3FBNB

Structure of the mediator submodule med7n/31
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
94
structure length
94
Chain Sequence
SDQNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mediator of RNA polymerase II transcription subunit 7
publication title Identification, structure, and functional requirement of the Mediator submodule Med7N/31
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 28
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05669 Med31 SOH1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1340 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3fbnB00
3FBNB 3FBIB
chains in the Genus database with same CATH superfamily
2EA2A 4XORA 1X3ZB 2GIVA 2WY7Q 3F8CA 1XGNA 2M30A 3M1EA 5F0HA 2KIMA 1LDKB 2BW3B 1P2FA 2R7UA 3KETA 1PP7U 2LY9A 2QSHX 2MLGA 2UWMA 1FP1D 3PSIA 3FXUA 1Y8RB 2QSFX 5CVJA 2ZO4A 4Y4RA 5FD5A 5DCMB 1REPC 1I1SA 2Y2ZA 3BOQA 1R58A 1MDMB 3RCOA 1ULYA 4ZC3A 1E3PA 2KPMA 4EEFG 4A12A 1U0JA 2HS5A 1NHAA 1MNDA 2X6WA 4L5EA 2XPVA 4JBAA 1XGSA 4N9HA 3KP5A 2R0QC 2Y9YA 3DEWA 3K4BA 1FOWA 2QF7A 2YUSA 1OCTC 2LC2A 2Q2EA 2XRLA 1HQCA 3TDZC 3MVPA 1TT0A 4P55A 2EPFA 4E7IA 2D1HA 3A01B 1QRYA 4GYGA 3IAM2 5B1BH 4HRIA 3S2DJ 3PIPF 1R49A 1ACIA 2P7CB 1EF4A 4RB0A 2IT0A 3I4NJ 4CCLA 2EFNA 2GXGA 2CFOA 3HKZN 2K9MA 2OF7A 3RKWA 1ZTRA 3A1YA 2Z3YA 2KIQA 3WGGA 4UUTA 2AQEA 3TBIA 3QOEA 1SFUA 2PLYA 1H0MA 4KIFA 5GTHC 2DODA 3TW7A 2ZXHA 3RSNA 1S6LA 2CQXA 4I99C 2O9LA 3TOBA 1XSXA 1BBYA 2XB0X 4ZDPA 3K4KA 4RM3A 1K6YA 2VT2A 2P0WA 2FJ1A 2OQRA 3WG9A 1BR4A 1RIOH 3DPTA 2M34A 1T08B 5E3NA 2XSJC 3ABUA 3WTYC 1XD7A 5A2QK 4U0VA 1LVKA 2DA7A 2KDOA 1BN5A 2LFBA 5HODA 2DMNA 4U88A 1Y6IA 4J01A 4KISA 4BQAA 3QOPA 4I09A 1FLIA 1BOBA 4NDLA 4M3DA 4BE2A 2V79A 1HSJA 2XAJA 4OIRF 3J7YJ 3RZDJ 2X1EA 5K7FA 5FLMJ 2HZTA 1IF1A 4D0PA 1BA5A 4B8XA 3ERED 4OWRB 2CUEA 1GXQA 2CUJA 4Y13A 4PJLA 4CCJA 3AG1H 5K7HA 1RR7A 4IHTA 3ML6A 4HBLA 4BU2A 3S3NA 1IJWC 5F0CA 3IUOA 4BE1A 4HV6A 1WJAA 1ONVA 2V1DA 2MH2A 2DT5A 3J80K 4XLEA 5ICEA 4ESJA 1QPIA 3IV5A 3KPHA 3OOUA 1UJ8A 1KU9A 2XC7A 1SFOJ 4C2TA 2GOXB 1QO0D 3OSGA 1POGA 2PFBA 2ACJA 3WU2C 4C2UA 5J6XA 1BR1A 4XKBA 4F7ZA 2DA4A 2MGQA 2CUZA 2BY2A 3HRSA 1J7KA 1LDDA 4XIDA 2ZJQF 3SDBA 4G7HF 1RNLA 2FMYA 1HA8A 4HDVA 3BG6A 2CJJA 2CWEA 2YU3A 2F4OB 2CYYA 4WXDA 3TL4X 3BCBA 4EM2A 3HGGA 4TV7A 2M5WA 4J19A 4YG2F 4BE0A 5TRDA 2M0CA 2DDAA 4UNOA 2F4IA 3NRVA 4M3BA 1SD7A 3RYPA 3H36A 1APLC 2KZGA 3JW4A 2ZMEB 2IW5A 4RMNA 4BJTA 3MQ0A 1ZAOA 4ESBA 2A6HF 2MD5A 3HOUJ 2KRHA 1KYWA 4G9YA 3HRTA 1UELB 3LOCA 3H5AA 4HSTA 4IHWA 2VPRA 4Y7NJ 4ENMA 1XX5A 4CSWA 2NYXA 1N78A 1S7EA 3ECOA 3M07A 1JUMA 2WB1A 3DEUA 1D5YA 2LVSA 5J3LA 3ROUA 2DMUA 1W5TA 1QHHD 3GTPJ 2R7SA 1QPMA 3H3UA 1Z7UA 4FASD 4RGSA 4QPOA 3O3KA 5E20A 4XRSG 4G94A 3S93A 1ETKA 4M6XA 1JE8A 4IRHA 3DPUA 1XMAA 4HDUA 2DK8A 4N4NB 1YRNA 4IQ4A 3BG9A 4MGRA 2JSPA 2HPMA 3MZYA 2CQNA 1U9OA 4HPQA 1OPCA 2QBYB 3OR2C 2M45A 3SYTA 4CICA 3WTTC 4IOCF 1K79A 3VYUB 1E2XA 4A6EA 3HYIA 2IEKA 3BJAA 4FE4A 5J4VA 4O3MA 1R1TA 1SD4A 1LFPA 4XK4A 3R4KA 2FQ4A 4DZJA 2WC2A 1QZYA 3S2HJ 3IL2A 2VBYA 2GWRA 4A3MJ 4ZTJA 4CYDA 4I2OA 3HOSA 4KMFA 4II3A 3GTMJ 4BHPA 1P7JA 4EV0A 3OIPA 2V9VA 1XTAA 4PUSA 2DA6A 2FA5A 3DEEA 2Y48A 3GFMA 4PK4A 1FTZA 4V2GA 3WTXC 2BE5F 2STWA 1B59A 4XLAA 4XICA 3BJ6A 4JK1X 1RPWA 2R4GA 4U0WA 3U9GA 1XSDA 3M1CA 2GA1A 3RPUD 4U0YA 2TDXA 1VQKI 2NS7A 3HL2A 3RZOJ 4IRIA 3E6MA 4EJVA 3UNGC 5BPDA 4XLCA 2UV1A 2QCOA 2OA4A 3E5UA 2XIGA 3JTGA 2DMPA 1WQ2A 2XAHA 2LOOA 2VASA 4E7LA 2Y75A 2QSGX 2JA7J 3QWLA 5GPCA 2JT1A 5LHIA 3L9FA 5IPAA 4E6KG 1MH4A 4HSRA 1C0WA 2EFWA 2XV4S 1Y8QB 3MZHA 3B73A 4BKXA 2EIMH 5C3EJ 1T33A 5J4YA 5FFXA 3V7SA 2EFPA 2H94A 2A69F 1L0OC 1R5GA 1CGPA 3ISPA 3ZGKA 3KCCA 5GAGJ 3OY9A 2Z99A 1WJEA 2R7WA 3FXKA 5ICCA 5M3MJ 2W00A 1VQ4I 5FLXZ 2L7MP 1TZLA 4HF0A 3ELKA 2HWVA 2M2EA 4X1EA 4RBOA 3CLOA 5IOZA 2FOKA 3BWGA 3SFIA 3ZQQA 3LSKA 4ZTFA 3ONQA 2EZKA 3ZMDA 5CVVA 4CH7A 3CCMI 2W24A 3ECHA 2PG4A 2NRAC 2FX0A 5K5QA 4PCQA 4ZZLA 3OYCA 2PN6A 2L9VA 3EPZA 3E3VA 2VODA 2H09A 3F22A 1DGRM 3CCSI 2E19A 2IBDA 1KQ0A 1MJBA 3PSFA 4BHCA 2XPWA 2R7FA 1BJZA 2XPUA 1MGTA 4UB6C 2ADUA 3CMEI 4AVZA 5CLSA 2CO5A 4L5JA 3LSTA 4L9JA 4XM3A 5J8CA 1VQ7I 3GFLA 3HRMA 2VPLA 1FX7A 3TW6A 1NK2P 3CLQA 1UG0A 1K83J 1USSA 4ZYEA 3JREA 4RGUA 5B5EC 1FY7A 5GPAA 4BYYA 3W6JB 5LHHA 2ISYA 5EGOA 1JTYA 2QLZA 4KUMA 5F6FA 1GVDA 3KEQA 2FRHA 3HTSB 2GAUA 3HJEA 3DTEA 5HLHA 2EV6A 2V9KA 3SQNA 3F72A 3FK6A 3BROA 3T8RA 3IH2A 3M3YJ 1MBEA 4LMYA 2DPDA 2ECBA 3O2PE 5LBQA 2HDDA 2DDBA 2VJJA 1ITYA 2R7VA 1T0FA 1LE8B 2VJIA 4ESFA 2HZDA 3F3XA 2XKPA 1VQLI 2JSCA 1TT5B 4DGWB 3FISA 3ZMTA 5GTIC 3I5UA 2HXIA 4PFOA 3TP3A 2STTA 2L7ZA 1D0XA 1B72B 3FHNA 1NTCA 1ETWA 3BDDA 1GLNA 1O3RA 2Z5UA 2O61A 3SEQA 2A05A 5DM6F 3BC8A 1UFMA 2W84A 3FXQA 4BDZA 1I6HJ 4FISA 4BXUA 4RB2C 4KIBA 2XAGA 2JPBA 4HAMA 3C2HA 3RPQA 4LG0A 4CYCA 1QZZA 4N0BA 4ASNA 1JGGA 3OYDA 2AQFA 5LHGA 2E5NA 1W0UA 3U1KA 4LLNA 5CPRB 1N77A 3RKQA 3M8FA 3S1NJ 1Z67A 2PBIA 3ZP5A 4A3BJ 4PJNA 5E3MA 3GTGJ 3HHHA 1SFEA 2E1MC 1AKHA 2EINH 3ERMA 2X4HA 2DOEA 1M1EB 2NS8A 2DK5A 2EZIA 4DYRA 1MMDA 1L3LA 4X6AJ 1VQOI 4UUSB 4BH9A 3EYYA 2HTJA 1A6IA 3PQJA 1R4MB 2B7EA 3CP8A 5ERIA 3S32A 4A3DJ 2VKEA 3WU1B 2O8XA 3K10A 3F21A 1PUFA 2P5VA 3QU6A 3CUQA 3S3MA 3F8MA 3S3OA 3BG3A 2JVGA 3LSHA 2ME6A 4BACA 1MBHA 2EH3A 1XCVA 1SD6A 1ZYRF 2BVMA 4XRFA 1I6XA 2R5YB 3ZQLA 2M7AA 1LUJB 2JRTA 4ZH4F 4HF1A 4A2UA 2ZJPF 1E3HA 4HV5A 4HLYA 4EJTA 2XVCA 2HVSA 2DTRA 3QU3A 1UHMA 4Q4ZF 1FYMA 1XDSA 4ZDLA 2RV8A 2X6OA 2DA3A 1T95A 4A3EJ 4E7ZA 2A6TA 3OS1A 2JJ7A 4JX6A 1YIOA 1ZRFA 2IS4A 2RREA 1EH6A 4A3CJ 1SFXA 3VYTB 1RKTA 3HTUA 2Z9OA 2OU2A 5LGTA 2VQCA 4QTRA 1UAAA 3D5LA 2QYOA 3T0YA 3PQKA 2MH9A 2NOJB 1X3UA 2QQAA 3K70C 3R60A 4BDYA 3AAFA 5J1RA 4G6QA 2G9WA 2K86A 2V1NA 2W48A 4OAYA 5E79C 1ZELA 1EH8A 1K6OA 3BJOA 4IVNA 1J75A 1J2XA 2KMUA 2B63J 1IDYA 2IGOA 3DQVC 3REOA 3FX3A 4YIIA 4IO9F 2LYCA 5HVQC 2A07F 2V4JC 1T56A 1WJFA 3CD6I 2HOTA 4KA4A 1YTYA 1U6GA 2M7BA 1TWCJ 1R22A 5DS9A 1T98A 2DFIA 4FCYA 1R71A 4A3JJ 1FYLA 1D5VA 2XGEA 2W82A 3K4JA 2E2JJ 1QQIA 2ZKZA 3TO6A 1ETVA 3B02A 4IHXA 2ZSHB 1YJ9I 5LFAA 1E17A 2P6TA 3KP7A 3P9CA 3T1BA 1O7FA 3W2AA 2ESNA 2X85A 3D5RC 3J81K 1WJ5A 1N75A 3S14J 4UUVA 4UVAA 2TRTA 4M3FA 4RGRA 3C1DA 1SFKA 3KZIC 5IP7J 4Z6YA 2ZFWA 1FOYA 3KP6A 5ICGA 2NXNB 1S9HA 4QPQA 3Q9SA 3GFJA 3ZQGA 2L2OA 4ZJZA 2QKMB 3K1PA 3GUDA 5CQGA 3QPTA 3BTCA 3TOAA 3RKXA 2OTLI 2LR8A 4YFXF 3CMYA 4HA8A 1PYVA 3GX4X 1D1AA 3CC2I 2DMTA 4Y33A 3GMEA 3PJRA 3DKYA 1IN7A 5KVRA 4HYEA 2L02A 4AM3A 2Y0SA 2PJRB 2HOEA 5HS8A 2KIUA 3FBNB 1U5TB 3WU0A 1RR8C 3FK7A 3K1MA 1K4SA 1ENHA 4I76A 1Z3XA 1VF9A 1FMVA 1TTYA 2VQHA 2ELHA 3H9QA 5DM7F 5FFZA 1P92A 1G6NA 5LGUA 2ID6A 4KFCA 1WH5A 1VQ8I 4BXFA 5FROA 1YS7A 3ASNH 4YRVA 3K4LA 2QWWA 4B47A 4LITA 2M8EA 3QAHA 3WODF 1LEAA 1XMKA 2E1OA 2JWTA 1FSEA 2WV1A 2M87A 2W1OA 2ZSIB 2M8GX 4E7KA 3Q0UA 3CCEI 2RNGA 1ZR2A 1TWFJ 1B6AA 1MH3A 2NOGA 2HKOA 5F27A 3H3VK 3E6BA 5EZGA 3M4OJ 3DKXA 3QODA 3IHUA 2HQAA 2OZ6A 5DDGA 3ZOBA 2VIXA 2LDUA 4M3EA 1JKPC 1MBJA 1WRJA 3ZMVA 4OIPF 2R5ZA 3V8LA 2IXSA 1U3EM 1OLTA 3LSMA 5JVTA 4C3HJ 4AIKA 2K3FA 4HNVA 1BI1A 2IA0A 3K2AA 4FX0A 1R6RA 4UV9A 5HS7A 2AXLA 2H8WA 3GCMA 4R8HA 4G12A 1YW8A 1G3WA 2LMDA 3F8FA 1MMAA 3SXYA 3RQ4A 2JA8J 2Z1DA 4L0YB 3QRFF 4L0ZB 1SANA 2MW8A 2X48A 3CCYA 3QPLA 2K4BA 1K78A 5IYDJ 2H1KA 1SAUA 2DFHA 5E1WA 2CW7A 4LB5A 2KLOA 2HYFA 1W7PD 5EJCA 2ZB9A 4E7JA 2VE9A 4RS8A 3NWSA 3BR6A 3I4PA 4DJAA 3MKWB 4I6ZA 5AIQA 2ELJA 4G7ZF 1D0YA 1X4OA 2CQQA 3CUQC 1O7LA 1R5ID 3LAJA 5ED4A 3MEXA 4Q5SF 2XAFA 3QQAA 3HM5A 3MWMA 2VQLA 1YJWI 5EDNA 1F1ZA 2R7OA 2HVRA 4KN4X 1OFCX 4KITB 5HOOA 1MSFC 1KYZA 2IPQX 3FIWA 4FX4A 4L18B 2XRNA 2NVTJ 3OS0A 4ZDOA 5M5XJ 4CZZA 4H0EA 3K1NA 4XSXF 3V42A 4PFPA 4LG0B 3DBLB 4M9SA 5E1ZB 4IRGA 2ID3A 1IRFA 1GT0C 4ENJA 2L4AA 3PFYA 4HOBA 5F64A 1OCPA 1TW3A 3CCLI 2EWNA 4FHTA 1UHWA 2LRDA 1P7IA 2VXDA 3DBRB 3SZTA 2XAQA 3WTWC 3K7AJ 2WADA 5D4SA 1QNTA 1MBFA 3LSJA 1IC8A 3PNVA 1B9MA 2LKPA 4LIUA 4EJUA 1BC8C 3ULQB 2BY0A 5JLWA 2ZXIA 3I55I 2VBWA 4P1WA 4UB8C 3IRQA 1G8XA 2R7RA 3WTVC 3S8PA 4BJ5C 2OZUA 1X2MA 1Y56A 3C18A 3BR5A 4OOIA 1TQPA 2FE3A 2QGUA 1IXCA 1EV7A 3CESA 5CVUA 1TWAJ 4I02A 5H6QA 2HDCA 1G59A 3D0SA 3CUOA 2EB7A 4MO7A 2RC4A 3LA2A 3HUGA 3ZQIA 4HNTA 3DTKA 2ZFUA 2Q0OA 3MMYB 1Z1DA 2Z33A 2XSDC 2KRCA 2NVYJ 3RQIA 3F23A 2Y0MA 3L2UA 1FZPB 3A02A 3DCFA 3E5XA 3SZPA 1BI0A 3ZR8X 4Z2YA 2EA4A 5J47A 2E1NA 2NNYA 1Y1WJ 2FD5A 2WAQA 4M71A 1FBQA 1TC3C 3LFKA 4XKCA 1WPKA 4ZYGA 2KDZA 4EGYA 2K9NA 1T6SA 2GA2A 2BYVE 3U2RA 4B4CA 4IQJA 1Z91A 5F1JA 1USTA 2HR3A 1FYKA 4YIRX 2VJ4A 4AYBN 3WE3A 2EIKH 3V7CA 3S1QJ 3J7AY 2H1LA 2JTVA 1LVAA 3MFKA 3AFHA 3GZ5A 3WHCA 4NQWA 4BY7J 3RKYA 4EVIA 3DTIA 5D5UB 1O4XA 1JUSA 1VQMI 3BTJA 1F5TA 5D8LB 5EEHA 3BLYA 2P4WA 1KONA 1WI3A 5HDGA 3H1CA 1J09A 3AKZA 3NWTA 2EILH 2KJCA 4JX5A 2HDWA 3GLLA 4V19K 2IGMA 1WSUA 5ICFA 3R6SA 2OTJI 1B8IB 1RRJA 1HDPA 4BEHA 3OYLA 2W7NA 5E8GA 2AO9A 3WTZA 4DZPA 5KAFC 1PJRA 4MEXF 2P5KA 3HZJA 4IHYA 1ZRDA 3A03A 3KE2A 3GTOJ 3OL4A 2FBIA 4UVCA 3G3ZA 5CVRA 3QPSA 2ISZA 2V9PA 3ZN1A 2V7FA 2QA4I 3JAMZ 3LWFA 2DCEA 2NVUB 5IT9K 1MJAA 2Y30A 4NUBA 3IRRA 5BMZA 1BM9A 1MBKA 1V4RA 3ABKH 2F6CA 2IGNA 2RQQA 3H3ZA 3HKZA 5F08A 1DP3A 2E5ZA 2F2EA 2L01A 3GEZA 4F55A 3LSPA 3I59B 1EJ9A 2XGCA 1WGXA 4GGGA 1LDJA 1YQAA 1GUUA 3PNTA 1WWXA 1HKQA 2GIZA 2PX9A 2KISA 3K2ZA 2BEOA 2UXNA 2M4GA 2NAZA 4WXHA 2EZHA 2LG4A 4B09A 3IKTA 1MNMC 1IN4A 3MAJA 3CCRI 5IP9J 1F9NA 3IP4B 4XLPF 3S17J 3DWLE 3BY6A 3FKIJ 4I01A 2YX4A 2DLLA 1V5GA 2D2WA 4XQFA 1D3YA 2L9SA 3L2QA 1HW2A 2GXAA 5DTDA 3R0JA 1VQ5I 2X1DA 2E60A 1ODDA 2XKOA 5ILSA 4C2MJ 1VNDA 2O8KA 1BW6A 1VQNI 5EG0A 1D8KA 2DOFA 1G3YA 1WCMJ 2J5OA 4BQQA 4NC8A 3BTIA 2FU4A 4I98B 2UUZA 4NB5A 3OIQA 1W5SA 2BHYA 3ABMH 3FXRA 3P9IA 2KQRA 1BI3A 2LY2A 3VDXA 1O3TA 3FM3A 1ZARA 3OYEA 3G4SI 4CZCA 1FP2A 1ON2A 2CS3A 5BS6A 3SDGA 4RAZA 4F93B 4DYQA 5FGMA 3NQOA 3O8HA 1OYIA 4RGXA 3J7ZI 3RI4A 1E3OC 1IZ1A 2LKSA 3JRGA 2DO7A 1IV8A 2R5ZB 1YI2I 3E1SA 2D1VA 2LTPA 2QUFA 3H9JA 4AD9A 3OYIA 2IS6A 1V55H 1MBGA 1QHGA 4AWXB 3HOWJ 4XR6A 5CYVA 2P6SA 1HF0A 2CG4A 2DOAA 4B48A 3H0DA 3Q0VA 3TDUC 3L00A 1G3SA 2F5FA 1T38A 2QKLB 1SAXA 1BW5A 2DTZA 2V6EA 1SD5A 1K78B 5EZHA 4A5MA 2GM4A 2F5DA 5C4JJ 3HEFA 3P9KA 1D8JA 3ABLH 2HOAA 2XF5A 2VONA 2ECCA 3FKJA 4WXCA 3JRAA 4M6VA 3GFIA 5A2QZ 3KYCB 1JXSA 2Q2EB 4ETSA 5FRNA 4IOAF 4P96A 3I64A 5D6EA 4LIVA 2KJBA 1MKMA 2ELKA 3ZQHA 5L3FA 4RLQA 4HQMA 5AIPA 2E36A 1FSHA 1IO2A 3L7WA 1XDUA 1J59A 3HBLA 2CV1A 4WWCA 3A2KA 4BJ6C 5LRSA 1XB4A 1R9TJ 4N4OB 1Y0UA 1JKRC 1WJDA 1YE9A 1ZLKA 3OYHA 3E6CC 3GLXA 4LJZF 3BG7A 1U78A 1MW7A 3BR3A 3BPXA 4FQGA 5HLIA 3ZMSA 4F52A 3SHFA 3COAC 4A3KJ 5HNFA 1IW7F 5IY5H 2CSOA 2HXOA 3J80Z 4XONA 1OCOH 3H5RA 1FEXA 1V54H 4RAFA 5GP9A 2K02A 2PMHA 3CJRB 2R7QA 3D1NI 1KGSA 4PJ0C 3EUHA 3VODA 2VB6A 2L7FP 4CUGA 3JRCA 3CZ6A 2YS9A 2Z16A 5H6RA 3ZN0A 4MTEA 1HOMA 3CDHA 4QWQA 2HKXA 3OYGA 3HPGA 2WBMA 1EA3A 4BXXJ 2F5EA 2K5CA 2X9DA 2ZXJA 2LNBA 3FWEA 3W2VA 5HDKA 1V5EA 2PMUA 4IXAA 4AIDA 5E3LA 1LB2A 2EV0A 4P5OA 3A01A 2R92J 4RA2A 4MIMA 5JHUA 2LD5A 1AWCA 3O6BB 1SVLA 4L9TA 1ZG5A 2WWYA 2VKDA 2V26A 1WVRA 4BGDA 4C9YA 3HUGB 3QYEA 4XN0A 2NVQJ 5L3GA 1FOKA 2MC4A 1I1GA 3BT9A 4HG2A 5L3EA 5GAEJ 1TNSA 2GOMA 2JK3A 3ASOH 3PIOF 2O6GE 1F43A 1UHSA 4A3GJ 4WK8F 2LLKA 4XL9A 4DBQA 4R1HA 1CF7A 1YYVA 1HDDC 1JT0A 1P6RA 1OCZH 1H89C 3IKVA 2W25A 3E0JB 5FKMA 3CCUI 3AG4H 1BIBA 3UR3C 2COMA 2I8DA 3ZRGA 3FBIB 1X2NA 4IHVA 4UHTA 3IWFA 4OIQF 1MSEC 2X1CA 4I7HA 2DFFA 1O57A 2Z2SB 1GV5A 4MFEA 1K7AA 2F5VA 1UG2A 3CJTB 2VOPA 2AHQA 2FXAA 4XKVA 3LAPA 2DU9A 1WI9A 2O3FA 3KYDB 4NQWB 3AG2H 5JI6A 1TQMA 4CO8A 1H8AC 3A0HC 2CV0A 4BUPA 2DA5A 1X19A 2OBPA 2JZYA 5HS9A 1G3TA 3CCQI 3NARA 2DFEA 4ENNA 1PP8F 4KMUX 2HQNA 4JOMA 3OOPA 4D5CA 1JI8A 1X1BA 3F9KA 4NC6A 3H0GJ 5DYMA 1A31A 4BEHB 1XS9A 1YFHA 5M3FJ 1R1VA 4XOPA 3O8GA 3PUBA 3FHZA 1JHHA 3ESWB 4FE7A 4AIJA 1J9IA 2LF7A 1QZEA 3S1MJ 2LF8A 2IRFG 4NHJA 5EEGA 2E1MB 2DA1A 2V1UA 1W36C 1QVUA 3PUFA 5FKKA 1YRNB 3K4MA 5D6FA 4S05A 3OYMA 4XOTA 5GAHJ 2IA2A 1Z77A 2FNAA 3U21A 2D5VA 1ZH5A 2IVMA 1Z21A 4JYKA 4XN3A 2KL4A 3V7RA 4IX7A 1RESA 1DUXC 1S7AA 2YSRA 3EETA 4QLCU 3KYLA 2NVXJ 1R4NB 3CCJI 3PM1A 2E2HJ 3JRBA 3HB9A 4N9IA 2BHZA 2QVOA 1XN7A 4B44A 1HW1A 2DI3A 2ZMEA 3EUAA 1A35A 1FMWA 5DEQA 2RAEA 4XRSA 1NG6A 4D5FA 1PUEE 4U7DA 4L9VA 2OV7A 1OMIA 1VTNC 3JRIA 2QEXI 4KJZA 4XLNF 2BZTA 3PO2J 2JPCA 2MG4A 3EDPA 1Z0XA 4ON0A 3G2BA 2JA2A 4U87A 1ETXA 1G2HA 4KDPA 3VB2A 3RPUA 4CCOA 1T8IA 2BVLA 3HOXJ 3W6KB 5B1AH 4GDFA 2LK2A 4Y3OA 4LGWA 1STZA 2HVQA 1ZGJA 2EK5A 5EG0B 2LP0A 5D5VB 1MIJA 3ZMUA 2Y69H 3H92A 2KT0A 3M9AA 1BI2A 3PFIA 4MEYF 5IT3A 1H88C 1OCRH 3D5SC 2L54A 1RC9A 3AL0C 1RZ4A 2FOWA 2KIFA 3K0LA 3DXJF 3U1DA 1LJ9A 3X2QH 4JX4A 4Q47A 1LFUP 3HOZJ 2L9RA 5E1XA 3FMRA 1A36A 4RDUA 2FQ3A 2FMLA 3IWZA 3MZ8A 3WTUC 4A0XA 1U8RA 3BG5A 1MZBA 4CA0A 1LPQA 2GZWA 1OYYA 3F0CA 4G6DA 2HPIA 3QYFA 1J0RA 1X1CA 3GYHX 2MFZA 5ILVA 4XRMA 4D9JA 1K4TA 4GFBA 1AA7A 1BC7C 3ZQFA 1OISA 4FETA 5AONA 4NC7A 3BTLA 5HLGA 3I56I 2WTEA 4E7SA 5IYCJ 1IXRC 3BP8A 2K85A 1ZK8A 3DLAA 4KT6A 4LOCA 2GLOA 2NNNA 2VL8A 3DP7A 3OYJA 5F1RA 3HOTA 1IG7A 5C44J 1HC8A 3CJQB 1H9GA 3Q5FA 1ZQ3P 3V8JA 2M0MA 2JVHA 3FXJA 3BR0A 3ZQ7A 3EUHC 3TO9A 2X0LA 2DN0A 4CCMA 1B9NA 4F91B 4YEJA 2A6EF 3E6DA 3SEZA 3CO7C 2F4MB 1I50J 2OUMA 3R61A 1GV2A 1P9QC 1GDTA 1UCRA 5JLXA 1G4DA 3K70D 2E7WA 1IAWA 3C2GA 4LLGF 3GTKJ 3A4CA 3CTAA 4KICA 4M3GA 4EGZA 4HEA2 3T5XA 1I39A 3WTSC 4KYWA 1A5JA 4MNUA 4GO1A 4LG3A 5E17F 4OAZA 3LQQA 3IH3A 2OD5A 1YW7A 4UXNA 3QP5A 2DQRA 3LQRA 5D4RA 1NH3A 2AXTC 3ABTA 1P4AA 2HI3A 4JP0A 2Y9ZA 4JQFA 2R7TA 2WAEA 1KZHA 3CC4I 5HLTA 4C3JJ 1X4PA 3HSEA 5EGOB 2ZNYA 1AHDP 3P5JA 2XGXA 5D8KB 2L3DA 5KK1A 2PI0A 2A5YB 4GYIA 4AIHA 3JCUC 1DGWY 4PJJA 2OJED 5DV5A 5E8IA 2JRMA 3HGYA 3VSKA 1KA8A 3DU5A 3GBGA 3W2WA 1Q1VA 1XSVA 3FM5A 3B6AA 1VZ0A 1FPQA 2H6BA 2LBFA 1ETYA 4A0ZA 3EUKL 2R7ZJ 2CFXA 3MN2A 3FXLA 2W4SA 2PEXA 3KZZA 3FMSA 5M5YJ 3OYKA 4IL6C 4J00A 3LA7A 4OIOF 1TLHB 3OSFA 5CQEA 3WG7H 2WB1N 3CO6C 4A69C 5DD4A 3FXMA 1W1WE 2DYSH 5BPIA 1OR7C 3UKGA 4ZYDA 3HHGA 3ZQCA 2P81A 2QZ8A 2VUMJ 4Y15A 4OU0A 1U2WA 2E34A 5LLQA 4M72A 3L2WA 4CYCB 2MABA 1WKMA 3G6EI 2EZLA 5IP6A 1S5LC 1SMYF 5FLXK 4C30A 3OIOA 2XHKA 4GXOA 5GADJ 1W5CC 3QP6A 5B66C 5F04A 1TNTA 3E97A 1PDNC 2IA1A 3BR2A 2H8RA 1KU7A 1AKHB 5EEAA 4BS9A 2EV5A 2L5QA 2HYGD 3C2BA 2H6CA 4ENKA 3TO7A 2B9SA 4A3FJ 4KNYA 4YFNF 1XMXA 4XKWA 1CF7B 5C4XJ 2YPRA 3LFUA 2A61A 3EYIA 1LE8A 1H9TA 3LMMA 3DPLC 4A5NA 4PSWA 2CV2A 1U8BA 2N8GA 1O3QA 2XF6A 1RI7A 1B72A 1PUFB 1FC3A 5K7ZA 4ITVA 4DNCA 2HU9A 3A0BC 3FMQA 5L3DA 1W0TA 2JMWA 3CUQB 4Q48A 3HDDA 2CW8A 1SVOA 1S8NA 5E18F 1VI0A 1B4AA 3BZKA 4IJAA 4HLXA 4B1RA 2GQQA 4E70A 3VOEA 2XUBA 1ERDA 4R79A 1SEUA 3OYAA 2ZMEC 3M8EA 2MC3A 1F36A 3QYBA 4NNJA 3BPVA 3FZVA 3Q9VA 1VQPI 1LQ1A 3PO3J 2WV0A 3VSLA 4BQNA 1OQYA 4ZZDA 1W4MA 1FBSA 1Z6TA 3FF5A 4A3IJ 1J5YA 3MCZA 3RIRA 4HX8A 5LEJA 1X3WB 5KAIC 1LEBA 4K2EA 2KRFA 2E2IJ 3DV8A 4UVBA 3HG9A 1EKEA 1ZG3A 5CKTA 4DW6A 2HFHA 4M73A 2XGDA 2LKXA 1UB9A 1BOAA 4MQ9F 5IOYA 2XF7A 4BNCA 1X58A 3CMAI 3CC7I 4BY1J 4LK0F 4WX9A 1E0EA 2Q1ZB 1RETA 4HZFA 3E7LA 2LH9A 4L9NA 3BR1A 2PMZN 1Z6RA 2R7DA 1KU2A 1XG1A 3BCAA 2ZNZA 2DJIA 4UUSA 2DT6A 2BXZA 2M1BA 3VFZA 3J81Z 5KCMA 1DU6A 3K6GA 3RDIA 1ON1A 1JKOC 2M4KA 1MMGA 2L4MA 1YIJI 3CQZJ 4XLFA 2HYJA 2VKVA 1ZN2A 1EH7A 4M74A 1FIPA 4YIFA 4IPAA 3W3CA 4BBRJ 2COBA 4HW0A 2RN7A 3I53A 2QM3A 2O0YA 3I71A 3GF2A 1GXPA 2G0EA 1TP4A 4CXFA 4IZZA 2R5YA 3GTQJ 4MQVA 3VWBA 3DKWA 2BY3A 4MFDA 3GW2A 3N05A 3HPHA 4RAGA 3ZXSA 1XGOA 2DW4A 2ETHA 4D7MA 1BR2A 1OYWA 2MLKA 4A0YA 5FB2A 4II2A 1DU0A 1RUOA 3JRHA 4E7HA 2KKOA 5FKLA 3GO5A 1ZKGA 1ZLJA 3DLLF 2D45A 4B43A 4DIQA 4KT5C 1KQ8A 2DXIA 1A6QA 1JHFA 2CUFA 2YX7A 5KHDA 3CMMA 2FF4A 1A04A 2E71A 5CVIA 2ESHA 3MKYB 3N97A 1Z7LA 3CF2A 3RJPA 5FD6A 2X51A 4HNUA 3GXOA 3KEYA 5J8FA 3AG3H 3GZ6A 4A3LJ 5B3SH 2ZCWA 1T2KA 3JR9A 2ZC2A 5BQTA 4UY8I 1YOVB 3TP0A 1TWHJ 3Q0WA 3KIOA 2ZBKA 3SFZA 1Z3YA 2VE8A 4IHSA 1IRXA 3WGIA 3VEPA 2XAUA 4PSXA 2YR2A 4I0AA 1WH7A 1YLFA 2XASA 2K4JA 4ANJA 4UV8A 1R1UA 3KFWX 1VQ9I 1X1DA 1AOYA 5JFRA 5E3OA 3VPRA 2FSWA 1TQIA 5EF6A 4Y17A 4B3AA 4DYCA 2VQGA 1JGSA 1N25A 4RB1A 1D1CA 3CP2A 4XMYA 2DYRH 4CCNA 3L1PA 2R3SA 1IN5A 1NG7A 2LSOA 3LSIA 4WCGA 3T8TA 2QQ9A 3L2CA 2WA0A 1BJAA 2HQ5A 4O5VA 2UZKA 1IRZA 5CJ9A 2W57A 5D5XB 4FT8A 2IS1A 1FIAA 1HW5A 3RYRA 1V5FA 2ZJ2A 4G7OF 2R7XA 2UXXA 1RKWA 2K40A 2OAZA 2KP6A 4AYBA 1DP7P 3M7GA 6PAXA 1Z9CA 3E5QA 1IV6A 2K3PA 2L9NA 3C7JA 2PMZA 4EJWA 3LSGA 3F8BA 3QPHA 4D1QA 2IS2A 2PJRA 4BL0B 3M8JA 4V2FA 2G7HA 2EFOA 5HNHA 1U5TA 4RLFA 1TL8A 2HEOA 4P9FA 4NBQA 2A3SA 4D7NA 3B6CA 2W85A 5BOXA 1I5ZA 1LNWA 2RKHA 4BBSJ 2FNPA 4MLOA 2FUG2 3HOVJ 3FDYA 5J1YA 1W7PA 4YELA 1ZG1A 3KLOA 1HSTA 4QIWN 3OS2A 1X1PA 5FO5A 3HOYJ 3KEOA 2CU7A 4XBFA 1YS6A 1QGPA 2DQLA 4EQQA 2JA6J 3OMYA 4PGHA 2CGPA 2AS5F 3IH4A 5TISC 4P9UA 1YO5C 3JTHA 1I27A 2K9SA 5FRMA 1VFCA 3S15J 3OYFA 3Q3SA 2LBFB 4CCKA 4BQOA 4CHUA 2NS0A 2CQKA 4M9ZA 1Y39A 5K5OA 4DOZA 1KQ9A 3R0AA 1XC5A 3FXOA 1FNNA 3F6OA 4ZYAA 1YJNI 4F92B 5KNLA 1NK3P 3GTJJ 2A5WA 1S3JA 2MYSA 3LA3A 4LFUA 3K4CA 1S29A 2VKHA 2BW3A 4M6YA 3HC7A 1IGNA 1XPXA 3MD2A 4CDGA 1Z05A 3DFGA 4A93J 1IRGA 2HQRA 1R5HA 3H35A 4PZJA 5DCMA 2IP2A 1YHQI 5K1YA 1HBXG 1MDMA 3CCVI 2GXBA 1IN6A 3PNYA 1FJLA 2CW0F 3EQLF 3MKZA 2EIJH 1WFXA 4LD5A 2ICWG 5JVGF 2G7UA 2J5PA 2F48A 2VI6A 3GZNB 4I0BA 2CMPA 2Y31A 1SMTA 1TBXA 4ABZA 3JRFA 4FTHA 1MMSA 1FBUA 2L7KA 4MTDA 2C6YA 2QENA 4HX7A 1IUYA 1KU3A 2E35A 4GRIA 5IYBJ 4KN7X 2IJLA 1I3QJ 1QVTA 3OR1C 1OJLA 2KHMA 2EBIA 4GCVA 4X0GA 2E1CA 2XROA 3OL3A 4RAYA 1IUFA 1R00A 2KFDA 4EMSA 3OV8A 5L3CA 3G1OA 1HXDA 2P7VB 2R93J 1GVJA 3J7AO 1S7OA 4C3IJ 4EM1A 2M9HA 5BNGA 4AUXA 2VBZA 2ME0A 3L09A 1WJBA 4BHBA 3LL7A 1O3SA 1QBJA 1MNEA 1TW2A 3BZ6A 2HTSA 1TWGJ 3TEDA 2K27A 1UMQA 2OPTA 3G1LA 1RUNA 3F6VA 4EJOA 4F3QA 3L2RA 1JJ6C 2QQBA 3HSFA 4AVPA 2VOOA 3NEUA 4EM0B 5FLVA 3KP2A 1XCBA 1QA6A 2K9QA 5IT9Z 2O5RA 1ZGAA 3SJMA 2OC6A 2XB5A 1V3FA 4E4HA 3TMOA 3I4MJ 1HKSA 5LGNA 3RTRA 5LRRA 2Y0SN 5J1UA 2BOLA 4OMZA 2RGVA 2XDVA 1FT9A 5HDNA 2L0KA 2V6CA 1OR7A 4HX4A 2MD0A 5F0FA 5FKOA 3WE2A 2P5LC 5H2FC 2YU9J 1YW9A 4IF4A 2JA5J 1R36A 2JN6A 1P4WA 1WHUA 2BY1A 3HRUA 1X1AA 2BBYA 5EYRA 2X6YA 1MD0A 4MHGA 1ZRCA 1UZCA 1DPRA 2DBBA 3CDIA 3G71I 3JSPA 1Q1HA 2BXYA 2V1XA 3IAS2 3WGHA 2EJRA 2DA2A 2VT3A 4KIGA 1P4XA 3OYBA 1ORKA 2LREA 4DQ2A 4ZYHA 2CH0A 2DMQA 2CQ7A 1K61A 1PVEA 3DF8A 1MJ9A 1YITI 2EQRA 4G8XA 4PGGA 2DAOA 3GTLJ 2HNHA 5TGTA 2QQ8A 3TQNA 4A6DA 1S72I 2H27A 1JT6A 2EFQA 1JUPA 2K9LA 3K9TA 5K5RA 3OYNA 3W6VA 4IKFA 3BZCA 4LK1F 3TGNA 3ZPLA 1YX3A 2ZXWH 5JR3A 2X6XA 2VXZA 3HIFA 2FEZA 2MBFA 3OWTA 1BIAA 3G73A 3DBHB 4W97A 2JQ7A 9ANTA 1ZHFA 4OINF 4HQEA 1R23A 4G6TB 2DPUA 4L5IA 1JKQC 1GHCA 2HGCA 3ZMZA 4O6JA 4LLLA 3S2WA 3GWZA 3IC7A 5DCFA 3I9V2 4S04A 2M3AA 2PJPA 5DUKA 3K4NA 4YFKF 4W1UA 2CRGA 1Y0NA 3K69A 1B8IA 4IEJA 1U5TC 2BV6A 2F5CA 1ETQA 3HSRA 4EATA 3S16J 4QSHA 2VC1A 4B3XA 4RB3C 4WF2A 4BAYA 2LY1A 1BL0A 2RQPA 2OQGA 2IGKA 3KP3A 2I10A 3DU6A 3G1MA 1R7JA 1IN8A 1ZR4A 5LD2C 4HF2A 2VC0A 2E7XA 1IDZA 1HLVA 3I3LA 4XLHA 5DD8A 3KP4A 2VJ5A 5FJ8J 1WZ2A 1FOXA 1FTTA 1ZGWA 1HKTA 3S1RJ 2FBHA 4AC0A 3JRDA 3HXLA 3C3WA 2JUGA 4DBRA 4S0HB 1I3AA 2QBYA 5FKNA 4Y52J 3I0TA 3I54A 2DT7B 3GVAA 2VLAA 2P8TA 3I59A 1DPUA 5TJJA 1HCRA 1SVMA 3PL8A 1JTXA 3L2VA 2DJNA 3ZCOA 1OKRA 2GBYA 1B1BA 4XSZF 5J40A 2MA3A 3KZYA 1WJCA 2RDPA 1QU3A 3LSRA 3CF5F 1DQUA 4CGZA 1VQ6I 2Q8KA 2HOSA 1IXSB 5D5WB 2RVCA 2TCTA 3SZGA 1OCCH 3VYSB 1T39A 1CQTA 3H5NA 5ILUA 3H9GA 3LNQA 1YX5A 2BGCA 3MKLA 2A68F 3JAMK 3P7NA 4U7BA 4RM2A 2K7LA 3WHBA 3F8NA 1XGMA 2OCEA 4AU7A 1MMNA 2I5UA 2JUCA 1D0ZA 4LB6B 1D1BA 5M5WJ 3KX2A 2OCCH 4PDKA 3N4MA 2WY8Q 3CJNA 3V8KA 3BQZA 4OMYA 1W7PB 1LFBA 5DUIA 1JJ8C 1DDNA 3CDLA 5JHFA 2O03A 2ZJRF 3KLNA 3I58A 3BQYA 5LEKA 3NAUA 1F4KA 3TKYA 1T0FC 2PQ8A 1W36D 5L3BA 2KZVA 2MSYA 2VN2A 3AL0B 3JSOA 1SC7A 4XNFA 2WAFA 2B0LA 4H4KC 3VYRB 5H20A 1Y1VJ 4M9XA 1AU7A 1YG2A 3V4GA 1LKXA 2RNJA 1FWZA 2FBKA 2VBXA 2O7OA 1ETOA 2IAIA 2WAQN 1ZREA 4PJMA 1U9NA
chains in the Genus database with same CATH topology
1MMGA 4XORA 2V6EA 1T95A 4E7ZA 4XLFA 2WY7Q 2A6TA 3OS1A 3W3CA 1LDKB 2BW3B 2XF5A 2R7UA 2IS4A 2RREA 3FKJA 2UWMA 3VYTB 1UAAA 3PSIA 2VQCA 2Q2EB 3D5LA 4Y4RA 5FRNA 4IZZA 3VWBA 2NOJB 4LIVA 3K70C 4RLQA 3N05A 4BDYA 3RCOA 3HPHA 3ZXSA 2V1NA 4OAYA 4ZC3A 2CV1A 1BR2A 1ZELA 2KPMA 4II2A 3A2KA 4BJ6C 1U0JA 2KMUA 1MNDA 2X6WA 4E7HA 2IGOA 3DQVC 4N4OB 1WJDA 1YE9A 4B43A 4DIQA 3OYHA 2LYCA 2DXIA 5HVQC 3BG7A 5KHDA 3K4BA 3CMMA 1MW7A 1WJFA 2V4JC 3MKYB 4F52A 1Z7LA 3CF2A 2LC2A 2M7BA 5HNFA 2X51A 4HNUA 1TT0A 3KEYA 4XONA 4E7IA 3H5RA 2W82A 3IAM2 4HRIA 3CJRB 3K4JA 2R7QA 4CCLA 2ZSHB 1Z3YA 2CFOA 5LFAA 2VB6A 4CUGA 2K9MA 3CZ6A 2Z16A 3W2AA 1IRXA 3A1YA 2X85A 3D5RC 3TBIA 2AQEA 3QOEA 3OYGA 1WJ5A 3HPGA 2WBMA 1EA3A 1N75A 2XAUA 2K5CA 2ZXHA 4PSXA 3RSNA 3W2VA 1V5EA 1SFKA 4ZDPA 4ANJA 3K4KA 4P5OA 4RM3A 1K6YA 1S9HA 2P0WA 4QPQA 1BR4A 3DPTA 2L2OA 4ZJZA 2QKMB 1X1DA 2XSJC 5CQGA 2VKDA 2V26A 4BGDA 1LVKA 2KDOA 4C9YA 3HUGB 4J01A 1Y6IA 4KISA 1PYVA 3QYEA 1D1AA 4XN0A 4Y33A 2MC4A 2VQGA 3PJRA 3DKYA 4HG2A 1D1CA 1BOBA 4BE2A 2GOMA 3CP2A 4XMYA 2Y0SA 4CCNA 2PJRB 2X1EA 1NG7A 3FBNB 3LSIA 4XL9A 4DBQA 2WA0A 4OWRB 2CUJA 3E0JB 4PJLA 1Z3XA 3UR3C 4CCJA 1FMVA 2I8DA 3ZRGA 2VQHA 3FBIB 3H9QA 2IS1A 4BU2A 3S3NA 2X1CA 3IUOA 4BE1A 1V5FA 4BXFA 2R7XA 1WJAA 2Z2SB 5FROA 4YRVA 2F5VA 2KP6A 3K4LA 4AYBA 4XKVA 4B47A 4LITA 4XLEA 4NQWB 2K3PA 2L9NA 3OOUA 2XC7A 2CV0A 2PMZA 4C2TA 4BUPA 2GOXB 2W1OA 2ZSIB 4E7KA 3LSGA 2IS2A 4D1QA 2PJRA 1X19A 2RNGA 4BL0B 3M8JA 4C2UA 5HNHA 1BR1A 4XKBA 4RLFA 2CUZA 4JOMA 4MLOA 2FUG2 3DKXA 1X1BA 3FDYA 3QODA 2HQAA 3SDBA 3F9KA 1JI8A 2VIXA 4YELA 1HA8A 3BG6A 4BEHB 3OS2A 3TL4X 3BCBA 2IXSA 4XOPA 1OLTA 3LSMA 3PUBA 3OMYA 4BE0A 5FRMA 1R6RA 3OYFA 2F4IA 2LBFB 4CCKA 4BQOA 2E1MB 1W36C 4RMNA 4BJTA 4DOZA 1MMAA 3RQ4A 3K4MA 3OYMA 4ZYAA 4XOTA 2Z1DA 2KRHA 3U21A 4F92B 5KNLA 1UELB 3H5AA 4HSTA 2A5WA 1Z21A 2MYSA 2KL4A 4XN3A 1SAUA 3K4CA 4IX7A 2CW7A 4CSWA 2KLOA 1N78A 3KYLA 2WB1A 2VKHA 2BW3A 3HC7A 1QHHD 4E7JA 2R7SA 3MD2A 3NWSA 4FASD 4QPOA 4DJAA 3MKWB 3S93A 3H35A 2ELJA 4B44A 3DPUA 1D0YA 1X4OA 4N4NB 3EUAA 1FMWA 3PNYA 1NG6A 4IQ4A 3MKZA 2OV7A 2JSPA 2HPMA 2VQLA 4KJZA 1WFXA 4HPQA 2R7OA 3OR2C 2HVRA 3SYTA 2CMPA 4KITB 5HOOA 3VYUB 3G2BA 2JA2A 4U87A 3OS0A 4ZDOA 2L7KA 4CCOA 2BVLA 1LFPA 3V42A 4GRIA 4Y3OA 4PFPA 2HVQA 4ZTJA 3OR1C 2KHMA 3HOSA 3PFYA 4X0GA 3D5SC 4II3A 3OL3A 3AL0C 3OIPA 2LRDA 2VXDA 2WADA 4PUSA 3DEEA 3PNVA 4PK4A 4LIUA 4XLAA 2ZXIA 1WJBA 4P1WA 2R4GA 1G8XA 4CA0A 2R7RA 3LL7A 3M1CA 1MNEA 3RPUD 3S8PA 4BJ5C 1Y56A 3HL2A 2HPIA 3QYFA 3UNGC 1X1CA 2MFZA 4D9JA 4XLCA 1AA7A 3CESA 2UV1A 4FETA 4NC7A 4F3QA 3L2RA 1G59A 2LOOA 2VASA 4E7SA 4E7LA 4KT6A 3DLAA 4HNTA 3DTKA 2ZFUA 2O5RA 3MMYB 2VL8A 2OC6A 3OYJA 3HOTA 4E4HA 3CJQB 2KRCA 3TMOA 3L2UA 4E6KG 3RTRA 2M0MA 2JVHA 4HSRA 2BOLA 2XDVA 3EUHC 3ZR8X 4CCMA 2MD0A 4YEJA 2WAQA 4F91B 3SEZA 3ZGKA 4XKCA 1X1AA 3OY9A 2OUMA 2X6YA 1WJEA 2R7WA 1P9QC 4IQJA 2W00A 2VJ4A 3IAS2 3K70D 3C2GA 1TZLA 3J7AY 3A4CA 3OYBA 4HEA2 2LREA 3AFHA 3ZQQA 2CH0A 3LSKA 3DTIA 4LG3A 4ZTFA 4OAZA 3ONQA 4CH7A 3BLYA 3OYCA 1KONA 2HNHA 4JQFA 2R7TA 5TGTA 3EPZA 1J09A 2WAEA 3AKZA 1DGRM 5HLTA 1X4PA 3NWTA 2HDWA 2IGMA 3PSFA 2K9LA 3OYNA 4IKFA 1DGWY 4PJJA 4BEHA 3OYLA 1YX3A 2W7NA 4AVZA 1PJRA 2X6XA 2VXZA 4XM3A 3VSKA 3GBGA 3DU5A 3W2WA 2VPLA 3OL4A 1VZ0A 3OWTA 1UG0A 2LBFA 4G6TB 3EUKL 4PJMA 2W4SA 2V7FA 2DCEA 3OYKA 3I9V2 4NUBA 2M3AA 4J00A 3K4NA 5CQEA 2F6CA 2IGNA 2RQQA 3DTEA 3HKZA 1DP3A 2V9KA 2E5ZA 1OR7C 4F55A 4EATA 4B3XA 2LY1A 3PNTA 2VJJA 2R7VA 2IGKA 2VJIA 3DU6A 3L2WA 2HZDA 2MABA 4DGWB 2M4GA 4PFOA 2LG4A 5LD2C 1D0XA 3I3LA 4C30A 3FHNA 4XLHA 2VJ5A 1GLNA 3IP4B 3HXLA 2JUGA 4DBRA 3SEQA 3DWLE 1V5GA 4BS9A 2DT7B 4XQFA 3BC8A 2VLAA 2L5QA 4BDZA 2L9SA 3L2QA 3PL8A 4XKWA 3L2VA 3LFUA 2X1DA 2E60A 3ZCOA 3C2HA 3LMMA 3DPLC 1WJCA 4PSWA 3OYDA 2CV2A 2AQFA 1QU3A 2E5NA 1DQUA 2XF6A 5CPRB 1N77A 4ITVA 2HU9A 4BQQA 2CW8A 4NC8A 3SZGA 3VYSB 4PJNA 3H5NA 3H9GA 1ERDA 2E1MC 4R79A 1YX5A 3OYAA 2UUZA 3QYBA 3OIQA 4NNJA 4U7BA 1MMDA 2KQRA 4RM2A 3VSLA 4BQNA 2LY2A 4AU7A 1MMNA 3VDXA 1D0ZA 1D1BA 3OYEA 3KX2A 4CZCA 2CS3A 2WY8Q 3CP8A 3S32A 4F93B 3K10A 5JHFA 3HG9A 3S3MA 5CKTA 3S3OA 3E1SA 2XF7A 1T0FC 2JVGA 3LSHA 4BACA 1W36D 2KZVA 3H9JA 3AL0B 3OYIA 2IS6A 4XNFA 2WAFA 1E0EA 2BVMA 2Q1ZB 2LH9A 4H4KC 3VYRB 1QHGA 4XR6A 2M7AA 3BCAA 1LKXA 2DJIA 2DOAA 2DT6A 4B48A 2HVSA 3H0DA 5KCMA 3K6GA 4ZDLA 2M4KA 2QKLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBN B;  3FBI B; 
#chains in the Genus database with same CATH topology
 2EA2 A;  4XOR A;  1X3Z B;  2GIV A;  2WY7 Q;  3F8C A;  1XGN A;  2M30 A;  3M1E A;  5F0H A;  2KIM A;  1LDK B;  2BW3 B;  1P2F A;  2R7U A;  3KET A;  1PP7 U;  2LY9 A;  2QSH X;  2MLG A;  2UWM A;  1FP1 D;  3PSI A;  3FXU A;  1Y8R B;  2QSF X;  5CVJ A;  2ZO4 A;  4Y4R A;  5FD5 A;  5DCM B;  1REP C;  1I1S A;  2Y2Z A;  3BOQ A;  1R58 A;  1MDM B;  3RCO A;  1ULY A;  4ZC3 A;  1E3P A;  2KPM A;  4EEF G;  4A12 A;  1U0J A;  2HS5 A;  1NHA A;  1MND A;  2X6W A;  4L5E A;  2XPV A;  4JBA A;  1XGS A;  4N9H A;  3KP5 A;  2R0Q C;  2Y9Y A;  3DEW A;  3K4B A;  1FOW A;  2QF7 A;  2YUS A;  1OCT C;  2LC2 A;  2Q2E A;  2XRL A;  1HQC A;  3TDZ C;  3MVP A;  1TT0 A;  4P55 A;  2EPF A;  4E7I A;  2D1H A;  3A01 B;  1QRY A;  4GYG A;  3IAM 2;  5B1B H;  4HRI A;  3S2D J;  3PIP F;  1R49 A;  1ACI A;  2P7C B;  1EF4 A;  4RB0 A;  2IT0 A;  3I4N J;  4CCL A;  2EFN A;  2GXG A;  2CFO A;  3HKZ N;  2K9M A;  2OF7 A;  3RKW A;  1ZTR A;  3A1Y A;  2Z3Y A;  2KIQ A;  3WGG A;  4UUT A;  2AQE A;  3TBI A;  3QOE A;  1SFU A;  2PLY A;  1H0M A;  4KIF A;  5GTH C;  2DOD A;  3TW7 A;  2ZXH A;  3RSN A;  1S6L A;  2CQX A;  4I99 C;  2O9L A;  3TOB A;  1XSX A;  1BBY A;  2XB0 X;  4ZDP A;  3K4K A;  4RM3 A;  1K6Y A;  2VT2 A;  2P0W A;  2FJ1 A;  2OQR A;  3WG9 A;  1BR4 A;  1RIO H;  3DPT A;  2M34 A;  1T08 B;  5E3N A;  2XSJ C;  3ABU A;  3WTY C;  1XD7 A;  5A2Q K;  4U0V A;  1LVK A;  2DA7 A;  2KDO A;  1BN5 A;  2LFB A;  5HOD A;  2DMN A;  4U88 A;  1Y6I A;  4J01 A;  4KIS A;  4BQA A;  3QOP A;  4I09 A;  1FLI A;  1BOB A;  4NDL A;  4M3D A;  4BE2 A;  2V79 A;  1HSJ A;  2XAJ A;  4OIR F;  3J7Y J;  3RZD J;  2X1E A;  5K7F A;  5FLM J;  2HZT A;  1IF1 A;  4D0P A;  1BA5 A;  4B8X A;  3ERE D;  4OWR B;  2CUE A;  1GXQ A;  2CUJ A;  4Y13 A;  4PJL A;  4CCJ A;  3AG1 H;  5K7H A;  1RR7 A;  4IHT A;  3ML6 A;  4HBL A;  4BU2 A;  3S3N A;  1IJW C;  5F0C A;  3IUO A;  4BE1 A;  4HV6 A;  1WJA A;  1ONV A;  2V1D A;  2MH2 A;  2DT5 A;  3J80 K;  4XLE A;  5ICE A;  4ESJ A;  1QPI A;  3IV5 A;  3KPH A;  3OOU A;  1UJ8 A;  1KU9 A;  2XC7 A;  1SFO J;  4C2T A;  2GOX B;  1QO0 D;  3OSG A;  1POG A;  2PFB A;  2ACJ A;  3WU2 C;  4C2U A;  5J6X A;  1BR1 A;  4XKB A;  4F7Z A;  2DA4 A;  2MGQ A;  2CUZ A;  2BY2 A;  3HRS A;  1J7K A;  1LDD A;  4XID A;  2ZJQ F;  3SDB A;  4G7H F;  1RNL A;  2FMY A;  1HA8 A;  4HDV A;  3BG6 A;  2CJJ A;  2CWE A;  2YU3 A;  2F4O B;  2CYY A;  4WXD A;  3TL4 X;  3BCB A;  4EM2 A;  3HGG A;  4TV7 A;  2M5W A;  4J19 A;  4YG2 F;  4BE0 A;  5TRD A;  2M0C A;  2DDA A;  4UNO A;  2F4I A;  3NRV A;  4M3B A;  1SD7 A;  3RYP A;  3H36 A;  1APL C;  2KZG A;  3JW4 A;  2ZME B;  2IW5 A;  4RMN A;  4BJT A;  3MQ0 A;  1ZAO A;  4ESB A;  2A6H F;  2MD5 A;  3HOU J;  2KRH A;  1KYW A;  4G9Y A;  3HRT A;  1UEL B;  3LOC A;  3H5A A;  4HST A;  4IHW A;  2VPR A;  4Y7N J;  4ENM A;  1XX5 A;  4CSW A;  2NYX A;  1N78 A;  1S7E A;  3ECO A;  3M07 A;  1JUM A;  2WB1 A;  3DEU A;  1D5Y A;  2LVS A;  5J3L A;  3ROU A;  2DMU A;  1W5T A;  1QHH D;  3GTP J;  2R7S A;  1QPM A;  3H3U A;  1Z7U A;  4FAS D;  4RGS A;  4QPO A;  3O3K A;  5E20 A;  4XRS G;  4G94 A;  3S93 A;  1ETK A;  4M6X A;  1JE8 A;  4IRH A;  3DPU A;  1XMA A;  4HDU A;  2DK8 A;  4N4N B;  1YRN A;  4IQ4 A;  3BG9 A;  4MGR A;  2JSP A;  2HPM A;  3MZY A;  2CQN A;  1U9O A;  4HPQ A;  1OPC A;  2QBY B;  3OR2 C;  2M45 A;  3SYT A;  4CIC A;  3WTT C;  4IOC F;  1K79 A;  3VYU B;  1E2X A;  4A6E A;  3HYI A;  2IEK A;  3BJA A;  4FE4 A;  5J4V A;  4O3M A;  1R1T A;  1SD4 A;  1LFP A;  4XK4 A;  3R4K A;  2FQ4 A;  4DZJ A;  2WC2 A;  1QZY A;  3S2H J;  3IL2 A;  2VBY A;  2GWR A;  4A3M J;  4ZTJ A;  4CYD A;  4I2O A;  3HOS A;  4KMF A;  4II3 A;  3GTM J;  4BHP A;  1P7J A;  4EV0 A;  3OIP A;  2V9V A;  1XTA A;  4PUS A;  2DA6 A;  2FA5 A;  3DEE A;  2Y48 A;  3GFM A;  4PK4 A;  1FTZ A;  4V2G A;  3WTX C;  2BE5 F;  2STW A;  1B59 A;  4XLA A;  4XIC A;  3BJ6 A;  4JK1 X;  1RPW A;  2R4G A;  4U0W A;  3U9G A;  1XSD A;  3M1C A;  2GA1 A;  3RPU D;  4U0Y A;  2TDX A;  1VQK I;  2NS7 A;  3HL2 A;  3RZO J;  4IRI A;  3E6M A;  4EJV A;  3UNG C;  5BPD A;  4XLC A;  2UV1 A;  2QCO A;  2OA4 A;  3E5U A;  2XIG A;  3JTG A;  2DMP A;  1WQ2 A;  2XAH A;  2LOO A;  2VAS A;  4E7L A;  2Y75 A;  2QSG X;  2JA7 J;  3QWL A;  5GPC A;  2JT1 A;  5LHI A;  3L9F A;  5IPA A;  4E6K G;  1MH4 A;  4HSR A;  1C0W A;  2EFW A;  2XV4 S;  1Y8Q B;  3MZH A;  3B73 A;  4BKX A;  2EIM H;  5C3E J;  1T33 A;  5J4Y A;  5FFX A;  3V7S A;  2EFP A;  2H94 A;  2A69 F;  1L0O C;  1R5G A;  1CGP A;  3ISP A;  3ZGK A;  3KCC A;  5GAG J;  3OY9 A;  2Z99 A;  1WJE A;  2R7W A;  3FXK A;  5ICC A;  5M3M J;  2W00 A;  1VQ4 I;  5FLX Z;  2L7M P;  1TZL A;  4HF0 A;  3ELK A;  2HWV A;  2M2E A;  4X1E A;  4RBO A;  3CLO A;  5IOZ A;  2FOK A;  3BWG A;  3SFI A;  3ZQQ A;  3LSK A;  4ZTF A;  3ONQ A;  2EZK A;  3ZMD A;  5CVV A;  4CH7 A;  3CCM I;  2W24 A;  3ECH A;  2PG4 A;  2NRA C;  2FX0 A;  5K5Q A;  4PCQ A;  4ZZL A;  3OYC A;  2PN6 A;  2L9V A;  3EPZ A;  3E3V A;  2VOD A;  2H09 A;  3F22 A;  1DGR M;  3CCS I;  2E19 A;  2IBD A;  1KQ0 A;  1MJB A;  3PSF A;  4BHC A;  2XPW A;  2R7F A;  1BJZ A;  2XPU A;  1MGT A;  4UB6 C;  2ADU A;  3CME I;  4AVZ A;  5CLS A;  2CO5 A;  4L5J A;  3LST A;  4L9J A;  4XM3 A;  5J8C A;  1VQ7 I;  3GFL A;  3HRM A;  2VPL A;  1FX7 A;  3TW6 A;  1NK2 P;  3CLQ A;  1UG0 A;  1K83 J;  1USS A;  4ZYE A;  3JRE A;  4RGU A;  5B5E C;  1FY7 A;  5GPA A;  4BYY A;  3W6J B;  5LHH A;  2ISY A;  5EGO A;  1JTY A;  2QLZ A;  4KUM A;  5F6F A;  1GVD A;  3KEQ A;  2FRH A;  3HTS B;  2GAU A;  3HJE A;  3DTE A;  5HLH A;  2EV6 A;  2V9K A;  3SQN A;  3F72 A;  3FK6 A;  3BRO A;  3T8R A;  3IH2 A;  3M3Y J;  1MBE A;  4LMY A;  2DPD A;  2ECB A;  3O2P E;  5LBQ A;  2HDD A;  2DDB A;  2VJJ A;  1ITY A;  2R7V A;  1T0F A;  1LE8 B;  2VJI A;  4ESF A;  2HZD A;  3F3X A;  2XKP A;  1VQL I;  2JSC A;  1TT5 B;  4DGW B;  3FIS A;  3ZMT A;  5GTI C;  3I5U A;  2HXI A;  4PFO A;  3TP3 A;  2STT A;  2L7Z A;  1D0X A;  1B72 B;  3FHN A;  1NTC A;  1ETW A;  3BDD A;  1GLN A;  1O3R A;  2Z5U A;  2O61 A;  3SEQ A;  2A05 A;  5DM6 F;  3BC8 A;  1UFM A;  2W84 A;  3FXQ A;  4BDZ A;  1I6H J;  4FIS A;  4BXU A;  4RB2 C;  4KIB A;  2XAG A;  2JPB A;  4HAM A;  3C2H A;  3RPQ A;  4LG0 A;  4CYC A;  1QZZ A;  4N0B A;  4ASN A;  1JGG A;  3OYD A;  2AQF A;  5LHG A;  2E5N A;  1W0U A;  3U1K A;  4LLN A;  5CPR B;  1N77 A;  3RKQ A;  3M8F A;  3S1N J;  1Z67 A;  2PBI A;  3ZP5 A;  4A3B J;  4PJN A;  5E3M A;  3GTG J;  3HHH A;  1SFE A;  2E1M C;  1AKH A;  2EIN H;  3ERM A;  2X4H A;  2DOE A;  1M1E B;  2NS8 A;  2DK5 A;  2EZI A;  4DYR A;  1MMD A;  1L3L A;  4X6A J;  1VQO I;  4UUS B;  4BH9 A;  3EYY A;  2HTJ A;  1A6I A;  3PQJ A;  1R4M B;  2B7E A;  3CP8 A;  5ERI A;  3S32 A;  4A3D J;  2VKE A;  3WU1 B;  2O8X A;  3K10 A;  3F21 A;  1PUF A;  2P5V A;  3QU6 A;  3CUQ A;  3S3M A;  3F8M A;  3S3O A;  3BG3 A;  2JVG A;  3LSH A;  2ME6 A;  4BAC A;  1MBH A;  2EH3 A;  1XCV A;  1SD6 A;  1ZYR F;  2BVM A;  4XRF A;  1I6X A;  2R5Y B;  3ZQL A;  2M7A A;  1LUJ B;  2JRT A;  4ZH4 F;  4HF1 A;  4A2U A;  2ZJP F;  1E3H A;  4HV5 A;  4HLY A;  4EJT A;  2XVC A;  2HVS A;  2DTR A;  3QU3 A;  1UHM A;  4Q4Z F;  1FYM A;  1XDS A;  4ZDL A;  2RV8 A;  2X6O A;  2DA3 A;  1T95 A;  4A3E J;  4E7Z A;  2A6T A;  3OS1 A;  2JJ7 A;  4JX6 A;  1YIO A;  1ZRF A;  2IS4 A;  2RRE A;  1EH6 A;  4A3C J;  1SFX A;  3VYT B;  1RKT A;  3HTU A;  2Z9O A;  2OU2 A;  5LGT A;  2VQC A;  4QTR A;  1UAA A;  3D5L A;  2QYO A;  3T0Y A;  3PQK A;  2MH9 A;  2NOJ B;  1X3U A;  2QQA A;  3K70 C;  3R60 A;  4BDY A;  3AAF A;  5J1R A;  4G6Q A;  2G9W A;  2K86 A;  2V1N A;  2W48 A;  4OAY A;  5E79 C;  1ZEL A;  1EH8 A;  1K6O A;  3BJO A;  4IVN A;  1J75 A;  1J2X A;  2KMU A;  2B63 J;  1IDY A;  2IGO A;  3DQV C;  3REO A;  3FX3 A;  4YII A;  4IO9 F;  2LYC A;  5HVQ C;  2A07 F;  2V4J C;  1T56 A;  1WJF A;  3CD6 I;  2HOT A;  4KA4 A;  1YTY A;  1U6G A;  2M7B A;  1TWC J;  1R22 A;  5DS9 A;  1T98 A;  2DFI A;  4FCY A;  1R71 A;  4A3J J;  1FYL A;  1D5V A;  2XGE A;  2W82 A;  3K4J A;  2E2J J;  1QQI A;  2ZKZ A;  3TO6 A;  1ETV A;  3B02 A;  4IHX A;  2ZSH B;  1YJ9 I;  5LFA A;  1E17 A;  2P6T A;  3KP7 A;  3P9C A;  3T1B A;  1O7F A;  3W2A A;  2ESN A;  2X85 A;  3D5R C;  3J81 K;  1WJ5 A;  1N75 A;  3S14 J;  4UUV A;  4UVA A;  2TRT A;  4M3F A;  4RGR A;  3C1D A;  1SFK A;  3KZI C;  5IP7 J;  4Z6Y A;  2ZFW A;  1FOY A;  3KP6 A;  5ICG A;  2NXN B;  1S9H A;  4QPQ A;  3Q9S A;  3GFJ A;  3ZQG A;  2L2O A;  4ZJZ A;  2QKM B;  3K1P A;  3GUD A;  5CQG A;  3QPT A;  3BTC A;  3TOA A;  3RKX A;  2OTL I;  2LR8 A;  4YFX F;  3CMY A;  4HA8 A;  1PYV A;  3GX4 X;  1D1A A;  3CC2 I;  2DMT A;  4Y33 A;  3GME A;  3PJR A;  3DKY A;  1IN7 A;  5KVR A;  4HYE A;  2L02 A;  4AM3 A;  2Y0S A;  2PJR B;  2HOE A;  5HS8 A;  2KIU A;  3FBN B;  1U5T B;  3WU0 A;  1RR8 C;  3FK7 A;  3K1M A;  1K4S A;  1ENH A;  4I76 A;  1Z3X A;  1VF9 A;  1FMV A;  1TTY A;  2VQH A;  2ELH A;  3H9Q A;  5DM7 F;  5FFZ A;  1P92 A;  1G6N A;  5LGU A;  2ID6 A;  4KFC A;  1WH5 A;  1VQ8 I;  4BXF A;  5FRO A;  1YS7 A;  3ASN H;  4YRV A;  3K4L A;  2QWW A;  4B47 A;  4LIT A;  2M8E A;  3QAH A;  3WOD F;  1LEA A;  1XMK A;  2E1O A;  2JWT A;  1FSE A;  2WV1 A;  2M87 A;  2W1O A;  2ZSI B;  2M8G X;  4E7K A;  3Q0U A;  3CCE I;  2RNG A;  1ZR2 A;  1TWF J;  1B6A A;  1MH3 A;  2NOG A;  2HKO A;  5F27 A;  3H3V K;  3E6B A;  5EZG A;  3M4O J;  3DKX A;  3QOD A;  3IHU A;  2HQA A;  2OZ6 A;  5DDG A;  3ZOB A;  2VIX A;  2LDU A;  4M3E A;  1JKP C;  1MBJ A;  1WRJ A;  3ZMV A;  4OIP F;  2R5Z A;  3V8L A;  2IXS A;  1U3E M;  1OLT A;  3LSM A;  5JVT A;  4C3H J;  4AIK A;  2K3F A;  4HNV A;  1BI1 A;  2IA0 A;  3K2A A;  4FX0 A;  1R6R A;  4UV9 A;  5HS7 A;  2AXL A;  2H8W A;  3GCM A;  4R8H A;  4G12 A;  1YW8 A;  1G3W A;  2LMD A;  3F8F A;  1MMA A;  3SXY A;  3RQ4 A;  2JA8 J;  2Z1D A;  4L0Y B;  3QRF F;  4L0Z B;  1SAN A;  2MW8 A;  2X48 A;  3CCY A;  3QPL A;  2K4B A;  1K78 A;  5IYD J;  2H1K A;  1SAU A;  2DFH A;  5E1W A;  2CW7 A;  4LB5 A;  2KLO A;  2HYF A;  1W7P D;  5EJC A;  2ZB9 A;  4E7J A;  2VE9 A;  4RS8 A;  3NWS A;  3BR6 A;  3I4P A;  4DJA A;  3MKW B;  4I6Z A;  5AIQ A;  2ELJ A;  4G7Z F;  1D0Y A;  1X4O A;  2CQQ A;  3CUQ C;  1O7L A;  1R5I D;  3LAJ A;  5ED4 A;  3MEX A;  4Q5S F;  2XAF A;  3QQA A;  3HM5 A;  3MWM A;  2VQL A;  1YJW I;  5EDN A;  1F1Z A;  2R7O A;  2HVR A;  4KN4 X;  1OFC X;  4KIT B;  5HOO A;  1MSF C;  1KYZ A;  2IPQ X;  3FIW A;  4FX4 A;  4L18 B;  2XRN A;  2NVT J;  3OS0 A;  4ZDO A;  5M5X J;  4CZZ A;  4H0E A;  3K1N A;  4XSX F;  3V42 A;  4PFP A;  4LG0 B;  3DBL B;  4M9S A;  5E1Z B;  4IRG A;  2ID3 A;  1IRF A;  1GT0 C;  4ENJ A;  2L4A A;  3PFY A;  4HOB A;  5F64 A;  1OCP A;  1TW3 A;  3CCL I;  2EWN A;  4FHT A;  1UHW A;  2LRD A;  1P7I A;  2VXD A;  3DBR B;  3SZT A;  2XAQ A;  3WTW C;  3K7A J;  2WAD A;  5D4S A;  1QNT A;  1MBF A;  3LSJ A;  1IC8 A;  3PNV A;  1B9M A;  2LKP A;  4LIU A;  4EJU A;  1BC8 C;  3ULQ B;  2BY0 A;  5JLW A;  2ZXI A;  3I55 I;  2VBW A;  4P1W A;  4UB8 C;  3IRQ A;  1G8X A;  2R7R A;  3WTV C;  3S8P A;  4BJ5 C;  2OZU A;  1X2M A;  1Y56 A;  3C18 A;  3BR5 A;  4OOI A;  1TQP A;  2FE3 A;  2QGU A;  1IXC A;  1EV7 A;  3CES A;  5CVU A;  1TWA J;  4I02 A;  5H6Q A;  2HDC A;  1G59 A;  3D0S A;  3CUO A;  2EB7 A;  4MO7 A;  2RC4 A;  3LA2 A;  3HUG A;  3ZQI A;  4HNT A;  3DTK A;  2ZFU A;  2Q0O A;  3MMY B;  1Z1D A;  2Z33 A;  2XSD C;  2KRC A;  2NVY J;  3RQI A;  3F23 A;  2Y0M A;  3L2U A;  1FZP B;  3A02 A;  3DCF A;  3E5X A;  3SZP A;  1BI0 A;  3ZR8 X;  4Z2Y A;  2EA4 A;  5J47 A;  2E1N A;  2NNY A;  1Y1W J;  2FD5 A;  2WAQ A;  4M71 A;  1FBQ A;  1TC3 C;  3LFK A;  4XKC A;  1WPK A;  4ZYG A;  2KDZ A;  4EGY A;  2K9N A;  1T6S A;  2GA2 A;  2BYV E;  3U2R A;  4B4C A;  4IQJ A;  1Z91 A;  5F1J A;  1UST A;  2HR3 A;  1FYK A;  4YIR X;  2VJ4 A;  4AYB N;  3WE3 A;  2EIK H;  3V7C A;  3S1Q J;  3J7A Y;  2H1L A;  2JTV A;  1LVA A;  3MFK A;  3AFH A;  3GZ5 A;  3WHC A;  4NQW A;  4BY7 J;  3RKY A;  4EVI A;  3DTI A;  5D5U B;  1O4X A;  1JUS A;  1VQM I;  3BTJ A;  1F5T A;  5D8L B;  5EEH A;  3BLY A;  2P4W A;  1KON A;  1WI3 A;  5HDG A;  3H1C A;  1J09 A;  3AKZ A;  3NWT A;  2EIL H;  2KJC A;  4JX5 A;  2HDW A;  3GLL A;  4V19 K;  2IGM A;  1WSU A;  5ICF A;  3R6S A;  2OTJ I;  1B8I B;  1RRJ A;  1HDP A;  4BEH A;  3OYL A;  2W7N A;  5E8G A;  2AO9 A;  3WTZ A;  4DZP A;  5KAF C;  1PJR A;  4MEX F;  2P5K A;  3HZJ A;  4IHY A;  1ZRD A;  3A03 A;  3KE2 A;  3GTO J;  3OL4 A;  2FBI A;  4UVC A;  3G3Z A;  5CVR A;  3QPS A;  2ISZ A;  2V9P A;  3ZN1 A;  2V7F A;  2QA4 I;  3JAM Z;  3LWF A;  2DCE A;  2NVU B;  5IT9 K;  1MJA A;  2Y30 A;  4NUB A;  3IRR A;  5BMZ A;  1BM9 A;  1MBK A;  1V4R A;  3ABK H;  2F6C A;  2IGN A;  2RQQ A;  3H3Z A;  3HKZ A;  5F08 A;  1DP3 A;  2E5Z A;  2F2E A;  2L01 A;  3GEZ A;  4F55 A;  3LSP A;  3I59 B;  1EJ9 A;  2XGC A;  1WGX A;  4GGG A;  1LDJ A;  1YQA A;  1GUU A;  3PNT A;  1WWX A;  1HKQ A;  2GIZ A;  2PX9 A;  2KIS A;  3K2Z A;  2BEO A;  2UXN A;  2M4G A;  2NAZ A;  4WXH A;  2EZH A;  2LG4 A;  4B09 A;  3IKT A;  1MNM C;  1IN4 A;  3MAJ A;  3CCR I;  5IP9 J;  1F9N A;  3IP4 B;  4XLP F;  3S17 J;  3DWL E;  3BY6 A;  3FKI J;  4I01 A;  2YX4 A;  2DLL A;  1V5G A;  2D2W A;  4XQF A;  1D3Y A;  2L9S A;  3L2Q A;  1HW2 A;  2GXA A;  5DTD A;  3R0J A;  1VQ5 I;  2X1D A;  2E60 A;  1ODD A;  2XKO A;  5ILS A;  4C2M J;  1VND A;  2O8K A;  1BW6 A;  1VQN I;  5EG0 A;  1D8K A;  2DOF A;  1G3Y A;  1WCM J;  2J5O A;  4BQQ A;  4NC8 A;  3BTI A;  2FU4 A;  4I98 B;  2UUZ A;  4NB5 A;  3OIQ A;  1W5S A;  2BHY A;  3ABM H;  3FXR A;  3P9I A;  2KQR A;  1BI3 A;  2LY2 A;  3VDX A;  1O3T A;  3FM3 A;  1ZAR A;  3OYE A;  3G4S I;  4CZC A;  1FP2 A;  1ON2 A;  2CS3 A;  5BS6 A;  3SDG A;  4RAZ A;  4F93 B;  4DYQ A;  5FGM A;  3NQO A;  3O8H A;  1OYI A;  4RGX A;  3J7Z I;  3RI4 A;  1E3O C;  1IZ1 A;  2LKS A;  3JRG A;  2DO7 A;  1IV8 A;  2R5Z B;  1YI2 I;  3E1S A;  2D1V A;  2LTP A;  2QUF A;  3H9J A;  4AD9 A;  3OYI A;  2IS6 A;  1V55 H;  1MBG A;  1QHG A;  4AWX B;  3HOW J;  4XR6 A;  5CYV A;  2P6S A;  1HF0 A;  2CG4 A;  2DOA A;  4B48 A;  3H0D A;  3Q0V A;  3TDU C;  3L00 A;  1G3S A;  2F5F A;  1T38 A;  2QKL B;  1SAX A;  1BW5 A;  2DTZ A;  2V6E A;  1SD5 A;  1K78 B;  5EZH A;  4A5M A;  2GM4 A;  2F5D A;  5C4J J;  3HEF A;  3P9K A;  1D8J A;  3ABL H;  2HOA A;  2XF5 A;  2VON A;  2ECC A;  3FKJ A;  4WXC A;  3JRA A;  4M6V A;  3GFI A;  5A2Q Z;  3KYC B;  1JXS A;  2Q2E B;  4ETS A;  5FRN A;  4IOA F;  4P96 A;  3I64 A;  5D6E A;  4LIV A;  2KJB A;  1MKM A;  2ELK A;  3ZQH A;  5L3F A;  4RLQ A;  4HQM A;  5AIP A;  2E36 A;  1FSH A;  1IO2 A;  3L7W A;  1XDU A;  1J59 A;  3HBL A;  2CV1 A;  4WWC A;  3A2K A;  4BJ6 C;  5LRS A;  1XB4 A;  1R9T J;  4N4O B;  1Y0U A;  1JKR C;  1WJD A;  1YE9 A;  1ZLK A;  3OYH A;  3E6C C;  3GLX A;  4LJZ F;  3BG7 A;  1U78 A;  1MW7 A;  3BR3 A;  3BPX A;  4FQG A;  5HLI A;  3ZMS A;  4F52 A;  3SHF A;  3COA C;  4A3K J;  5HNF A;  1IW7 F;  5IY5 H;  2CSO A;  2HXO A;  3J80 Z;  4XON A;  1OCO H;  3H5R A;  1FEX A;  1V54 H;  4RAF A;  5GP9 A;  2K02 A;  2PMH A;  3CJR B;  2R7Q A;  3D1N I;  1KGS A;  4PJ0 C;  3EUH A;  3VOD A;  2VB6 A;  2L7F P;  4CUG A;  3JRC A;  3CZ6 A;  2YS9 A;  2Z16 A;  5H6R A;  3ZN0 A;  4MTE A;  1HOM A;  3CDH A;  4QWQ A;  2HKX A;  3OYG A;  3HPG A;  2WBM A;  1EA3 A;  4BXX J;  2F5E A;  2K5C A;  2X9D A;  2ZXJ A;  2LNB A;  3FWE A;  3W2V A;  5HDK A;  1V5E A;  2PMU A;  4IXA A;  4AID A;  5E3L A;  1LB2 A;  2EV0 A;  4P5O A;  3A01 A;  2R92 J;  4RA2 A;  4MIM A;  5JHU A;  2LD5 A;  1AWC A;  3O6B B;  1SVL A;  4L9T A;  1ZG5 A;  2WWY A;  2VKD A;  2V26 A;  1WVR A;  4BGD A;  4C9Y A;  3HUG B;  3QYE A;  4XN0 A;  2NVQ J;  5L3G A;  1FOK A;  2MC4 A;  1I1G A;  3BT9 A;  4HG2 A;  5L3E A;  5GAE J;  1TNS A;  2GOM A;  2JK3 A;  3ASO H;  3PIO F;  2O6G E;  1F43 A;  1UHS A;  4A3G J;  4WK8 F;  2LLK A;  4XL9 A;  4DBQ A;  4R1H A;  1CF7 A;  1YYV A;  1HDD C;  1JT0 A;  1P6R A;  1OCZ H;  1H89 C;  3IKV A;  2W25 A;  3E0J B;  5FKM A;  3CCU I;  3AG4 H;  1BIB A;  3UR3 C;  2COM A;  2I8D A;  3ZRG A;  3FBI B;  1X2N A;  4IHV A;  4UHT A;  3IWF A;  4OIQ F;  1MSE C;  2X1C A;  4I7H A;  2DFF A;  1O57 A;  2Z2S B;  1GV5 A;  4MFE A;  1K7A A;  2F5V A;  1UG2 A;  3CJT B;  2VOP A;  2AHQ A;  2FXA A;  4XKV A;  3LAP A;  2DU9 A;  1WI9 A;  2O3F A;  3KYD B;  4NQW B;  3AG2 H;  5JI6 A;  1TQM A;  4CO8 A;  1H8A C;  3A0H C;  2CV0 A;  4BUP A;  2DA5 A;  1X19 A;  2OBP A;  2JZY A;  5HS9 A;  1G3T A;  3CCQ I;  3NAR A;  2DFE A;  4ENN A;  1PP8 F;  4KMU X;  2HQN A;  4JOM A;  3OOP A;  4D5C A;  1JI8 A;  1X1B A;  3F9K A;  4NC6 A;  3H0G J;  5DYM A;  1A31 A;  4BEH B;  1XS9 A;  1YFH A;  5M3F J;  1R1V A;  4XOP A;  3O8G A;  3PUB A;  3FHZ A;  1JHH A;  3ESW B;  4FE7 A;  4AIJ A;  1J9I A;  2LF7 A;  1QZE A;  3S1M J;  2LF8 A;  2IRF G;  4NHJ A;  5EEG A;  2E1M B;  2DA1 A;  2V1U A;  1W36 C;  1QVU A;  3PUF A;  5FKK A;  1YRN B;  3K4M A;  5D6F A;  4S05 A;  3OYM A;  4XOT A;  5GAH J;  2IA2 A;  1Z77 A;  2FNA A;  3U21 A;  2D5V A;  1ZH5 A;  2IVM A;  1Z21 A;  4JYK A;  4XN3 A;  2KL4 A;  3V7R A;  4IX7 A;  1RES A;  1DUX C;  1S7A A;  2YSR A;  3EET A;  4QLC U;  3KYL A;  2NVX J;  1R4N B;  3CCJ I;  3PM1 A;  2E2H J;  3JRB A;  3HB9 A;  4N9I A;  2BHZ A;  2QVO A;  1XN7 A;  4B44 A;  1HW1 A;  2DI3 A;  2ZME A;  3EUA A;  1A35 A;  1FMW A;  5DEQ A;  2RAE A;  4XRS A;  1NG6 A;  4D5F A;  1PUE E;  4U7D A;  4L9V A;  2OV7 A;  1OMI A;  1VTN C;  3JRI A;  2QEX I;  4KJZ A;  4XLN F;  2BZT A;  3PO2 J;  2JPC A;  2MG4 A;  3EDP A;  1Z0X A;  4ON0 A;  3G2B A;  2JA2 A;  4U87 A;  1ETX A;  1G2H A;  4KDP A;  3VB2 A;  3RPU A;  4CCO A;  1T8I A;  2BVL A;  3HOX J;  3W6K B;  5B1A H;  4GDF A;  2LK2 A;  4Y3O A;  4LGW A;  1STZ A;  2HVQ A;  1ZGJ A;  2EK5 A;  5EG0 B;  2LP0 A;  5D5V B;  1MIJ A;  3ZMU A;  2Y69 H;  3H92 A;  2KT0 A;  3M9A A;  1BI2 A;  3PFI A;  4MEY F;  5IT3 A;  1H88 C;  1OCR H;  3D5S C;  2L54 A;  1RC9 A;  3AL0 C;  1RZ4 A;  2FOW A;  2KIF A;  3K0L A;  3DXJ F;  3U1D A;  1LJ9 A;  3X2Q H;  4JX4 A;  4Q47 A;  1LFU P;  3HOZ J;  2L9R A;  5E1X A;  3FMR A;  1A36 A;  4RDU A;  2FQ3 A;  2FML A;  3IWZ A;  3MZ8 A;  3WTU C;  4A0X A;  1U8R A;  3BG5 A;  1MZB A;  4CA0 A;  1LPQ A;  2GZW A;  1OYY A;  3F0C A;  4G6D A;  2HPI A;  3QYF A;  1J0R A;  1X1C A;  3GYH X;  2MFZ A;  5ILV A;  4XRM A;  4D9J A;  1K4T A;  4GFB A;  1AA7 A;  1BC7 C;  3ZQF A;  1OIS A;  4FET A;  5AON A;  4NC7 A;  3BTL A;  5HLG A;  3I56 I;  2WTE A;  4E7S A;  5IYC J;  1IXR C;  3BP8 A;  2K85 A;  1ZK8 A;  3DLA A;  4KT6 A;  4LOC A;  2GLO A;  2NNN A;  2VL8 A;  3DP7 A;  3OYJ A;  5F1R A;  3HOT A;  1IG7 A;  5C44 J;  1HC8 A;  3CJQ B;  1H9G A;  3Q5F A;  1ZQ3 P;  3V8J A;  2M0M A;  2JVH A;  3FXJ A;  3BR0 A;  3ZQ7 A;  3EUH C;  3TO9 A;  2X0L A;  2DN0 A;  4CCM A;  1B9N A;  4F91 B;  4YEJ A;  2A6E F;  3E6D A;  3SEZ A;  3CO7 C;  2F4M B;  1I50 J;  2OUM A;  3R61 A;  1GV2 A;  1P9Q C;  1GDT A;  1UCR A;  5JLX A;  1G4D A;  3K70 D;  2E7W A;  1IAW A;  3C2G A;  4LLG F;  3GTK J;  3A4C A;  3CTA A;  4KIC A;  4M3G A;  4EGZ A;  4HEA 2;  3T5X A;  1I39 A;  3WTS C;  4KYW A;  1A5J A;  4MNU A;  4GO1 A;  4LG3 A;  5E17 F;  4OAZ A;  3LQQ A;  3IH3 A;  2OD5 A;  1YW7 A;  4UXN A;  3QP5 A;  2DQR A;  3LQR A;  5D4R A;  1NH3 A;  2AXT C;  3ABT A;  1P4A A;  2HI3 A;  4JP0 A;  2Y9Z A;  4JQF A;  2R7T A;  2WAE A;  1KZH A;  3CC4 I;  5HLT A;  4C3J J;  1X4P A;  3HSE A;  5EGO B;  2ZNY A;  1AHD P;  3P5J A;  2XGX A;  5D8K B;  2L3D A;  5KK1 A;  2PI0 A;  2A5Y B;  4GYI A;  4AIH A;  3JCU C;  1DGW Y;  4PJJ A;  2OJE D;  5DV5 A;  5E8I A;  2JRM A;  3HGY A;  3VSK A;  1KA8 A;  3DU5 A;  3GBG A;  3W2W A;  1Q1V A;  1XSV A;  3FM5 A;  3B6A A;  1VZ0 A;  1FPQ A;  2H6B A;  2LBF A;  1ETY A;  4A0Z A;  3EUK L;  2R7Z J;  2CFX A;  3MN2 A;  3FXL A;  2W4S A;  2PEX A;  3KZZ A;  3FMS A;  5M5Y J;  3OYK A;  4IL6 C;  4J00 A;  3LA7 A;  4OIO F;  1TLH B;  3OSF A;  5CQE A;  3WG7 H;  2WB1 N;  3CO6 C;  4A69 C;  5DD4 A;  3FXM A;  1W1W E;  2DYS H;  5BPI A;  1OR7 C;  3UKG A;  4ZYD A;  3HHG A;  3ZQC A;  2P81 A;  2QZ8 A;  2VUM J;  4Y15 A;  4OU0 A;  1U2W A;  2E34 A;  5LLQ A;  4M72 A;  3L2W A;  4CYC B;  2MAB A;  1WKM A;  3G6E I;  2EZL A;  5IP6 A;  1S5L C;  1SMY F;  5FLX K;  4C30 A;  3OIO A;  2XHK A;  4GXO A;  5GAD J;  1W5C C;  3QP6 A;  5B66 C;  5F04 A;  1TNT A;  3E97 A;  1PDN C;  2IA1 A;  3BR2 A;  2H8R A;  1KU7 A;  1AKH B;  5EEA A;  4BS9 A;  2EV5 A;  2L5Q A;  2HYG D;  3C2B A;  2H6C A;  4ENK A;  3TO7 A;  2B9S A;  4A3F J;  4KNY A;  4YFN F;  1XMX A;  4XKW A;  1CF7 B;  5C4X J;  2YPR A;  3LFU A;  2A61 A;  3EYI A;  1LE8 A;  1H9T A;  3LMM A;  3DPL C;  4A5N A;  4PSW A;  2CV2 A;  1U8B A;  2N8G A;  1O3Q A;  2XF6 A;  1RI7 A;  1B72 A;  1PUF B;  1FC3 A;  5K7Z A;  4ITV A;  4DNC A;  2HU9 A;  3A0B C;  3FMQ A;  5L3D A;  1W0T A;  2JMW A;  3CUQ B;  4Q48 A;  3HDD A;  2CW8 A;  1SVO A;  1S8N A;  5E18 F;  1VI0 A;  1B4A A;  3BZK A;  4IJA A;  4HLX A;  4B1R A;  2GQQ A;  4E70 A;  3VOE A;  2XUB A;  1ERD A;  4R79 A;  1SEU A;  3OYA A;  2ZME C;  3M8E A;  2MC3 A;  1F36 A;  3QYB A;  4NNJ A;  3BPV A;  3FZV A;  3Q9V A;  1VQP I;  1LQ1 A;  3PO3 J;  2WV0 A;  3VSL A;  4BQN A;  1OQY A;  4ZZD A;  1W4M A;  1FBS A;  1Z6T A;  3FF5 A;  4A3I J;  1J5Y A;  3MCZ A;  3RIR A;  4HX8 A;  5LEJ A;  1X3W B;  5KAI C;  1LEB A;  4K2E A;  2KRF A;  2E2I J;  3DV8 A;  4UVB A;  3HG9 A;  1EKE A;  1ZG3 A;  5CKT A;  4DW6 A;  2HFH A;  4M73 A;  2XGD A;  2LKX A;  1UB9 A;  1BOA A;  4MQ9 F;  5IOY A;  2XF7 A;  4BNC A;  1X58 A;  3CMA I;  3CC7 I;  4BY1 J;  4LK0 F;  4WX9 A;  1E0E A;  2Q1Z B;  1RET A;  4HZF A;  3E7L A;  2LH9 A;  4L9N A;  3BR1 A;  2PMZ N;  1Z6R A;  2R7D A;  1KU2 A;  1XG1 A;  3BCA A;  2ZNZ A;  2DJI A;  4UUS A;  2DT6 A;  2BXZ A;  2M1B A;  3VFZ A;  3J81 Z;  5KCM A;  1DU6 A;  3K6G A;  3RDI A;  1ON1 A;  1JKO C;  2M4K A;  1MMG A;  2L4M A;  1YIJ I;  3CQZ J;  4XLF A;  2HYJ A;  2VKV A;  1ZN2 A;  1EH7 A;  4M74 A;  1FIP A;  4YIF A;  4IPA A;  3W3C A;  4BBR J;  2COB A;  4HW0 A;  2RN7 A;  3I53 A;  2QM3 A;  2O0Y A;  3I71 A;  3GF2 A;  1GXP A;  2G0E A;  1TP4 A;  4CXF A;  4IZZ A;  2R5Y A;  3GTQ J;  4MQV A;  3VWB A;  3DKW A;  2BY3 A;  4MFD A;  3GW2 A;  3N05 A;  3HPH A;  4RAG A;  3ZXS A;  1XGO A;  2DW4 A;  2ETH A;  4D7M A;  1BR2 A;  1OYW A;  2MLK A;  4A0Y A;  5FB2 A;  4II2 A;  1DU0 A;  1RUO A;  3JRH A;  4E7H A;  2KKO A;  5FKL A;  3GO5 A;  1ZKG A;  1ZLJ A;  3DLL F;  2D45 A;  4B43 A;  4DIQ A;  4KT5 C;  1KQ8 A;  2DXI A;  1A6Q A;  1JHF A;  2CUF A;  2YX7 A;  5KHD A;  3CMM A;  2FF4 A;  1A04 A;  2E71 A;  5CVI A;  2ESH A;  3MKY B;  3N97 A;  1Z7L A;  3CF2 A;  3RJP A;  5FD6 A;  2X51 A;  4HNU A;  3GXO A;  3KEY A;  5J8F A;  3AG3 H;  3GZ6 A;  4A3L J;  5B3S H;  2ZCW A;  1T2K A;  3JR9 A;  2ZC2 A;  5BQT A;  4UY8 I;  1YOV B;  3TP0 A;  1TWH J;  3Q0W A;  3KIO A;  2ZBK A;  3SFZ A;  1Z3Y A;  2VE8 A;  4IHS A;  1IRX A;  3WGI A;  3VEP A;  2XAU A;  4PSX A;  2YR2 A;  4I0A A;  1WH7 A;  1YLF A;  2XAS A;  2K4J A;  4ANJ A;  4UV8 A;  1R1U A;  3KFW X;  1VQ9 I;  1X1D A;  1AOY A;  5JFR A;  5E3O A;  3VPR A;  2FSW A;  1TQI A;  5EF6 A;  4Y17 A;  4B3A A;  4DYC A;  2VQG A;  1JGS A;  1N25 A;  4RB1 A;  1D1C A;  3CP2 A;  4XMY A;  2DYR H;  4CCN A;  3L1P A;  2R3S A;  1IN5 A;  1NG7 A;  2LSO A;  3LSI A;  4WCG A;  3T8T A;  2QQ9 A;  3L2C A;  2WA0 A;  1BJA A;  2HQ5 A;  4O5V A;  2UZK A;  1IRZ A;  5CJ9 A;  2W57 A;  5D5X B;  4FT8 A;  2IS1 A;  1FIA A;  1HW5 A;  3RYR A;  1V5F A;  2ZJ2 A;  4G7O F;  2R7X A;  2UXX A;  1RKW A;  2K40 A;  2OAZ A;  2KP6 A;  4AYB A;  1DP7 P;  3M7G A;  6PAX A;  1Z9C A;  3E5Q A;  1IV6 A;  2K3P A;  2L9N A;  3C7J A;  2PMZ A;  4EJW A;  3LSG A;  3F8B A;  3QPH A;  4D1Q A;  2IS2 A;  2PJR A;  4BL0 B;  3M8J A;  4V2F A;  2G7H A;  2EFO A;  5HNH A;  1U5T A;  4RLF A;  1TL8 A;  2HEO A;  4P9F A;  4NBQ A;  2A3S A;  4D7N A;  3B6C A;  2W85 A;  5BOX A;  1I5Z A;  1LNW A;  2RKH A;  4BBS J;  2FNP A;  4MLO A;  2FUG 2;  3HOV J;  3FDY A;  5J1Y A;  1W7P A;  4YEL A;  1ZG1 A;  3KLO A;  1HST A;  4QIW N;  3OS2 A;  1X1P A;  5FO5 A;  3HOY J;  3KEO A;  2CU7 A;  4XBF A;  1YS6 A;  1QGP A;  2DQL A;  4EQQ A;  2JA6 J;  3OMY A;  4PGH A;  2CGP A;  2AS5 F;  3IH4 A;  5TIS C;  4P9U A;  1YO5 C;  3JTH A;  1I27 A;  2K9S A;  5FRM A;  1VFC A;  3S15 J;  3OYF A;  3Q3S A;  2LBF B;  4CCK A;  4BQO A;  4CHU A;  2NS0 A;  2CQK A;  4M9Z A;  1Y39 A;  5K5O A;  4DOZ A;  1KQ9 A;  3R0A A;  1XC5 A;  3FXO A;  1FNN A;  3F6O A;  4ZYA A;  1YJN I;  4F92 B;  5KNL A;  1NK3 P;  3GTJ J;  2A5W A;  1S3J A;  2MYS A;  3LA3 A;  4LFU A;  3K4C A;  1S29 A;  2VKH A;  2BW3 A;  4M6Y A;  3HC7 A;  1IGN A;  1XPX A;  3MD2 A;  4CDG A;  1Z05 A;  3DFG A;  4A93 J;  1IRG A;  2HQR A;  1R5H A;  3H35 A;  4PZJ A;  5DCM A;  2IP2 A;  1YHQ I;  5K1Y A;  1HBX G;  1MDM A;  3CCV I;  2GXB A;  1IN6 A;  3PNY A;  1FJL A;  2CW0 F;  3EQL F;  3MKZ A;  2EIJ H;  1WFX A;  4LD5 A;  2ICW G;  5JVG F;  2G7U A;  2J5P A;  2F48 A;  2VI6 A;  3GZN B;  4I0B A;  2CMP A;  2Y31 A;  1SMT A;  1TBX A;  4ABZ A;  3JRF A;  4FTH A;  1MMS A;  1FBU A;  2L7K A;  4MTD A;  2C6Y A;  2QEN A;  4HX7 A;  1IUY A;  1KU3 A;  2E35 A;  4GRI A;  5IYB J;  4KN7 X;  2IJL A;  1I3Q J;  1QVT A;  3OR1 C;  1OJL A;  2KHM A;  2EBI A;  4GCV A;  4X0G A;  2E1C A;  2XRO A;  3OL3 A;  4RAY A;  1IUF A;  1R00 A;  2KFD A;  4EMS A;  3OV8 A;  5L3C A;  3G1O A;  1HXD A;  2P7V B;  2R93 J;  1GVJ A;  3J7A O;  1S7O A;  4C3I J;  4EM1 A;  2M9H A;  5BNG A;  4AUX A;  2VBZ A;  2ME0 A;  3L09 A;  1WJB A;  4BHB A;  3LL7 A;  1O3S A;  1QBJ A;  1MNE A;  1TW2 A;  3BZ6 A;  2HTS A;  1TWG J;  3TED A;  2K27 A;  1UMQ A;  2OPT A;  3G1L A;  1RUN A;  3F6V A;  4EJO A;  4F3Q A;  3L2R A;  1JJ6 C;  2QQB A;  3HSF A;  4AVP A;  2VOO A;  3NEU A;  4EM0 B;  5FLV A;  3KP2 A;  1XCB A;  1QA6 A;  2K9Q A;  5IT9 Z;  2O5R A;  1ZGA A;  3SJM A;  2OC6 A;  2XB5 A;  1V3F A;  4E4H A;  3TMO A;  3I4M J;  1HKS A;  5LGN A;  3RTR A;  5LRR A;  2Y0S N;  5J1U A;  2BOL A;  4OMZ A;  2RGV A;  2XDV A;  1FT9 A;  5HDN A;  2L0K A;  2V6C A;  1OR7 A;  4HX4 A;  2MD0 A;  5F0F A;  5FKO A;  3WE2 A;  2P5L C;  5H2F C;  2YU9 J;  1YW9 A;  4IF4 A;  2JA5 J;  1R36 A;  2JN6 A;  1P4W A;  1WHU A;  2BY1 A;  3HRU A;  1X1A A;  2BBY A;  5EYR A;  2X6Y A;  1MD0 A;  4MHG A;  1ZRC A;  1UZC A;  1DPR A;  2DBB A;  3CDI A;  3G71 I;  3JSP A;  1Q1H A;  2BXY A;  2V1X A;  3IAS 2;  3WGH A;  2EJR A;  2DA2 A;  2VT3 A;  4KIG A;  1P4X A;  3OYB A;  1ORK A;  2LRE A;  4DQ2 A;  4ZYH A;  2CH0 A;  2DMQ A;  2CQ7 A;  1K61 A;  1PVE A;  3DF8 A;  1MJ9 A;  1YIT I;  2EQR A;  4G8X A;  4PGG A;  2DAO A;  3GTL J;  2HNH A;  5TGT A;  2QQ8 A;  3TQN A;  4A6D A;  1S72 I;  2H27 A;  1JT6 A;  2EFQ A;  1JUP A;  2K9L A;  3K9T A;  5K5R A;  3OYN A;  3W6V A;  4IKF A;  3BZC A;  4LK1 F;  3TGN A;  3ZPL A;  1YX3 A;  2ZXW H;  5JR3 A;  2X6X A;  2VXZ A;  3HIF A;  2FEZ A;  2MBF A;  3OWT A;  1BIA A;  3G73 A;  3DBH B;  4W97 A;  2JQ7 A;  9ANT A;  1ZHF A;  4OIN F;  4HQE A;  1R23 A;  4G6T B;  2DPU A;  4L5I A;  1JKQ C;  1GHC A;  2HGC A;  3ZMZ A;  4O6J A;  4LLL A;  3S2W A;  3GWZ A;  3IC7 A;  5DCF A;  3I9V 2;  4S04 A;  2M3A A;  2PJP A;  5DUK A;  3K4N A;  4YFK F;  4W1U A;  2CRG A;  1Y0N A;  3K69 A;  1B8I A;  4IEJ A;  1U5T C;  2BV6 A;  2F5C A;  1ETQ A;  3HSR A;  4EAT A;  3S16 J;  4QSH A;  2VC1 A;  4B3X A;  4RB3 C;  4WF2 A;  4BAY A;  2LY1 A;  1BL0 A;  2RQP A;  2OQG A;  2IGK A;  3KP3 A;  2I10 A;  3DU6 A;  3G1M A;  1R7J A;  1IN8 A;  1ZR4 A;  5LD2 C;  4HF2 A;  2VC0 A;  2E7X A;  1IDZ A;  1HLV A;  3I3L A;  4XLH A;  5DD8 A;  3KP4 A;  2VJ5 A;  5FJ8 J;  1WZ2 A;  1FOX A;  1FTT A;  1ZGW A;  1HKT A;  3S1R J;  2FBH A;  4AC0 A;  3JRD A;  3HXL A;  3C3W A;  2JUG A;  4DBR A;  4S0H B;  1I3A A;  2QBY A;  5FKN A;  4Y52 J;  3I0T A;  3I54 A;  2DT7 B;  3GVA A;  2VLA A;  2P8T A;  3I59 A;  1DPU A;  5TJJ A;  1HCR A;  1SVM A;  3PL8 A;  1JTX A;  3L2V A;  2DJN A;  3ZCO A;  1OKR A;  2GBY A;  1B1B A;  4XSZ F;  5J40 A;  2MA3 A;  3KZY A;  1WJC A;  2RDP A;  1QU3 A;  3LSR A;  3CF5 F;  1DQU A;  4CGZ A;  1VQ6 I;  2Q8K A;  2HOS A;  1IXS B;  5D5W B;  2RVC A;  2TCT A;  3SZG A;  1OCC H;  3VYS B;  1T39 A;  1CQT A;  3H5N A;  5ILU A;  3H9G A;  3LNQ A;  1YX5 A;  2BGC A;  3MKL A;  2A68 F;  3JAM K;  3P7N A;  4U7B A;  4RM2 A;  2K7L A;  3WHB A;  3F8N A;  1XGM A;  2OCE A;  4AU7 A;  1MMN A;  2I5U A;  2JUC A;  1D0Z A;  4LB6 B;  1D1B A;  5M5W J;  3KX2 A;  2OCC H;  4PDK A;  3N4M A;  2WY8 Q;  3CJN A;  3V8K A;  3BQZ A;  4OMY A;  1W7P B;  1LFB A;  5DUI A;  1JJ8 C;  1DDN A;  3CDL A;  5JHF A;  2O03 A;  2ZJR F;  3KLN A;  3I58 A;  3BQY A;  5LEK A;  3NAU A;  1F4K A;  3TKY A;  1T0F C;  2PQ8 A;  1W36 D;  5L3B A;  2KZV A;  2MSY A;  2VN2 A;  3AL0 B;  3JSO A;  1SC7 A;  4XNF A;  2WAF A;  2B0L A;  4H4K C;  3VYR B;  5H20 A;  1Y1V J;  4M9X A;  1AU7 A;  1YG2 A;  3V4G A;  1LKX A;  2RNJ A;  1FWZ A;  2FBK A;  2VBX A;  2O7O A;  1ETO A;  2IAI A;  2WAQ N;  1ZRE A;  4PJM A;  1U9N A; 
#chains in the Genus database with same CATH homology
 1MMG A;  4XOR A;  2V6E A;  1T95 A;  4E7Z A;  4XLF A;  2WY7 Q;  2A6T A;  3OS1 A;  3W3C A;  1LDK B;  2BW3 B;  2XF5 A;  2R7U A;  2IS4 A;  2RRE A;  3FKJ A;  2UWM A;  3VYT B;  1UAA A;  3PSI A;  2VQC A;  2Q2E B;  3D5L A;  4Y4R A;  5FRN A;  4IZZ A;  3VWB A;  2NOJ B;  4LIV A;  3K70 C;  4RLQ A;  3N05 A;  4BDY A;  3RCO A;  3HPH A;  3ZXS A;  2V1N A;  4OAY A;  4ZC3 A;  2CV1 A;  1BR2 A;  1ZEL A;  2KPM A;  4II2 A;  3A2K A;  4BJ6 C;  1U0J A;  2KMU A;  1MND A;  2X6W A;  4E7H A;  2IGO A;  3DQV C;  4N4O B;  1WJD A;  1YE9 A;  4B43 A;  4DIQ A;  3OYH A;  2LYC A;  2DXI A;  5HVQ C;  3BG7 A;  5KHD A;  3K4B A;  3CMM A;  1MW7 A;  1WJF A;  2V4J C;  3MKY B;  4F52 A;  1Z7L A;  3CF2 A;  2LC2 A;  2M7B A;  5HNF A;  2X51 A;  4HNU A;  1TT0 A;  3KEY A;  4XON A;  4E7I A;  3H5R A;  2W82 A;  3IAM 2;  4HRI A;  3CJR B;  3K4J A;  2R7Q A;  4CCL A;  2ZSH B;  1Z3Y A;  2CFO A;  5LFA A;  2VB6 A;  4CUG A;  2K9M A;  3CZ6 A;  2Z16 A;  3W2A A;  1IRX A;  3A1Y A;  2X85 A;  3D5R C;  3TBI A;  2AQE A;  3QOE A;  3OYG A;  1WJ5 A;  3HPG A;  2WBM A;  1EA3 A;  1N75 A;  2XAU A;  2K5C A;  2ZXH A;  4PSX A;  3RSN A;  3W2V A;  1V5E A;  1SFK A;  4ZDP A;  4ANJ A;  3K4K A;  4P5O A;  4RM3 A;  1K6Y A;  1S9H A;  2P0W A;  4QPQ A;  1BR4 A;  3DPT A;  2L2O A;  4ZJZ A;  2QKM B;  1X1D A;  2XSJ C;  5CQG A;  2VKD A;  2V26 A;  4BGD A;  1LVK A;  2KDO A;  4C9Y A;  3HUG B;  4J01 A;  1Y6I A;  4KIS A;  1PYV A;  3QYE A;  1D1A A;  4XN0 A;  4Y33 A;  2MC4 A;  2VQG A;  3PJR A;  3DKY A;  4HG2 A;  1D1C A;  1BOB A;  4BE2 A;  2GOM A;  3CP2 A;  4XMY A;  2Y0S A;  4CCN A;  2PJR B;  2X1E A;  1NG7 A;  3FBN B;  3LSI A;  4XL9 A;  4DBQ A;  2WA0 A;  4OWR B;  2CUJ A;  3E0J B;  4PJL A;  1Z3X A;  3UR3 C;  4CCJ A;  1FMV A;  2I8D A;  3ZRG A;  2VQH A;  3FBI B;  3H9Q A;  2IS1 A;  4BU2 A;  3S3N A;  2X1C A;  3IUO A;  4BE1 A;  1V5F A;  4BXF A;  2R7X A;  1WJA A;  2Z2S B;  5FRO A;  4YRV A;  2F5V A;  2KP6 A;  3K4L A;  4AYB A;  4XKV A;  4B47 A;  4LIT A;  4XLE A;  4NQW B;  2K3P A;  2L9N A;  3OOU A;  2XC7 A;  2CV0 A;  2PMZ A;  4C2T A;  4BUP A;  2GOX B;  2W1O A;  2ZSI B;  4E7K A;  3LSG A;  2IS2 A;  4D1Q A;  2PJR A;  1X19 A;  2RNG A;  4BL0 B;  3M8J A;  4C2U A;  5HNH A;  1BR1 A;  4XKB A;  4RLF A;  2CUZ A;  4JOM A;  4MLO A;  2FUG 2;  3DKX A;  1X1B A;  3FDY A;  3QOD A;  2HQA A;  3SDB A;  3F9K A;  1JI8 A;  2VIX A;  4YEL A;  1HA8 A;  3BG6 A;  4BEH B;  3OS2 A;  3TL4 X;  3BCB A;  2IXS A;  4XOP A;  1OLT A;  3LSM A;  3PUB A;  3OMY A;  4BE0 A;  5FRM A;  1R6R A;  3OYF A;  2F4I A;  2LBF B;  4CCK A;  4BQO A;  2E1M B;  1W36 C;  4RMN A;  4BJT A;  4DOZ A;  1MMA A;  3RQ4 A;  3K4M A;  3OYM A;  4ZYA A;  4XOT A;  2Z1D A;  2KRH A;  3U21 A;  4F92 B;  5KNL A;  1UEL B;  3H5A A;  4HST A;  2A5W A;  1Z21 A;  2MYS A;  2KL4 A;  4XN3 A;  1SAU A;  3K4C A;  4IX7 A;  2CW7 A;  4CSW A;  2KLO A;  1N78 A;  3KYL A;  2WB1 A;  2VKH A;  2BW3 A;  3HC7 A;  1QHH D;  4E7J A;  2R7S A;  3MD2 A;  3NWS A;  4FAS D;  4QPO A;  4DJA A;  3MKW B;  3S93 A;  3H35 A;  2ELJ A;  4B44 A;  3DPU A;  1D0Y A;  1X4O A;  4N4N B;  3EUA A;  1FMW A;  3PNY A;  1NG6 A;  4IQ4 A;  3MKZ A;  2OV7 A;  2JSP A;  2HPM A;  2VQL A;  4KJZ A;  1WFX A;  4HPQ A;  2R7O A;  3OR2 C;  2HVR A;  3SYT A;  2CMP A;  4KIT B;  5HOO A;  3VYU B;  3G2B A;  2JA2 A;  4U87 A;  3OS0 A;  4ZDO A;  2L7K A;  4CCO A;  2BVL A;  1LFP A;  3V42 A;  4GRI A;  4Y3O A;  4PFP A;  2HVQ A;  4ZTJ A;  3OR1 C;  2KHM A;  3HOS A;  3PFY A;  4X0G A;  3D5S C;  4II3 A;  3OL3 A;  3AL0 C;  3OIP A;  2LRD A;  2VXD A;  2WAD A;  4PUS A;  3DEE A;  3PNV A;  4PK4 A;  4LIU A;  4XLA A;  2ZXI A;  1WJB A;  4P1W A;  2R4G A;  1G8X A;  4CA0 A;  2R7R A;  3LL7 A;  3M1C A;  1MNE A;  3RPU D;  3S8P A;  4BJ5 C;  1Y56 A;  3HL2 A;  2HPI A;  3QYF A;  3UNG C;  1X1C A;  2MFZ A;  4D9J A;  4XLC A;  1AA7 A;  3CES A;  2UV1 A;  4FET A;  4NC7 A;  4F3Q A;  3L2R A;  1G59 A;  2LOO A;  2VAS A;  4E7S A;  4E7L A;  4KT6 A;  3DLA A;  4HNT A;  3DTK A;  2ZFU A;  2O5R A;  3MMY B;  2VL8 A;  2OC6 A;  3OYJ A;  3HOT A;  4E4H A;  3CJQ B;  2KRC A;  3TMO A;  3L2U A;  4E6K G;  3RTR A;  2M0M A;  2JVH A;  4HSR A;  2BOL A;  2XDV A;  3EUH C;  3ZR8 X;  4CCM A;  2MD0 A;  4YEJ A;  2WAQ A;  4F91 B;  3SEZ A;  3ZGK A;  4XKC A;  1X1A A;  3OY9 A;  2OUM A;  2X6Y A;  1WJE A;  2R7W A;  1P9Q C;  4IQJ A;  2W00 A;  2VJ4 A;  3IAS 2;  3K70 D;  3C2G A;  1TZL A;  3J7A Y;  3A4C A;  3OYB A;  4HEA 2;  2LRE A;  3AFH A;  3ZQQ A;  2CH0 A;  3LSK A;  3DTI A;  4LG3 A;  4ZTF A;  4OAZ A;  3ONQ A;  4CH7 A;  3BLY A;  3OYC A;  1KON A;  2HNH A;  4JQF A;  2R7T A;  5TGT A;  3EPZ A;  1J09 A;  2WAE A;  3AKZ A;  1DGR M;  5HLT A;  1X4P A;  3NWT A;  2HDW A;  2IGM A;  3PSF A;  2K9L A;  3OYN A;  4IKF A;  1DGW Y;  4PJJ A;  4BEH A;  3OYL A;  1YX3 A;  2W7N A;  4AVZ A;  1PJR A;  2X6X A;  2VXZ A;  4XM3 A;  3VSK A;  3GBG A;  3DU5 A;  3W2W A;  2VPL A;  3OL4 A;  1VZ0 A;  3OWT A;  1UG0 A;  2LBF A;  4G6T B;  3EUK L;  4PJM A;  2W4S A;  2V7F A;  2DCE A;  3OYK A;  3I9V 2;  4NUB A;  2M3A A;  4J00 A;  3K4N A;  5CQE A;  2F6C A;  2IGN A;  2RQQ A;  3DTE A;  3HKZ A;  1DP3 A;  2V9K A;  2E5Z A;  1OR7 C;  4F55 A;  4EAT A;  4B3X A;  2LY1 A;  3PNT A;  2VJJ A;  2R7V A;  2IGK A;  2VJI A;  3DU6 A;  3L2W A;  2HZD A;  2MAB A;  4DGW B;  2M4G A;  4PFO A;  2LG4 A;  5LD2 C;  1D0X A;  3I3L A;  4C30 A;  3FHN A;  4XLH A;  2VJ5 A;  1GLN A;  3IP4 B;  3HXL A;  2JUG A;  4DBR A;  3SEQ A;  3DWL E;  1V5G A;  4BS9 A;  2DT7 B;  4XQF A;  3BC8 A;  2VLA A;  2L5Q A;  4BDZ A;  2L9S A;  3L2Q A;  3PL8 A;  4XKW A;  3L2V A;  3LFU A;  2X1D A;  2E60 A;  3ZCO A;  3C2H A;  3LMM A;  3DPL C;  1WJC A;  4PSW A;  3OYD A;  2CV2 A;  2AQF A;  1QU3 A;  2E5N A;  1DQU A;  2XF6 A;  5CPR B;  1N77 A;  4ITV A;  2HU9 A;  4BQQ A;  2CW8 A;  4NC8 A;  3SZG A;  3VYS B;  4PJN A;  3H5N A;  3H9G A;  1ERD A;  2E1M C;  4R79 A;  1YX5 A;  3OYA A;  2UUZ A;  3QYB A;  3OIQ A;  4NNJ A;  4U7B A;  1MMD A;  2KQR A;  4RM2 A;  3VSL A;  4BQN A;  2LY2 A;  4AU7 A;  1MMN A;  3VDX A;  1D0Z A;  1D1B A;  3OYE A;  3KX2 A;  4CZC A;  2CS3 A;  2WY8 Q;  3CP8 A;  3S32 A;  4F93 B;  3K10 A;  5JHF A;  3HG9 A;  3S3M A;  5CKT A;  3S3O A;  3E1S A;  2XF7 A;  1T0F C;  2JVG A;  3LSH A;  4BAC A;  1W36 D;  2KZV A;  3H9J A;  3AL0 B;  3OYI A;  2IS6 A;  4XNF A;  2WAF A;  1E0E A;  2BVM A;  2Q1Z B;  2LH9 A;  4H4K C;  3VYR B;  1QHG A;  4XR6 A;  2M7A A;  3BCA A;  1LKX A;  2DJI A;  2DOA A;  2DT6 A;  4B48 A;  2HVS A;  3H0D A;  5KCM A;  3K6G A;  4ZDL A;  2M4K A;  2QKL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...