJA 1MIEL 4PJGB 1A3LL 1PZAA 2YC1A 1GA2A 1KJ2L 2WJ7A 2EDFA 4RMTA 4BA0A 5DMIL 1BDYA 4G59C 5EOCL 4L8DB 5F7NC 3QWOB 1A6ZB 4I18C 2GBUA 3QI9B 4MQ7B 4R96A 5E8EB 2DLFL 3CLEH 1E8WA 4RAUB 2V2WA 5T5FH 1L7TL 4LHUG 4QO1B 3IBEA 2DYPB 5BRZD 3T2QA 1CQKA 1RZKC 3LH9A 1CFBA 3EH5B 2Y0SA 2N4IA 3MRGA 1DANU 5E1IA 3GMOA 1AQHA 5DYOB 2GYSA 4JZJA 2DYSB 1H5BC 3PL6C 5HDLA 3FB5A 3HCVA 2VDLH 3R7RA 5B3NA 3VVWA 5EOQL 3NZ8B 5C1MB 4PRAB 1TSRA 4KZCA 2WLIB 4LAJH 5E9DE 3ISWA 3WHXA 4ODBD 1OZUA 2J7LA 3DPDA 4FZEL 4OQ1A 2EQDA 4QRRB 3MX0B 4XNBA 3LN4A 2D9QB 2QVMA 4X5LA 1FVDB 5C97A 4M62L 4PW3A 1E4XH 1HI6A 3HG1B 1T1XB 1FNHA 5D1XC 5DJAB 2JWYA 3UAEA 4L8CB 2O5XH 1WD9A 1TJIL 1IGCH 3O6FD 5FLUA 1UOLA 3HOGA 2AANA 2EKSA 2JCCE 1G6VK 1T7WA 2IPUK 1JWMB 2OL3H 4U1SA 4APQC 4KMQA 1E4WH 1MJ8H 3M07A 4EBQH 4EUPA 4DTGH 1VPOL 2VKXA 4OZHE 5IHZB 3FTGB 4EOWL 5FB8A 5IHLB 3KM2A 2JTYA 3QJVB 1CBVH 4NWUL 2D7TH 1NUGA 3FH5A 2P5EE 4DN3L 4JJ5B 2WBJD 1ADWA 2VN6A 35C8H 3D3VA 3KCWA 3MNZB 4HF5L 2LGNA 4RX4D 3OLIA 4M7KL 4I0CC 1NGQH 5DD1H 1OAYH 2NXZD 5G2NA 4L18A 5JXEA 2OSLB 4S2SA 5C3TA 4NQDE 2BSSA 4FFYH 2J6EA 3QO1A 1U6AL 4Y5YB 4LIQL 3EH4B 2LV4A 3K2IA 5K39A 5GHWL 5C7XH 1MCWM 3K8LA 1B3IA 2HKFH 2WOBA 3NCYP 5C0AE 4ZW3A 4QXUL 4XNYH 3GSXA 5HSFA 3KLDA 1BZ9A 4Z7OF 5IREA 2HLFD 1YRKA 3RB5A 5ABZA 2NW3A 5JZ7C 4M5YL 3W2DL 3PF2A 4D0DA 1MY7A 4B50A 3ESMA 3UZEC 2MOGA 3QHTC 4C58B 1ZLDA 4LLDA 5DMGD 5D6DA 4LHUB 1UXSA 3ABGA 2Z92B 5IK3A 4EAEA 4DGYH 4R26H 3GNMH 4XCFH 1J11A 4JCLA 4KKLC 2ADFL 3L3GA 4PJHB 1P4LB 1Q9WB 3LSOB 1YEDB 2DQHL 4NI6A 3O9WC 4FS0A 1AQKL 2BC4B 2AS5M 3CX5J 1AR2A 2VKWA 5EF2A 1NGXB 3Q2WA 1SBSL 4U3SB 3H54A 3TV3L 1IBFA 2PW2A 2HPTA 3QS2A 1S7TA 3F8UB 1PG7X 1KC5L 3QRLA 1UH4A 2VT0A 4U1JB 4I3RL 3L1GA 1UM4H 1W0WB 4N22A 4MA8H 2GPZA 3LJ3A 3UFIA 4FNLH 1S8DB 5DJYB 4E9QA 4BZ2A 1A7RL 1CXEA 2I27N 4ZX6A 5BJTB 4N5UA 5I82A 1K72A 3ECBB 5AW7B 4YQXH 3TF7C 3KJ6H 1YNLH 1EAPB 4G7SB 3EGSA 5HVFB 3E8UL 5LAPA 4LSQH 1OGAE 1LTXA 4DGWC 4UM9B 4LBEA 3UJTL 1WV7T 3CFTA 2HG5B 4HUUB 2OS7A 3HE7C 4P5TB 1LJMA 2ZICA 5A6MA 1H3TA 3IT8D 3KPMB 5MI0C 4OB5H 3VXQB 3TCLA 5CEZL 3FO2A 4Y8AA 1FO0B 4TLKA 1KB9K 2B5IC 1E28B 3UYPA 5EUKA 4J6RL 1EWHA 5I1CL 5F0JB 3HB3C 1IBHA 1VFAA 3ES6A 1S7SB 4UT6L 3L8QA 4H20H 5DHXB 4M6NL 3P54A 2WQAA 3BN3B 1YMHB 5CGYC 2VQ1A 1KNOB 1G9NC 4GW4B 2X3AA 1XWVA 4PB0H 4YXLL 1SJHB 4J3OF 2IBZX 5D72L 2UY7A 2R9HD 4X99B 1EBPA 2CDGB 2V9TA 3ZSSA 1ZTXE 4KRNA 3ETSA 2ICWB 4W9CC 4X4XA 5