3FBLA

Crystal structure of orf132 of the archaeal virus acidianus filamentous virus 1 (afv1)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
82
structure length
82
Chain Sequence
YHKLRLAIKEICKTDGIPNIKWGMYIAFGEKLLKSYLKMKAGSASSDMIAEYINNAISAFSSRTGISQETAQKIADFITSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Acidianus filamentous virus 1 coat proteins display a helical fold spanning the filamentous archaeal viruses lineage
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Structural protein
total genus 38
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2008-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.800 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3fblA00
3J9X1 3FBLA 3F2EA 3FBZA
chains in the Genus database with same CATH superfamily
1VCSA 5A1LA 3RI5A 4QHOA 3HR0A 2P9BA 5L3GB 1YD8G 3HA4A 4P09A 1SA0E 3SS1A 2BKNA 5CA0E 4OYKA 4TZ4C 4DV0T 1IBKT 2QYWA 4LFAT 4QWNB 1NWMX 1VOMA 5HWYA 5HEUA 2DLRA 5ABFB 5HXSA 1IAPA 4YXDA 4QKNA 2WMOA 4QXBB 2R6GF 3AE4A 4GKJT 3R84B 2V6YA 2WCAA 4X64T 2XQ5A 2WAUA 2CHNA 4H63H 1XNRT 4ZI3C 4DV1T 3KFWX 4DR7T 4OYJA 3AE8A 4O2AE 3AE1A 4YY3T 4UV9B 2WU5A 4HWFA 4IT4A 2E5LT 1WFDA 3ZYLA 3P4RA 2D9DA 2MPKA 3MK7C 4UVAB 1MMGA 5JDFA 2YK0A 3WAJA 3QC9A 5JRCA 2UUAT 4P1NA 3TLUA 4X62T 2MOZA 2XQ7A 1Z0PA 4HWDA 2L9QA 5FXWA 4AXPA 1UX4A 2W0GA 2K5BB 3CPZA 4TV8E 2BKOA 2LLYA 5IHYA 3RKGA 2ZM8A 4XBFB 4QH1A 1W0AA 5HXEA 3FZLB 2UUBT 2BBJA 3LK3B 2XQAA 4UXNB 3IEEA 4JI7T 3G06A 2VVSA 5LBMA 2WMNA 3W15B 2NOXA 4L9IA 4E7SA 4U3CA 1V9DA 3NRXA 3FZHB 2KT9A 2J4GA 4IE4A 3E0ZA 4IE7A 2LEHA 2KZ7B 5JDGA 2M67A 4U31A 5AFUL 5IWAT 4HEAA 3ZT5A 1QUUA 4HKAA 4PK6A 5HEJA 4NIQA 4DMWA 3FZFB 5CJ5A 2RP4A 3IBPA 4F8HA 1ZEEA 4HFBA 3Q5WA 4U7YA 2ZM6T 4AKRB 3C4XA 3N2KE 2VL8A 2FBWA 4QXCB 4AQGA 1M7KA 4CXWA 3AE2A 3BQIA 4PFOA 2H89A 1MMNA 4PJJA 3C51A 3ESLA 2VKOA 4LF9T 2Q9QA 2V7MA 5FNVE 3K1SA 4JYAT 5LA6E 5LHHB 2LJLA 4DR5T 5KMGP 1VRBA 3LG7A 4IE0A 4JI3T 4X1IE 4JI6T 1YKHB 4WBNE 3EDVA 4EAHA 1NENA 3F57A 3BK9A 1E7PA 2NTXA 3NVOA 2I6HA 2NTYA 3O1HA 4QX7B 3AEFA 2X51A 4UIGA 3AE6A 3ZT7A 1XZYA 3K3QC 5F3JA 2BVMA 4GKKT 3ONLC 1FEWA 3RGLA 1G8XA 4I55E 4C91A 1WR6A 4EEDA 1J5WA 1XDPA 1HX8A 4PNIA 3AAEB 2IAKA 2PTFA 4WYVA 1HTJF 2QRXA 5EK3A 4ISTA 5AQTB 3A5XA 2WM9A 2LM2A 3H37A 4YFSA 4IREA 3SFEA 3MACA 2ZLYA 1N34T 3L09A 4K0UA 2CLYC 4CI2B 1J1JA 2XQ4A 2JQQA 2K24A 2QA7A 5E0OA 4CN4A 1XDOA 4QXHB 4G2AA 2IHR1 2X9XA 5BMVE 2X9WA 3KV6A 2DNXA 4H9PC 3RKOA 2CHOA 1HNWT 1JNZA 1JNRA 2XY8B 2WQYA 1OXZA 3RYCE 3N9NA 1ZHCA 4EGWA 2I59A 3AE3A 2CBIA 3PUSA 4JLEA 3VRAA 4OFZA 3O1JA 3NZPA 3VRBA 2RA1A 3RC8A 1XNQT 3AEBA 5FP3A 4PJMA 1FMWA 5AQKB 1T7SA 2A72A 4AQFA 2WBLA 1MMAA 3GWHA 2MTQA 3ZC0A 2XQ6A 4PK5A 4TNWA 1WRDA 3N5LA 3LFMA 2BG9E 3OBVE 3I9YA 2N2NA 3C64A 4JI0T 3N2OA 1D0YA 3AAAB 2CXFA 3CWZB 3PURA 4NUUA 1BR1A 1UURA 2QVAA 2FJDA 2HHHT 3AE9A 3HI2A 4JUYA 1MMDA 2ODVA 4ASKA 3P4SA 4MHCA 5LG3A 1AJ3A 2WDRA 4L5GA 1HCIA 2N1GA 5AQFB 3P8CD 1KEYA 4AKGA 1IJ5A 3ZKRA 3TKLB 1L0VA 3P4PA 3CQCB 2ACXA 4X1YE 3QOFA 2KINB 5CA1E 3AA7B 3OKQA 3VR8A 3AA6B 4JEHB 3UUMA 4DVDA 2WS3A 3PJAA 1OEDC 2VKJA 4MALA 4EIWA 3EI0A 4DV6T 4LF7T 3ETUA 2FJBA 2UXXB 1LKXA 2X67A 5H6RB 2VWAA 3FXEB 4AQYT 4JI4T 3CK6A 4YSXA 3UU8A 5ABGA 4FJOA 2VL0A 2JQHA 4IL4A 1H7CA 4LF5T 4LF6T 3Q9DA 4Z91A 2J47A 3PUWF 3PTRB 5JREA 2QGSA 1MNEA 2AE9A 1YKEB 3Q5EA 3RIUC 1D1AA 3PUGA 1FMVA 3LBXB 3VHLA 3E22E 3CX8B 3L39A 3ZSTA 1U5PA 4U2YA 4UVBB 2XHEB 3KBTA 2W66A 3SWHA 1E2AA 2BG9C 2XQ9A 4HN9A 4ZZCA 3MXZA 2CCQA 4JV5T 2JMKA 4IIJE 2BKPA 3ZN0B 3P4WA 3C98B 3K3OA 4U2ZA 4EXTA 5CGMA 3Q5DA 1W0BA 3I1AA 2YDSA 2WZHA 2CM0A 5J0ZA 2ES0A 2OLTA 5J2TE 2BDEA 5LHIB 3UT5E 4YHHT 2Y48B 4UR9A 4ZOLE 4DV7T 5LHGB 4B3TT 2X0HA 4NXMT 2JMHA 5JDLA 3UQ7A 5AQPB 4B6XA 4HWIB 2K3WA 3J9X1 5LG4A 1MIVA 3P7IA 3N9OA 2WZIA 4GYRA 2LKHA 3PUAA 2LSKA 4TNVA 2CWOA 5L3EB 5BR8T 3HKCE 4J2CA 2D0UA 3OJAA 3QK6A 2BS2A 1XWMA 3ZMUB 1N36T 4ZHQE 4EOZB 5AQMB 2H88A 2A9UA 5HXRA 4DR4T 3LSVA 1WLXA 2CPTA 3M3ZB 4IE6A 1N33T 4A56A 3PUYF 4ADZA 3JCFA 2IUBA 5M4YA 2XQ8A 4C90A 3O4XE 2XQYA 4DIDB 4HWCA 2Q9QC 4ERRA 2V5CA 2I0MA 4AIUA 3DJBA 3O1IA 4LF8T 5AQUB 2CBJA 4ILAA 5JDMA 4O4HE 3H3AA 2C5JA 3PDYA 3UUBA 4X1KE 3UU4A 4O8SA 3FBZA 5AQSB 2XQ3A 2K48A 2LOSA 4LF4T 3RHWA 3FHNA 2CXLA 4H9QC 3AECA 3T1YT 4IDOA 3DTOA 5GONE 3N2GE 5ABHA 4KHPT 5EK4A 3V5UA 1NEKA 3TLTA 4DUZT 4EB6E 2V7KA 2WB5A 5LXTE 3UU3A 5JDHA 2PJQA 4H9RC 4TUYE 3CKDA 2X66A 3O9XA 1I94T 2VQET 3AA0B 5LNKA 4TX5A 2C0SA 5ETWA 2XAQB 2L3LA 2D5UA 5FXVA 3QB5A 2X9YA 4IE5A 3V5SA 2X0YA 4O4LE 5HAXA 2YOEA 4PJLA 5KDMC 2LSGA 3RRWA 4IDPA 5HYAA 4ANJA 1QSDA 4M1PA 2KMFA 4A5XA 4UVCB 1N32T 1D1BA 2XPKA 2WU2A 2V7JA 4UEMA 1O3XA 2MAWA 3ONJA 4CI1B 4QH5A 1WR0A 2VK9A 3ZYMA 2UXCT 3GA8A 2ZM2A 1T98A 4MBQA 3AA1B 3B57A 5AQJB 2SPCA 3HKDE 3JADA 2LRKA 3HKEE 4DR3T 2DL1A 3JC6C 5LGTB 2F4VT 2XASB 4ILUA 3ZCJA 2IIUA 3LBXA 4WBOA 3ZJ2A 2DWGA 4AKHA 5H6QB 5HXHA 2YN6A 3FXDB 1QLBA 2BZBA 2E2AA 5HXCA 3UULA 3UFGA 3ZC1A 1EZ3A 3ANWB 4IHJE 5AQGB 3I9WA 4ZI7E 2MBGA 1G73A 2DWKA 1OEDB 2XSBA 4EYUA 2W2UA 3AVRA 4IGUA 5AQHB 1U4QA 1GQEA 2KXPB 3UUNA 1D0ZA 2WWVA 4DV2T 3U3IA 4IDNA 4JBWF 3UU6A 5C3JA 4KBMB 5DABA 3C50A 4WNKA 1LRZA 5JDQA 1B7TA 2HN2A 1UX5A 3F2EA 3KBUA 5FXZA 3Q2MA 4FI5A 3RQWA 3I0OA 4NUVA 3CMLA 3UQ4A 4EV6A 5FY0A 3OPCA 3OTOT 3RQUA 2CRBA 2EHOB 4LFCT 2BG9B 4DR2T 2FJEA 4P0AA 2BBHA 3C4ZA 1T72A 1CHUA 2RPAA 3KVAA 3EDUA 2D2SA 4DUYT 1MIWA 1HFAA 2LM9A 4X66T 5HEHA 2NW8A 3N9LA 4GIWA 4AI6A 4CI3B 3AEEA 2E9XC 4COFA 3GN5A 2LSJA 1E1HB 2OA5A 4AISA 5EK2A 2UUCT 5FYMA 4QH4A 3S4UA 1IJ6A 2HPJA 2EHOD 4I0UA 5L3DB 4UELA 4PK4A 5FL1A 1I6ZA 1Z8UA 4YSZA 1SE7A 3CIRA 3SRZA 5FVKA 2ZMAA 1LVKA 2WWUA 5JR9C 4DBQA 2L8KA 1ZOYA 4K0KT 4CZZB 3LK42 4TWHA 5AQIB 1W09A 5HCJA 5J2UE 4MFRA 5TAOA 4HFEA 5C2TA 4H63V 4IDQA 4LMJA 3VR9A 4JI8T 5FVLA 2DI4A 2B76A 3CX6B 3KV9A 4B3ST 2J62A 3MJXA 2XZEA 2V26A 3TLSA 5FY7A 3UFEA 3KVBA 1KFYA 2DCFA 3IHRA 2UU9T 4HGAA 2V5DA 3B5MA 5KXJA 1KF6A 4DV5T 5LGNB 3QB5K 4CN1A 5J1GA 2JIWA 3ZT6A 4PFPA 1KNZA 3X1DA 3KV5A 4ISSA 1LVFA 1ZP0A 5F8PA 2K9AA 4GK0E 3R6NA 3HL6A 4NXNT 2V8SV 1HX1B 2A3DA 2YEVC 4ZI3D 2XTLA 4UF0B 2NR4A 5DQWA 4JI5T 3FZMB 5DJQC 2KNDA 1SHZC 4DO0A 3ZMSB 3H3MA 4H9SE 2NP9A 4UV8B 2IMLA 5LYJE 1UGOA 2CWYA 5ADXL 3ZPOA 4A97A 5FKYA 2WDQA 1UUSA 1US7B 4GK5E 5FMNA 2B1EA 3EUHA 4X5TA 2XAHB 5L3BB 4U74A 1IBMT 1YW0A 5IUXA 3KDSE 1D0XA 2IC6A 3N9QA 4DV4T 5HCMA 2NW7A 5AQLB 4JI1T 4CXXA 3L3PA 2H7VC 3LDQB 2XUEA 2LHRA 4OX9T 5L3CB 3AE7A 3ZMVB 3ANWA 2PG8A 5EZYE 3NBXX 3CQXC 2PFVA 2YINA 4EZHA 1CUNA 3AXJB 1OEDA 3AEGA 2LSIA 4WZXA 3DP7A 1VCTA 4KI0F 3AVSA 5LJNA 2Z6EA 3A8YC 3CQGB 3ZN1B 1HNZT 3Q5XA 4ZS2A 2UXNB 2YU2A 1UCUA 2LE8A 2W63A 5AQOB 4BJNA 2HPLA 5CFBA 3GN5B 3QUJA 3TLVA 4HFCA 2IC9A 4ZI2C 4U33A 3RIUA 4G63A 4AKIA 4ZS3A 3PUXF 3ABVA 4NPPA 4KHZF 2CXDA 3GMIA 3ETVA 1YQ3A 4AKLA 5JDNA 5LCYA 5LBQB 1OWAA 5FY1A 2EHOA 3MZKB 4WW0A 2BG9A 3ZEFB 5HWXA 2LOPA 3J7Yq 1HS7A 2W62A 4YTPA 2KLQA 2NWBA 5F5WA 5L4HA 3IA3A 2XAJB 1BR0A 4GOUA 1UK5A 4ZXLA 4KMCA 3D0TA 4X65T 1IZNB 3JC6D 3EAMA 2CLYB 5LOVE 4Z90A 3EABA 3BQLA 5LGUB 3B13A 3E08A 3IF8B 4ZZBA 2XJ7A 3RLFF 1J5ET 4X20E 2VKHA 3PUQA 1DU2A 3RX6A 3PU3A 4Z8XA 3OYXA 1X9BA 3NWIA 2GK9A 3RYIE 4U72A 3LK2B 5JVDE 4DMVA 4B3MT 2E8IA 4L0RA 3ZCIA 4GYSA 2MYSA 2VVNA 4V1Av 4YLHA 1MIYA 3RC3A 1HG5A 3ZSSA 3PUVF 2M6BA 1WYBA 2M6IA 2HH7A 2WY2A 5AQQB 4I50E 3F31A 1BR4A 4KUMB 3ZJ1A 1D1CA 2KWIB 3P50A 3UUXB 5AQRB 4O2BE 3KV4A 2E5VA 1T8BA 3EHZA 3RIAA 1ZKEA 2LRLA 3T8OA 2E9XB 2C5IT 2YDQA 4EZ4A 2WSSV 2DHRA 5LB7B 1HNXT 2VASA 5L4EA 4XAXB 5AQNB 3HKBE 4TWFA 4Q25A 4AQFC 4HFDA 3CX7B 4JI2T 3C4WA 3WAKA 3T1HT 1HF8A 2AXDS 2XSAA 4DR6T 5JH7E 5C8YE 4TWDA 4DV3T 2BS4A 3N9PA 2BVLA 5JR9B 4IDZA 4IL9A 3RF1A 4UF0A 3OYZA 2E9XD 3P4QA 2UXDT 1S35A 2Y8DA 3UU5A 1X79A 1KNRA 1KNPA 3FBLA 2LKGA 3KINB 3MKDA 1XMQT 3AB3B 2WDVA 4YJ3E 2J1DG 2VURA 3BQKA 3FZKB 1IBLT 2W00A 4YJ2E 4PW8A 3N9MA 1FJGT 2XAFB 1MNDA 5LMNT 4HFVA 3VKGA 1YQ4A 4BJMA 5FL0A 4EEBA 4P0BA 5ABEA 2V6YB 4JEUB 2CE7A 4MLKA 2FJAA 2LHNA 5CB4E 5HEOA 3AEAA 1OEDE 2VKDA 2XM2A 2XAGB 3RYFE 2Y6XA 4H9NC 1NAFA 2YU1A 3JAEA 3AXJA 2HN1A 2XM1A 2CEAA 4DR1T 4BA9A 1BR2A 5AQVB 3LJCA 4I43B 4DNDA 1HR0T 3PE0A 5ABFA 3PJAJ 5JRCB 2V7LA 4YTMA 2W4XA 4F6RC 4H9OC 4YT0A 4PAGA 2KWHA 2V6XA 4CN6A 5JQGE 3VU7H 3U78A 3L8RA 2BS3A 2N9DA 3OVUA 4KX6A 3SOLA 3NRYA 1XMOT 1S94A 2H7OA 5FXXA 3UTKA 2W61A 5L3FB 2CMRA 2ZM0A 2JQKA 3NZQA 3ZMTB 3ZLIA 3EVYA 3ZMZB 1KK7A 4I4TE 3K8PC 2V7IA 2X68A 3M65A 4OHFA 1HG2A 4TN7B 4HTEA 1W9RA 4ILCA 3CVRA 2JJ9A 4HFIA 1Y64B 1SUMB 3AE5A 1FIOA 2ODUA 2JPFA 4N78D 2C5KT 4YSYA 3JAFA 4HWHA 5IYZE 2VB6A 4YHJA 1YXRA 3I0QA 3A7MA 2IDOB 2X9HA 5LMUT 2A2FX 4CQIA 2UXBT 3FB2A 2H3RA 1WCRA 2ACZA 4HFHA 4BAYB 5KX5E 4B3RT 3AAIA 4OK0A 2D0TA 5LP6E 4KP3C 1WYCA 2Q9QB 4ZEYA 2CA5A 2FUPA 3PV0F 1ZV4X 4ILBA 4XZCA 2JRKA 3RRCA 2V1DB 5LJMA 4HE8A 1M62A 5HEGA 3VKHA 5JTGA 3RIFA 3WI3A 5L47A 2YKSA 5DQVA 3AEDA 5L2LA 2JQ9A 4O4JE 3TLWA 2NW9A 4LFBT 4CXYA 4U7IA 4ZI2D 2E9XA 3NKZA 4LMKA 2EHOC 2Q9QD 3ONXA 4A98A 2OV9A 4E7ZA 2G0UA 2LT3A 4O4IE 2W67A 3K3NA 1R8IA 2IW5B 2LSYA 3SFDA 4YTNA 2YDRA 3PU8A 2VQFT 3RH3A 3RYHE 4QX8B 4PJNA 4TV9E 1Y01A 2KSRA 4DBRA 4LMLA 2X0LB 2WP9A 3QNUA 5JR9A 3MA9A 3PUZF 2PBIA 3RPUA 3ZYKA 4EYYR
chains in the Genus database with same CATH topology
4EYUA 3P8CD 2VKHA 3AVRA 4IGUA 3PUQA 5A1LA 4AKGA 1U4QA 1IJ5A 3RX6A 3PU3A 4QHOA 3HR0A 3TKLB 2P9BA 4Z8XA 3CQCB 3OYXA 5L3GB 1YD8G 2ACXA 2KXPB 4X1YE 3HA4A 3UUNA 4P09A 1D0ZA 1SA0E 3SS1A 5CA0E 2KINB 2GK9A 3RYIE 3AA7B 3OKQA 4U72A 5CA1E 3LK2B 3U3IA 4OYKA 4TZ4C 5JVDE 4DMVA 3AA6B 4JEHB 3UUMA 4QWNB 4DVDA 4KBMB 5DABA 1NWMX 3C50A 4WNKA 1VOMA 2E8IA 1LRZA 5JDQA 4L0RA 1B7TA 3ZCIA 4GYSA 2VKJA 5HWYA 2MYSA 2DLRA 4MALA 4V1Av 4YLHA 1UX5A 4EIWA 1MIYA 3RC3A 1HG5A 5HXSA 3ETUA 3F2EA 3KBUA 5FXZA 2UXXB 3Q2MA 1LKXA 4FI5A 1IAPA 1WYBA 2X67A 5H6RB 2HH7A 2VWAA 3I0OA 4QKNA 3FXEB 4NUVA 2WMOA 4I50E 3F31A 4QXBB 1BR4A 3CMLA 4KUMB 4FJOA 3ZJ1A 1D1CA 2KWIB 5FY0A 1H7CA 3UUXB 4O2BE 3KV4A 3Q9DA 3R84B 3PTRB 5JREA 2EHOB 2QGSA 1MNEA 2WAUA 1ZKEA 4H63H 4ZI3C 4P0AA 3T8OA 1YKEB 2E9XB 2C5IT 3C4ZA 3KFWX 4EZ4A 2WSSV 2DHRA 4OYJA 3KVAA 4O2AE 3EDUA 2D2SA 1D1AA 2VASA 3PUGA 1FMVA 1MIWA 4UV9B 1HFAA 4XAXB 3LBXB 2LM9A 3VHLA 3E22E 3CX8B 3HKBE 3ZYLA 1U5PA 2NW8A 4AQFC 4UVBB 3N9LA 2XHEB 3CX7B 4GIWA 4AI6A 3KBTA 3C4WA 3WAKA 4CI3B 3MK7C 4UVAB 1HF8A 3SWHA 1MMGA 5JDFA 2YK0A 4HN9A 5JH7E 3MXZA 5C8YE 3WAJA 2E9XC 3QC9A 2CCQA 3GN5A 5JRCA 2JMKA 4IIJE 2LSJA 2MOZA 3ZN0B 3N9PA 1E1HB 2OA5A 1Z0PA 2BVLA 5EK2A 5JR9B 5FYMA 3C98B 3K3OA 3S4UA 4IDZA 1IJ6A 2HPJA 4EXTA 2L9QA 4UF0A 3I1AA 2EHOD 2CM0A 5FXWA 4AXPA 1UX4A 2W0GA 5L3DB 2K5BB 4UELA 3CPZA 4PK4A 3OYZA 4TV8E 2E9XD 2ES0A 5IHYA 1S35A 2Y8DA 5J2TE 2BDEA 1X79A 3SRZA 2ZM8A 5LHIB 3UT5E 2Y48B 4XBFB 4ZOLE 5HXEA 3FBLA 2ZMAA 1LVKA 3KINB 3LK3B 3MKDA 4UXNB 3IEEA 2WWUA 5LBMA 5LHGB 2WMNA 3W15B 5JR9C 2NOXA 3AB3B 4DBQA 4L9IA 2L8KA 2JMHA 4E7SA 4CZZB 5JDLA 1V9DA 3LK42 3NRXA 4YJ3E 2J1DG 5J2UE 2KT9A 4MFRA 5TAOA 4IE4A 4B6XA 3BQKA 3E0ZA 4IE7A 2W00A 2LEHA 4YJ2E 4PW8A 4H63V 2KZ7B 3J9X1 3N9MA 5JDGA 5LG4A 2M67A 1MIVA 2DI4A 5AFUL 2XAFB 1MNDA 3P7IA 4HEAA 4HFVA 3CX6B 3N9OA 3KV9A 1QUUA 4HKAA 4PK6A 3VKGA 4GYRA 3MJXA 1HCIA 4BJMA 3PUAA 4DMWA 2LSKA 4P0BA 2V26A 5FY7A 3UFEA 2CWOA 5L3EB 3KVBA 4JEUB 2CE7A 2RP4A 2DCFA 3IBPA 3IHRA 4MLKA 2LHNA 3HKCE 1ZEEA 4J2CA 5CB4E 2D0UA 4HGAA 3Q5WA 2VKDA 3OJAA 4AKRB 3C4XA 3QK6A 2XAGB 3N2KE 3RYFE 2Y6XA 2VL8A 3ZMUB 5LGNB 4H9NC 4ZHQE 4QXCB 5J1GA 4AQGA 4EOZB 1NAFA 2YU1A 2CEAA 4PFPA 1KNZA 4BA9A 1BR2A 3LJCA 4CXWA 3BQIA 5HXRA 4I43B 4PFOA 3KV5A 4DNDA 4ISSA 1LVFA 1WLXA 5F8PA 4IE6A 3PE0A 4A56A 2K9AA 4ADZA 1MMNA 4GK0E 5M4YA 4PJJA 5JRCB 3R6NA 2V7LA 3C51A 3ESLA 2VKOA 4F6RC 3HL6A 4H9OC 2Q9QA 2V7MA 4C90A 5FNVE 4PAGA 2A3DA 2YEVC 3O4XE 4ZI3D 2XTLA 5LA6E 5LHHB 2XQYA 4UF0B 2Q9QC 4ERRA 2LJLA 5DQWA 5KMGP 2KWHA 1VRBA 3LG7A 4IE0A 5DJQC 2KNDA 1SHZC 4DO0A 5JQGE 3VU7H 3ZMSB 3DJBA 3O1IA 3U78A 4X1IE 5JDMA 4H9SE 2N9DA 2NP9A 4UV8B 4O4HE 3H3AA 1YKHB 4WBNE 3EDVA 2C5JA 5LYJE 3PDYA 4EAHA 4X1KE 3SOLA 3NRYA 3F57A 2CWYA 3BK9A 5ADXL 4O8SA 3ZPOA 1S94A 2H7OA 5FXXA 3UTKA 1US7B 2NTXA 2W61A 4GK5E 5FMNA 5L3FB 2CMRA 3FBZA 2B1EA 2ZM0A 3EUHA 2K48A 3NZQA 2NTYA 3O1HA 4QX7B 2LOSA 3EVYA 2XAHB 3ZMTB 3ZLIA 2X51A 5L3BB 4UIGA 4U74A 3ZMZB 1KK7A 3FHNA 1YW0A 2CXLA 4H9QC 3K3QC 3KDSE 4I4TE 3K8PC 5F3JA 2V7IA 2X68A 2BVMA 3DTOA 5GONE 1D0XA 3M65A 2IC6A 3N9QA 1FEWA 3N2GE 4OHFA 1HG2A 2NW7A 4TN7B 1G8XA 4HTEA 5EK4A 4I55E 3L3PA 4CXXA 3V5UA 4C91A 1WR6A 2H7VC 1HX8A 4PNIA 3CVRA 3AAEB 4EB6E 2V7KA 2IAKA 2JJ9A 2XUEA 1HTJF 5LXTE 2LHRA 5JDHA 1Y64B 5EK3A 4ISTA 5L3CB 2PJQA 3A5XA 2WM9A 4H9RC 3ZMVB 3H37A 3ANWA 4TUYE 3CKDA 2X66A 4YFSA 3O9XA 3MACA 1FIOA 2ZLYA 2PG8A 2ODUA 3L09A 5EZYE 4K0UA 3AA0B 2JPFA 2PFVA 3CQXC 2C5KT 3NBXX 2YINA 4N78D 4TX5A 2CLYC 4CI2B 4EZHA 5LNKA 2C0SA 5ETWA 2XAQB 1CUNA 2L3LA 2D5UA 2JQQA 2K24A 2QA7A 5FXVA 2X9YA 5IYZE 4IE5A 5E0OA 3V5SA 2VB6A 4YHJA 2LSIA 3I0QA 3DP7A 4O4LE 4QXHB 2X9HA 2A2FX 3AVSA 4G2AA 4CQIA 3FB2A 2H3RA 5HAXA 2X9XA 5BMVE 4PJLA 5KX5E 4BAYB 2X9WA 5KDMC 5LJNA 2LSGA 2Z6EA 3KV6A 3CQGB 2DNXA 4H9PC 3AAIA 4OK0A 3RRWA 2D0TA 3RKOA 5HYAA 5LP6E 4KP3C 3ZN1B 1WYCA 2Q9QB 4ANJA 1QSDA 1OXZA 2CA5A 3RYCE 3N9NA 4M1PA 2KMFA 3Q5XA 4ZS2A 1ZHCA 2UXNB 2YU2A 1UCUA 2I59A 4UVCB 2LE8A 2W63A 1ZV4X 1D1BA 3PUSA 4BJNA 2HPLA 4XZCA 2JRKA 3GN5B 4JLEA 3QUJA 3RRCA 2V7JA 2V1DB 5LJMA 4OFZA 4HE8A 2IC9A 3O1JA 3VKHA 4UEMA 3NZPA 1O3XA 4ZI2C 2RA1A 3RC8A 4CI1B 4G63A 4AKIA 4ZS3A 3WI3A 5FP3A 4PJMA 5DQVA 1FMWA 5L2LA 2VK9A 2CXDA 3GMIA 3ZYMA 3ETVA 4O4JE 2NW9A 3GA8A 4CXYA 4AKLA 2A72A 4AQFA 2WBLA 2ZM2A 1T98A 4MBQA 5JDNA 5LCYA 1MMAA 3AA1B 3B57A 5LBQB 1OWAA 3GWHA 2MTQA 5FY1A 2SPCA 2EHOA 3MZKB 3HKDE 3ZC0A 4WW0A 4PK5A 3HKEE 4ZI2D 1WRDA 3N5LA 2E9XA 3LFMA 3ZEFB 2EHOC 2Q9QD 3ONXA 3JC6C 5HWXA 5LGTB 2LOPA 3J7Yq 1HS7A 2XASB 3OBVE 4E7ZA 2W62A 3I9YA 2G0UA 2N2NA 3C64A 2LT3A 4ILUA 4O4IE 3ZCJA 2KLQA 3K3NA 2NWBA 1D0YA 3LBXA 3N2OA 4WBOA 2DWGA 2IW5B 3ZJ2A 4AKHA 2LSYA 5H6QB 5HXHA 2XAJB 1BR0A 3AAAB 4GOUA 3FXDB 3PU8A 4KMCA 2BZBA 2CXFA 3CWZB 3PURA 5HXCA 3D0TA 4NUUA 3UULA 3ZC1A 1IZNB 3RH3A 3RYHE 1EZ3A 3JC6D 4QX8B 3ANWB 2CLYB 1BR1A 4PJNA 4IHJE 4TV9E 5LOVE 3BQLA 5LGUB 3B13A 4DBRA 3E08A 3HI2A 3I9WA 4JUYA 4ZI7E 1MMDA 2ODVA 2X0LB 2MBGA 3IF8B 4ASKA 4MHCA 1G73A 2DWKA 5JR9A 3MA9A 1AJ3A 4X20E 2PBIA 3RPUA 3ZYKA 4L5GA 2N1GA 4EYYR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J9X 1;  3FBL A;  3F2E A;  3FBZ A; 
#chains in the Genus database with same CATH topology
 1VCS A;  5A1L A;  3RI5 A;  4QHO A;  3HR0 A;  2P9B A;  5L3G B;  1YD8 G;  3HA4 A;  4P09 A;  1SA0 E;  3SS1 A;  2BKN A;  5CA0 E;  4OYK A;  4TZ4 C;  4DV0 T;  1IBK T;  2QYW A;  4LFA T;  4QWN B;  1NWM X;  1VOM A;  5HWY A;  5HEU A;  2DLR A;  5ABF B;  5HXS A;  1IAP A;  4YXD A;  4QKN A;  2WMO A;  4QXB B;  2R6G F;  3AE4 A;  4GKJ T;  3R84 B;  2V6Y A;  2WCA A;  4X64 T;  2XQ5 A;  2WAU A;  2CHN A;  4H63 H;  1XNR T;  4ZI3 C;  4DV1 T;  3KFW X;  4DR7 T;  4OYJ A;  3AE8 A;  4O2A E;  3AE1 A;  4YY3 T;  4UV9 B;  2WU5 A;  4HWF A;  4IT4 A;  2E5L T;  1WFD A;  3ZYL A;  3P4R A;  2D9D A;  2MPK A;  3MK7 C;  4UVA B;  1MMG A;  5JDF A;  2YK0 A;  3WAJ A;  3QC9 A;  5JRC A;  2UUA T;  4P1N A;  3TLU A;  4X62 T;  2MOZ A;  2XQ7 A;  1Z0P A;  4HWD A;  2L9Q A;  5FXW A;  4AXP A;  1UX4 A;  2W0G A;  2K5B B;  3CPZ A;  4TV8 E;  2BKO A;  2LLY A;  5IHY A;  3RKG A;  2ZM8 A;  4XBF B;  4QH1 A;  1W0A A;  5HXE A;  3FZL B;  2UUB T;  2BBJ A;  3LK3 B;  2XQA A;  4UXN B;  3IEE A;  4JI7 T;  3G06 A;  2VVS A;  5LBM A;  2WMN A;  3W15 B;  2NOX A;  4L9I A;  4E7S A;  4U3C A;  1V9D A;  3NRX A;  3FZH B;  2KT9 A;  2J4G A;  4IE4 A;  3E0Z A;  4IE7 A;  2LEH A;  2KZ7 B;  5JDG A;  2M67 A;  4U31 A;  5AFU L;  5IWA T;  4HEA A;  3ZT5 A;  1QUU A;  4HKA A;  4PK6 A;  5HEJ A;  4NIQ A;  4DMW A;  3FZF B;  5CJ5 A;  2RP4 A;  3IBP A;  4F8H A;  1ZEE A;  4HFB A;  3Q5W A;  4U7Y A;  2ZM6 T;  4AKR B;  3C4X A;  3N2K E;  2VL8 A;  2FBW A;  4QXC B;  4AQG A;  1M7K A;  4CXW A;  3AE2 A;  3BQI A;  4PFO A;  2H89 A;  1MMN A;  4PJJ A;  3C51 A;  3ESL A;  2VKO A;  4LF9 T;  2Q9Q A;  2V7M A;  5FNV E;  3K1S A;  4JYA T;  5LA6 E;  5LHH B;  2LJL A;  4DR5 T;  5KMG P;  1VRB A;  3LG7 A;  4IE0 A;  4JI3 T;  4X1I E;  4JI6 T;  1YKH B;  4WBN E;  3EDV A;  4EAH A;  1NEN A;  3F57 A;  3BK9 A;  1E7P A;  2NTX A;  3NVO A;  2I6H A;  2NTY A;  3O1H A;  4QX7 B;  3AEF A;  2X51 A;  4UIG A;  3AE6 A;  3ZT7 A;  1XZY A;  3K3Q C;  5F3J A;  2BVM A;  4GKK T;  3ONL C;  1FEW A;  3RGL A;  1G8X A;  4I55 E;  4C91 A;  1WR6 A;  4EED A;  1J5W A;  1XDP A;  1HX8 A;  4PNI A;  3AAE B;  2IAK A;  2PTF A;  4WYV A;  1HTJ F;  2QRX A;  5EK3 A;  4IST A;  5AQT B;  3A5X A;  2WM9 A;  2LM2 A;  3H37 A;  4YFS A;  4IRE A;  3SFE A;  3MAC A;  2ZLY A;  1N34 T;  3L09 A;  4K0U A;  2CLY C;  4CI2 B;  1J1J A;  2XQ4 A;  2JQQ A;  2K24 A;  2QA7 A;  5E0O A;  4CN4 A;  1XDO A;  4QXH B;  4G2A A;  2IHR 1;  2X9X A;  5BMV E;  2X9W A;  3KV6 A;  2DNX A;  4H9P C;  3RKO A;  2CHO A;  1HNW T;  1JNZ A;  1JNR A;  2XY8 B;  2WQY A;  1OXZ A;  3RYC E;  3N9N A;  1ZHC A;  4EGW A;  2I59 A;  3AE3 A;  2CBI A;  3PUS A;  4JLE A;  3VRA A;  4OFZ A;  3O1J A;  3NZP A;  3VRB A;  2RA1 A;  3RC8 A;  1XNQ T;  3AEB A;  5FP3 A;  4PJM A;  1FMW A;  5AQK B;  1T7S A;  2A72 A;  4AQF A;  2WBL A;  1MMA A;  3GWH A;  2MTQ A;  3ZC0 A;  2XQ6 A;  4PK5 A;  4TNW A;  1WRD A;  3N5L A;  3LFM A;  2BG9 E;  3OBV E;  3I9Y A;  2N2N A;  3C64 A;  4JI0 T;  3N2O A;  1D0Y A;  3AAA B;  2CXF A;  3CWZ B;  3PUR A;  4NUU A;  1BR1 A;  1UUR A;  2QVA A;  2FJD A;  2HHH T;  3AE9 A;  3HI2 A;  4JUY A;  1MMD A;  2ODV A;  4ASK A;  3P4S A;  4MHC A;  5LG3 A;  1AJ3 A;  2WDR A;  4L5G A;  1HCI A;  2N1G A;  5AQF B;  3P8C D;  1KEY A;  4AKG A;  1IJ5 A;  3ZKR A;  3TKL B;  1L0V A;  3P4P A;  3CQC B;  2ACX A;  4X1Y E;  3QOF A;  2KIN B;  5CA1 E;  3AA7 B;  3OKQ A;  3VR8 A;  3AA6 B;  4JEH B;  3UUM A;  4DVD A;  2WS3 A;  3PJA A;  1OED C;  2VKJ A;  4MAL A;  4EIW A;  3EI0 A;  4DV6 T;  4LF7 T;  3ETU A;  2FJB A;  2UXX B;  1LKX A;  2X67 A;  5H6R B;  2VWA A;  3FXE B;  4AQY T;  4JI4 T;  3CK6 A;  4YSX A;  3UU8 A;  5ABG A;  4FJO A;  2VL0 A;  2JQH A;  4IL4 A;  1H7C A;  4LF5 T;  4LF6 T;  3Q9D A;  4Z91 A;  2J47 A;  3PUW F;  3PTR B;  5JRE A;  2QGS A;  1MNE A;  2AE9 A;  1YKE B;  3Q5E A;  3RIU C;  1D1A A;  3PUG A;  1FMV A;  3LBX B;  3VHL A;  3E22 E;  3CX8 B;  3L39 A;  3ZST A;  1U5P A;  4U2Y A;  4UVB B;  2XHE B;  3KBT A;  2W66 A;  3SWH A;  1E2A A;  2BG9 C;  2XQ9 A;  4HN9 A;  4ZZC A;  3MXZ A;  2CCQ A;  4JV5 T;  2JMK A;  4IIJ E;  2BKP A;  3ZN0 B;  3P4W A;  3C98 B;  3K3O A;  4U2Z A;  4EXT A;  5CGM A;  3Q5D A;  1W0B A;  3I1A A;  2YDS A;  2WZH A;  2CM0 A;  5J0Z A;  2ES0 A;  2OLT A;  5J2T E;  2BDE A;  5LHI B;  3UT5 E;  4YHH T;  2Y48 B;  4UR9 A;  4ZOL E;  4DV7 T;  5LHG B;  4B3T T;  2X0H A;  4NXM T;  2JMH A;  5JDL A;  3UQ7 A;  5AQP B;  4B6X A;  4HWI B;  2K3W A;  3J9X 1;  5LG4 A;  1MIV A;  3P7I A;  3N9O A;  2WZI A;  4GYR A;  2LKH A;  3PUA A;  2LSK A;  4TNV A;  2CWO A;  5L3E B;  5BR8 T;  3HKC E;  4J2C A;  2D0U A;  3OJA A;  3QK6 A;  2BS2 A;  1XWM A;  3ZMU B;  1N36 T;  4ZHQ E;  4EOZ B;  5AQM B;  2H88 A;  2A9U A;  5HXR A;  4DR4 T;  3LSV A;  1WLX A;  2CPT A;  3M3Z B;  4IE6 A;  1N33 T;  4A56 A;  3PUY F;  4ADZ A;  3JCF A;  2IUB A;  5M4Y A;  2XQ8 A;  4C90 A;  3O4X E;  2XQY A;  4DID B;  4HWC A;  2Q9Q C;  4ERR A;  2V5C A;  2I0M A;  4AIU A;  3DJB A;  3O1I A;  4LF8 T;  5AQU B;  2CBJ A;  4ILA A;  5JDM A;  4O4H E;  3H3A A;  2C5J A;  3PDY A;  3UUB A;  4X1K E;  3UU4 A;  4O8S A;  3FBZ A;  5AQS B;  2XQ3 A;  2K48 A;  2LOS A;  4LF4 T;  3RHW A;  3FHN A;  2CXL A;  4H9Q C;  3AEC A;  3T1Y T;  4IDO A;  3DTO A;  5GON E;  3N2G E;  5ABH A;  4KHP T;  5EK4 A;  3V5U A;  1NEK A;  3TLT A;  4DUZ T;  4EB6 E;  2V7K A;  2WB5 A;  5LXT E;  3UU3 A;  5JDH A;  2PJQ A;  4H9R C;  4TUY E;  3CKD A;  2X66 A;  3O9X A;  1I94 T;  2VQE T;  3AA0 B;  5LNK A;  4TX5 A;  2C0S A;  5ETW A;  2XAQ B;  2L3L A;  2D5U A;  5FXV A;  3QB5 A;  2X9Y A;  4IE5 A;  3V5S A;  2X0Y A;  4O4L E;  5HAX A;  2YOE A;  4PJL A;  5KDM C;  2LSG A;  3RRW A;  4IDP A;  5HYA A;  4ANJ A;  1QSD A;  4M1P A;  2KMF A;  4A5X A;  4UVC B;  1N32 T;  1D1B A;  2XPK A;  2WU2 A;  2V7J A;  4UEM A;  1O3X A;  2MAW A;  3ONJ A;  4CI1 B;  4QH5 A;  1WR0 A;  2VK9 A;  3ZYM A;  2UXC T;  3GA8 A;  2ZM2 A;  1T98 A;  4MBQ A;  3AA1 B;  3B57 A;  5AQJ B;  2SPC A;  3HKD E;  3JAD A;  2LRK A;  3HKE E;  4DR3 T;  2DL1 A;  3JC6 C;  5LGT B;  2F4V T;  2XAS B;  4ILU A;  3ZCJ A;  2IIU A;  3LBX A;  4WBO A;  3ZJ2 A;  2DWG A;  4AKH A;  5H6Q B;  5HXH A;  2YN6 A;  3FXD B;  1QLB A;  2BZB A;  2E2A A;  5HXC A;  3UUL A;  3UFG A;  3ZC1 A;  1EZ3 A;  3ANW B;  4IHJ E;  5AQG B;  3I9W A;  4ZI7 E;  2MBG A;  1G73 A;  2DWK A;  1OED B;  2XSB A;  4EYU A;  2W2U A;  3AVR A;  4IGU A;  5AQH B;  1U4Q A;  1GQE A;  2KXP B;  3UUN A;  1D0Z A;  2WWV A;  4DV2 T;  3U3I A;  4IDN A;  4JBW F;  3UU6 A;  5C3J A;  4KBM B;  5DAB A;  3C50 A;  4WNK A;  1LRZ A;  5JDQ A;  1B7T A;  2HN2 A;  1UX5 A;  3F2E A;  3KBU A;  5FXZ A;  3Q2M A;  4FI5 A;  3RQW A;  3I0O A;  4NUV A;  3CML A;  3UQ4 A;  4EV6 A;  5FY0 A;  3OPC A;  3OTO T;  3RQU A;  2CRB A;  2EHO B;  4LFC T;  2BG9 B;  4DR2 T;  2FJE A;  4P0A A;  2BBH A;  3C4Z A;  1T72 A;  1CHU A;  2RPA A;  3KVA A;  3EDU A;  2D2S A;  4DUY T;  1MIW A;  1HFA A;  2LM9 A;  4X66 T;  5HEH A;  2NW8 A;  3N9L A;  4GIW A;  4AI6 A;  4CI3 B;  3AEE A;  2E9X C;  4COF A;  3GN5 A;  2LSJ A;  1E1H B;  2OA5 A;  4AIS A;  5EK2 A;  2UUC T;  5FYM A;  4QH4 A;  3S4U A;  1IJ6 A;  2HPJ A;  2EHO D;  4I0U A;  5L3D B;  4UEL A;  4PK4 A;  5FL1 A;  1I6Z A;  1Z8U A;  4YSZ A;  1SE7 A;  3CIR A;  3SRZ A;  5FVK A;  2ZMA A;  1LVK A;  2WWU A;  5JR9 C;  4DBQ A;  2L8K A;  1ZOY A;  4K0K T;  4CZZ B;  3LK4 2;  4TWH A;  5AQI B;  1W09 A;  5HCJ A;  5J2U E;  4MFR A;  5TAO A;  4HFE A;  5C2T A;  4H63 V;  4IDQ A;  4LMJ A;  3VR9 A;  4JI8 T;  5FVL A;  2DI4 A;  2B76 A;  3CX6 B;  3KV9 A;  4B3S T;  2J62 A;  3MJX A;  2XZE A;  2V26 A;  3TLS A;  5FY7 A;  3UFE A;  3KVB A;  1KFY A;  2DCF A;  3IHR A;  2UU9 T;  4HGA A;  2V5D A;  3B5M A;  5KXJ A;  1KF6 A;  4DV5 T;  5LGN B;  3QB5 K;  4CN1 A;  5J1G A;  2JIW A;  3ZT6 A;  4PFP A;  1KNZ A;  3X1D A;  3KV5 A;  4ISS A;  1LVF A;  1ZP0 A;  5F8P A;  2K9A A;  4GK0 E;  3R6N A;  3HL6 A;  4NXN T;  2V8S V;  1HX1 B;  2A3D A;  2YEV C;  4ZI3 D;  2XTL A;  4UF0 B;  2NR4 A;  5DQW A;  4JI5 T;  3FZM B;  5DJQ C;  2KND A;  1SHZ C;  4DO0 A;  3ZMS B;  3H3M A;  4H9S E;  2NP9 A;  4UV8 B;  2IML A;  5LYJ E;  1UGO A;  2CWY A;  5ADX L;  3ZPO A;  4A97 A;  5FKY A;  2WDQ A;  1UUS A;  1US7 B;  4GK5 E;  5FMN A;  2B1E A;  3EUH A;  4X5T A;  2XAH B;  5L3B B;  4U74 A;  1IBM T;  1YW0 A;  5IUX A;  3KDS E;  1D0X A;  2IC6 A;  3N9Q A;  4DV4 T;  5HCM A;  2NW7 A;  5AQL B;  4JI1 T;  4CXX A;  3L3P A;  2H7V C;  3LDQ B;  2XUE A;  2LHR A;  4OX9 T;  5L3C B;  3AE7 A;  3ZMV B;  3ANW A;  2PG8 A;  5EZY E;  3NBX X;  3CQX C;  2PFV A;  2YIN A;  4EZH A;  1CUN A;  3AXJ B;  1OED A;  3AEG A;  2LSI A;  4WZX A;  3DP7 A;  1VCT A;  4KI0 F;  3AVS A;  5LJN A;  2Z6E A;  3A8Y C;  3CQG B;  3ZN1 B;  1HNZ T;  3Q5X A;  4ZS2 A;  2UXN B;  2YU2 A;  1UCU A;  2LE8 A;  2W63 A;  5AQO B;  4BJN A;  2HPL A;  5CFB A;  3GN5 B;  3QUJ A;  3TLV A;  4HFC A;  2IC9 A;  4ZI2 C;  4U33 A;  3RIU A;  4G63 A;  4AKI A;  4ZS3 A;  3PUX F;  3ABV A;  4NPP A;  4KHZ F;  2CXD A;  3GMI A;  3ETV A;  1YQ3 A;  4AKL A;  5JDN A;  5LCY A;  5LBQ B;  1OWA A;  5FY1 A;  2EHO A;  3MZK B;  4WW0 A;  2BG9 A;  3ZEF B;  5HWX A;  2LOP A;  3J7Y q;  1HS7 A;  2W62 A;  4YTP A;  2KLQ A;  2NWB A;  5F5W A;  5L4H A;  3IA3 A;  2XAJ B;  1BR0 A;  4GOU A;  1UK5 A;  4ZXL A;  4KMC A;  3D0T A;  4X65 T;  1IZN B;  3JC6 D;  3EAM A;  2CLY B;  5LOV E;  4Z90 A;  3EAB A;  3BQL A;  5LGU B;  3B13 A;  3E08 A;  3IF8 B;  4ZZB A;  2XJ7 A;  3RLF F;  1J5E T;  4X20 E;  2VKH A;  3PUQ A;  1DU2 A;  3RX6 A;  3PU3 A;  4Z8X A;  3OYX A;  1X9B A;  3NWI A;  2GK9 A;  3RYI E;  4U72 A;  3LK2 B;  5JVD E;  4DMV A;  4B3M T;  2E8I A;  4L0R A;  3ZCI A;  4GYS A;  2MYS A;  2VVN A;  4V1A v;  4YLH A;  1MIY A;  3RC3 A;  1HG5 A;  3ZSS A;  3PUV F;  2M6B A;  1WYB A;  2M6I A;  2HH7 A;  2WY2 A;  5AQQ B;  4I50 E;  3F31 A;  1BR4 A;  4KUM B;  3ZJ1 A;  1D1C A;  2KWI B;  3P50 A;  3UUX B;  5AQR B;  4O2B E;  3KV4 A;  2E5V A;  1T8B A;  3EHZ A;  3RIA A;  1ZKE A;  2LRL A;  3T8O A;  2E9X B;  2C5I T;  2YDQ A;  4EZ4 A;  2WSS V;  2DHR A;  5LB7 B;  1HNX T;  2VAS A;  5L4E A;  4XAX B;  5AQN B;  3HKB E;  4TWF A;  4Q25 A;  4AQF C;  4HFD A;  3CX7 B;  4JI2 T;  3C4W A;  3WAK A;  3T1H T;  1HF8 A;  2AXD S;  2XSA A;  4DR6 T;  5JH7 E;  5C8Y E;  4TWD A;  4DV3 T;  2BS4 A;  3N9P A;  2BVL A;  5JR9 B;  4IDZ A;  4IL9 A;  3RF1 A;  4UF0 A;  3OYZ A;  2E9X D;  3P4Q A;  2UXD T;  1S35 A;  2Y8D A;  3UU5 A;  1X79 A;  1KNR A;  1KNP A;  3FBL A;  2LKG A;  3KIN B;  3MKD A;  1XMQ T;  3AB3 B;  2WDV A;  4YJ3 E;  2J1D G;  2VUR A;  3BQK A;  3FZK B;  1IBL T;  2W00 A;  4YJ2 E;  4PW8 A;  3N9M A;  1FJG T;  2XAF B;  1MND A;  5LMN T;  4HFV A;  3VKG A;  1YQ4 A;  4BJM A;  5FL0 A;  4EEB A;  4P0B A;  5ABE A;  2V6Y B;  4JEU B;  2CE7 A;  4MLK A;  2FJA A;  2LHN A;  5CB4 E;  5HEO A;  3AEA A;  1OED E;  2VKD A;  2XM2 A;  2XAG B;  3RYF E;  2Y6X A;  4H9N C;  1NAF A;  2YU1 A;  3JAE A;  3AXJ A;  2HN1 A;  2XM1 A;  2CEA A;  4DR1 T;  4BA9 A;  1BR2 A;  5AQV B;  3LJC A;  4I43 B;  4DND A;  1HR0 T;  3PE0 A;  5ABF A;  3PJA J;  5JRC B;  2V7L A;  4YTM A;  2W4X A;  4F6R C;  4H9O C;  4YT0 A;  4PAG A;  2KWH A;  2V6X A;  4CN6 A;  5JQG E;  3VU7 H;  3U78 A;  3L8R A;  2BS3 A;  2N9D A;  3OVU A;  4KX6 A;  3SOL A;  3NRY A;  1XMO T;  1S94 A;  2H7O A;  5FXX A;  3UTK A;  2W61 A;  5L3F B;  2CMR A;  2ZM0 A;  2JQK A;  3NZQ A;  3ZMT B;  3ZLI A;  3EVY A;  3ZMZ B;  1KK7 A;  4I4T E;  3K8P C;  2V7I A;  2X68 A;  3M65 A;  4OHF A;  1HG2 A;  4TN7 B;  4HTE A;  1W9R A;  4ILC A;  3CVR A;  2JJ9 A;  4HFI A;  1Y64 B;  1SUM B;  3AE5 A;  1FIO A;  2ODU A;  2JPF A;  4N78 D;  2C5K T;  4YSY A;  3JAF A;  4HWH A;  5IYZ E;  2VB6 A;  4YHJ A;  1YXR A;  3I0Q A;  3A7M A;  2IDO B;  2X9H A;  5LMU T;  2A2F X;  4CQI A;  2UXB T;  3FB2 A;  2H3R A;  1WCR A;  2ACZ A;  4HFH A;  4BAY B;  5KX5 E;  4B3R T;  3AAI A;  4OK0 A;  2D0T A;  5LP6 E;  4KP3 C;  1WYC A;  2Q9Q B;  4ZEY A;  2CA5 A;  2FUP A;  3PV0 F;  1ZV4 X;  4ILB A;  4XZC A;  2JRK A;  3RRC A;  2V1D B;  5LJM A;  4HE8 A;  1M62 A;  5HEG A;  3VKH A;  5JTG A;  3RIF A;  3WI3 A;  5L47 A;  2YKS A;  5DQV A;  3AED A;  5L2L A;  2JQ9 A;  4O4J E;  3TLW A;  2NW9 A;  4LFB T;  4CXY A;  4U7I A;  4ZI2 D;  2E9X A;  3NKZ A;  4LMK A;  2EHO C;  2Q9Q D;  3ONX A;  4A98 A;  2OV9 A;  4E7Z A;  2G0U A;  2LT3 A;  4O4I E;  2W67 A;  3K3N A;  1R8I A;  2IW5 B;  2LSY A;  3SFD A;  4YTN A;  2YDR A;  3PU8 A;  2VQF T;  3RH3 A;  3RYH E;  4QX8 B;  4PJN A;  4TV9 E;  1Y01 A;  2KSR A;  4DBR A;  4LML A;  2X0L B;  2WP9 A;  3QNU A;  5JR9 A;  3MA9 A;  3PUZ F;  2PBI A;  3RPU A;  3ZYK A;  4EYY R; 
#chains in the Genus database with same CATH homology
 4EYU A;  3P8C D;  2VKH A;  3AVR A;  4IGU A;  3PUQ A;  5A1L A;  4AKG A;  1U4Q A;  1IJ5 A;  3RX6 A;  3PU3 A;  4QHO A;  3HR0 A;  3TKL B;  2P9B A;  4Z8X A;  3CQC B;  3OYX A;  5L3G B;  1YD8 G;  2ACX A;  2KXP B;  4X1Y E;  3HA4 A;  3UUN A;  4P09 A;  1D0Z A;  1SA0 E;  3SS1 A;  5CA0 E;  2KIN B;  2GK9 A;  3RYI E;  3AA7 B;  3OKQ A;  4U72 A;  5CA1 E;  3LK2 B;  3U3I A;  4OYK A;  4TZ4 C;  5JVD E;  4DMV A;  3AA6 B;  4JEH B;  3UUM A;  4QWN B;  4DVD A;  4KBM B;  5DAB A;  1NWM X;  3C50 A;  4WNK A;  1VOM A;  2E8I A;  1LRZ A;  5JDQ A;  4L0R A;  1B7T A;  3ZCI A;  4GYS A;  2VKJ A;  5HWY A;  2MYS A;  2DLR A;  4MAL A;  4V1A v;  4YLH A;  1UX5 A;  4EIW A;  1MIY A;  3RC3 A;  1HG5 A;  5HXS A;  3ETU A;  3F2E A;  3KBU A;  5FXZ A;  2UXX B;  3Q2M A;  1LKX A;  4FI5 A;  1IAP A;  1WYB A;  2X67 A;  5H6R B;  2HH7 A;  2VWA A;  3I0O A;  4QKN A;  3FXE B;  4NUV A;  2WMO A;  4I50 E;  3F31 A;  4QXB B;  1BR4 A;  3CML A;  4KUM B;  4FJO A;  3ZJ1 A;  1D1C A;  2KWI B;  5FY0 A;  1H7C A;  3UUX B;  4O2B E;  3KV4 A;  3Q9D A;  3R84 B;  3PTR B;  5JRE A;  2EHO B;  2QGS A;  1MNE A;  2WAU A;  1ZKE A;  4H63 H;  4ZI3 C;  4P0A A;  3T8O A;  1YKE B;  2E9X B;  2C5I T;  3C4Z A;  3KFW X;  4EZ4 A;  2WSS V;  2DHR A;  4OYJ A;  3KVA A;  4O2A E;  3EDU A;  2D2S A;  1D1A A;  2VAS A;  3PUG A;  1FMV A;  1MIW A;  4UV9 B;  1HFA A;  4XAX B;  3LBX B;  2LM9 A;  3VHL A;  3E22 E;  3CX8 B;  3HKB E;  3ZYL A;  1U5P A;  2NW8 A;  4AQF C;  4UVB B;  3N9L A;  2XHE B;  3CX7 B;  4GIW A;  4AI6 A;  3KBT A;  3C4W A;  3WAK A;  4CI3 B;  3MK7 C;  4UVA B;  1HF8 A;  3SWH A;  1MMG A;  5JDF A;  2YK0 A;  4HN9 A;  5JH7 E;  3MXZ A;  5C8Y E;  3WAJ A;  2E9X C;  3QC9 A;  2CCQ A;  3GN5 A;  5JRC A;  2JMK A;  4IIJ E;  2LSJ A;  2MOZ A;  3ZN0 B;  3N9P A;  1E1H B;  2OA5 A;  1Z0P A;  2BVL A;  5EK2 A;  5JR9 B;  5FYM A;  3C98 B;  3K3O A;  3S4U A;  4IDZ A;  1IJ6 A;  2HPJ A;  4EXT A;  2L9Q A;  4UF0 A;  3I1A A;  2EHO D;  2CM0 A;  5FXW A;  4AXP A;  1UX4 A;  2W0G A;  5L3D B;  2K5B B;  4UEL A;  3CPZ A;  4PK4 A;  3OYZ A;  4TV8 E;  2E9X D;  2ES0 A;  5IHY A;  1S35 A;  2Y8D A;  5J2T E;  2BDE A;  1X79 A;  3SRZ A;  2ZM8 A;  5LHI B;  3UT5 E;  2Y48 B;  4XBF B;  4ZOL E;  5HXE A;  3FBL A;  2ZMA A;  1LVK A;  3KIN B;  3LK3 B;  3MKD A;  4UXN B;  3IEE A;  2WWU A;  5LBM A;  5LHG B;  2WMN A;  3W15 B;  5JR9 C;  2NOX A;  3AB3 B;  4DBQ A;  4L9I A;  2L8K A;  2JMH A;  4E7S A;  4CZZ B;  5JDL A;  1V9D A;  3LK4 2;  3NRX A;  4YJ3 E;  2J1D G;  5J2U E;  2KT9 A;  4MFR A;  5TAO A;  4IE4 A;  4B6X A;  3BQK A;  3E0Z A;  4IE7 A;  2W00 A;  2LEH A;  4YJ2 E;  4PW8 A;  4H63 V;  2KZ7 B;  3J9X 1;  3N9M A;  5JDG A;  5LG4 A;  2M67 A;  1MIV A;  2DI4 A;  5AFU L;  2XAF B;  1MND A;  3P7I A;  4HEA A;  4HFV A;  3CX6 B;  3N9O A;  3KV9 A;  1QUU A;  4HKA A;  4PK6 A;  3VKG A;  4GYR A;  3MJX A;  1HCI A;  4BJM A;  3PUA A;  4DMW A;  2LSK A;  4P0B A;  2V26 A;  5FY7 A;  3UFE A;  2CWO A;  5L3E B;  3KVB A;  4JEU B;  2CE7 A;  2RP4 A;  2DCF A;  3IBP A;  3IHR A;  4MLK A;  2LHN A;  3HKC E;  1ZEE A;  4J2C A;  5CB4 E;  2D0U A;  4HGA A;  3Q5W A;  2VKD A;  3OJA A;  4AKR B;  3C4X A;  3QK6 A;  2XAG B;  3N2K E;  3RYF E;  2Y6X A;  2VL8 A;  3ZMU B;  5LGN B;  4H9N C;  4ZHQ E;  4QXC B;  5J1G A;  4AQG A;  4EOZ B;  1NAF A;  2YU1 A;  2CEA A;  4PFP A;  1KNZ A;  4BA9 A;  1BR2 A;  3LJC A;  4CXW A;  3BQI A;  5HXR A;  4I43 B;  4PFO A;  3KV5 A;  4DND A;  4ISS A;  1LVF A;  1WLX A;  5F8P A;  4IE6 A;  3PE0 A;  4A56 A;  2K9A A;  4ADZ A;  1MMN A;  4GK0 E;  5M4Y A;  4PJJ A;  5JRC B;  3R6N A;  2V7L A;  3C51 A;  3ESL A;  2VKO A;  4F6R C;  3HL6 A;  4H9O C;  2Q9Q A;  2V7M A;  4C90 A;  5FNV E;  4PAG A;  2A3D A;  2YEV C;  3O4X E;  4ZI3 D;  2XTL A;  5LA6 E;  5LHH B;  2XQY A;  4UF0 B;  2Q9Q C;  4ERR A;  2LJL A;  5DQW A;  5KMG P;  2KWH A;  1VRB A;  3LG7 A;  4IE0 A;  5DJQ C;  2KND A;  1SHZ C;  4DO0 A;  5JQG E;  3VU7 H;  3ZMS B;  3DJB A;  3O1I A;  3U78 A;  4X1I E;  5JDM A;  4H9S E;  2N9D A;  2NP9 A;  4UV8 B;  4O4H E;  3H3A A;  1YKH B;  4WBN E;  3EDV A;  2C5J A;  5LYJ E;  3PDY A;  4EAH A;  4X1K E;  3SOL A;  3NRY A;  3F57 A;  2CWY A;  3BK9 A;  5ADX L;  4O8S A;  3ZPO A;  1S94 A;  2H7O A;  5FXX A;  3UTK A;  1US7 B;  2NTX A;  2W61 A;  4GK5 E;  5FMN A;  5L3F B;  2CMR A;  3FBZ A;  2B1E A;  2ZM0 A;  3EUH A;  2K48 A;  3NZQ A;  2NTY A;  3O1H A;  4QX7 B;  2LOS A;  3EVY A;  2XAH B;  3ZMT B;  3ZLI A;  2X51 A;  5L3B B;  4UIG A;  4U74 A;  3ZMZ B;  1KK7 A;  3FHN A;  1YW0 A;  2CXL A;  4H9Q C;  3K3Q C;  3KDS E;  4I4T E;  3K8P C;  5F3J A;  2V7I A;  2X68 A;  2BVM A;  3DTO A;  5GON E;  1D0X A;  3M65 A;  2IC6 A;  3N9Q A;  1FEW A;  3N2G E;  4OHF A;  1HG2 A;  2NW7 A;  4TN7 B;  1G8X A;  4HTE A;  5EK4 A;  4I55 E;  3L3P A;  4CXX A;  3V5U A;  4C91 A;  1WR6 A;  2H7V C;  1HX8 A;  4PNI A;  3CVR A;  3AAE B;  4EB6 E;  2V7K A;  2IAK A;  2JJ9 A;  2XUE A;  1HTJ F;  5LXT E;  2LHR A;  5JDH A;  1Y64 B;  5EK3 A;  4IST A;  5L3C B;  2PJQ A;  3A5X A;  2WM9 A;  4H9R C;  3ZMV B;  3H37 A;  3ANW A;  4TUY E;  3CKD A;  2X66 A;  4YFS A;  3O9X A;  3MAC A;  1FIO A;  2ZLY A;  2PG8 A;  2ODU A;  3L09 A;  5EZY E;  4K0U A;  3AA0 B;  2JPF A;  2PFV A;  3CQX C;  2C5K T;  3NBX X;  2YIN A;  4N78 D;  4TX5 A;  2CLY C;  4CI2 B;  4EZH A;  5LNK A;  2C0S A;  5ETW A;  2XAQ B;  1CUN A;  2L3L A;  2D5U A;  2JQQ A;  2K24 A;  2QA7 A;  5FXV A;  2X9Y A;  5IYZ E;  4IE5 A;  5E0O A;  3V5S A;  2VB6 A;  4YHJ A;  2LSI A;  3I0Q A;  3DP7 A;  4O4L E;  4QXH B;  2X9H A;  2A2F X;  3AVS A;  4G2A A;  4CQI A;  3FB2 A;  2H3R A;  5HAX A;  2X9X A;  5BMV E;  4PJL A;  5KX5 E;  4BAY B;  2X9W A;  5KDM C;  5LJN A;  2LSG A;  2Z6E A;  3KV6 A;  3CQG B;  2DNX A;  4H9P C;  3AAI A;  4OK0 A;  3RRW A;  2D0T A;  3RKO A;  5HYA A;  5LP6 E;  4KP3 C;  3ZN1 B;  1WYC A;  2Q9Q B;  4ANJ A;  1QSD A;  1OXZ A;  2CA5 A;  3RYC E;  3N9N A;  4M1P A;  2KMF A;  3Q5X A;  4ZS2 A;  1ZHC A;  2UXN B;  2YU2 A;  1UCU A;  2I59 A;  4UVC B;  2LE8 A;  2W63 A;  1ZV4 X;  1D1B A;  3PUS A;  4BJN A;  2HPL A;  4XZC A;  2JRK A;  3GN5 B;  4JLE A;  3QUJ A;  3RRC A;  2V7J A;  2V1D B;  5LJM A;  4OFZ A;  4HE8 A;  2IC9 A;  3O1J A;  3VKH A;  4UEM A;  3NZP A;  1O3X A;  4ZI2 C;  2RA1 A;  3RC8 A;  4CI1 B;  4G63 A;  4AKI A;  4ZS3 A;  3WI3 A;  5FP3 A;  4PJM A;  5DQV A;  1FMW A;  5L2L A;  2VK9 A;  2CXD A;  3GMI A;  3ZYM A;  3ETV A;  4O4J E;  2NW9 A;  3GA8 A;  4CXY A;  4AKL A;  2A72 A;  4AQF A;  2WBL A;  2ZM2 A;  1T98 A;  4MBQ A;  5JDN A;  5LCY A;  1MMA A;  3AA1 B;  3B57 A;  5LBQ B;  1OWA A;  3GWH A;  2MTQ A;  5FY1 A;  2SPC A;  2EHO A;  3MZK B;  3HKD E;  3ZC0 A;  4WW0 A;  4PK5 A;  3HKE E;  4ZI2 D;  1WRD A;  3N5L A;  2E9X A;  3LFM A;  3ZEF B;  2EHO C;  2Q9Q D;  3ONX A;  3JC6 C;  5HWX A;  5LGT B;  2LOP A;  3J7Y q;  1HS7 A;  2XAS B;  3OBV E;  4E7Z A;  2W62 A;  3I9Y A;  2G0U A;  2N2N A;  3C64 A;  2LT3 A;  4ILU A;  4O4I E;  3ZCJ A;  2KLQ A;  3K3N A;  2NWB A;  1D0Y A;  3LBX A;  3N2O A;  4WBO A;  2DWG A;  2IW5 B;  3ZJ2 A;  4AKH A;  2LSY A;  5H6Q B;  5HXH A;  2XAJ B;  1BR0 A;  3AAA B;  4GOU A;  3FXD B;  3PU8 A;  4KMC A;  2BZB A;  2CXF A;  3CWZ B;  3PUR A;  5HXC A;  3D0T A;  4NUU A;  3UUL A;  3ZC1 A;  1IZN B;  3RH3 A;  3RYH E;  1EZ3 A;  3JC6 D;  4QX8 B;  3ANW B;  2CLY B;  1BR1 A;  4PJN A;  4IHJ E;  4TV9 E;  5LOV E;  3BQL A;  5LGU B;  3B13 A;  4DBR A;  3E08 A;  3HI2 A;  3I9W A;  4JUY A;  4ZI7 E;  1MMD A;  2ODV A;  2X0L B;  2MBG A;  3IF8 B;  4ASK A;  4MHC A;  1G73 A;  2DWK A;  5JR9 A;  3MA9 A;  1AJ3 A;  4X20 E;  2PBI A;  3RPU A;  3ZYK A;  4L5G A;  2N1G A;  4EYY R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...