3FBLA

Crystal structure of orf132 of the archaeal virus acidianus filamentous virus 1 (afv1)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
82
structure length
82
Chain Sequence
YHKLRLAIKEICKTDGIPNIKWGMYIAFGEKLLKSYLKMKAGSASSDMIAEYINNAISAFSSRTGISQETAQKIADFITSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acidianus filamentous virus 1 coat proteins display a helical fold spanning the filamentous archaeal viruses lineage
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Structural protein
molecule keywords Putative uncharacterized protein
total genus 38
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2008-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.800 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3fblA00
3FBLA 3F2EA 3J9X1 3FBZA
chains in the Genus database with same CATH superfamily
1S35A 3RIAA 4ZEYA 2XQYA 2EHOA 3L8RA 5HXSA 3DTOA 2CLYB 2FJDA 4O4LE 4FI5A 1BR1A 3EABA 3W15B 5TAOA 2UXCT 4K0KT 5LA6E 5C3JA 4LF4T 1O3XA 1T7SA 5AQGB 3ZJ2A 2W62A 4UXNB 4O4IE 2I6HA 2ZMAA 2KSRA 2VURA 3EAMA 5HWYA 4EEBA 4IL9A 5J2UE 5FXXA 2CRBA 1ZEEA 4YT0A 1HNZT 2C5IT 1OEDC 3AAIA 1KK7A 5JR9A 4AKLA 4HWCA 2XY8B 4LF5T 1YXRA 5JVDE 4U2YA 4ZI2C 4I55E 4YHJA 4CI3B 1NWMX 3O1JA 4DV6T 1W0BA 2C0SA 2X68A 2Y8DA 4IE5A 2BBJA 2E2AA 2XPKA 3AE9A 4WNKA 4KBMB 3ZYLA 2W00A 1FMVA 5LNKA 1IZNB 3CQCB 3HA4A 3RYIE 2FJAA 1FEWA 3P4SA 3CWZB 5F8PA 4LFBT 2CXLA 5M4YA 2IIUA 4H63V 3PUSA 3CMLA 3GN5B 3N5LA 4QKNA 3FHNA 5EK4A 3QC9A 3SFEA 2UXNB 5DJQC 2XQ6A 4HFVA 3C4WA 3SWHA 3SRZA 3Q2MA 2V5CA 1I6ZA 2LKHA 5AQKB 2E9XC 2WS3A 2WMNA 2X9HA 2BKNA 3C4XA 2ACZA 3JC6D 3AE7A 3PE0A 4QX8B 4TN7B 2ZM8A 2NWBA 5AQFB 4WBOA 4HFEA 4ZOLE 5L3GB 2JIWA 2XJ7A 3KV5A 2LE8A 4UIGA 2XSAA 4PAGA 5FMNA 2X0LB 4E7SA 5LGTB 2QGSA 3LBXA 1L0VA 2NOXA 2BVLA 2RA1A 4XBFB 2D0UA 2FJBA 2Q9QC 4G63A 2LRLA 4WBNE 2VVSA 2XQ9A 2YKSA 2HPLA 5AQJB 3ZLIA 1B7TA 2OV9A 5F5WA 4EAHA 4EV6A 2YEVC 1UUSA 2PJQA 2Y6XA 5AQTB 4AKRB 3OYZA 3F57A 4YTMA 5CJ5A 2VVNA 4YSZA 2PTFA 4U72A 1D0ZA 4ZS2A 3ETVA 3KBTA 3KBUA 3ZKRA 5KDMC 4XAXB 2XAGB 1NENA 3BQKA 3ONLC 4GIWA 5L3DB 3HI2A 4DV1T 1JNZA 4X65T 2YOEA 2XAJB 3OJAA 5C8YE 4OFZA 3AEDA 4EB6E 4B6XA 2K3WA 4TX5A 4DR5T 2B76A 2WDVA 3AEEA 3HKCE 3HR0A 4WYVA 2XZEA 5ABHA 2UXDT 2AE9A 1UX4A 4HN9A 4Q25A 2EHOD 3ZSTA 2G0UA 3LK2B 2CE7A 4H63H 2RPAA 5JREA 3OBVE 5IYZE 2BG9B 2VASA 4NUVA 4HFBA 2WWVA 2CLYC 3PUWF 5LG4A 1MNDA 5AQUB 4EEDA 4O4JE 2A3DA 3RKOA 2XHEB 5DQWA 4GYSA 3UTKA 3CKDA 1WYCA 3FBLA 3TLSA 2BS2A 4JI0T 4B3MT 3R84B 4COFA 4A56A 4ILAA 2V1DB 3EUHA 5LOVE 3OPCA 3VRAA 4NIQA 3LJCA 2LM2A 3ANWA 3UU8A 3NZPA 5LHHB 1G8XA 1N36T 3MA9A 3DJBA 4DUYT 1KNRA 3S4UA 3AEBA 2ZLYA 4DV2T 1QSDA 5CFBA 4U31A 3CIRA 1D1AA 2KINB 4UVBB 5ETWA 1SUMB 2XSBA 3KVBA 4B3TT 1US7B 1XZYA 2X9XA 3AE6A 3P4RA 3WAKA 2KXPB 3ZMUB 4JI3T 2QA7A 3A8YC 2YU2A 2MBGA 1N33T 3VR9A 1JNRA 2XQAA 3JCFA 2NW8A 2NTXA 3RRCA 3B13A 3UUMA 2CCQA 2CHNA 4EXTA 3M65A 3JAEA 4Z90A 4ZI3D 2FJEA 2BG9C 2WWUA 3ZC1A 1HF8A 3ZJ1A 3PJAA 3IEEA 5LJNA 2LSJA 3ONXA 3PUQA 3J7Yq 3PU8A 4FJOA 1HNXT 1G73A 1X9BA 3Q9DA 1ZP0A 4CN4A 3ZEFB 3I0OA 4YFSA 4DUZT 4NXNT 2JQ9A 3P7IA 1HX8A 4EOZB 1Z0PA 2D2SA 2DCFA 2KWIB 4C90A 4YSYA 4A5XA 2L8KA 2WU5A 5L4EA 2NW9A 4U74A 4YLHA 3C51A 4PJMA 2FBWA 2Q9QA 3PUGA 5KX5E 1UGOA 2LKGA 2X9YA 4HFHA 1N32T 1YW0A 2JRKA 3K3QC 3PUVF 4IDOA 4PFPA 2XQ7A 4TWHA 5FNVE 3RI5A 4DBRA 5LJMA 1XWMA 1UK5A 2QVAA 4HWHA 3N2OA 3O9XA 2X66A 4CN1A 2P9BA 5HWXA 4CI2B 2NTYA 3RLFF 3V5SA 2A72A 5JQGE 4NXMT 3B57A 3PUYF 3TLTA 4CXWA 2KMFA 2WB5A 3AVSA 2LOPA 4HKAA 1UCUA 3KV4A 2N1GA 4NUUA 4BA9A 4DV7T 1BR0A 4K0UA 2X67A 2WDRA 2HN2A 4G2AA 2BBHA 5EK2A 3CX7B 3C4ZA 5FL1A 2VK9A 3VHLA 2VKJA 3CVRA 3H37A 4OYKA 3ZCIA 4AQFA 4TWFA 4E7ZA 4CZZB 5LMUT 2LHRA 4IE6A 4CXXA 5DABA 5BMVE 2V6YB 1D1BA 4ZS3A 2N9DA 1Z8UA 2V26A 2XAFB 1HX1B 3ETUA 3QK6A 3AXJA 1OEDA 3RX6A 4ZZCA 3J9X1 4ANJA 2V7JA 3ANWB 1E2AA 1R8IA 4YSXA 3FB2A 4WZXA 4P0BA 3P4WA 5ABFA 2W67A 5KXJA 2ZM0A 3ZMZB 4ISTA 4KP3C 3TLUA 3A7MA 4BJNA 4PJNA 4PK5A 5FXVA 1XNRT 2VQFT 1WCRA 3IA3A 4JEUB 5AQPB 5C2TA 4DVDA 4CXYA 2WSSV 3AEAA 2NW7A 3C64A 2V7IA 3V5UA 3G06A 4IDZA 2H88A 2LOSA 5AFUL 3MJXA 2DL1A 4JI6T 4GKKT 2WQYA 3Q5DA 2LSGA 4LF6T 1MMNA 3AAAB 4JBWF 3PUZF 2XM2A 5HAXA 4OK0A 4ZI3C 1W09A 4AI6A 1IJ5A 3CK6A 3ESLA 1GQEA 2YN6A 2IDOB 2CM0A 2IAKA 3GWHA 4GK0E 3VR8A 4JI2T 4ZZBA 2LT3A 4L0RA 1YQ4A 4H9QC 4JI4T 2KT9A 1U4QA 2A9UA 2H7OA 2CXFA 3P8CD 2LM9A 4P09A 3HKEE 3LK42 4U33A 4UR9A 4DMVA 5JR9B 4BAYB 2VQET 1V9DA 2CBJA 4TWDA 5H6QB 4PNIA 5L4HA 4JI5T 3ZMSB 4O8SA 3NRYA 5EK3A 5ADXL 3VRBA 3UQ7A 4U2ZA 1SHZC 3T1HT 3FZKB 3PU3A 1YKEB 1HR0T 4IDQA 4A98A 3C98B 5FY0A 4UV8B 4QH5A 4QX7B 4X62T 1AJ3A 5LGUB 5L47A 2I59A 4DV5T 2KZ7B 2AXDS 2Z6EA 1MMAA 5BR8T 2LHNA 1NAFA 2K48A 2CPTA 5LB7B 4QWNB 5LHIB 3ABVA 1WYBA 4ZXLA 1XMOT 4OYJA 4P0AA 1MIVA 3U78A 4EGWA 4PW8A 1ZOYA 3BQIA 5L2LA 3RC8A 4EYYR 1CHUA 1OWAA 2JQKA 2YK0A 4HEAA 4HWDA 5ABFB 4JI7T 2E9XD 3N9OA 3RYCE 4JI8T 5JRCA 2E9XA 4AIUA 5HEOA 2DNXA 2X51A 3K3NA 2A2FX 4PFOA 3OVUA 4MLKA 1SE7A 4PJJA 4ASKA 2V8SV 2MPKA 2LSKA 4AQFC 3AE5A 3KFWX 5LHGB 4GKJT 2CMRA 3ZT5A 2XQ4A 2CHOA 5FY7A 1HCIA 1M7KA 3NWIA 3VKHA 2MAWA 1UURA 3ZPOA 3ZMVB 2LSIA 4EZ4A 2WDQA 3UFEA 2X9WA 3UUXB 4C91A 4DV0T 4PK4A 3PJAJ 2DI4A 2I0MA 2W4XA 3ZT7A 3O1IA 4BJMA 5FY1A 2CWOA 5CA0E 3N9NA 2WU2A 3HL6A 4TZ4C 2BS3A 4QXCB 3QOFA 3I1AA 3MK7C 1KNPA 2MOZA 2WMOA 4M1PA 4I43B 4ADZA 4QH4A 2OLTA 1KEYA 3RC3A 2Q9QB 4A97A 3LG7A 5ABEA 4TUYE 3AE4A 1LKXA 2L3LA 1WLXA 1WR6A 3N9QA 1OEDE 1UX5A 3R6NA 2V6YA 3RQWA 3OKQA 4AKHA 1S94A 3QB5K 4YHHT 3CQGB 3T8OA 4HWIB 4IDNA 1HFAA 2ES0A 3Q5XA 5IUXA 4LF9T 2BZBA 3PV0F 5LCYA 2V6XA 4OX9T 1WFDA 3K3OA 3L09A 2QYWA 2XASB 3FZFB 2J47A 2YDRA 2H89A 5LYJE 5HEUA 5LP6E 2MTQA 3RYHE 4JUYA 4DR6T 3I9WA 1D1CA 1IAPA 2IUBA 2LEHA 5JR9C 3NVOA 2UUCT 2VKDA 5HEJA 2D5UA 4JV5T 4JEHB 2PBIA 2D9DA 4AKIA 1D0YA 3CX6B 5E0OA 3PUAA 4MHCA 3O1HA 3FBZA 2C5JA 3LK3B 5JH7E 3AB3B 1WR0A 4LFAT 3AECA 4U3CA 3L3PA 1T98A 1YQ3A 4IGUA 4I4TE 4U7IA 1KNZA 3ZN0B 5JDLA 4EYUA 4YJ3E 2V7KA 3IBPA 4UV9B 1J1JA 3RIUC 1E7PA 4DR7T 4DMWA 2CXDA 2VWAA 3I0QA 1MMDA 4MALA 4DR4T 5JRCB 1OEDB 2LRKA 2YDSA 4P1NA 2HH7A 5FXZA 3LSVA 1BR2A 1EZ3A 2BKPA 2UXXB 3K8PC 4GYRA 5AQIB 3AA1B 2VKOA 3M3ZB 1MMGA 3UUBA 3ZYKA 2K9AA 5CGMA 5L3EB 2V7MA 4X66T 4AQYT 2F4VT 4Z8XA 4O2BE 3AE2A 2WBLA 3EDUA 5F3JA 3UFGA 3NBXX 3NRXA 2BG9A 2DWGA 2XQ3A 2X0YA 1QUUA 3GMIA 2KWHA 5AQLB 3ZMTB 1HNWT 4X1IE 2BG9E 4LMJA 5HYAA 3EHZA 4QHOA 5HEHA 3PURA 4DV4T 1HS7A 3TLVA 3AE3A 3AA6B 1FJGT 2WZHA 4EZHA 3AEFA 5FP3A 5AQOB 5ABGA 2DWKA 1HTJF 2W0GA 3IF8B 3B5MA 5A1LA 3FZLB 4KI0F 3SS1A 3O4XE 3TKLB 4ILCA 2BS4A 4B3RT 1IBMT 2XTLA 5JDFA 2CWYA 5FYMA 5DQVA 1KF6A 3SOLA 3RKGA 3AA0B 3AEGA 4TNVA 4AKGA 5HXRA 3RIUA 2CA5A 2ACXA 2Y48B 3JC6C 3MXZA 3P4QA 3PDYA 4ZI7E 4HFDA 4ISSA 3IHRA 4KHPT 3HKBE 1NEKA 4UF0B 4X1YE 2LSYA 4O4HE 4UVAB 4IE4A 2WAUA 3RH3A 4TNWA 4X1KE 2EHOC 4H9RC 5H6RB 2UUAT 2WY2A 1XDOA 1FIOA 4IT4A 2J1DG 5HXEA 1W9RA 4IE0A 4B3ST 3GA8A 4YXDA 3N2KE 2XAQB 3MKDA 2E8IA 4H9OC 3FZHB 4Z91A 2H3RA 4H9NC 4PJLA 1CUNA 3EDVA 5JTGA 3LBXB 5AQVB 2VKHA 3RRWA 4YTNA 5GONE 2IHR1 3PTRB 2WCAA 5AQHB 2RP4A 1H7CA 4LF7T 2SPCA 5HXCA 2X0HA 4QXHB 2WZIA 4AISA 3RYFE 2CEAA 4GOUA 2K24A 2PFVA 2K5BB 3ZT6A 1M62A 3ZSSA 4DIDB 4DV3T 4DR3T 3WI3A 3F2EA 4GK5E 2IMLA 5J0ZA 1SA0E 1MIYA 2DLRA 2KNDA 3C50A 3MACA 4KX6A 5CB4E 4F6RC 2E9XB 3FZMB 3VKGA 5HCMA 4IIJE 3HKDE 5AQMB 4EIWA 2J4GA 5LBMA 3UULA 2XUEA 1MIWA 4X64T 4KMCA 2XM1A 3BQLA 1X79A 3F31A 4HFCA 4LF8T 3SFDA 1I94T 4UEMA 2KLQA 2QRXA 4O2AE 3P50A 2W66A 3AVRA 4DO0A 5HXHA 2HPJA 4DR1T 3KVAA 3LDQB 4L5GA 2V7LA 1W0AA 3FXDB 4IL4A 3RF1A 3Q5WA 1QLBA 2ODUA 1LVFA 2ZM2A 3AA7B 4MBQA 4TV9E 5LMNT 2UUBT 1XDPA 1ZKEA 3UT5E 4DNDA 4DBQA 4ERRA 5L3CB 3N2GE 4U7YA 5FL0A 4ILUA 4LMKA 2UU9T 5JDQA 3L39A 3Q5EA 1VCSA 4MFRA 3VU7H 1IBLT 4LMLA 2C5KT 3KDSE 1T72A 1LRZA 1T8BA 2OA5A 2XQ8A 3X1DA 2Q9QD 4ZHQE 4ZI2D 3ZCJA 3NKZA 3AE8A 3AE1A 4HFIA 4UF0A 1VRBA 1KFYA 5AQRB 4IREA 4PK6A 2M67A 2YU1A 2IW5B 3AAEB 5LGNB 1HG2A 2HHHT 1LVKA 5IWAT 3LFMA 2FUPA 3N9LA 4LFCT 3D0TA 1ZHCA 2M6BA 4WW0A 1XNQT 1J5ET 3CPZA 2YDQA 3RIFA 1HG5A 3U3IA 5L3BB 5IHYA 3ZC0A 2B1EA 3GN5A 4CQIA 2MYSA 3QNUA 1N34T 4JYAT 4UVCB 2LJLA 2W63A 4JLEA 5HCJA 5J1GA 3RPUA 3UU3A 4HTEA 3RGLA 1OXZA 5LBQB 4IE7A 2WP9A 2XQ5A 2UXBT 2ODVA 5JDGA 1IJ6A 2VL8A 2VL0A 4KHZF 3JAFA 4QH1A 4X5TA 4OHFA 4HWFA 2DHRA 5J2TE 5FVLA 2E5VA 3EI0A 3KV6A 4I50E 3UUNA 1XMQT 3UQ4A 2E5LT 5LXTE 2NP9A 4H9PC 3RHWA 3A5XA 1Y01A 2J62A 2JMHA 3ZN1B 4IDPA 3OTOT 4JI1T 2V5DA 4AXPA 3BK9A 4YTPA 3H3AA 4YY3T 3H3MA 2M6IA 2EHOB 3CQXC 2D0TA 2ZM6T 4ILBA 2W61A 2L9QA 4N78D 2BVMA 2BDEA 3UU4A 4L9IA 1DU2A 2WM9A 2PG8A 1MNEA 4TV8E 2CBIA 3UU6A 2JMKA 2N2NA 4H9SE 2HN1A 3JADA 5CA1E 2JPFA 2JJ9A 3N9PA 4CN6A 5FXWA 2BKOA 3P4PA 3WAJA 2NR4A 4KUMB 5LG3A 3OYXA 3PUXF 3I9YA 2YINA 3ONJA 3FXEB 2IC9A 4NPPA 4DR2T 1VCTA 4X20E 3KINB 3AXJB 2VB6A 3MZKB 3T1YT 5JDNA 1ZV4X 1VOMA 3K1SA 4QXBB 3QB5A 5HEGA 3TLWA 2JQQA 4UELA 5AQQB 1J5WA 2JQHA 2R6GF 4J2CA 1Y64B 3E22E 3UU5A 4HE8A 3ZYMA 2GK9A 2IC6A 5AQNB 5AQSB 4F8HA 2H7VC 5JDMA 1BR4A 3CX8B 1IBKT 5L3FB 3EVYA 3E08A 3RQUA 1U5PA 1YKHB 1WRDA 4HGAA 4AQGA 4I0UA 3KV9A 4YJ2E 4CI1B 5JDHA 4IHJE 5EZYE 1D0XA 1FMWA 5KMGP 2W2UA 3QUJA 3NZQA 1YD8G 4V1Av 4XZCA 3N9MA 5FKYA 2LLYA 2XAHB 3DP7A 3E0ZA 1E1HB 5FVKA
chains in the Genus database with same CATH topology
1S35A 2XQYA 2EHOA 5HXSA 3DTOA 2CLYB 4O4LE 4FI5A 1BR1A 3W15B 5TAOA 5LA6E 1O3XA 3ZJ2A 2W62A 4UXNB 4O4IE 2ZMAA 5HWYA 5J2UE 5FXXA 1ZEEA 2C5IT 3AAIA 4AKLA 1KK7A 5JR9A 5JVDE 4ZI2C 4I55E 4YHJA 1NWMX 3O1JA 2C0SA 2X68A 2Y8DA 4IE5A 4WNKA 3ZYLA 4KBMB 2W00A 1FMVA 5LNKA 1IZNB 3CQCB 3HA4A 3RYIE 1FEWA 5F8PA 3CWZB 2CXLA 5M4YA 4H63V 3PUSA 3CMLA 3GN5B 3N5LA 4QKNA 3FHNA 5EK4A 3QC9A 5JREA 2UXNB 5DJQC 3SWHA 4HFVA 3C4WA 3SRZA 3Q2MA 2E9XC 2X9HA 2WMNA 3C4XA 3JC6D 3PE0A 4QX8B 4TN7B 2ZM8A 2NWBA 4WBOA 4ZOLE 5L3GB 4UIGA 3KV5A 2LE8A 5FMNA 5LGTB 4PAGA 4E7SA 2X0LB 2QGSA 3LBXA 2NOXA 2BVLA 2RA1A 2D0UA 2Q9QC 4G63A 4WBNE 2HPLA 4EAHA 3ZLIA 1B7TA 2YEVC 2PJQA 2Y6XA 4AKRB 3OYZA 3F57A 4U72A 1D0ZA 4ZS2A 3ETVA 3KBTA 3KBUA 5KDMC 4XAXB 2XAGB 3BQKA 4GIWA 5L3DB 3HI2A 2XAJB 3OJAA 4OFZA 4EB6E 4B6XA 4TX5A 3HKCE 3HR0A 1UX4A 4HN9A 2EHOD 2G0UA 3LK2B 2CE7A 4H63H 3OBVE 5IYZE 2VASA 4NUVA 5LG4A 2CLYC 1MNDA 4O4JE 2A3DA 3RKOA 2XHEB 5DQWA 4GYSA 3UTKA 3CKDA 1WYCA 3FBLA 3R84B 4A56A 2V1DB 3EUHA 5LOVE 3LJCA 5LHHB 3ANWA 3NZPA 1G8XA 3MA9A 3DJBA 3S4UA 2ZLYA 1QSDA 1D1AA 2KINB 4UVBB 5ETWA 3KVBA 1US7B 2X9XA 3WAKA 2KXPB 3ZMUB 2QA7A 2YU2A 2MBGA 3RRCA 3UUMA 2NW8A 2NTXA 3B13A 2CCQA 4EXTA 3M65A 4ZI3D 2WWUA 3ZC1A 1HF8A 3ZJ1A 3IEEA 5LJNA 2LSJA 3ONXA 3PUQA 3J7Yq 3PU8A 4FJOA 1G73A 3Q9DA 3ZEFB 3I0OA 4YFSA 3P7IA 1HX8A 1Z0PA 2D2SA 2DCFA 2KWIB 4C90A 2L8KA 2NW9A 4U74A 4YLHA 3C51A 4PJMA 2Q9QA 3PUGA 5KX5E 2X9YA 1YW0A 2JRKA 3K3QC 4PFPA 5FNVE 4DBRA 5LJMA 3N2OA 3O9XA 2X66A 5HWXA 2P9BA 4CI2B 2NTYA 3V5SA 2A72A 5JQGE 3B57A 4CXWA 2KMFA 3AVSA 2LOPA 4HKAA 1UCUA 3KV4A 2N1GA 4NUUA 4BA9A 1BR0A 4K0UA 2X67A 4G2AA 5EK2A 3CX7B 3C4ZA 2VK9A 3VHLA 2VKJA 3CVRA 3H37A 4OYKA 3ZCIA 4AQFA 4E7ZA 4CZZB 2LHRA 4IE6A 4CXXA 5DABA 5BMVE 1D1BA 4ZS3A 2N9DA 2V26A 2XAFB 3ETUA 3QK6A 3RX6A 3J9X1 4ANJA 2V7JA 3ANWB 3FB2A 4P0BA 2ZM0A 3ZMZB 4ISTA 4KP3C 4BJNA 4PJNA 4PK5A 5FXVA 4CXYA 4JEUB 4DVDA 2WSSV 3C64A 2NW7A 2V7IA 3V5UA 4IDZA 2LOSA 5AFUL 3MJXA 2LSGA 1MMNA 3AAAB 5HAXA 4OK0A 4AI6A 1IJ5A 3ESLA 4GK0E 4EOZB 4F6RC 2CM0A 2IAKA 3GWHA 2LT3A 4L0RA 4H9QC 2KT9A 1U4QA 2H7OA 3P8CD 2CXFA 2LM9A 4P09A 3HKEE 3LK42 4DMVA 5JR9B 4BAYB 1V9DA 5H6QB 4PNIA 3ZMSB 4O8SA 3NRYA 5EK3A 5ADXL 1SHZC 3PU3A 1YKEB 3C98B 5FY0A 4UV8B 4QX7B 1AJ3A 5LGUB 2I59A 2KZ7B 2Z6EA 1MMAA 2LHNA 1NAFA 2K48A 4QWNB 5LHIB 4P0AA 1WYBA 4OYJA 1MIVA 3U78A 4PW8A 5L2LA 3BQIA 3RC8A 4EYYR 1OWAA 4HEAA 2YK0A 5JRCA 2E9XD 3N9OA 3RYCE 2E9XA 2DNXA 2X51A 3K3NA 2A2FX 4PFOA 4MLKA 4PJJA 4ASKA 2LSKA 4AQFC 3KFWX 5LHGB 2CMRA 5FY7A 1HCIA 3VKHA 3ZPOA 3ZMVB 2LSIA 4EZ4A 3UFEA 2X9WA 3UUXB 4C91A 4PK4A 2DI4A 4BJMA 3O1IA 5FY1A 2CWOA 5CA0E 3N9NA 3HL6A 4TZ4C 4QXCB 3I1AA 3MK7C 2MOZA 2WMOA 4M1PA 4I43B 4ADZA 3RC3A 2Q9QB 3LG7A 4TUYE 1LKXA 2L3LA 1WLXA 1WR6A 3N9QA 1UX5A 3R6NA 4AKHA 3OKQA 1S94A 3CQGB 3T8OA 1HFAA 2ES0A 3Q5XA 2BZBA 5LCYA 3L09A 3K3OA 2XASB 5LYJE 5LP6E 2MTQA 3RYHE 4JUYA 3I9WA 1D1CA 1IAPA 2LEHA 5JR9C 2VKDA 2D5UA 4JEHB 2PBIA 4AKIA 1D0YA 3CX6B 5E0OA 3PUAA 4MHCA 3O1HA 3FBZA 2C5JA 3LK3B 5JH7E 3AB3B 3L3PA 1T98A 4IGUA 4I4TE 1KNZA 3ZN0B 5JDLA 4EYUA 4YJ3E 2V7KA 3IBPA 4UV9B 4DMWA 2CXDA 2VWAA 3I0QA 1MMDA 4MALA 5JRCB 5FXZA 2HH7A 4ZI3C 1BR2A 1EZ3A 2UXXB 3K8PC 4GYRA 3ZYKA 4CI3B 3AA1B 2VKOA 5C8YE 1MMGA 2K9AA 5L3EB 2V7MA 4Z8XA 4O2BE 5F3JA 2WBLA 3EDUA 3NBXX 3NRXA 2DWGA 3GMIA 1QUUA 2KWHA 3ZMTB 4X1IE 5HYAA 4QHOA 3PURA 1HS7A 3AA6B 4EZHA 5FP3A 2DWKA 1HTJF 2W0GA 3IF8B 5A1LA 3SS1A 3O4XE 3TKLB 2XTLA 5JDFA 2CWYA 5FYMA 5DQVA 3SOLA 3AA0B 4AKGA 5HXRA 2CA5A 2ACXA 2Y48B 3JC6C 3MXZA 3PDYA 4ZI7E 4ISSA 3IHRA 3HKBE 4UF0B 4X1YE 2LSYA 4O4HE 4UVAB 4IE4A 2WAUA 3RH3A 4X1KE 2EHOC 4H9RC 5H6RB 1FIOA 2J1DG 5HXEA 4IE0A 3GA8A 3N2KE 2XAQB 3MKDA 2E8IA 4H9OC 2H3RA 4H9NC 4PJLA 1CUNA 3EDVA 3LBXB 2VKHA 3RRWA 5GONE 3PTRB 2RP4A 1H7CA 2SPCA 5HXCA 4QXHB 3RYFE 2CEAA 4GOUA 2K24A 2PFVA 2K5BB 3WI3A 3F2EA 4GK5E 1SA0E 1MIYA 2DLRA 2KNDA 3C50A 3MACA 5CB4E 3VKGA 2E9XB 4IIJE 3HKDE 4EIWA 5LBMA 3UULA 2XUEA 1MIWA 4KMCA 3BQLA 1X79A 3F31A 4UEMA 2KLQA 4O2AE 3AVRA 4DO0A 5HXHA 2HPJA 3KVAA 4L5GA 2V7LA 3FXDB 3Q5WA 2ODUA 2ZM2A 1LVFA 3AA7B 4MBQA 4TV9E 4DNDA 1ZKEA 3UT5E 4DBQA 4ERRA 5L3CB 3N2GE 4ILUA 5JDQA 4MFRA 3VU7H 2C5KT 3KDSE 1LRZA 2OA5A 4ZHQE 2Q9QD 4ZI2D 3ZCJA 4UF0A 1VRBA 4XBFB 4PK6A 2M67A 2YU1A 2IW5B 3AAEB 5LGNB 1HG2A 1LVKA 3LFMA 3N9LA 3D0TA 1ZHCA 4WW0A 3CPZA 3U3IA 1HG5A 5L3BB 5IHYA 3ZC0A 2B1EA 3GN5A 4CQIA 2MYSA 4UVCB 2LJLA 2W63A 4JLEA 5J1GA 3RPUA 4HTEA 1OXZA 5LBQB 4IE7A 2ODVA 5JDGA 1IJ6A 2VL8A 4OHFA 2DHRA 5J2TE 4I50E 3KV6A 3UUNA 5LXTE 2NP9A 4H9PC 3A5XA 2JMHA 3ZN1B 4AXPA 3BK9A 3H3AA 2EHOB 3CQXC 2D0TA 2W61A 2L9QA 4N78D 2BVMA 2BDEA 4L9IA 2WM9A 2PG8A 1MNEA 4TV8E 2JMKA 2N2NA 4H9SE 5CA1E 2JPFA 2JJ9A 3N9PA 5FXWA 3WAJA 4KUMB 3OYXA 3I9YA 2YINA 3FXEB 2IC9A 4X20E 3KINB 2VB6A 3MZKB 5JDNA 1ZV4X 1VOMA 4QXBB 2JQQA 4UELA 4J2CA 1Y64B 3E22E 4HE8A 3ZYMA 2GK9A 2IC6A 2H7VC 5JDMA 1BR4A 3CX8B 5L3FB 3EVYA 3E08A 1U5PA 1YKHB 1WRDA 4HGAA 4AQGA 4CI1B 3KV9A 4YJ2E 5JDHA 4IHJE 5EZYE 1D0XA 1FMWA 5KMGP 3QUJA 3NZQA 1YD8G 4V1Av 4XZCA 3N9MA 2XAHB 3DP7A 3E0ZA 1E1HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBL A;  3F2E A;  3J9X 1;  3FBZ A; 
#chains in the Genus database with same CATH topology
 1S35 A;  3RIA A;  4ZEY A;  2XQY A;  2EHO A;  3L8R A;  5HXS A;  3DTO A;  2CLY B;  2FJD A;  4O4L E;  4FI5 A;  1BR1 A;  3EAB A;  3W15 B;  5TAO A;  2UXC T;  4K0K T;  5LA6 E;  5C3J A;  4LF4 T;  1O3X A;  1T7S A;  5AQG B;  3ZJ2 A;  2W62 A;  4UXN B;  4O4I E;  2I6H A;  2ZMA A;  2KSR A;  2VUR A;  3EAM A;  5HWY A;  4EEB A;  4IL9 A;  5J2U E;  5FXX A;  2CRB A;  1ZEE A;  4YT0 A;  1HNZ T;  2C5I T;  1OED C;  3AAI A;  1KK7 A;  5JR9 A;  4AKL A;  4HWC A;  2XY8 B;  4LF5 T;  1YXR A;  5JVD E;  4U2Y A;  4ZI2 C;  4I55 E;  4YHJ A;  4CI3 B;  1NWM X;  3O1J A;  4DV6 T;  1W0B A;  2C0S A;  2X68 A;  2Y8D A;  4IE5 A;  2BBJ A;  2E2A A;  2XPK A;  3AE9 A;  4WNK A;  4KBM B;  3ZYL A;  2W00 A;  1FMV A;  5LNK A;  1IZN B;  3CQC B;  3HA4 A;  3RYI E;  2FJA A;  1FEW A;  3P4S A;  3CWZ B;  5F8P A;  4LFB T;  2CXL A;  5M4Y A;  2IIU A;  4H63 V;  3PUS A;  3CML A;  3GN5 B;  3N5L A;  4QKN A;  3FHN A;  5EK4 A;  3QC9 A;  3SFE A;  2UXN B;  5DJQ C;  2XQ6 A;  4HFV A;  3C4W A;  3SWH A;  3SRZ A;  3Q2M A;  2V5C A;  1I6Z A;  2LKH A;  5AQK B;  2E9X C;  2WS3 A;  2WMN A;  2X9H A;  2BKN A;  3C4X A;  2ACZ A;  3JC6 D;  3AE7 A;  3PE0 A;  4QX8 B;  4TN7 B;  2ZM8 A;  2NWB A;  5AQF B;  4WBO A;  4HFE A;  4ZOL E;  5L3G B;  2JIW A;  2XJ7 A;  3KV5 A;  2LE8 A;  4UIG A;  2XSA A;  4PAG A;  5FMN A;  2X0L B;  4E7S A;  5LGT B;  2QGS A;  3LBX A;  1L0V A;  2NOX A;  2BVL A;  2RA1 A;  4XBF B;  2D0U A;  2FJB A;  2Q9Q C;  4G63 A;  2LRL A;  4WBN E;  2VVS A;  2XQ9 A;  2YKS A;  2HPL A;  5AQJ B;  3ZLI A;  1B7T A;  2OV9 A;  5F5W A;  4EAH A;  4EV6 A;  2YEV C;  1UUS A;  2PJQ A;  2Y6X A;  5AQT B;  4AKR B;  3OYZ A;  3F57 A;  4YTM A;  5CJ5 A;  2VVN A;  4YSZ A;  2PTF A;  4U72 A;  1D0Z A;  4ZS2 A;  3ETV A;  3KBT A;  3KBU A;  3ZKR A;  5KDM C;  4XAX B;  2XAG B;  1NEN A;  3BQK A;  3ONL C;  4GIW A;  5L3D B;  3HI2 A;  4DV1 T;  1JNZ A;  4X65 T;  2YOE A;  2XAJ B;  3OJA A;  5C8Y E;  4OFZ A;  3AED A;  4EB6 E;  4B6X A;  2K3W A;  4TX5 A;  4DR5 T;  2B76 A;  2WDV A;  3AEE A;  3HKC E;  3HR0 A;  4WYV A;  2XZE A;  5ABH A;  2UXD T;  2AE9 A;  1UX4 A;  4HN9 A;  4Q25 A;  2EHO D;  3ZST A;  2G0U A;  3LK2 B;  2CE7 A;  4H63 H;  2RPA A;  5JRE A;  3OBV E;  5IYZ E;  2BG9 B;  2VAS A;  4NUV A;  4HFB A;  2WWV A;  2CLY C;  3PUW F;  5LG4 A;  1MND A;  5AQU B;  4EED A;  4O4J E;  2A3D A;  3RKO A;  2XHE B;  5DQW A;  4GYS A;  3UTK A;  3CKD A;  1WYC A;  3FBL A;  3TLS A;  2BS2 A;  4JI0 T;  4B3M T;  3R84 B;  4COF A;  4A56 A;  4ILA A;  2V1D B;  3EUH A;  5LOV E;  3OPC A;  3VRA A;  4NIQ A;  3LJC A;  2LM2 A;  3ANW A;  3UU8 A;  3NZP A;  5LHH B;  1G8X A;  1N36 T;  3MA9 A;  3DJB A;  4DUY T;  1KNR A;  3S4U A;  3AEB A;  2ZLY A;  4DV2 T;  1QSD A;  5CFB A;  4U31 A;  3CIR A;  1D1A A;  2KIN B;  4UVB B;  5ETW A;  1SUM B;  2XSB A;  3KVB A;  4B3T T;  1US7 B;  1XZY A;  2X9X A;  3AE6 A;  3P4R A;  3WAK A;  2KXP B;  3ZMU B;  4JI3 T;  2QA7 A;  3A8Y C;  2YU2 A;  2MBG A;  1N33 T;  3VR9 A;  1JNR A;  2XQA A;  3JCF A;  2NW8 A;  2NTX A;  3RRC A;  3B13 A;  3UUM A;  2CCQ A;  2CHN A;  4EXT A;  3M65 A;  3JAE A;  4Z90 A;  4ZI3 D;  2FJE A;  2BG9 C;  2WWU A;  3ZC1 A;  1HF8 A;  3ZJ1 A;  3PJA A;  3IEE A;  5LJN A;  2LSJ A;  3ONX A;  3PUQ A;  3J7Y q;  3PU8 A;  4FJO A;  1HNX T;  1G73 A;  1X9B A;  3Q9D A;  1ZP0 A;  4CN4 A;  3ZEF B;  3I0O A;  4YFS A;  4DUZ T;  4NXN T;  2JQ9 A;  3P7I A;  1HX8 A;  4EOZ B;  1Z0P A;  2D2S A;  2DCF A;  2KWI B;  4C90 A;  4YSY A;  4A5X A;  2L8K A;  2WU5 A;  5L4E A;  2NW9 A;  4U74 A;  4YLH A;  3C51 A;  4PJM A;  2FBW A;  2Q9Q A;  3PUG A;  5KX5 E;  1UGO A;  2LKG A;  2X9Y A;  4HFH A;  1N32 T;  1YW0 A;  2JRK A;  3K3Q C;  3PUV F;  4IDO A;  4PFP A;  2XQ7 A;  4TWH A;  5FNV E;  3RI5 A;  4DBR A;  5LJM A;  1XWM A;  1UK5 A;  2QVA A;  4HWH A;  3N2O A;  3O9X A;  2X66 A;  4CN1 A;  2P9B A;  5HWX A;  4CI2 B;  2NTY A;  3RLF F;  3V5S A;  2A72 A;  5JQG E;  4NXM T;  3B57 A;  3PUY F;  3TLT A;  4CXW A;  2KMF A;  2WB5 A;  3AVS A;  2LOP A;  4HKA A;  1UCU A;  3KV4 A;  2N1G A;  4NUU A;  4BA9 A;  4DV7 T;  1BR0 A;  4K0U A;  2X67 A;  2WDR A;  2HN2 A;  4G2A A;  2BBH A;  5EK2 A;  3CX7 B;  3C4Z A;  5FL1 A;  2VK9 A;  3VHL A;  2VKJ A;  3CVR A;  3H37 A;  4OYK A;  3ZCI A;  4AQF A;  4TWF A;  4E7Z A;  4CZZ B;  5LMU T;  2LHR A;  4IE6 A;  4CXX A;  5DAB A;  5BMV E;  2V6Y B;  1D1B A;  4ZS3 A;  2N9D A;  1Z8U A;  2V26 A;  2XAF B;  1HX1 B;  3ETU A;  3QK6 A;  3AXJ A;  1OED A;  3RX6 A;  4ZZC A;  3J9X 1;  4ANJ A;  2V7J A;  3ANW B;  1E2A A;  1R8I A;  4YSX A;  3FB2 A;  4WZX A;  4P0B A;  3P4W A;  5ABF A;  2W67 A;  5KXJ A;  2ZM0 A;  3ZMZ B;  4IST A;  4KP3 C;  3TLU A;  3A7M A;  4BJN A;  4PJN A;  4PK5 A;  5FXV A;  1XNR T;  2VQF T;  1WCR A;  3IA3 A;  4JEU B;  5AQP B;  5C2T A;  4DVD A;  4CXY A;  2WSS V;  3AEA A;  2NW7 A;  3C64 A;  2V7I A;  3V5U A;  3G06 A;  4IDZ A;  2H88 A;  2LOS A;  5AFU L;  3MJX A;  2DL1 A;  4JI6 T;  4GKK T;  2WQY A;  3Q5D A;  2LSG A;  4LF6 T;  1MMN A;  3AAA B;  4JBW F;  3PUZ F;  2XM2 A;  5HAX A;  4OK0 A;  4ZI3 C;  1W09 A;  4AI6 A;  1IJ5 A;  3CK6 A;  3ESL A;  1GQE A;  2YN6 A;  2IDO B;  2CM0 A;  2IAK A;  3GWH A;  4GK0 E;  3VR8 A;  4JI2 T;  4ZZB A;  2LT3 A;  4L0R A;  1YQ4 A;  4H9Q C;  4JI4 T;  2KT9 A;  1U4Q A;  2A9U A;  2H7O A;  2CXF A;  3P8C D;  2LM9 A;  4P09 A;  3HKE E;  3LK4 2;  4U33 A;  4UR9 A;  4DMV A;  5JR9 B;  4BAY B;  2VQE T;  1V9D A;  2CBJ A;  4TWD A;  5H6Q B;  4PNI A;  5L4H A;  4JI5 T;  3ZMS B;  4O8S A;  3NRY A;  5EK3 A;  5ADX L;  3VRB A;  3UQ7 A;  4U2Z A;  1SHZ C;  3T1H T;  3FZK B;  3PU3 A;  1YKE B;  1HR0 T;  4IDQ A;  4A98 A;  3C98 B;  5FY0 A;  4UV8 B;  4QH5 A;  4QX7 B;  4X62 T;  1AJ3 A;  5LGU B;  5L47 A;  2I59 A;  4DV5 T;  2KZ7 B;  2AXD S;  2Z6E A;  1MMA A;  5BR8 T;  2LHN A;  1NAF A;  2K48 A;  2CPT A;  5LB7 B;  4QWN B;  5LHI B;  3ABV A;  1WYB A;  4ZXL A;  1XMO T;  4OYJ A;  4P0A A;  1MIV A;  3U78 A;  4EGW A;  4PW8 A;  1ZOY A;  3BQI A;  5L2L A;  3RC8 A;  4EYY R;  1CHU A;  1OWA A;  2JQK A;  2YK0 A;  4HEA A;  4HWD A;  5ABF B;  4JI7 T;  2E9X D;  3N9O A;  3RYC E;  4JI8 T;  5JRC A;  2E9X A;  4AIU A;  5HEO A;  2DNX A;  2X51 A;  3K3N A;  2A2F X;  4PFO A;  3OVU A;  4MLK A;  1SE7 A;  4PJJ A;  4ASK A;  2V8S V;  2MPK A;  2LSK A;  4AQF C;  3AE5 A;  3KFW X;  5LHG B;  4GKJ T;  2CMR A;  3ZT5 A;  2XQ4 A;  2CHO A;  5FY7 A;  1HCI A;  1M7K A;  3NWI A;  3VKH A;  2MAW A;  1UUR A;  3ZPO A;  3ZMV B;  2LSI A;  4EZ4 A;  2WDQ A;  3UFE A;  2X9W A;  3UUX B;  4C91 A;  4DV0 T;  4PK4 A;  3PJA J;  2DI4 A;  2I0M A;  2W4X A;  3ZT7 A;  3O1I A;  4BJM A;  5FY1 A;  2CWO A;  5CA0 E;  3N9N A;  2WU2 A;  3HL6 A;  4TZ4 C;  2BS3 A;  4QXC B;  3QOF A;  3I1A A;  3MK7 C;  1KNP A;  2MOZ A;  2WMO A;  4M1P A;  4I43 B;  4ADZ A;  4QH4 A;  2OLT A;  1KEY A;  3RC3 A;  2Q9Q B;  4A97 A;  3LG7 A;  5ABE A;  4TUY E;  3AE4 A;  1LKX A;  2L3L A;  1WLX A;  1WR6 A;  3N9Q A;  1OED E;  1UX5 A;  3R6N A;  2V6Y A;  3RQW A;  3OKQ A;  4AKH A;  1S94 A;  3QB5 K;  4YHH T;  3CQG B;  3T8O A;  4HWI B;  4IDN A;  1HFA A;  2ES0 A;  3Q5X A;  5IUX A;  4LF9 T;  2BZB A;  3PV0 F;  5LCY A;  2V6X A;  4OX9 T;  1WFD A;  3K3O A;  3L09 A;  2QYW A;  2XAS B;  3FZF B;  2J47 A;  2YDR A;  2H89 A;  5LYJ E;  5HEU A;  5LP6 E;  2MTQ A;  3RYH E;  4JUY A;  4DR6 T;  3I9W A;  1D1C A;  1IAP A;  2IUB A;  2LEH A;  5JR9 C;  3NVO A;  2UUC T;  2VKD A;  5HEJ A;  2D5U A;  4JV5 T;  4JEH B;  2PBI A;  2D9D A;  4AKI A;  1D0Y A;  3CX6 B;  5E0O A;  3PUA A;  4MHC A;  3O1H A;  3FBZ A;  2C5J A;  3LK3 B;  5JH7 E;  3AB3 B;  1WR0 A;  4LFA T;  3AEC A;  4U3C A;  3L3P A;  1T98 A;  1YQ3 A;  4IGU A;  4I4T E;  4U7I A;  1KNZ A;  3ZN0 B;  5JDL A;  4EYU A;  4YJ3 E;  2V7K A;  3IBP A;  4UV9 B;  1J1J A;  3RIU C;  1E7P A;  4DR7 T;  4DMW A;  2CXD A;  2VWA A;  3I0Q A;  1MMD A;  4MAL A;  4DR4 T;  5JRC B;  1OED B;  2LRK A;  2YDS A;  4P1N A;  2HH7 A;  5FXZ A;  3LSV A;  1BR2 A;  1EZ3 A;  2BKP A;  2UXX B;  3K8P C;  4GYR A;  5AQI B;  3AA1 B;  2VKO A;  3M3Z B;  1MMG A;  3UUB A;  3ZYK A;  2K9A A;  5CGM A;  5L3E B;  2V7M A;  4X66 T;  4AQY T;  2F4V T;  4Z8X A;  4O2B E;  3AE2 A;  2WBL A;  3EDU A;  5F3J A;  3UFG A;  3NBX X;  3NRX A;  2BG9 A;  2DWG A;  2XQ3 A;  2X0Y A;  1QUU A;  3GMI A;  2KWH A;  5AQL B;  3ZMT B;  1HNW T;  4X1I E;  2BG9 E;  4LMJ A;  5HYA A;  3EHZ A;  4QHO A;  5HEH A;  3PUR A;  4DV4 T;  1HS7 A;  3TLV A;  3AE3 A;  3AA6 B;  1FJG T;  2WZH A;  4EZH A;  3AEF A;  5FP3 A;  5AQO B;  5ABG A;  2DWK A;  1HTJ F;  2W0G A;  3IF8 B;  3B5M A;  5A1L A;  3FZL B;  4KI0 F;  3SS1 A;  3O4X E;  3TKL B;  4ILC A;  2BS4 A;  4B3R T;  1IBM T;  2XTL A;  5JDF A;  2CWY A;  5FYM A;  5DQV A;  1KF6 A;  3SOL A;  3RKG A;  3AA0 B;  3AEG A;  4TNV A;  4AKG A;  5HXR A;  3RIU A;  2CA5 A;  2ACX A;  2Y48 B;  3JC6 C;  3MXZ A;  3P4Q A;  3PDY A;  4ZI7 E;  4HFD A;  4ISS A;  3IHR A;  4KHP T;  3HKB E;  1NEK A;  4UF0 B;  4X1Y E;  2LSY A;  4O4H E;  4UVA B;  4IE4 A;  2WAU A;  3RH3 A;  4TNW A;  4X1K E;  2EHO C;  4H9R C;  5H6R B;  2UUA T;  2WY2 A;  1XDO A;  1FIO A;  4IT4 A;  2J1D G;  5HXE A;  1W9R A;  4IE0 A;  4B3S T;  3GA8 A;  4YXD A;  3N2K E;  2XAQ B;  3MKD A;  2E8I A;  4H9O C;  3FZH B;  4Z91 A;  2H3R A;  4H9N C;  4PJL A;  1CUN A;  3EDV A;  5JTG A;  3LBX B;  5AQV B;  2VKH A;  3RRW A;  4YTN A;  5GON E;  2IHR 1;  3PTR B;  2WCA A;  5AQH B;  2RP4 A;  1H7C A;  4LF7 T;  2SPC A;  5HXC A;  2X0H A;  4QXH B;  2WZI A;  4AIS A;  3RYF E;  2CEA A;  4GOU A;  2K24 A;  2PFV A;  2K5B B;  3ZT6 A;  1M62 A;  3ZSS A;  4DID B;  4DV3 T;  4DR3 T;  3WI3 A;  3F2E A;  4GK5 E;  2IML A;  5J0Z A;  1SA0 E;  1MIY A;  2DLR A;  2KND A;  3C50 A;  3MAC A;  4KX6 A;  5CB4 E;  4F6R C;  2E9X B;  3FZM B;  3VKG A;  5HCM A;  4IIJ E;  3HKD E;  5AQM B;  4EIW A;  2J4G A;  5LBM A;  3UUL A;  2XUE A;  1MIW A;  4X64 T;  4KMC A;  2XM1 A;  3BQL A;  1X79 A;  3F31 A;  4HFC A;  4LF8 T;  3SFD A;  1I94 T;  4UEM A;  2KLQ A;  2QRX A;  4O2A E;  3P50 A;  2W66 A;  3AVR A;  4DO0 A;  5HXH A;  2HPJ A;  4DR1 T;  3KVA A;  3LDQ B;  4L5G A;  2V7L A;  1W0A A;  3FXD B;  4IL4 A;  3RF1 A;  3Q5W A;  1QLB A;  2ODU A;  1LVF A;  2ZM2 A;  3AA7 B;  4MBQ A;  4TV9 E;  5LMN T;  2UUB T;  1XDP A;  1ZKE A;  3UT5 E;  4DND A;  4DBQ A;  4ERR A;  5L3C B;  3N2G E;  4U7Y A;  5FL0 A;  4ILU A;  4LMK A;  2UU9 T;  5JDQ A;  3L39 A;  3Q5E A;  1VCS A;  4MFR A;  3VU7 H;  1IBL T;  4LML A;  2C5K T;  3KDS E;  1T72 A;  1LRZ A;  1T8B A;  2OA5 A;  2XQ8 A;  3X1D A;  2Q9Q D;  4ZHQ E;  4ZI2 D;  3ZCJ A;  3NKZ A;  3AE8 A;  3AE1 A;  4HFI A;  4UF0 A;  1VRB A;  1KFY A;  5AQR B;  4IRE A;  4PK6 A;  2M67 A;  2YU1 A;  2IW5 B;  3AAE B;  5LGN B;  1HG2 A;  2HHH T;  1LVK A;  5IWA T;  3LFM A;  2FUP A;  3N9L A;  4LFC T;  3D0T A;  1ZHC A;  2M6B A;  4WW0 A;  1XNQ T;  1J5E T;  3CPZ A;  2YDQ A;  3RIF A;  1HG5 A;  3U3I A;  5L3B B;  5IHY A;  3ZC0 A;  2B1E A;  3GN5 A;  4CQI A;  2MYS A;  3QNU A;  1N34 T;  4JYA T;  4UVC B;  2LJL A;  2W63 A;  4JLE A;  5HCJ A;  5J1G A;  3RPU A;  3UU3 A;  4HTE A;  3RGL A;  1OXZ A;  5LBQ B;  4IE7 A;  2WP9 A;  2XQ5 A;  2UXB T;  2ODV A;  5JDG A;  1IJ6 A;  2VL8 A;  2VL0 A;  4KHZ F;  3JAF A;  4QH1 A;  4X5T A;  4OHF A;  4HWF A;  2DHR A;  5J2T E;  5FVL A;  2E5V A;  3EI0 A;  3KV6 A;  4I50 E;  3UUN A;  1XMQ T;  3UQ4 A;  2E5L T;  5LXT E;  2NP9 A;  4H9P C;  3RHW A;  3A5X A;  1Y01 A;  2J62 A;  2JMH A;  3ZN1 B;  4IDP A;  3OTO T;  4JI1 T;  2V5D A;  4AXP A;  3BK9 A;  4YTP A;  3H3A A;  4YY3 T;  3H3M A;  2M6I A;  2EHO B;  3CQX C;  2D0T A;  2ZM6 T;  4ILB A;  2W61 A;  2L9Q A;  4N78 D;  2BVM A;  2BDE A;  3UU4 A;  4L9I A;  1DU2 A;  2WM9 A;  2PG8 A;  1MNE A;  4TV8 E;  2CBI A;  3UU6 A;  2JMK A;  2N2N A;  4H9S E;  2HN1 A;  3JAD A;  5CA1 E;  2JPF A;  2JJ9 A;  3N9P A;  4CN6 A;  5FXW A;  2BKO A;  3P4P A;  3WAJ A;  2NR4 A;  4KUM B;  5LG3 A;  3OYX A;  3PUX F;  3I9Y A;  2YIN A;  3ONJ A;  3FXE B;  2IC9 A;  4NPP A;  4DR2 T;  1VCT A;  4X20 E;  3KIN B;  3AXJ B;  2VB6 A;  3MZK B;  3T1Y T;  5JDN A;  1ZV4 X;  1VOM A;  3K1S A;  4QXB B;  3QB5 A;  5HEG A;  3TLW A;  2JQQ A;  4UEL A;  5AQQ B;  1J5W A;  2JQH A;  2R6G F;  4J2C A;  1Y64 B;  3E22 E;  3UU5 A;  4HE8 A;  3ZYM A;  2GK9 A;  2IC6 A;  5AQN B;  5AQS B;  4F8H A;  2H7V C;  5JDM A;  1BR4 A;  3CX8 B;  1IBK T;  5L3F B;  3EVY A;  3E08 A;  3RQU A;  1U5P A;  1YKH B;  1WRD A;  4HGA A;  4AQG A;  4I0U A;  3KV9 A;  4YJ2 E;  4CI1 B;  5JDH A;  4IHJ E;  5EZY E;  1D0X A;  1FMW A;  5KMG P;  2W2U A;  3QUJ A;  3NZQ A;  1YD8 G;  4V1A v;  4XZC A;  3N9M A;  5FKY A;  2LLY A;  2XAH B;  3DP7 A;  3E0Z A;  1E1H B;  5FVK A; 
#chains in the Genus database with same CATH homology
 1S35 A;  2XQY A;  2EHO A;  5HXS A;  3DTO A;  2CLY B;  4O4L E;  4FI5 A;  1BR1 A;  3W15 B;  5TAO A;  5LA6 E;  1O3X A;  3ZJ2 A;  2W62 A;  4UXN B;  4O4I E;  2ZMA A;  5HWY A;  5J2U E;  5FXX A;  1ZEE A;  2C5I T;  3AAI A;  4AKL A;  1KK7 A;  5JR9 A;  5JVD E;  4ZI2 C;  4I55 E;  4YHJ A;  1NWM X;  3O1J A;  2C0S A;  2X68 A;  2Y8D A;  4IE5 A;  4WNK A;  3ZYL A;  4KBM B;  2W00 A;  1FMV A;  5LNK A;  1IZN B;  3CQC B;  3HA4 A;  3RYI E;  1FEW A;  5F8P A;  3CWZ B;  2CXL A;  5M4Y A;  4H63 V;  3PUS A;  3CML A;  3GN5 B;  3N5L A;  4QKN A;  3FHN A;  5EK4 A;  3QC9 A;  5JRE A;  2UXN B;  5DJQ C;  3SWH A;  4HFV A;  3C4W A;  3SRZ A;  3Q2M A;  2E9X C;  2X9H A;  2WMN A;  3C4X A;  3JC6 D;  3PE0 A;  4QX8 B;  4TN7 B;  2ZM8 A;  2NWB A;  4WBO A;  4ZOL E;  5L3G B;  4UIG A;  3KV5 A;  2LE8 A;  5FMN A;  5LGT B;  4PAG A;  4E7S A;  2X0L B;  2QGS A;  3LBX A;  2NOX A;  2BVL A;  2RA1 A;  2D0U A;  2Q9Q C;  4G63 A;  4WBN E;  2HPL A;  4EAH A;  3ZLI A;  1B7T A;  2YEV C;  2PJQ A;  2Y6X A;  4AKR B;  3OYZ A;  3F57 A;  4U72 A;  1D0Z A;  4ZS2 A;  3ETV A;  3KBT A;  3KBU A;  5KDM C;  4XAX B;  2XAG B;  3BQK A;  4GIW A;  5L3D B;  3HI2 A;  2XAJ B;  3OJA A;  4OFZ A;  4EB6 E;  4B6X A;  4TX5 A;  3HKC E;  3HR0 A;  1UX4 A;  4HN9 A;  2EHO D;  2G0U A;  3LK2 B;  2CE7 A;  4H63 H;  3OBV E;  5IYZ E;  2VAS A;  4NUV A;  5LG4 A;  2CLY C;  1MND A;  4O4J E;  2A3D A;  3RKO A;  2XHE B;  5DQW A;  4GYS A;  3UTK A;  3CKD A;  1WYC A;  3FBL A;  3R84 B;  4A56 A;  2V1D B;  3EUH A;  5LOV E;  3LJC A;  5LHH B;  3ANW A;  3NZP A;  1G8X A;  3MA9 A;  3DJB A;  3S4U A;  2ZLY A;  1QSD A;  1D1A A;  2KIN B;  4UVB B;  5ETW A;  3KVB A;  1US7 B;  2X9X A;  3WAK A;  2KXP B;  3ZMU B;  2QA7 A;  2YU2 A;  2MBG A;  3RRC A;  3UUM A;  2NW8 A;  2NTX A;  3B13 A;  2CCQ A;  4EXT A;  3M65 A;  4ZI3 D;  2WWU A;  3ZC1 A;  1HF8 A;  3ZJ1 A;  3IEE A;  5LJN A;  2LSJ A;  3ONX A;  3PUQ A;  3J7Y q;  3PU8 A;  4FJO A;  1G73 A;  3Q9D A;  3ZEF B;  3I0O A;  4YFS A;  3P7I A;  1HX8 A;  1Z0P A;  2D2S A;  2DCF A;  2KWI B;  4C90 A;  2L8K A;  2NW9 A;  4U74 A;  4YLH A;  3C51 A;  4PJM A;  2Q9Q A;  3PUG A;  5KX5 E;  2X9Y A;  1YW0 A;  2JRK A;  3K3Q C;  4PFP A;  5FNV E;  4DBR A;  5LJM A;  3N2O A;  3O9X A;  2X66 A;  5HWX A;  2P9B A;  4CI2 B;  2NTY A;  3V5S A;  2A72 A;  5JQG E;  3B57 A;  4CXW A;  2KMF A;  3AVS A;  2LOP A;  4HKA A;  1UCU A;  3KV4 A;  2N1G A;  4NUU A;  4BA9 A;  1BR0 A;  4K0U A;  2X67 A;  4G2A A;  5EK2 A;  3CX7 B;  3C4Z A;  2VK9 A;  3VHL A;  2VKJ A;  3CVR A;  3H37 A;  4OYK A;  3ZCI A;  4AQF A;  4E7Z A;  4CZZ B;  2LHR A;  4IE6 A;  4CXX A;  5DAB A;  5BMV E;  1D1B A;  4ZS3 A;  2N9D A;  2V26 A;  2XAF B;  3ETU A;  3QK6 A;  3RX6 A;  3J9X 1;  4ANJ A;  2V7J A;  3ANW B;  3FB2 A;  4P0B A;  2ZM0 A;  3ZMZ B;  4IST A;  4KP3 C;  4BJN A;  4PJN A;  4PK5 A;  5FXV A;  4CXY A;  4JEU B;  4DVD A;  2WSS V;  3C64 A;  2NW7 A;  2V7I A;  3V5U A;  4IDZ A;  2LOS A;  5AFU L;  3MJX A;  2LSG A;  1MMN A;  3AAA B;  5HAX A;  4OK0 A;  4AI6 A;  1IJ5 A;  3ESL A;  4GK0 E;  4EOZ B;  4F6R C;  2CM0 A;  2IAK A;  3GWH A;  2LT3 A;  4L0R A;  4H9Q C;  2KT9 A;  1U4Q A;  2H7O A;  3P8C D;  2CXF A;  2LM9 A;  4P09 A;  3HKE E;  3LK4 2;  4DMV A;  5JR9 B;  4BAY B;  1V9D A;  5H6Q B;  4PNI A;  3ZMS B;  4O8S A;  3NRY A;  5EK3 A;  5ADX L;  1SHZ C;  3PU3 A;  1YKE B;  3C98 B;  5FY0 A;  4UV8 B;  4QX7 B;  1AJ3 A;  5LGU B;  2I59 A;  2KZ7 B;  2Z6E A;  1MMA A;  2LHN A;  1NAF A;  2K48 A;  4QWN B;  5LHI B;  4P0A A;  1WYB A;  4OYJ A;  1MIV A;  3U78 A;  4PW8 A;  5L2L A;  3BQI A;  3RC8 A;  4EYY R;  1OWA A;  4HEA A;  2YK0 A;  5JRC A;  2E9X D;  3N9O A;  3RYC E;  2E9X A;  2DNX A;  2X51 A;  3K3N A;  2A2F X;  4PFO A;  4MLK A;  4PJJ A;  4ASK A;  2LSK A;  4AQF C;  3KFW X;  5LHG B;  2CMR A;  5FY7 A;  1HCI A;  3VKH A;  3ZPO A;  3ZMV B;  2LSI A;  4EZ4 A;  3UFE A;  2X9W A;  3UUX B;  4C91 A;  4PK4 A;  2DI4 A;  4BJM A;  3O1I A;  5FY1 A;  2CWO A;  5CA0 E;  3N9N A;  3HL6 A;  4TZ4 C;  4QXC B;  3I1A A;  3MK7 C;  2MOZ A;  2WMO A;  4M1P A;  4I43 B;  4ADZ A;  3RC3 A;  2Q9Q B;  3LG7 A;  4TUY E;  1LKX A;  2L3L A;  1WLX A;  1WR6 A;  3N9Q A;  1UX5 A;  3R6N A;  4AKH A;  3OKQ A;  1S94 A;  3CQG B;  3T8O A;  1HFA A;  2ES0 A;  3Q5X A;  2BZB A;  5LCY A;  3L09 A;  3K3O A;  2XAS B;  5LYJ E;  5LP6 E;  2MTQ A;  3RYH E;  4JUY A;  3I9W A;  1D1C A;  1IAP A;  2LEH A;  5JR9 C;  2VKD A;  2D5U A;  4JEH B;  2PBI A;  4AKI A;  1D0Y A;  3CX6 B;  5E0O A;  3PUA A;  4MHC A;  3O1H A;  3FBZ A;  2C5J A;  3LK3 B;  5JH7 E;  3AB3 B;  3L3P A;  1T98 A;  4IGU A;  4I4T E;  1KNZ A;  3ZN0 B;  5JDL A;  4EYU A;  4YJ3 E;  2V7K A;  3IBP A;  4UV9 B;  4DMW A;  2CXD A;  2VWA A;  3I0Q A;  1MMD A;  4MAL A;  5JRC B;  5FXZ A;  2HH7 A;  4ZI3 C;  1BR2 A;  1EZ3 A;  2UXX B;  3K8P C;  4GYR A;  3ZYK A;  4CI3 B;  3AA1 B;  2VKO A;  5C8Y E;  1MMG A;  2K9A A;  5L3E B;  2V7M A;  4Z8X A;  4O2B E;  5F3J A;  2WBL A;  3EDU A;  3NBX X;  3NRX A;  2DWG A;  3GMI A;  1QUU A;  2KWH A;  3ZMT B;  4X1I E;  5HYA A;  4QHO A;  3PUR A;  1HS7 A;  3AA6 B;  4EZH A;  5FP3 A;  2DWK A;  1HTJ F;  2W0G A;  3IF8 B;  5A1L A;  3SS1 A;  3O4X E;  3TKL B;  2XTL A;  5JDF A;  2CWY A;  5FYM A;  5DQV A;  3SOL A;  3AA0 B;  4AKG A;  5HXR A;  2CA5 A;  2ACX A;  2Y48 B;  3JC6 C;  3MXZ A;  3PDY A;  4ZI7 E;  4ISS A;  3IHR A;  3HKB E;  4UF0 B;  4X1Y E;  2LSY A;  4O4H E;  4UVA B;  4IE4 A;  2WAU A;  3RH3 A;  4X1K E;  2EHO C;  4H9R C;  5H6R B;  1FIO A;  2J1D G;  5HXE A;  4IE0 A;  3GA8 A;  3N2K E;  2XAQ B;  3MKD A;  2E8I A;  4H9O C;  2H3R A;  4H9N C;  4PJL A;  1CUN A;  3EDV A;  3LBX B;  2VKH A;  3RRW A;  5GON E;  3PTR B;  2RP4 A;  1H7C A;  2SPC A;  5HXC A;  4QXH B;  3RYF E;  2CEA A;  4GOU A;  2K24 A;  2PFV A;  2K5B B;  3WI3 A;  3F2E A;  4GK5 E;  1SA0 E;  1MIY A;  2DLR A;  2KND A;  3C50 A;  3MAC A;  5CB4 E;  3VKG A;  2E9X B;  4IIJ E;  3HKD E;  4EIW A;  5LBM A;  3UUL A;  2XUE A;  1MIW A;  4KMC A;  3BQL A;  1X79 A;  3F31 A;  4UEM A;  2KLQ A;  4O2A E;  3AVR A;  4DO0 A;  5HXH A;  2HPJ A;  3KVA A;  4L5G A;  2V7L A;  3FXD B;  3Q5W A;  2ODU A;  2ZM2 A;  1LVF A;  3AA7 B;  4MBQ A;  4TV9 E;  4DND A;  1ZKE A;  3UT5 E;  4DBQ A;  4ERR A;  5L3C B;  3N2G E;  4ILU A;  5JDQ A;  4MFR A;  3VU7 H;  2C5K T;  3KDS E;  1LRZ A;  2OA5 A;  4ZHQ E;  2Q9Q D;  4ZI2 D;  3ZCJ A;  4UF0 A;  1VRB A;  4XBF B;  4PK6 A;  2M67 A;  2YU1 A;  2IW5 B;  3AAE B;  5LGN B;  1HG2 A;  1LVK A;  3LFM A;  3N9L A;  3D0T A;  1ZHC A;  4WW0 A;  3CPZ A;  3U3I A;  1HG5 A;  5L3B B;  5IHY A;  3ZC0 A;  2B1E A;  3GN5 A;  4CQI A;  2MYS A;  4UVC B;  2LJL A;  2W63 A;  4JLE A;  5J1G A;  3RPU A;  4HTE A;  1OXZ A;  5LBQ B;  4IE7 A;  2ODV A;  5JDG A;  1IJ6 A;  2VL8 A;  4OHF A;  2DHR A;  5J2T E;  4I50 E;  3KV6 A;  3UUN A;  5LXT E;  2NP9 A;  4H9P C;  3A5X A;  2JMH A;  3ZN1 B;  4AXP A;  3BK9 A;  3H3A A;  2EHO B;  3CQX C;  2D0T A;  2W61 A;  2L9Q A;  4N78 D;  2BVM A;  2BDE A;  4L9I A;  2WM9 A;  2PG8 A;  1MNE A;  4TV8 E;  2JMK A;  2N2N A;  4H9S E;  5CA1 E;  2JPF A;  2JJ9 A;  3N9P A;  5FXW A;  3WAJ A;  4KUM B;  3OYX A;  3I9Y A;  2YIN A;  3FXE B;  2IC9 A;  4X20 E;  3KIN B;  2VB6 A;  3MZK B;  5JDN A;  1ZV4 X;  1VOM A;  4QXB B;  2JQQ A;  4UEL A;  4J2C A;  1Y64 B;  3E22 E;  4HE8 A;  3ZYM A;  2GK9 A;  2IC6 A;  2H7V C;  5JDM A;  1BR4 A;  3CX8 B;  5L3F B;  3EVY A;  3E08 A;  1U5P A;  1YKH B;  1WRD A;  4HGA A;  4AQG A;  4CI1 B;  3KV9 A;  4YJ2 E;  5JDH A;  4IHJ E;  5EZY E;  1D0X A;  1FMW A;  5KMG P;  3QUJ A;  3NZQ A;  1YD8 G;  4V1A v;  4XZC A;  3N9M A;  2XAH B;  3DP7 A;  3E0Z A;  1E1H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...