3FBLA

Crystal structure of orf132 of the archaeal virus acidianus filamentous virus 1 (afv1)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
82
structure length
82
Chain Sequence
b'YHKLRLAIKEICKTDGIPNIKWGMYIAFGEKLLKSYLKMKAGSASSDMIAEYINNAISAFSSRTGISQETAQKIADFITSNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Acidianus filamentous virus 1 coat proteins display a helical fold spanning the filamentous archaeal viruses lineage
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Structural protein
total genus 38
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2008-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.800 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3fblA00
3J9X1 3F2EA 3FBLA 3FBZA
chains in the Genus database with same CATH superfamily
3UUNA 2OA5A 2YINA 2VURA 3RRWA 3OYZA 3QK6A 3FZHB 3N2GE 3UQ4A 2WZIA 3B5MA 2IHR1 4TWDA 4YTMA 1FIOA 4PJJA 3VU7H 3ONXA 2NW8A 1B7TA 2DNXA 2D0UA 2NW7A 3ZPOA 4OFZA 2BKOA 4HWIB 2KWIB 3ESLA 3UT5E 3AE6A 4DBQA 1ZP0A 4DUYT 1YD8G 3RKOA 3O1JA 5F3JA 2XAQB 4H63H 4ZI7E 3J7Yq 4DV4T 1MIWA 2YU1A 3P50A 3KV5A 3P4QA 3P4PA 4NXNT 3EDVA 4YSZA 2X9WA 1HX1B 2HN1A 4DVDA 1W0AA 2CM0A 3AE3A 2W0GA 2DLRA 2CBJA 4FJOA 4JBWF 3AEAA 4DNDA 2WU5A 2ZMAA 2IUBA 3GWHA 3CPZA 5JH7E 3CQCB 1O3XA 2MBGA 5LOVE 5JDQA 4JI6T 3DJBA 4MLKA 5HEJA 3LBXB 5EK3A 4E7ZA 2BVLA 3UUBA 2X66A 3HKEE 2JQKA 3ANWA 4OHFA 2L3LA 5AQIB 5AQSB 4LF6T 3L8RA 1E7PA 3ZT7A 3I0QA 1ZHCA 2A9UA 4I55E 3LG7A 3SFDA 1Z8UA 3RIUC 3G06A 4UELA 4LFBT 4DBRA 1HG2A 5HEGA 1OXZA 3JC6C 5KDMC 4DMWA 2KNDA 3RPUA 2XM1A 5AQUB 4YJ3E 1XDOA 4IIJE 1M62A 4TWFA 3CX8B 3ZYKA 4ERRA 3RIUA 3ZMZB 4U72A 4QWNB 2FBWA 3HKCE 1R8IA 3ONJA 5LBMA 2L8KA 4P0AA 1KNRA 5ABHA 2DWKA 5AQGB 2KMFA 2CMRA 4NXMT 3OPCA 1OWAA 1KEYA 3AB3B 4JYAT 4ZZBA 2MPKA 3PE0A 4X1KE 2BS3A 3B57A 2W2UA 5FL1A 5L4HA 3VKHA 4PJNA 2UXDT 3P7IA 2H88A 4QX7B 3TLWA 3ABVA 4DV3T 4TNVA 3RIAA 3OBVE 4EYUA 1YKHB 1BR4A 3OVUA 2Y48B 3CX6B 1G73A 4LFCT 2X0HA 4YFSA 2N1GA 5LHGB 4PK5A 4V1Av 4TV9E 1IJ5A 4AQGA 3RKGA 2V6YA 4YT0A 4IE5A 2PG8A 3CQXC 5J0ZA 4A97A 2XSAA 4JUYA 4YLHA 2ZM0A 5BR8T 2HHHT 3FZMB 5KMGP 1FMVA 4B6XA 4IL9A 4AKGA 2X9XA 1QSDA 2XAGB 2LSGA 3C50A 3PUAA 4H9OC 4KP3C 1ZV4X 2JIWA 4CN4A 3ETVA 2E9XB 3FZFB 3LK2B 2NOXA 2JMKA 3K3QC 4TNWA 3LJCA 3KV9A 5GONE 2XQ4A 2LRKA 1XZYA 3IBPA 2Q9QC 2WWUA 2ZLYA 5KXJA 3RYIE 2JRKA 5LB7B 3RI5A 5HWYA 3UU8A 3ZCJA 5L3CB 4DIDB 2Q9QA 1S94A 3ZMSB 1KF6A 2V7JA 3PUYF 2X9YA 4DV1T 5HCMA 5AQJB 5JVDE 2A72A 2VVNA 3SFEA 4JI4T 4YTNA 2YU2A 2V8SV 3PJAA 4KX6A 3JAEA 3L39A 3ZSSA 2XTLA 3EI0A 4IE4A 1MMAA 2C5JA 4F6RC 4UV8B 5JRCB 2LLYA 3KVAA 2D9DA 4EYYR 4XBFB 3RH3A 3H37A 3AAAB 3VRAA 4X66T 4L0RA 1LVKA 1I6ZA 4U74A 3J9X1 3JC6D 2D5UA 4O4IE 1MMDA 3RQUA 4QXHB 3VRBA 1E1HB 1J5WA 4O8SA 2BBHA 3UUMA 4P09A 2JQHA 5FL0A 3TLSA 3PUGA 1OEDE 1JNRA 2VK9A 5FY1A 1D1AA 5HYAA 1UURA 1WYBA 1FJGT 3C64A 4EZHA 4L5GA 2UU9T 2VVSA 5L3EB 2P9BA 3VR9A 3MZKB 2XQYA 1US7B 3I0OA 1LVFA 3PU8A 1XDPA 2K9AA 3GN5B 4ILAA 4C90A 1UK5A 1IBKT 2XQ9A 2BDEA 3QC9A 2WCAA 5H6QB 4LF7T 3B13A 1KNPA 3M3ZB 4HWHA 4GYSA 2F4VT 4ADZA 1ZOYA 4A98A 3PUQA 4AIUA 5DQVA 4M1PA 2XM2A 2WDVA 4HGAA 3AXJA 2V7MA 2V5CA 2BS2A 2VKOA 2PTFA 4KBMB 2GK9A 1HX8A 2I6HA 2CLYB 2HPJA 4CI3B 1HNZT 2D0TA 3AE1A 4JLEA 3ZT6A 4UIGA 3SRZA 5AQOB 1WFDA 3UFEA 4YSXA 1HNXT 2J62A 5JTGA 1H7CA 2NP9A 2CCQA 4C91A 2LHRA 2N9DA 2ZM8A 1G8XA 4JI8T 2CA5A 2DCFA 5CA0E 2CBIA 2V5DA 4DO0A 2D2SA 1WYCA 2DL1A 2NTYA 3Q5EA 4WW0A 2RP4A 4A5XA 2BG9B 5LCYA 2UUAT 2X0LB 3NRXA 2SPCA 3FXDB 1IBMT 4KHPT 3AE2A 4JI5T 2A2FX 1QUUA 2V1DB 4P1NA 1UGOA 2Y6XA 4ZOLE 2LOPA 3ZEFB 1AJ3A 4DV7T 5FVKA 2W67A 2XPKA 2Q9QD 5CFBA 4IDZA 2XJ7A 2XQ6A 1HS7A 2V7LA 4PFOA 2WM9A 2BKPA 4U31A 3RRCA 2WU2A 2QRXA 3L09A 5HXHA 1UX4A 3EABA 4CN1A 1MNDA 3UU5A 5FY7A 1UCUA 1J1JA 4IE6A 3F31A 3AE7A 5C2TA 5F5WA 1ZEEA 4B3TT 3IEEA 4CXXA 2FJBA 3AVSA 3K8PC 1T8BA 1W09A 3RC3A 4ILBA 2WSSV 3N2OA 4U3CA 1HG5A 2NW9A 4Z91A 3KV4A 1J5ET 2XASB 2WP9A 1MMGA 2DWGA 4QXBB 3RYFE 3C98B 5EZYE 2H3RA 4NUVA 2BG9E 4H9QC 2M6IA 4CN6A 2C0SA 3NZPA 2VL0A 2DI4A 3ZMVB 5JR9C 3WAJA 3F2EA 4UF0B 3I1AA 3X1DA 5AQVB 4LF4T 4IT4A 3GMIA 2RPAA 4IGUA 5JR9A 4CI2B 2C5KT 5DABA 2L9QA 3OJAA 1YW0A 5LGUB 4GK5E 4L9IA 2KT9A 2WMNA 3HKDE 3CQGB 5L3GB 5ABEA 3A8YC 2DHRA 1MMNA 4UVBB 4LF8T 4ZI3C 5JDFA 4U33A 3P4RA 3O1HA 4GK0E 2EHOB 2MYSA 2XQ5A 4O4JE 3ZC0A 2LSYA 3PUXF 2FJDA 2QA7A 5DJQC 2E5LT 4TV8E 2IW5B 3RIFA 3AA0B 3CIRA 1CUNA 5JDGA 3EDUA 4DMVA 5EK4A 2LSJA 3N2KE 4EB6E 3ZYMA 1SE7A 4LF9T 3FZLB 5LXTE 4JI3T 3LDQB 2QVAA 2KWHA 4K0UA 5AQKB 5CB4E 4HFIA 3CK6A 4IL4A 4WBOA 3NRYA 2MTQA 3AE9A 1MNEA 3P4WA 4YHHT 2XUEA 5CJ5A 3C4WA 2WBLA 3QUJA 4YSYA 3EUHA 4OYKA 2PBIA 2WMOA 4EAHA 1LKXA 4QH1A 2IC9A 3KBUA 2E8IA 5LG4A 4ASKA 2X68A 2XAJB 2BKNA 5LNKA 3N9MA 3N9NA 2YK0A 1XNQT 1GQEA 3FZKB 5LJMA 2VASA 3ZN0B 1M7KA 3ZSTA 5LBQB 3TKLB 2Y8DA 3PUZF 4IDOA 5AQMB 3CWZB 2WAUA 1QLBA 2IAKA 3HR0A 2FUPA 2WQYA 3ZN1B 1YQ3A 4X65T 3ZLIA 2H89A 5IYZE 1D0ZA 2QGSA 3C4ZA 2ZM2A 4AI6A 3IF8B 3P4SA 3EHZA 1XNRT 4DR7T 3AAEB 5JDHA 3KDSE 1WR0A 4EEBA 2YDQA 1HTJF 3LBXA 4MBQA 2CWYA 3QNUA 3ETUA 4DR2T 3NZQA 3RF1A 2VB6A 4WYVA 5L3FB 5LMUT 4Z8XA 4AKLA 4HFEA 1JNZA 2BS4A 2MAWA 5C8YE 1MIYA 5A1LA 3N5LA 2B76A 5LP6E 3F57A 5LHIB 1W0BA 2J47A 4XZCA 2K5BB 2M6BA 5LA6E 3AA1B 4QHOA 1HF8A 2W66A 3OTOT 1NENA 4EGWA 5HXEA 4HEAA 4FI5A 2LJLA 3PURA 4TX5A 5L47A 1MIVA 3AEBA 4DR3T 2CHNA 1I94T 2LRLA 2YEVC 3UQ7A 1KFYA 4UVAB 4QXCB 2LE8A 3PTRB 4NPPA 5ABFB 1BR0A 1FEWA 2PFVA 3FB2A 3AEGA 4O4HE 4H9RC 4ZI2C 3CMLA 2W62A 3MXZA 1UUSA 4ZS3A 4ZI3D 4P0BA 3A7MA 3QOFA 2XAFB 4ZHQE 2X0YA 2PJQA 1NEKA 4U2ZA 3E0ZA 3AE5A 1WCRA 3N9LA 4B3RT 2W63A 4NUUA 3I9YA 2LT3A 3AEFA 3Q5XA 4YHJA 1HNWT 5IHYA 4IHJE 2KSRA 2LM9A 4QX8B 5FXZA 3ZJ2A 1WRDA 5AQPB 4OK0A 4KUMB 4X62T 1S35A 4Z90A 4H9SE 3AVRA 3TLUA 2LSIA 4HWFA 4HFBA 4TWHA 3A5XA 2LM2A 3R84B 5KX5E 1T72A 2HPLA 1D0YA 3AECA 2IMLA 4UXNB 2WB5A 5HCJA 2E9XC 2XQ8A 1D1BA 4DR1T 4DR5T 3ZJ1A 5LMNT 2NTXA 4COFA 4HE8A 2E9XA 2YDRA 1WR6A 4PAGA 5L3BB 2W4XA 2ACXA 5AQNB 3Q5DA 3AAIA 5JDLA 3HKBE 3CKDA 2K24A 5CGMA 1NAFA 2FJEA 3PUSA 2VQET 1OEDC 4LMLA 4NIQA 3PV0F 4BJNA 5HEHA 2OLTA 5AQTB 1XMQT 1T98A 2CXFA 4JEHB 2ODVA 4HFVA 3K3NA 1OEDA 4DV5T 4HWCA 2E5VA 2IDOB 3PDYA 2OV9A 3NWIA 2UUCT 2A3DA 3S4UA 5L4EA 4E7SA 3MACA 1SUMB 4GKJT 2H7OA 1KK7A 3BQLA 5DQWA 3KINB 3ZYLA 2FJAA 2E2AA 2KZ7B 3RGLA 1BR2A 2LKHA 1IJ6A 3Q5WA 3K1SA 1YQ4A 3ANWB 5FMNA 5JRCA 3CX7B 3KBTA 3O4XE 3P8CD 3BQKA 2XY8B 4EV6A 4UEMA 1L0VA 1SA0E 2UXNB 4AISA 4U2YA 3VHLA 1N34T 4WZXA 3KFWX 3T8OA 2I59A 3OKQA 4LMKA 2NWBA 1EZ3A 3R6NA 2V6XA 4MALA 2W00A 5HEOA 3NBXX 3UULA 4Q25A 2N2NA 2KINB 4DR6T 3RYHE 2WDQA 1X79A 4IDQA 1CHUA 4DV0T 5HXSA 3PUWF 2VKHA 3W15B 2B1EA 2WDRA 2RA1A 1XWMA 5HWXA 4JEUB 3DTOA 3SWHA 4ZI2D 3GN5A 5L2LA 2XZEA 3UFGA 5FNVE 5EK2A 4I0UA 2Z6EA 3H3MA 4PK4A 3AEEA 2UXCT 1V9DA 3V5UA 3Q2MA 1HCIA 4HKAA 3RQWA 2IIUA 4PNIA 2CLYC 4TN7B 5AQQB 1T7SA 2BBJA 4MHCA 4PK6A 4KI0F 3UU3A 2V6YB 2R6GF 4OX9T 5AQRB 5FYMA 3AE8A 3N9PA 1IBLT 4PFPA 3GA8A 2WY2A 2LOSA 3E08A 3T1YT 4ZXLA 4N78D 4LFAT 3EVYA 3NKZA 5LGNB 5HAXA 5FKYA 2E9XD 2BG9C 5JDNA 4BA9A 2CEAA 3KV6A 5FXXA 1VCSA 3O9XA 5FXVA 1U4QA 4AQFC 5LJNA 5LYJE 2JQ9A 3EAMA 2CWOA 2BG9A 4GIWA 5FP3A 3AEDA 2X9HA 4AQFA 2CHOA 4PJMA 3ONLC 4KMCA 3FXEB 3L3PA 4O4LE 2JJ9A 5AQHB 4X64T 3RYCE 4G2AA 3SS1A 3UTKA 1VCTA 3MJXA 4EEDA 3RC8A 1YXRA 4ISTA 2JQQA 3UU4A 1D1CA 4ZZCA 2Q9QB 2WS3A 2V7IA 1HFAA 4HFDA 4ANJA 2XQAA 4HFHA 2JPFA 2CXDA 1HR0T 2LKGA 2I0MA 3ZMUB 2IC6A 1VOMA 4ILUA 4LF5T 4X1YE 4YY3T 4O2BE 2MOZA 4DV2T 4IDPA 4ZS2A 4JI2T 3SOLA 4CQIA 2XAHB 5IWAT 2BZBA 4H9PC 3MKDA 4WNKA 4YJ2E 1DU2A 3FHNA 2YDSA 3Q9DA 5CA1E 4DR4T 2K48A 5IUXA 3RLFF 5E0OA 4PJLA 2K3WA 4BJMA 4AKRB 2QYWA 1UX5A 4ZEYA 4HN9A 5JREA 4G63A 5TAOA 3E22E 2ZM6T 1ZKEA 3N9QA 4UF0A 4YXDA 4I43B 2LSKA 4EZ4A 4X1IE 1LRZA 2YKSA 3ZT5A 4H9NC 3UU6A 3AE4A 3NVOA 3FBLA 3RX6A 5J2UE 2J1DG 2M67A 4GOUA 3OYXA 3K3OA 2EHOC 1N33T 5FY0A 5AQFB 2AXDS 2VWAA 3MA9A 4EXTA 5LHHB 3ZMTB 5LG3A 5AFUL 1D0XA 4AXPA 2EHOA 3C4XA 4O2AE 4JI7T 2WZHA 1N36T 4DUZT 2ACZA 5BMVE 1E2AA 4UVCB 4IE0A 4K0KT 4I4TE 3D0TA 3MK7C 4JI0T 4UR9A 3N9OA 2CE7A 5L3DB 2AE9A 4CXWA 2G0UA 2XSBA 4LMJA 3QB5K 5FVLA 4H63V 2XHEB 3C51A 5HEUA 3AXJB 4WBNE 4CZZB 5LGTB 1OEDB 2XQ7A 4JV5T 2LEHA 4PW8A 3JCFA 3T1HT 2NR4A 4IDNA 4IREA 1Z0PA 2W61A 2YN6A 4KHZF 4B3MT 4GKKT 3KVBA 3HL6A 3QB5A 3BK9A 5M4YA 3JAFA 2VKJA 2J4GA 3VR8A 3DP7A 5HXCA 1Y64B 3U78A 3WI3A 5AQLB 2LHNA 5FXWA 2UXXB 2KXPB 3TLTA 4ISSA 5HXRA 2ES0A 1U5PA 2V26A 1X9BA 2C5IT 2HN2A 3WAKA 2VQFT 2CXLA 4YTPA 5JDMA 4CXYA 5J1GA 2VL8A 3UUXB 1FMWA 3AA7B 3LK42 4UV9B 4MFRA 3H3AA 3I9WA 3HI2A 4F8HA 1Y01A 4HTEA 4AKHA 4QH4A 4U7IA 4ILCA 3VKGA 3HA4A 5JQGE 2VKDA 1IZNB 4DV6T 4AQYT 3ZKRA 3PJAJ 3U3IA 3IA3A 3LK3B 2CRBA 3PU3A 3RHWA 2BVMA 5ABGA 4AKIA 5C3JA 3LSVA 3BQIA 2X51A 2KLQA 3FBZA 2XQ3A 3O1IA 4OYJA 4J2CA 4I50E 2UXBT 3CVRA 2WWVA 4IE7A 4CI1B 4HFCA 3IHRA 1XMOT 4X5TA 1KNZA 3ZCIA 4EIWA 3V5SA 5JR9B 1VRBA 2H7VC 4U7YA 1YKEB 5J2TE 5ADXL 5ABFA 1BR1A 2X67A 3ZC1A 5H6RB 2EHOD 2CPTA 2HH7A 1SHZC 3M65A 1IAPA 4GYRA 3AA6B 4QH5A 2UUBT 1WLXA 2YOEA 5F8PA 4QKNA 2V7KA 3JADA 3PUVF 1W9RA 4HWDA 4X20E 4EOZB 4TZ4C 1N32T 4TUYE 4JI1T 4BAYB 4XAXB 2JMHA 4B3ST 3TLVA 1NWMX 2ODUA 5ETWA 4A56A 3LFMA
chains in the Genus database with same CATH topology
1D1AA 5L3FB 3UUNA 2OA5A 5HYAA 4PJMA 2YINA 1WYBA 4Z8XA 4AKLA 3C64A 3RRWA 3OYZA 3QK6A 4EZHA 4L5GA 3N2GE 4KMCA 3FXEB 3L3PA 4O4LE 2JJ9A 5L3EB 5C8YE 1MIYA 1FIOA 5A1LA 3N5LA 2P9BA 3RYCE 5LP6E 3MZKB 2XQYA 3F57A 4PJJA 4G2AA 1US7B 5LHIB 3SS1A 3I0OA 3VU7H 3UTKA 3ONXA 1LVFA 3PU8A 3MJXA 3RC8A 2K9AA 4XZCA 2NW8A 1B7TA 2DNXA 2D0UA 2NW7A 3GN5B 4ISTA 4OFZA 3ZPOA 4C90A 2K5BB 5LA6E 2JQQA 1D1CA 3AA1B 4QHOA 2Q9QB 1HF8A 2BDEA 3QC9A 2V7IA 1HFAA 4ANJA 2KWIB 5H6QB 3ESLA 3B13A 3UT5E 2JPFA 2CXDA 4DBQA 5HXEA 4HEAA 4GYSA 4FI5A 3ZMUB 2IC6A 4ADZA 1VOMA 4ILUA 2LJLA 4X1YE 3PURA 4TX5A 1YD8G 1MIVA 4O2BE 2MOZA 3PUQA 5DQVA 3O1JA 3RKOA 2XAQB 4H63H 4M1PA 5F3JA 4ZS2A 3SOLA 4ZI7E 4CQIA 3J7Yq 1MIWA 2XAHB 2BZBA 2YEVC 4HGAA 4UVAB 4H9PC 2YU1A 4QXCB 3MKDA 4WNKA 2LE8A 4YJ2E 3PTRB 3FHNA 2V7MA 3KV5A 3Q9DA 5CA1E 1BR0A 1FEWA 2K48A 2PFVA 2VKOA 3FB2A 4KBMB 2GK9A 4O4HE 3EDVA 4H9RC 2X9WA 1HX8A 4ZI2C 3CMLA 2CLYB 2HPJA 2W62A 3MXZA 4CI3B 5E0OA 4DVDA 4PJLA 4BJMA 2D0TA 2CM0A 4AKRB 4ZS3A 4JLEA 4UIGA 4ZI3D 1UX5A 2W0GA 2DLRA 3SRZA 4HN9A 5JREA 4P0BA 4G63A 4FJOA 3UFEA 2XAFB 5TAOA 3E22E 4ZHQE 4DNDA 1H7CA 2PJQA 1ZKEA 2NP9A 2CCQA 2ZMAA 3E0ZA 3N9QA 4UF0A 4C91A 2LHRA 2N9DA 2ZM8A 1G8XA 2CA5A 2DCFA 4I43B 3N9LA 3GWHA 5CA0E 2LSKA 2W63A 4NUUA 3CPZA 4DO0A 4EZ4A 5JH7E 4X1IE 3CQCB 1O3XA 2MBGA 3I9YA 1LRZA 2D2SA 1WYCA 5LOVE 5JDQA 2LT3A 4H9NC 2NTYA 3DJBA 4MLKA 4WW0A 3Q5XA 4YHJA 5IHYA 3LBXB 2RP4A 5EK3A 3FBLA 4IHJE 5LCYA 4E7ZA 2BVLA 2LM9A 4QX8B 3RX6A 2X66A 3HKEE 3ANWA 2X0LB 5FXZA 3ZJ2A 1WRDA 3NRXA 4OHFA 2L3LA 5J2UE 4OK0A 2SPCA 3FXDB 4KUMB 2J1DG 1S35A 2M67A 4GOUA 2A2FX 3OYXA 4H9SE 3I0QA 2EHOC 1QUUA 3AVRA 3K3OA 2V1DB 2LSIA 5FY0A 1ZHCA 2Y6XA 4ZOLE 2LOPA 2VWAA 3ZEFB 3MA9A 1AJ3A 4EXTA 3A5XA 5LHHB 3ZMTB 3R84B 5KX5E 4I55E 2Q9QD 2HPLA 3LG7A 4IDZA 5AFUL 1D0YA 1HS7A 1D0XA 4AXPA 2V7LA 4PFOA 2WM9A 2EHOA 4UXNB 4UELA 3C4XA 4O2AE 4DBRA 1HG2A 1OXZA 3JC6C 2E9XC 3RRCA 1D1BA 5KDMC 4DMWA 2KNDA 3RPUA 3ZJ1A 4YJ3E 3L09A 5BMVE 1UX4A 5HXHA 4IIJE 1MNDA 4UVCB 3CX8B 5FY7A 4IE0A 3ZYKA 1UCUA 4ERRA 2NTXA 4IE6A 3F31A 3ZMZB 4U72A 4QWNB 4HE8A 2E9XA 4I4TE 1ZEEA 3HKCE 1WR6A 5LBMA 3D0TA 3MK7C 4PAGA 5L3BB 3N9OA 2L8KA 4P0AA 2CE7A 3IEEA 2ACXA 4CXXA 3AVSA 3K8PC 5L3DB 4CXWA 3RC3A 2DWKA 2G0UA 3AAIA 2KMFA 2CMRA 5JDLA 3HKBE 2WSSV 3CKDA 2K24A 3N2OA 4H63V 1HG5A 2NW9A 2XHEB 1NAFA 1OWAA 3C51A 3AB3B 3PUSA 3KV4A 3PE0A 4WBNE 2XASB 4X1KE 4BJNA 4CZZB 3B57A 1MMGA 5LGTB 1T98A 2DWGA 2CXFA 3VKHA 4PJNA 4QXBB 4JEHB 3RYFE 2ODVA 3P7IA 2LEHA 3C98B 4PW8A 5EZYE 2H3RA 4HFVA 3K3NA 4NUVA 4H9QC 4QX7B 1Z0PA 3PDYA 2C0SA 3NZPA 2W61A 2A3DA 2DI4A 3ZMVB 5JR9C 3S4UA 3KVBA 3HL6A 3WAJA 3F2EA 4E7SA 4UF0B 3MACA 3BK9A 3I1AA 5M4YA 2VKJA 3OBVE 3DP7A 4EYUA 1YKHB 2H7OA 1BR4A 5HXCA 2Y48B 1Y64B 3CX6B 3GMIA 3U78A 1KK7A 3BQLA 5DQWA 1G73A 3KINB 4IGUA 5JR9A 3ZYLA 3WI3A 4YFSA 4CI2B 2C5KT 2N1GA 5DABA 2L9QA 5LHGB 4PK5A 2KZ7B 4V1Av 3OJAA 1YW0A 1BR2A 4TV9E 5LGUB 2LHNA 4GK5E 1IJ6A 3Q5WA 5FXWA 2UXXB 1IJ5A 2KT9A 2KXPB 2WMNA 3HKDE 4L9IA 4AQGA 3ANWB 3CQGB 5FMNA 3CX7B 5L3GB 5JRCA 3KBTA 3O4XE 4ISSA 3P8CD 3BQKA 2DHRA 1MMNA 4IE5A 4UEMA 4UVBB 1SA0E 2PG8A 2UXNB 3CQXC 5HXRA 2ES0A 4ZI3C 1U5PA 3VHLA 4JUYA 4YLHA 2V26A 2ZM0A 5JDFA 3KFWX 2C5IT 3T8OA 3O1HA 4GK0E 5KMGP 1FMVA 2I59A 4B6XA 3OKQA 3WAKA 2CXLA 4AKGA 2EHOB 2MYSA 4O4JE 3ZC0A 5JDMA 2NWBA 2LSYA 4CXYA 1EZ3A 2VL8A 5J1GA 2X9XA 2QA7A 5DJQC 3UUXB 1QSDA 1FMWA 2XAGB 3AA7B 3R6NA 4TV8E 2IW5B 3LK42 2LSGA 4UV9B 3AA0B 4MALA 3H3AA 4MFRA 2W00A 3C50A 3I9WA 1CUNA 3PUAA 4H9OC 4KP3C 1ZV4X 3NBXX 3UULA 5JDGA 3EDUA 3HI2A 4DMVA 3ETVA 5EK4A 2E9XB 4AKHA 2N2NA 4HTEA 2LSJA 3N2KE 3LK2B 4EB6E 3ZYMA 3VKGA 2KINB 3HA4A 5JQGE 3RYHE 2NOXA 2VKDA 1IZNB 2JMKA 3K3QC 5LXTE 1X79A 5HXSA 3LJCA 3KV9A 5GONE 3U3IA 3LK3B 2VKHA 3IBPA 2KWHA 4K0UA 5CB4E 2B1EA 3W15B 2Q9QC 2WWUA 2RA1A 2ZLYA 3PU3A 4WBOA 2BVMA 5HWXA 3NRYA 4JEUB 3DTOA 3RYIE 2MTQA 3SWHA 4AKIA 4ZI2D 3GN5A 1MNEA 2JRKA 5HWYA 2XUEA 5L2LA 3ZCJA 5L3CB 3BQIA 3C4WA 2WBLA 2X51A 2KLQA 1S94A 2Q9QA 3FBZA 3QUJA 3ZMSB 3EUHA 4OYKA 2PBIA 2WMOA 4EAHA 1LKXA 3O1IA 2IC9A 4OYJA 3KBUA 4J2CA 2E8IA 4I50E 5FNVE 5EK2A 2V7JA 2X9YA 3CVRA 5LG4A 2Z6EA 5JVDE 4ASKA 2X68A 4PK4A 2A72A 2XAJB 4IE7A 4CI1B 3IHRA 5LNKA 1V9DA 3V5UA 3N9MA 3Q2MA 3N9NA 2YU2A 1KNZA 2YK0A 1HCIA 4HKAA 3ZCIA 4EIWA 4PNIA 3V5SA 2CLYC 5LJMA 5JR9B 1VRBA 4TN7B 2H7VC 2VASA 3ZN0B 1YKEB 2XTLA 5J2TE 4MHCA 4IE4A 5ADXL 5LBQB 1BR1A 3TKLB 2Y8DA 4PK6A 2X67A 3CWZB 1MMAA 2WAUA 2C5JA 4F6RC 4UV8B 3ZC1A 5JRCB 2IAKA 3HR0A 3KVAA 5H6RB 5FYMA 2EHOD 4EYYR 2HH7A 3ZN1B 4XBFB 3RH3A 3H37A 3AAAB 3N9PA 1SHZC 3ZLIA 3M65A 3GA8A 4PFPA 1IAPA 2LOSA 3AA6B 4GYRA 3E08A 4N78D 4L0RA 1LVKA 3EVYA 5IYZE 1D0ZA 5LGNB 1WLXA 5HAXA 2QGSA 3C4ZA 5F8PA 4QKNA 2ZM2A 4U74A 3J9X1 2V7KA 4AI6A 3JC6D 2E9XD 2D5UA 3IF8B 4O4IE 5JDNA 4BA9A 1MMDA 2CEAA 3AAEB 5JDHA 3KDSE 4QXHB 4X20E 3KV6A 5FXXA 4EOZB 3O9XA 4TZ4C 5FXVA 1U4QA 4AQFC 5LJNA 5LYJE 1HTJF 1E1HB 4TUYE 3LBXA 4BAYB 4O8SA 4XAXB 3UUMA 2CWOA 4MBQA 4P09A 2JMHA 2CWYA 4GIWA 5FP3A 1NWMX 2ODUA 3ETUA 3PUGA 2X9HA 2VK9A 3NZQA 5ETWA 4A56A 4AQFA 2VB6A 3LFMA 5FY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J9X 1;  3F2E A;  3FBL A;  3FBZ A; 
#chains in the Genus database with same CATH topology
 3UUN A;  2OA5 A;  2YIN A;  2VUR A;  3RRW A;  3OYZ A;  3QK6 A;  3FZH B;  3N2G E;  3UQ4 A;  2WZI A;  3B5M A;  2IHR 1;  4TWD A;  4YTM A;  1FIO A;  4PJJ A;  3VU7 H;  3ONX A;  2NW8 A;  1B7T A;  2DNX A;  2D0U A;  2NW7 A;  3ZPO A;  4OFZ A;  2BKO A;  4HWI B;  2KWI B;  3ESL A;  3UT5 E;  3AE6 A;  4DBQ A;  1ZP0 A;  4DUY T;  1YD8 G;  3RKO A;  3O1J A;  5F3J A;  2XAQ B;  4H63 H;  4ZI7 E;  3J7Y q;  4DV4 T;  1MIW A;  2YU1 A;  3P50 A;  3KV5 A;  3P4Q A;  3P4P A;  4NXN T;  3EDV A;  4YSZ A;  2X9W A;  1HX1 B;  2HN1 A;  4DVD A;  1W0A A;  2CM0 A;  3AE3 A;  2W0G A;  2DLR A;  2CBJ A;  4FJO A;  4JBW F;  3AEA A;  4DND A;  2WU5 A;  2ZMA A;  2IUB A;  3GWH A;  3CPZ A;  5JH7 E;  3CQC B;  1O3X A;  2MBG A;  5LOV E;  5JDQ A;  4JI6 T;  3DJB A;  4MLK A;  5HEJ A;  3LBX B;  5EK3 A;  4E7Z A;  2BVL A;  3UUB A;  2X66 A;  3HKE E;  2JQK A;  3ANW A;  4OHF A;  2L3L A;  5AQI B;  5AQS B;  4LF6 T;  3L8R A;  1E7P A;  3ZT7 A;  3I0Q A;  1ZHC A;  2A9U A;  4I55 E;  3LG7 A;  3SFD A;  1Z8U A;  3RIU C;  3G06 A;  4UEL A;  4LFB T;  4DBR A;  1HG2 A;  5HEG A;  1OXZ A;  3JC6 C;  5KDM C;  4DMW A;  2KND A;  3RPU A;  2XM1 A;  5AQU B;  4YJ3 E;  1XDO A;  4IIJ E;  1M62 A;  4TWF A;  3CX8 B;  3ZYK A;  4ERR A;  3RIU A;  3ZMZ B;  4U72 A;  4QWN B;  2FBW A;  3HKC E;  1R8I A;  3ONJ A;  5LBM A;  2L8K A;  4P0A A;  1KNR A;  5ABH A;  2DWK A;  5AQG B;  2KMF A;  2CMR A;  4NXM T;  3OPC A;  1OWA A;  1KEY A;  3AB3 B;  4JYA T;  4ZZB A;  2MPK A;  3PE0 A;  4X1K E;  2BS3 A;  3B57 A;  2W2U A;  5FL1 A;  5L4H A;  3VKH A;  4PJN A;  2UXD T;  3P7I A;  2H88 A;  4QX7 B;  3TLW A;  3ABV A;  4DV3 T;  4TNV A;  3RIA A;  3OBV E;  4EYU A;  1YKH B;  1BR4 A;  3OVU A;  2Y48 B;  3CX6 B;  1G73 A;  4LFC T;  2X0H A;  4YFS A;  2N1G A;  5LHG B;  4PK5 A;  4V1A v;  4TV9 E;  1IJ5 A;  4AQG A;  3RKG A;  2V6Y A;  4YT0 A;  4IE5 A;  2PG8 A;  3CQX C;  5J0Z A;  4A97 A;  2XSA A;  4JUY A;  4YLH A;  2ZM0 A;  5BR8 T;  2HHH T;  3FZM B;  5KMG P;  1FMV A;  4B6X A;  4IL9 A;  4AKG A;  2X9X A;  1QSD A;  2XAG B;  2LSG A;  3C50 A;  3PUA A;  4H9O C;  4KP3 C;  1ZV4 X;  2JIW A;  4CN4 A;  3ETV A;  2E9X B;  3FZF B;  3LK2 B;  2NOX A;  2JMK A;  3K3Q C;  4TNW A;  3LJC A;  3KV9 A;  5GON E;  2XQ4 A;  2LRK A;  1XZY A;  3IBP A;  2Q9Q C;  2WWU A;  2ZLY A;  5KXJ A;  3RYI E;  2JRK A;  5LB7 B;  3RI5 A;  5HWY A;  3UU8 A;  3ZCJ A;  5L3C B;  4DID B;  2Q9Q A;  1S94 A;  3ZMS B;  1KF6 A;  2V7J A;  3PUY F;  2X9Y A;  4DV1 T;  5HCM A;  5AQJ B;  5JVD E;  2A72 A;  2VVN A;  3SFE A;  4JI4 T;  4YTN A;  2YU2 A;  2V8S V;  3PJA A;  4KX6 A;  3JAE A;  3L39 A;  3ZSS A;  2XTL A;  3EI0 A;  4IE4 A;  1MMA A;  2C5J A;  4F6R C;  4UV8 B;  5JRC B;  2LLY A;  3KVA A;  2D9D A;  4EYY R;  4XBF B;  3RH3 A;  3H37 A;  3AAA B;  3VRA A;  4X66 T;  4L0R A;  1LVK A;  1I6Z A;  4U74 A;  3J9X 1;  3JC6 D;  2D5U A;  4O4I E;  1MMD A;  3RQU A;  4QXH B;  3VRB A;  1E1H B;  1J5W A;  4O8S A;  2BBH A;  3UUM A;  4P09 A;  2JQH A;  5FL0 A;  3TLS A;  3PUG A;  1OED E;  1JNR A;  2VK9 A;  5FY1 A;  1D1A A;  5HYA A;  1UUR A;  1WYB A;  1FJG T;  3C64 A;  4EZH A;  4L5G A;  2UU9 T;  2VVS A;  5L3E B;  2P9B A;  3VR9 A;  3MZK B;  2XQY A;  1US7 B;  3I0O A;  1LVF A;  3PU8 A;  1XDP A;  2K9A A;  3GN5 B;  4ILA A;  4C90 A;  1UK5 A;  1IBK T;  2XQ9 A;  2BDE A;  3QC9 A;  2WCA A;  5H6Q B;  4LF7 T;  3B13 A;  1KNP A;  3M3Z B;  4HWH A;  4GYS A;  2F4V T;  4ADZ A;  1ZOY A;  4A98 A;  3PUQ A;  4AIU A;  5DQV A;  4M1P A;  2XM2 A;  2WDV A;  4HGA A;  3AXJ A;  2V7M A;  2V5C A;  2BS2 A;  2VKO A;  2PTF A;  4KBM B;  2GK9 A;  1HX8 A;  2I6H A;  2CLY B;  2HPJ A;  4CI3 B;  1HNZ T;  2D0T A;  3AE1 A;  4JLE A;  3ZT6 A;  4UIG A;  3SRZ A;  5AQO B;  1WFD A;  3UFE A;  4YSX A;  1HNX T;  2J62 A;  5JTG A;  1H7C A;  2NP9 A;  2CCQ A;  4C91 A;  2LHR A;  2N9D A;  2ZM8 A;  1G8X A;  4JI8 T;  2CA5 A;  2DCF A;  5CA0 E;  2CBI A;  2V5D A;  4DO0 A;  2D2S A;  1WYC A;  2DL1 A;  2NTY A;  3Q5E A;  4WW0 A;  2RP4 A;  4A5X A;  2BG9 B;  5LCY A;  2UUA T;  2X0L B;  3NRX A;  2SPC A;  3FXD B;  1IBM T;  4KHP T;  3AE2 A;  4JI5 T;  2A2F X;  1QUU A;  2V1D B;  4P1N A;  1UGO A;  2Y6X A;  4ZOL E;  2LOP A;  3ZEF B;  1AJ3 A;  4DV7 T;  5FVK A;  2W67 A;  2XPK A;  2Q9Q D;  5CFB A;  4IDZ A;  2XJ7 A;  2XQ6 A;  1HS7 A;  2V7L A;  4PFO A;  2WM9 A;  2BKP A;  4U31 A;  3RRC A;  2WU2 A;  2QRX A;  3L09 A;  5HXH A;  1UX4 A;  3EAB A;  4CN1 A;  1MND A;  3UU5 A;  5FY7 A;  1UCU A;  1J1J A;  4IE6 A;  3F31 A;  3AE7 A;  5C2T A;  5F5W A;  1ZEE A;  4B3T T;  3IEE A;  4CXX A;  2FJB A;  3AVS A;  3K8P C;  1T8B A;  1W09 A;  3RC3 A;  4ILB A;  2WSS V;  3N2O A;  4U3C A;  1HG5 A;  2NW9 A;  4Z91 A;  3KV4 A;  1J5E T;  2XAS B;  2WP9 A;  1MMG A;  2DWG A;  4QXB B;  3RYF E;  3C98 B;  5EZY E;  2H3R A;  4NUV A;  2BG9 E;  4H9Q C;  2M6I A;  4CN6 A;  2C0S A;  3NZP A;  2VL0 A;  2DI4 A;  3ZMV B;  5JR9 C;  3WAJ A;  3F2E A;  4UF0 B;  3I1A A;  3X1D A;  5AQV B;  4LF4 T;  4IT4 A;  3GMI A;  2RPA A;  4IGU A;  5JR9 A;  4CI2 B;  2C5K T;  5DAB A;  2L9Q A;  3OJA A;  1YW0 A;  5LGU B;  4GK5 E;  4L9I A;  2KT9 A;  2WMN A;  3HKD E;  3CQG B;  5L3G B;  5ABE A;  3A8Y C;  2DHR A;  1MMN A;  4UVB B;  4LF8 T;  4ZI3 C;  5JDF A;  4U33 A;  3P4R A;  3O1H A;  4GK0 E;  2EHO B;  2MYS A;  2XQ5 A;  4O4J E;  3ZC0 A;  2LSY A;  3PUX F;  2FJD A;  2QA7 A;  5DJQ C;  2E5L T;  4TV8 E;  2IW5 B;  3RIF A;  3AA0 B;  3CIR A;  1CUN A;  5JDG A;  3EDU A;  4DMV A;  5EK4 A;  2LSJ A;  3N2K E;  4EB6 E;  3ZYM A;  1SE7 A;  4LF9 T;  3FZL B;  5LXT E;  4JI3 T;  3LDQ B;  2QVA A;  2KWH A;  4K0U A;  5AQK B;  5CB4 E;  4HFI A;  3CK6 A;  4IL4 A;  4WBO A;  3NRY A;  2MTQ A;  3AE9 A;  1MNE A;  3P4W A;  4YHH T;  2XUE A;  5CJ5 A;  3C4W A;  2WBL A;  3QUJ A;  4YSY A;  3EUH A;  4OYK A;  2PBI A;  2WMO A;  4EAH A;  1LKX A;  4QH1 A;  2IC9 A;  3KBU A;  2E8I A;  5LG4 A;  4ASK A;  2X68 A;  2XAJ B;  2BKN A;  5LNK A;  3N9M A;  3N9N A;  2YK0 A;  1XNQ T;  1GQE A;  3FZK B;  5LJM A;  2VAS A;  3ZN0 B;  1M7K A;  3ZST A;  5LBQ B;  3TKL B;  2Y8D A;  3PUZ F;  4IDO A;  5AQM B;  3CWZ B;  2WAU A;  1QLB A;  2IAK A;  3HR0 A;  2FUP A;  2WQY A;  3ZN1 B;  1YQ3 A;  4X65 T;  3ZLI A;  2H89 A;  5IYZ E;  1D0Z A;  2QGS A;  3C4Z A;  2ZM2 A;  4AI6 A;  3IF8 B;  3P4S A;  3EHZ A;  1XNR T;  4DR7 T;  3AAE B;  5JDH A;  3KDS E;  1WR0 A;  4EEB A;  2YDQ A;  1HTJ F;  3LBX A;  4MBQ A;  2CWY A;  3QNU A;  3ETU A;  4DR2 T;  3NZQ A;  3RF1 A;  2VB6 A;  4WYV A;  5L3F B;  5LMU T;  4Z8X A;  4AKL A;  4HFE A;  1JNZ A;  2BS4 A;  2MAW A;  5C8Y E;  1MIY A;  5A1L A;  3N5L A;  2B76 A;  5LP6 E;  3F57 A;  5LHI B;  1W0B A;  2J47 A;  4XZC A;  2K5B B;  2M6B A;  5LA6 E;  3AA1 B;  4QHO A;  1HF8 A;  2W66 A;  3OTO T;  1NEN A;  4EGW A;  5HXE A;  4HEA A;  4FI5 A;  2LJL A;  3PUR A;  4TX5 A;  5L47 A;  1MIV A;  3AEB A;  4DR3 T;  2CHN A;  1I94 T;  2LRL A;  2YEV C;  3UQ7 A;  1KFY A;  4UVA B;  4QXC B;  2LE8 A;  3PTR B;  4NPP A;  5ABF B;  1BR0 A;  1FEW A;  2PFV A;  3FB2 A;  3AEG A;  4O4H E;  4H9R C;  4ZI2 C;  3CML A;  2W62 A;  3MXZ A;  1UUS A;  4ZS3 A;  4ZI3 D;  4P0B A;  3A7M A;  3QOF A;  2XAF B;  4ZHQ E;  2X0Y A;  2PJQ A;  1NEK A;  4U2Z A;  3E0Z A;  3AE5 A;  1WCR A;  3N9L A;  4B3R T;  2W63 A;  4NUU A;  3I9Y A;  2LT3 A;  3AEF A;  3Q5X A;  4YHJ A;  1HNW T;  5IHY A;  4IHJ E;  2KSR A;  2LM9 A;  4QX8 B;  5FXZ A;  3ZJ2 A;  1WRD A;  5AQP B;  4OK0 A;  4KUM B;  4X62 T;  1S35 A;  4Z90 A;  4H9S E;  3AVR A;  3TLU A;  2LSI A;  4HWF A;  4HFB A;  4TWH A;  3A5X A;  2LM2 A;  3R84 B;  5KX5 E;  1T72 A;  2HPL A;  1D0Y A;  3AEC A;  2IML A;  4UXN B;  2WB5 A;  5HCJ A;  2E9X C;  2XQ8 A;  1D1B A;  4DR1 T;  4DR5 T;  3ZJ1 A;  5LMN T;  2NTX A;  4COF A;  4HE8 A;  2E9X A;  2YDR A;  1WR6 A;  4PAG A;  5L3B B;  2W4X A;  2ACX A;  5AQN B;  3Q5D A;  3AAI A;  5JDL A;  3HKB E;  3CKD A;  2K24 A;  5CGM A;  1NAF A;  2FJE A;  3PUS A;  2VQE T;  1OED C;  4LML A;  4NIQ A;  3PV0 F;  4BJN A;  5HEH A;  2OLT A;  5AQT B;  1XMQ T;  1T98 A;  2CXF A;  4JEH B;  2ODV A;  4HFV A;  3K3N A;  1OED A;  4DV5 T;  4HWC A;  2E5V A;  2IDO B;  3PDY A;  2OV9 A;  3NWI A;  2UUC T;  2A3D A;  3S4U A;  5L4E A;  4E7S A;  3MAC A;  1SUM B;  4GKJ T;  2H7O A;  1KK7 A;  3BQL A;  5DQW A;  3KIN B;  3ZYL A;  2FJA A;  2E2A A;  2KZ7 B;  3RGL A;  1BR2 A;  2LKH A;  1IJ6 A;  3Q5W A;  3K1S A;  1YQ4 A;  3ANW B;  5FMN A;  5JRC A;  3CX7 B;  3KBT A;  3O4X E;  3P8C D;  3BQK A;  2XY8 B;  4EV6 A;  4UEM A;  1L0V A;  1SA0 E;  2UXN B;  4AIS A;  4U2Y A;  3VHL A;  1N34 T;  4WZX A;  3KFW X;  3T8O A;  2I59 A;  3OKQ A;  4LMK A;  2NWB A;  1EZ3 A;  3R6N A;  2V6X A;  4MAL A;  2W00 A;  5HEO A;  3NBX X;  3UUL A;  4Q25 A;  2N2N A;  2KIN B;  4DR6 T;  3RYH E;  2WDQ A;  1X79 A;  4IDQ A;  1CHU A;  4DV0 T;  5HXS A;  3PUW F;  2VKH A;  3W15 B;  2B1E A;  2WDR A;  2RA1 A;  1XWM A;  5HWX A;  4JEU B;  3DTO A;  3SWH A;  4ZI2 D;  3GN5 A;  5L2L A;  2XZE A;  3UFG A;  5FNV E;  5EK2 A;  4I0U A;  2Z6E A;  3H3M A;  4PK4 A;  3AEE A;  2UXC T;  1V9D A;  3V5U A;  3Q2M A;  1HCI A;  4HKA A;  3RQW A;  2IIU A;  4PNI A;  2CLY C;  4TN7 B;  5AQQ B;  1T7S A;  2BBJ A;  4MHC A;  4PK6 A;  4KI0 F;  3UU3 A;  2V6Y B;  2R6G F;  4OX9 T;  5AQR B;  5FYM A;  3AE8 A;  3N9P A;  1IBL T;  4PFP A;  3GA8 A;  2WY2 A;  2LOS A;  3E08 A;  3T1Y T;  4ZXL A;  4N78 D;  4LFA T;  3EVY A;  3NKZ A;  5LGN B;  5HAX A;  5FKY A;  2E9X D;  2BG9 C;  5JDN A;  4BA9 A;  2CEA A;  3KV6 A;  5FXX A;  1VCS A;  3O9X A;  5FXV A;  1U4Q A;  4AQF C;  5LJN A;  5LYJ E;  2JQ9 A;  3EAM A;  2CWO A;  2BG9 A;  4GIW A;  5FP3 A;  3AED A;  2X9H A;  4AQF A;  2CHO A;  4PJM A;  3ONL C;  4KMC A;  3FXE B;  3L3P A;  4O4L E;  2JJ9 A;  5AQH B;  4X64 T;  3RYC E;  4G2A A;  3SS1 A;  3UTK A;  1VCT A;  3MJX A;  4EED A;  3RC8 A;  1YXR A;  4IST A;  2JQQ A;  3UU4 A;  1D1C A;  4ZZC A;  2Q9Q B;  2WS3 A;  2V7I A;  1HFA A;  4HFD A;  4ANJ A;  2XQA A;  4HFH A;  2JPF A;  2CXD A;  1HR0 T;  2LKG A;  2I0M A;  3ZMU B;  2IC6 A;  1VOM A;  4ILU A;  4LF5 T;  4X1Y E;  4YY3 T;  4O2B E;  2MOZ A;  4DV2 T;  4IDP A;  4ZS2 A;  4JI2 T;  3SOL A;  4CQI A;  2XAH B;  5IWA T;  2BZB A;  4H9P C;  3MKD A;  4WNK A;  4YJ2 E;  1DU2 A;  3FHN A;  2YDS A;  3Q9D A;  5CA1 E;  4DR4 T;  2K48 A;  5IUX A;  3RLF F;  5E0O A;  4PJL A;  2K3W A;  4BJM A;  4AKR B;  2QYW A;  1UX5 A;  4ZEY A;  4HN9 A;  5JRE A;  4G63 A;  5TAO A;  3E22 E;  2ZM6 T;  1ZKE A;  3N9Q A;  4UF0 A;  4YXD A;  4I43 B;  2LSK A;  4EZ4 A;  4X1I E;  1LRZ A;  2YKS A;  3ZT5 A;  4H9N C;  3UU6 A;  3AE4 A;  3NVO A;  3FBL A;  3RX6 A;  5J2U E;  2J1D G;  2M67 A;  4GOU A;  3OYX A;  3K3O A;  2EHO C;  1N33 T;  5FY0 A;  5AQF B;  2AXD S;  2VWA A;  3MA9 A;  4EXT A;  5LHH B;  3ZMT B;  5LG3 A;  5AFU L;  1D0X A;  4AXP A;  2EHO A;  3C4X A;  4O2A E;  4JI7 T;  2WZH A;  1N36 T;  4DUZ T;  2ACZ A;  5BMV E;  1E2A A;  4UVC B;  4IE0 A;  4K0K T;  4I4T E;  3D0T A;  3MK7 C;  4JI0 T;  4UR9 A;  3N9O A;  2CE7 A;  5L3D B;  2AE9 A;  4CXW A;  2G0U A;  2XSB A;  4LMJ A;  3QB5 K;  5FVL A;  4H63 V;  2XHE B;  3C51 A;  5HEU A;  3AXJ B;  4WBN E;  4CZZ B;  5LGT B;  1OED B;  2XQ7 A;  4JV5 T;  2LEH A;  4PW8 A;  3JCF A;  3T1H T;  2NR4 A;  4IDN A;  4IRE A;  1Z0P A;  2W61 A;  2YN6 A;  4KHZ F;  4B3M T;  4GKK T;  3KVB A;  3HL6 A;  3QB5 A;  3BK9 A;  5M4Y A;  3JAF A;  2VKJ A;  2J4G A;  3VR8 A;  3DP7 A;  5HXC A;  1Y64 B;  3U78 A;  3WI3 A;  5AQL B;  2LHN A;  5FXW A;  2UXX B;  2KXP B;  3TLT A;  4ISS A;  5HXR A;  2ES0 A;  1U5P A;  2V26 A;  1X9B A;  2C5I T;  2HN2 A;  3WAK A;  2VQF T;  2CXL A;  4YTP A;  5JDM A;  4CXY A;  5J1G A;  2VL8 A;  3UUX B;  1FMW A;  3AA7 B;  3LK4 2;  4UV9 B;  4MFR A;  3H3A A;  3I9W A;  3HI2 A;  4F8H A;  1Y01 A;  4HTE A;  4AKH A;  4QH4 A;  4U7I A;  4ILC A;  3VKG A;  3HA4 A;  5JQG E;  2VKD A;  1IZN B;  4DV6 T;  4AQY T;  3ZKR A;  3PJA J;  3U3I A;  3IA3 A;  3LK3 B;  2CRB A;  3PU3 A;  3RHW A;  2BVM A;  5ABG A;  4AKI A;  5C3J A;  3LSV A;  3BQI A;  2X51 A;  2KLQ A;  3FBZ A;  2XQ3 A;  3O1I A;  4OYJ A;  4J2C A;  4I50 E;  2UXB T;  3CVR A;  2WWV A;  4IE7 A;  4CI1 B;  4HFC A;  3IHR A;  1XMO T;  4X5T A;  1KNZ A;  3ZCI A;  4EIW A;  3V5S A;  5JR9 B;  1VRB A;  2H7V C;  4U7Y A;  1YKE B;  5J2T E;  5ADX L;  5ABF A;  1BR1 A;  2X67 A;  3ZC1 A;  5H6R B;  2EHO D;  2CPT A;  2HH7 A;  1SHZ C;  3M65 A;  1IAP A;  4GYR A;  3AA6 B;  4QH5 A;  2UUB T;  1WLX A;  2YOE A;  5F8P A;  4QKN A;  2V7K A;  3JAD A;  3PUV F;  1W9R A;  4HWD A;  4X20 E;  4EOZ B;  4TZ4 C;  1N32 T;  4TUY E;  4JI1 T;  4BAY B;  4XAX B;  2JMH A;  4B3S T;  3TLV A;  1NWM X;  2ODU A;  5ETW A;  4A56 A;  3LFM A; 
#chains in the Genus database with same CATH homology
 1D1A A;  5L3F B;  3UUN A;  2OA5 A;  5HYA A;  4PJM A;  2YIN A;  1WYB A;  4Z8X A;  4AKL A;  3C64 A;  3RRW A;  3OYZ A;  3QK6 A;  4EZH A;  4L5G A;  3N2G E;  4KMC A;  3FXE B;  3L3P A;  4O4L E;  2JJ9 A;  5L3E B;  5C8Y E;  1MIY A;  1FIO A;  5A1L A;  3N5L A;  2P9B A;  3RYC E;  5LP6 E;  3MZK B;  2XQY A;  3F57 A;  4PJJ A;  4G2A A;  1US7 B;  5LHI B;  3SS1 A;  3I0O A;  3VU7 H;  3UTK A;  3ONX A;  1LVF A;  3PU8 A;  3MJX A;  3RC8 A;  2K9A A;  4XZC A;  2NW8 A;  1B7T A;  2DNX A;  2D0U A;  2NW7 A;  3GN5 B;  4IST A;  4OFZ A;  3ZPO A;  4C90 A;  2K5B B;  5LA6 E;  2JQQ A;  1D1C A;  3AA1 B;  4QHO A;  2Q9Q B;  1HF8 A;  2BDE A;  3QC9 A;  2V7I A;  1HFA A;  4ANJ A;  2KWI B;  5H6Q B;  3ESL A;  3B13 A;  3UT5 E;  2JPF A;  2CXD A;  4DBQ A;  5HXE A;  4HEA A;  4GYS A;  4FI5 A;  3ZMU B;  2IC6 A;  4ADZ A;  1VOM A;  4ILU A;  2LJL A;  4X1Y E;  3PUR A;  4TX5 A;  1YD8 G;  1MIV A;  4O2B E;  2MOZ A;  3PUQ A;  5DQV A;  3O1J A;  3RKO A;  2XAQ B;  4H63 H;  4M1P A;  5F3J A;  4ZS2 A;  3SOL A;  4ZI7 E;  4CQI A;  3J7Y q;  1MIW A;  2XAH B;  2BZB A;  2YEV C;  4HGA A;  4UVA B;  4H9P C;  2YU1 A;  4QXC B;  3MKD A;  4WNK A;  2LE8 A;  4YJ2 E;  3PTR B;  3FHN A;  2V7M A;  3KV5 A;  3Q9D A;  5CA1 E;  1BR0 A;  1FEW A;  2K48 A;  2PFV A;  2VKO A;  3FB2 A;  4KBM B;  2GK9 A;  4O4H E;  3EDV A;  4H9R C;  2X9W A;  1HX8 A;  4ZI2 C;  3CML A;  2CLY B;  2HPJ A;  2W62 A;  3MXZ A;  4CI3 B;  5E0O A;  4DVD A;  4PJL A;  4BJM A;  2D0T A;  2CM0 A;  4AKR B;  4ZS3 A;  4JLE A;  4UIG A;  4ZI3 D;  1UX5 A;  2W0G A;  2DLR A;  3SRZ A;  4HN9 A;  5JRE A;  4P0B A;  4G63 A;  4FJO A;  3UFE A;  2XAF B;  5TAO A;  3E22 E;  4ZHQ E;  4DND A;  1H7C A;  2PJQ A;  1ZKE A;  2NP9 A;  2CCQ A;  2ZMA A;  3E0Z A;  3N9Q A;  4UF0 A;  4C91 A;  2LHR A;  2N9D A;  2ZM8 A;  1G8X A;  2CA5 A;  2DCF A;  4I43 B;  3N9L A;  3GWH A;  5CA0 E;  2LSK A;  2W63 A;  4NUU A;  3CPZ A;  4DO0 A;  4EZ4 A;  5JH7 E;  4X1I E;  3CQC B;  1O3X A;  2MBG A;  3I9Y A;  1LRZ A;  2D2S A;  1WYC A;  5LOV E;  5JDQ A;  2LT3 A;  4H9N C;  2NTY A;  3DJB A;  4MLK A;  4WW0 A;  3Q5X A;  4YHJ A;  5IHY A;  3LBX B;  2RP4 A;  5EK3 A;  3FBL A;  4IHJ E;  5LCY A;  4E7Z A;  2BVL A;  2LM9 A;  4QX8 B;  3RX6 A;  2X66 A;  3HKE E;  3ANW A;  2X0L B;  5FXZ A;  3ZJ2 A;  1WRD A;  3NRX A;  4OHF A;  2L3L A;  5J2U E;  4OK0 A;  2SPC A;  3FXD B;  4KUM B;  2J1D G;  1S35 A;  2M67 A;  4GOU A;  2A2F X;  3OYX A;  4H9S E;  3I0Q A;  2EHO C;  1QUU A;  3AVR A;  3K3O A;  2V1D B;  2LSI A;  5FY0 A;  1ZHC A;  2Y6X A;  4ZOL E;  2LOP A;  2VWA A;  3ZEF B;  3MA9 A;  1AJ3 A;  4EXT A;  3A5X A;  5LHH B;  3ZMT B;  3R84 B;  5KX5 E;  4I55 E;  2Q9Q D;  2HPL A;  3LG7 A;  4IDZ A;  5AFU L;  1D0Y A;  1HS7 A;  1D0X A;  4AXP A;  2V7L A;  4PFO A;  2WM9 A;  2EHO A;  4UXN B;  4UEL A;  3C4X A;  4O2A E;  4DBR A;  1HG2 A;  1OXZ A;  3JC6 C;  2E9X C;  3RRC A;  1D1B A;  5KDM C;  4DMW A;  2KND A;  3RPU A;  3ZJ1 A;  4YJ3 E;  3L09 A;  5BMV E;  1UX4 A;  5HXH A;  4IIJ E;  1MND A;  4UVC B;  3CX8 B;  5FY7 A;  4IE0 A;  3ZYK A;  1UCU A;  4ERR A;  2NTX A;  4IE6 A;  3F31 A;  3ZMZ B;  4U72 A;  4QWN B;  4HE8 A;  2E9X A;  4I4T E;  1ZEE A;  3HKC E;  1WR6 A;  5LBM A;  3D0T A;  3MK7 C;  4PAG A;  5L3B B;  3N9O A;  2L8K A;  4P0A A;  2CE7 A;  3IEE A;  2ACX A;  4CXX A;  3AVS A;  3K8P C;  5L3D B;  4CXW A;  3RC3 A;  2DWK A;  2G0U A;  3AAI A;  2KMF A;  2CMR A;  5JDL A;  3HKB E;  2WSS V;  3CKD A;  2K24 A;  3N2O A;  4H63 V;  1HG5 A;  2NW9 A;  2XHE B;  1NAF A;  1OWA A;  3C51 A;  3AB3 B;  3PUS A;  3KV4 A;  3PE0 A;  4WBN E;  2XAS B;  4X1K E;  4BJN A;  4CZZ B;  3B57 A;  1MMG A;  5LGT B;  1T98 A;  2DWG A;  2CXF A;  3VKH A;  4PJN A;  4QXB B;  4JEH B;  3RYF E;  2ODV A;  3P7I A;  2LEH A;  3C98 B;  4PW8 A;  5EZY E;  2H3R A;  4HFV A;  3K3N A;  4NUV A;  4H9Q C;  4QX7 B;  1Z0P A;  3PDY A;  2C0S A;  3NZP A;  2W61 A;  2A3D A;  2DI4 A;  3ZMV B;  5JR9 C;  3S4U A;  3KVB A;  3HL6 A;  3WAJ A;  3F2E A;  4E7S A;  4UF0 B;  3MAC A;  3BK9 A;  3I1A A;  5M4Y A;  2VKJ A;  3OBV E;  3DP7 A;  4EYU A;  1YKH B;  2H7O A;  1BR4 A;  5HXC A;  2Y48 B;  1Y64 B;  3CX6 B;  3GMI A;  3U78 A;  1KK7 A;  3BQL A;  5DQW A;  1G73 A;  3KIN B;  4IGU A;  5JR9 A;  3ZYL A;  3WI3 A;  4YFS A;  4CI2 B;  2C5K T;  2N1G A;  5DAB A;  2L9Q A;  5LHG B;  4PK5 A;  2KZ7 B;  4V1A v;  3OJA A;  1YW0 A;  1BR2 A;  4TV9 E;  5LGU B;  2LHN A;  4GK5 E;  1IJ6 A;  3Q5W A;  5FXW A;  2UXX B;  1IJ5 A;  2KT9 A;  2KXP B;  2WMN A;  3HKD E;  4L9I A;  4AQG A;  3ANW B;  3CQG B;  5FMN A;  3CX7 B;  5L3G B;  5JRC A;  3KBT A;  3O4X E;  4ISS A;  3P8C D;  3BQK A;  2DHR A;  1MMN A;  4IE5 A;  4UEM A;  4UVB B;  1SA0 E;  2PG8 A;  2UXN B;  3CQX C;  5HXR A;  2ES0 A;  4ZI3 C;  1U5P A;  3VHL A;  4JUY A;  4YLH A;  2V26 A;  2ZM0 A;  5JDF A;  3KFW X;  2C5I T;  3T8O A;  3O1H A;  4GK0 E;  5KMG P;  1FMV A;  2I59 A;  4B6X A;  3OKQ A;  3WAK A;  2CXL A;  4AKG A;  2EHO B;  2MYS A;  4O4J E;  3ZC0 A;  5JDM A;  2NWB A;  2LSY A;  4CXY A;  1EZ3 A;  2VL8 A;  5J1G A;  2X9X A;  2QA7 A;  5DJQ C;  3UUX B;  1QSD A;  1FMW A;  2XAG B;  3AA7 B;  3R6N A;  4TV8 E;  2IW5 B;  3LK4 2;  2LSG A;  4UV9 B;  3AA0 B;  4MAL A;  3H3A A;  4MFR A;  2W00 A;  3C50 A;  3I9W A;  1CUN A;  3PUA A;  4H9O C;  4KP3 C;  1ZV4 X;  3NBX X;  3UUL A;  5JDG A;  3EDU A;  3HI2 A;  4DMV A;  3ETV A;  5EK4 A;  2E9X B;  4AKH A;  2N2N A;  4HTE A;  2LSJ A;  3N2K E;  3LK2 B;  4EB6 E;  3ZYM A;  3VKG A;  2KIN B;  3HA4 A;  5JQG E;  3RYH E;  2NOX A;  2VKD A;  1IZN B;  2JMK A;  3K3Q C;  5LXT E;  1X79 A;  5HXS A;  3LJC A;  3KV9 A;  5GON E;  3U3I A;  3LK3 B;  2VKH A;  3IBP A;  2KWH A;  4K0U A;  5CB4 E;  2B1E A;  3W15 B;  2Q9Q C;  2WWU A;  2RA1 A;  2ZLY A;  3PU3 A;  4WBO A;  2BVM A;  5HWX A;  3NRY A;  4JEU B;  3DTO A;  3RYI E;  2MTQ A;  3SWH A;  4AKI A;  4ZI2 D;  3GN5 A;  1MNE A;  2JRK A;  5HWY A;  2XUE A;  5L2L A;  3ZCJ A;  5L3C B;  3BQI A;  3C4W A;  2WBL A;  2X51 A;  2KLQ A;  1S94 A;  2Q9Q A;  3FBZ A;  3QUJ A;  3ZMS B;  3EUH A;  4OYK A;  2PBI A;  2WMO A;  4EAH A;  1LKX A;  3O1I A;  2IC9 A;  4OYJ A;  3KBU A;  4J2C A;  2E8I A;  4I50 E;  5FNV E;  5EK2 A;  2V7J A;  2X9Y A;  3CVR A;  5LG4 A;  2Z6E A;  5JVD E;  4ASK A;  2X68 A;  4PK4 A;  2A72 A;  2XAJ B;  4IE7 A;  4CI1 B;  3IHR A;  5LNK A;  1V9D A;  3V5U A;  3N9M A;  3Q2M A;  3N9N A;  2YU2 A;  1KNZ A;  2YK0 A;  1HCI A;  4HKA A;  3ZCI A;  4EIW A;  4PNI A;  3V5S A;  2CLY C;  5LJM A;  5JR9 B;  1VRB A;  4TN7 B;  2H7V C;  2VAS A;  3ZN0 B;  1YKE B;  2XTL A;  5J2T E;  4MHC A;  4IE4 A;  5ADX L;  5LBQ B;  1BR1 A;  3TKL B;  2Y8D A;  4PK6 A;  2X67 A;  3CWZ B;  1MMA A;  2WAU A;  2C5J A;  4F6R C;  4UV8 B;  3ZC1 A;  5JRC B;  2IAK A;  3HR0 A;  3KVA A;  5H6R B;  5FYM A;  2EHO D;  4EYY R;  2HH7 A;  3ZN1 B;  4XBF B;  3RH3 A;  3H37 A;  3AAA B;  3N9P A;  1SHZ C;  3ZLI A;  3M65 A;  3GA8 A;  4PFP A;  1IAP A;  2LOS A;  3AA6 B;  4GYR A;  3E08 A;  4N78 D;  4L0R A;  1LVK A;  3EVY A;  5IYZ E;  1D0Z A;  5LGN B;  1WLX A;  5HAX A;  2QGS A;  3C4Z A;  5F8P A;  4QKN A;  2ZM2 A;  4U74 A;  3J9X 1;  2V7K A;  4AI6 A;  3JC6 D;  2E9X D;  2D5U A;  3IF8 B;  4O4I E;  5JDN A;  4BA9 A;  1MMD A;  2CEA A;  3AAE B;  5JDH A;  3KDS E;  4QXH B;  4X20 E;  3KV6 A;  5FXX A;  4EOZ B;  3O9X A;  4TZ4 C;  5FXV A;  1U4Q A;  4AQF C;  5LJN A;  5LYJ E;  1HTJ F;  1E1H B;  4TUY E;  3LBX A;  4BAY B;  4O8S A;  4XAX B;  3UUM A;  2CWO A;  4MBQ A;  4P09 A;  2JMH A;  2CWY A;  4GIW A;  5FP3 A;  1NWM X;  2ODU A;  3ETU A;  3PUG A;  2X9H A;  2VK9 A;  3NZQ A;  5ETW A;  4A56 A;  4AQF A;  2VB6 A;  3LFM A;  5FY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...