3FBNB

Structure of the mediator submodule med7n/31
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
94
structure length
94
Chain Sequence
b'SDQNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mediator of RNA polymerase II transcription subunit 7
publication title Identification, structure, and functional requirement of the Mediator submodule Med7N/31
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 28
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05669 Med31 SOH1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1340 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3fbnB00
3FBNB 3FBIB
chains in the Genus database with same CATH superfamily
3DBRB 2E1OA 3HKZA 1RUOA 2Z33A 1ZHFA 3AAFA 3PNVA 1EV7A 1Y8QB 2OD5A 2G0EA 2MH9A 4HNUA 2F48A 2LYCA 3I54A 4KMFA 1XMXA 2DN0A 3GLXA 2Z16A 4AD9A 1USTA 1FIPA 3W6JB 1X3UA 4AVPA 1O3QA 3ELKA 3S3MA 2B9SA 5IP6A 1B8IB 1R4MB 3RIRA 3BQZA 4HDUA 1W36C 5J1YA 3LSPA 3GTGJ 5EYRA 1FYLA 3MKZA 2ZCWA 1IUYA 1FMVA 4UV8A 4DJAA 4JP0A 2MFZA 1NTCA 4A3IJ 5E17F 1BJAA 2DYSH 1A04A 2A5YB 1IXCA 5FKNA 2QUFA 4OAZA 3ERED 4PUSA 2FE3A 3D5LA 5GAGJ 1IV8A 2M4GA 3V8JA 4EM0B 1JT0A 3H0DA 1O3SA 3L00A 4WX9A 1X1BA 4OMYA 4QPOA 4RLFA 2IS6A 1HKQA 2X1CA 5EJCA 3KPHA 1ETWA 1WKMA 3K2ZA 3PNTA 1BIAA 2DFFA 3ZQLA 1FSEA 1QZEA 2HYGD 1RKTA 5JVGF 4XLAA 2EINH 1R9TJ 3E7LA 2GXGA 1RRJA 1G4DA 1DGRM 5E20A 5M5WJ 2VOPA 2A05A 3MZHA 3KZIC 3ZMUA 2OTJI 4E4HA 2VBYA 3JRGA 4WCGA 4CH7A 1KQ9A 3LA2A 2OCCH 2ZSIB 1TZLA 5FKOA 4XORA 4QTRA 3GO5A 1ZG3A 4OOIA 4HF0A 3G1LA 4IRGA 4QWQA 5TISC 1GLNA 2EFNA 2ESNA 2IXSA 4NNJA 1WJ5A 1EH6A 4E7SA 2DPDA 2PMUA 3OYNA 5DUIA 2GOXB 5JLWA 2WV0A 4Y3OA 5IYDJ 4Y13A 2XDVA 3GFMA 4ZZLA 1P9QC 3QU3A 1S5LC 3EQLF 3LQQA 3ECOA 2P0WA 1KQ0A 1OCOH 2W85A 2E1NA 1XDSA 2H1LA 2O9LA 4DYRA 1HDDC 3DEEA 5C4XJ 4ZJZA 2ID6A 2QQBA 1Y56A 2DA2A 3A2KA 1MMSA 2J5OA 3BTCA 2VONA 3SFZA 1X1CA 2VL8A 3TOAA 1FBQA 5FB2A 3ABLH 3OS2A 4IJAA 5K1YA 3WTWC 1Q1VA 3OYLA 1MZBA 2MSYA 1W0TA 2PJRB 3M9AA 2X51A 4PK4A 4NC6A 1VQ8I 2L9SA 1O7LA 2UZKA 4V2GA 3QAHA 2X6OA 1NG6A 3GWZA 2P5LC 2NVUB 3LSHA 3BCAA 1MSFC 2E2HJ 2JSPA 3CUQB 2GA2A 5FD5A 1J7KA 4XQFA 1N75A 2MH2A 2Q1ZB 1ZAOA 2RVCA 4ESBA 5IP7J 1IN4A 3JW4A 2OCEA 4J00A 1NH3A 2X6YA 4IEJA 2FEZA 3W2WA 3O8GA 1W36D 1AA7A 3O3KA 2WAFA 1U9NA 2TRTA 2XGXA 3G73A 4C2UA 5CJ9A 1F5TA 2RC4A 2AQFA 2OUMA 3EUKL 1WJEA 1E2XA 2HR3A 2DTZA 5DTDA 3L2RA 2B7EA 2L9VA 1Y8RB 2XSDC 2CGPA 4NDLA 5CYVA 4IOAF 4PSXA 2WADA 5JHFA 4F3QA 4M3FA 3BJAA 1SD6A 2VI6A 3AG3H 4FQGA 4BXUA 3WU1B 5EGOB 1RNLA 1TW3A 1T0FC 2HXOA 4A3LJ 1QRYA 1XGSA 2OZ6A 2HKXA 3D0SA 3FDYA 2DQLA 4DYCA 4LGWA 3ZQIA 2ELKA 1GV2A 2M9HA 2JRMA 1SC7A 2A5WA 3OYHA 3K1PA 4HW0A 3SHFA 1IZ1A 2NOJB 2VB6A 2M4KA 1SEUA 3HJEA 1BOBA 5E1XA 1BR4A 2NVTJ 2P8TA 3MKLA 1WZ2A 4AUXA 4BACA 2X1EA 1XD7A 3HZJA 4EVIA 1JGGA 3CQZJ 3WTYC 3PIPF 1DU6A 3J80K 3DP7A 1R5HA 3HPGA 2AHQA 2UXXA 2K9NA 3ZQ7A 4RLQA 1JXSA 1ZR2A 2DMTA 2K4JA 3CESA 3OYAA 3HSEA 2XGCA 4A3JJ 2HDWA 4XLFA 2R93J 3W2VA 1T95A 2VQGA 4BNCA 3CUQC 2VASA 4ANJA 1WSUA 2PFBA 5E1WA 4AIHA 3DKYA 5DS9A 2RNGA 2KIFA 3K10A 2W00A 4HNVA 5M5YJ 3HC7A 4UUVA 2H6BA 1M1EB 3CJQB 5B1AH 4BGDA 4A3FJ 3M3YJ 1MMNA 4HYEA 4JX4A 5LHHA 2P81A 4EM1A 1GVDA 4XRMA 4C3JJ 2CMPA 2H1KA 2DMNA 4RGXA 5JHUA 3PFIA 3HTUA 1QBJA 1DP3A 1B59A 2PBIA 5E8GA 3OYBA 1K6OA 5HLTA 4BJ5C 4MHGA 3IL2A 2Y30A 3OSGA 2STTA 3BG3A 3T1BA 3HTSB 3HOSA 1W1WE 1MSEC 2MC3A 4P1WA 1X1AA 3HOTA 3O6BB 4JBAA 3W3CA 2E2JJ 3KLNA 3I58A 4JX6A 1I3QJ 4RGSA 1HW1A 1G3WA 2VBXA 3CDLA 2ZXIA 3UR3C 4JQFA 1R49A 2DA7A 1FTZA 4MFDA 1OCTC 2A61A 5ED4A 2HPMA 3ZN0A 4D5CA 2L4MA 2OF7A 3S3NA 2EZLA 2NS0A 1UB9A 3I0TA 5FGMA 3T8RA 3L2CA 4E7JA 4CA0A 2FBKA 1MJBA 2K9QA 3ABTA 5J6XA 2HOTA 4MLOA 4UV9A 5TRDA 4D0PA 4G9YA 3OYCA 4B4CA 2DU9A 1UHSA 4CUGA 3KZYA 3W6KB 2PJPA 3CCYA 2HOAA 4KA4A 1ZRFA 1N77A 2DT5A 4LIVA 3K9TA 3WTVC 3GEZA 4C2MJ 4D5FA 3QPHA 5C4JJ 1K4TA 4QIWN 5FKMA 2IVMA 4YIRX 2KRHA 1ZGAA 2V26A 2V1UA 2V9PA 4BE0A 1ETYA 3ZMTA 3DU5A 2M1BA 1PYVA 3K2AA 2JUCA 1WJBA 4OU0A 2EH3A 1FSHA 1YE9A 1X3ZB 2VE8A 3ABKH 3HXLA 1OR7C 5EDNA 1SFUA 2KKOA 3DPTA 3JRAA 2YS9A 3MQ0A 4DW6A 2EFWA 4HDVA 3K70C 5HNHA 1L3LA 3ZGKA 2CQNA 4BL0B 5FLVA 2GXAA 3I3LA 1TW2A 1LFBA 1K6YA 2JA2A 2E1MB 4B44A 1JKPC 3OYEA 4IRIA 1RKWA 4UVAA 1D1BA 5HLGA 4EMSA 2ZFWA 4P96A 2BVMA 1X2NA 2FRHA 2Y48A 4L5JA 1U6GA 2CV0A 4KFCA 3DCFA 1JTYA 2DOAA 4XLCA 4FX0A 1WQ2A 4BHBA 3KP7A 3NEUA 3CC2I 4HSTA 2O0YA 3QU6A 3LAJA 1UCRA 3FZVA 4RAFA 1ETOA 1IRFA 1FBSA 2DFHA 3F8MA 1FJLA 1VQMI 3UNGC 2LKXA 1JE8A 3HOXJ 1LE8A 3BR1A 1O3TA 4L9NA 3RKXA 3HOVJ 1P92A 3L2UA 2WB1A 3J7YJ 4G7HF 4X6AJ 4JK1X 2Y0MA 3KE2A 4HA8A 1O4XA 3H3VK 2FX0A 2HS5A 4UNOA 2VJJA 2MLKA 3CJNA 4EJWA 4S0HB 5FLMJ 1E0EA 2KZGA 3C7JA 1IN7A 2Y75A 4C3HJ 5JVTA 3ZMVA 4Y15A 5L3EA 3CLOA 2HVQA 4B3AA 4WWCA 3I71A 3BR5A 3W6VA 3M8JA 3TO6A 5HODA 2I10A 2MD0A 3SZPA 3S15J 1G6NA 1ERDA 1ZQ3P 3QP6A 2O61A 2VODA 2XVCA 2R7SA 1LB2A 2YPRA 1G3YA 2M3AA 4YEJA 3IWFA 1QO0D 3LQRA 2CQ7A 2DOFA 1QVTA 3ZQGA 2H6CA 1S72I 2LMDA 4IZZA 1SVLA 3FMSA 3MEXA 4P9UA 2UV1A 2QCOA 1R1TA 1RPWA 2VQLA 2Z99A 4HX7A 2AS5F 3CD6I 2HFHA 2QQ8A 4PGGA 4XOPA 5CVUA 5GAHJ 1F4KA 2CJJA 1LVKA 2P5KA 2HKOA 4RB1A 2NVYJ 2GIVA 3AL0B 1LNWA 1MNDA 2RREA 3C2BA 4H4KC 3OMYA 2DCEA 2VT2A 2X6XA 1ZYRF 2MG4A 5EEHA 1VQ7I 4PFPA 1DQUA 5GTIC 3KX2A 3K1MA 4ZDLA 4BS9A 4MTDA 3HG9A 2IP2A 2XAJA 1D1CA 3DKXA 2ZJRF 4OIPF 4G7OF 3K4LA 1BOAA 2XRNA 3COAC 3LSKA 4EJVA 2M0MA 4Y33A 3FWEA 1S6LA 2X1DA 1P4XA 1T0FA 1Z9CA 1MH3A 4I09A 1QHGA 5CVVA 2LDUA 1E3PA 3RPUD 3CTAA 3CP2A 5DM7F 2DO7A 2NOGA 4NC8A 3K70D 4G12A 1SVMA 1TP4A 3GFJA 4MQ9F 2NNYA 1D8JA 2WAQN 4JX5A 3ULQB 2K27A 1IGNA 4BE2A 2HWVA 3F21A 3ABMH 3BR2A 2MYSA 3EETA 3TW7A 4KN4X 1B6AA 1TBXA 5CKTA 5LGUA 1Y1WJ 2XV4S 2E60A 1ZN2A 3FXRA 4OWRB 1HBXG 3VSLA 1SMYF 1Z6RA 3MN2A 4B1RA 2Z5UA 1AU7A 2IGMA 3HDDA 2CQKA 1QA6A 2BY0A 3DEWA 2EV0A 2R4GA 2EILH 1LUJB 4HV5A 4XKVA 1FP2A 3BPXA 4IL6C 3X2QH 4YRVA 5L3DA 1FEXA 4XICA 5IOZA 4OIOF 2XPWA 3M1EA 3C2HA 3TDZC 1R4NB 2LH9A 2NVQJ 2VPRA 2TDXA 4YFKF 1BI1A 4PFOA 3T8TA 1ITYA 4BXFA 1W7PA 1ONVA 2LY2A 3LOCA 1OYWA 3H9QA 1Z7LA 2EA4A 2FXAA 3BZCA 2BY3A 2QSGX 4U7BA 1OISA 1POGA 2LVSA 2QEXI 5DCMA 4XSZF 2K9MA 2VE9A 1KU3A 2MD5A 4LITA 2KZVA 2DOEA 1QNTA 4QLCU 1YLFA 3DV8A 1VNDA 2V9KA 2RKHA 2VQHA 1J59A 1YHQI 4RAGA 4UHTA 1Y39A 2ZXHA 1USSA 3E1SA 3LSTA 9ANTA 3E5XA 2FU4A 2WV1A 1B4AA 2K3FA 3D5SC 3FXMA 2QQ9A 2HI3A 2XAFA 4IHSA 1SD4A 4KJZA 3RYRA 3H92A 5HS9A 3C18A 3CDIA 3PQKA 1OQYA 4BUPA 3K0LA 4AYBN 3N4MA 2P7VB 3J7AY 2WY8Q 3LAPA 2DT7B 3OR1C 2H8WA 2CV2A 2ZBKA 1EF4A 3MZ8A 4YELA 2W1OA 3IHUA 4G7ZF 1LEBA 2XB5A 3OR2C 3PQJA 1OKRA 5H6QA 3PO3J 5H6RA 4CCJA 3I4PA 3TP3A 1D1AA 2JA6J 3JRDA 3TQNA 5D8KB 4S05A 3CCQI 2L9NA 3A02A 2ICWG 1FYMA 5FRNA 2BBYA 2VJ5A 2P6TA 2E36A 1CQTA 2YX7A 1YG2A 1D3YA 3V8KA 3GUDA 1YQAA 2BXZA 3CCVI 3F9KA 4HQEA 3LSJA 4GYGA 4AWXB 4HAMA 3F72A 2F4OB 4PJ0C 5M3MJ 2IS1A 3BLYA 1OR7A 3TEDA 2L3DA 1Z21A 3Q0UA 4HX8A 1Z0XA 5JFRA 1U5TC 1UAAA 2K9LA 1SD7A 2CS3A 2NXNB 2R7OA 4MNUA 3M8EA 3I59A 2LBFA 3KYLA 3Q9SA 1TQIA 5D5WB 3F8BA 3G1MA 4BKXA 4ENKA 3CO7C 1WI9A 3CJTB 3AG4H 3C2GA 3FK7A 3LSGA 5TJJA 3R60A 3FM5A 2F4IA 1S7OA 4BQAA 3RDIA 3LNQA 3KEOA 5IYCJ 1LE8B 4E7HA 2R7DA 4MGRA 3GZNB 5M5XJ 1QPMA 2MLGA 2M8EA 4AIKA 4Y52J 2CFOA 2H09A 3EDPA 3F3XA 5EEAA 4IHWA 1G8XA 2DMPA 1DPRA 2VUMJ 3DBHB 2L2OA 2L7KA 1IW7F 1FBUA 5J1RA 4LFUA 5D4RA 2LFBA 4BJTA 1IJWC 3VWBA 2VKHA 3HRUA 4FHTA 2CRGA 3K69A 3TO9A 2PMHA 2QKMB 1Z7UA 2VBZA 4GCVA 4Q48A 5D4SA 5J47A 3S93A 1CGPA 1NK3P 2ECCA 3GW2A 3QRFF 3ZN1A 4A3KJ 1UG0A 1DDNA 3S17J 2X85A 4EJTA 5TGTA 3BZ6A 2KT0A 5JLXA 1K78A 2L0KA 3ROUA 3JRIA 1LFPA 2A6TA 4U88A 4CXFA 4HSRA 1JUPA 2LOOA 3FXOA 4A2UA 1W4MA 1BR2A 3JRCA 2W4SA 1W5CC 1IXRC 3J80Z 1MJAA 1MIJA 2DTRA 2FNPA 4I6ZA 3BJ6A 2DJNA 1MBKA 1KU7A 4LIUA 1A36A 3NWSA 3RQIA 3FXKA 4XKWA 4CDGA 5DD8A 1BL0A 3G2BA 2HQ5A 4XMYA 4DBQA 3DF8A 4BAYA 2RQPA 3BT9A 1TNTA 5F6FA 3OIQA 3PO2J 3WODF 1Z3XA 3J7ZI 2OA4A 1U0JA 2OC6A 5J40A 1Y6IA 5JR3A 2BHZA 1UG2A 2GLOA 1RESA 4EATA 2M34A 4I99C 2F5DA 1Z77A 3MMYB 2FBHA 1PJRA 1A6IA 1UJ8A 2I8DA 1AOYA 2P5VA 3QOEA 1UMQA 3PFYA 3VPRA 2NYXA 1XGMA 1P4WA 3H1CA 3E6MA 3TDUC 3VSKA 2R5YA 5K7ZA 3GBGA 1SAXA 2CUZA 1T98A 3J7AO 4LOCA 1V4RA 4RDUA 1XMAA 2N8GA 1K61A 3CCJI 2BY2A 4P55A 2ZXJA 3RI4A 4KDPA 1O57A 2XUBA 4BEHA 3DEUA 5E18F 3P9KA 2ME0A 2R7WA 3T5XA 1VQ5I 2EZIA 2EPFA 4Y17A 2E5ZA 4HNTA 5H20A 2PN6A 2CW8A 2R5ZA 3ZPLA 3NRVA 4XKBA 1E3HA 2ACJA 1LVAA 2LSOA 5KK1A 3VYUB 4FE4A 4ZH4F 2W7NA 1UHMA 1S29A 2BXYA 4ZYHA 4XN0A 3OY9A 2DDAA 1MNEA 3BG5A 4WXCA 3KETA 4LLNA 4AU7A 3N05A 4L9VA 5HS7A 3NAUA 4XLEA 5A2QK 3CMYA 4CICA 3OYMA 1W7PB 3SEQA 3E3VA 3RQ4A 1OJLA 3BJOA 1O3RA 1WJFA 3LSRA 2LG4A 2RV8A 2B0LA 5AONA 1LPQA 3GTPJ 3S14J 5DCMB 2QM3A 5F04A 5M3FJ 1ZR4A 5IP9J 4G6DA 2L01A 1SMTA 2XROA 2OJED 3DTEA 4IXAA 4NHJA 1LDKB 4NB5A 5ILSA 4B09A 1J9IA 3FM3A 1B1BA 2IS4A 4G94A 1FWZA 3MZYA 5K5RA 4LMYA 1WCMJ 3U21A 1FMWA 3JAMZ 1ACIA 2QSFX 2V79A 2E5NA 3ZMDA 4DZPA 2PMZN 2BOLA 3U9GA 5J1UA 3FBIB 5E8IA 1FOKA 3IH4A 3MVPA 2H8RA 4KNYA 2LF8A 3H5RA 1E3OC 1MBHA 1DPUA 2VLAA 2Y9ZA 5BS6A 5ILUA 1Z05A 1HA8A 1XC5A 1O7FA 4HBLA 1G2HA 3CCMI 3KP3A 5LLQA 3JREA 3WTZA 4LK1F 5D6EA 1IO2A 1BJZA 1X19A 3G3ZA 3KIOA 4XR6A 2ZMEA 3GLLA 3OS0A 5F0HA 5LHGA 3W2AA 2M0CA 4L5IA 4WK8F 5BQTA 2V9VA 1WJDA 3HBLA 1YJWI 5B66C 3K1NA 1YIOA 3RKQA 3QPLA 4M72A 3GF2A 2AO9A 4FCYA 1V5FA 2YSRA 2HZDA 4GO1A 1MW7A 1R71A 1J75A 4Y4RA 1U3EM 3CCLI 1T56A 2DQRA 1GUUA 4LG0A 4DNCA 2OBPA 4D7NA 1RIOH 3E0JB 2DXIA 2R7XA 3EPZA 3MFKA 2KRCA 4NBQA 5DV5A 1APLC 4L0ZB 4KIFA 4A6EA 2CV1A 3K4JA 1MBFA 2HQRA 3OYFA 3LFUA 2K5CA 2LRDA 2X0LA 3IKVA 1ZH5A 1GVJA 1Z1DA 3I59B 3GZ5A 2LBFB 1OFCX 1K79A 3DLLF 2D2WA 2KIQA 4HPQA 4K2EA 3A03A 3ZP5A 1EJ9A 2L7FP 1X58A 3E5QA 3L7WA 2X4HA 3ASOH 4E7IA 4F55A 4XIDA 2JA8J 1KA8A 3ZMSA 1U5TA 3RZDJ 2IJLA 1J2XA 3BROA 2K85A 2YU9J 4EGZA 1ON1A 3RZOJ 4S04A 3P9IA 2K7LA 4M6YA 3WTXC 4EM2A 4GRIA 2OAZA 3MKYB 5IOYA 4LG3A 5J3LA 4CSWA 3SDBA 4BDYA 2LC2A 5EG0A 3RTRA 5DUKA 2G9WA 2ZJ2A 2JUGA 4DOZA 3KYCB 2VJIA 2KDZA 4KT6A 1IC8A 1XB4A 3S1NJ 5EF6A 2BW3A 4RMNA 3VEPA 1I39A 2O8KA 2JT1A 3ERMA 4E6KG 1WGXA 3BG7A 2LF7A 4R8HA 3GFLA 3H9JA 1JI8A 3SFIA 1TWCJ 3AG1H 4N4NB 1S8NA 3I53A 3JCUC 5EZHA 2ID3A 2Y9YA 4A6DA 1K78B 2DMUA 2D1VA 4X1EA 3SDGA 4IO9F 1TTYA 3OYIA 1R58A 4HX4A 2HGCA 1BI0A 2FQ4A 5FKLA 4IKFA 4ZDPA 2Q2EA 3NARA 5DM6F 1MBJA 1YJ9I 2CUJA 2O3FA 4ON0A 2E2IJ 4OAYA 2QQAA 4P5OA 3JAMK 2EFOA 2WAQA 3OSFA 2DA1A 5GADJ 4MO7A 1LFUP 1XCVA 4A93J 5AIPA 2NNNA 4WXHA 1JJ8C 2KPMA 3B6AA 1IRGA 1X4OA 3GTLJ 4D7MA 3N97A 3GYHX 1GXQA 2MW8A 2V6CA 5AIQA 3MD2A 5GPCA 3QOPA 5K5QA 3TBIA 1JJ6C 4A0XA 3ONQA 5E79C 1R1VA 1I6XA 2VXZA 3VDXA 5CPRB 4A5NA 1HXDA 5IT3A 3IWZA 4V19K 1XSDA 1YW7A 3S2HJ 3VYRB 1K4SA 1VQLI 3SQNA 2R5YB 1EH8A 3ASNH 3ZQHA 1ZLJA 4LK0F 2L7MP 3RKYA 2K4BA 1P6RA 2L02A 1ZGJA 1W7PD 4XL9A 2LK2A 3V4GA 3SZTA 2LP0A 3E97A 2QLZA 4BEHB 2LD5A 2IGOA 1FLIA 4GGGA 1MBGA 4HEA2 1IV6A 1RETA 1TWFJ 4M73A 1YX3A 1LDDA 5IYBJ 1FOYA 2R5ZB 1FYKA 2E35A 4ZC3A 1R36A 4IOCF 2CUEA 5HLIA 1T2KA 1DP7P 1OPCA 2F5FA 2P4WA 3OYGA 2DYRH 1RC9A 1OCPA 3RYPA 1PVEA 4XOTA 4UB8C 1OLTA 2DJIA 2JA7J 3L2QA 3C3WA 2XHKA 4DGWB 1ZRCA 3SXYA 2F2EA 1ZG5A 1XN7A 1UFMA 3QQAA 3CUOA 2XAHA 2K9SA 4XLHA 2G7HA 4IHXA 3O8HA 4BU2A 1ZK8A 2KLOA 3DPLC 4BXXJ 2MC4A 3E6DA 3DKWA 3K4BA 4Z6YA 3HM5A 4CCMA 5L3FA 3HRSA 1Z91A 3HOWJ 3PM1A 1F1ZA 2KFDA 1UZCA 4AYBA 5K7HA 4L9JA 4C3IJ 4IHYA 3R4KA 2WAEA 2M5WA 1P2FA 4XRSG 1JHHA 3IP4B 1ZGWA 3AFHA 2RQQA 1H89C 3HOYJ 1H0MA 2ISZA 2QVOA 4A3DJ 3MWMA 1MKMA 4MTEA 5FJ8J 3ZMZA 2KQRA 3BR3A 3IRQA 2EWNA 5E3MA 3K7AJ 3L1PA 3A0HC 3WGGA 2PG4A 2JPBA 1S3JA 1A35A 2BZTA 3Q5FA 2JMWA 5CQGA 4ZYAA 1P7IA 1B9MA 3NWTA 4OINF 4I2OA 3VYTB 4TV7A 3GX4X 1BN5A 3H0GJ 4RAZA 4IQJA 1AKHA 3E6CC 4KN7X 4HQMA 4XKCA 5LHIA 2CYYA 5B5EC 2OQGA 2P7CB 1J0RA 1F43A 1PUEE 2DPUA 4QPQA 2X48A 3OYJA 1I6HJ 5DYMA 1DUXC 1HDPA 3CF5F 2A3SA 1XSXA 1WWXA 1RR8C 2DA3A 2XKOA 3GTMJ 4LG0B 3GFIA 2VQCA 2OV7A 3R6SA 1BC8C 2XASA 1Q1HA 1SAUA 4PJMA 3WE2A 1YW8A 3QP5A 2OQRA 3AG2H 1IAWA 1B9NA 3IRRA 3GMEA 4CCKA 1BBYA 2XGDA 2VC1A 3CDHA 2W48A 4D1QA 2M45A 2HXIA 4EJUA 5J8FA 4U87A 1HW5A 2YR2A 4I76A 3QPTA 1FPQA 2OTLI 2OPTA 1I50J 5F27A 1LQ1A 3PIOF 2EV6A 2KJCA 1T08B 2IAIA 2MBFA 1R23A 1U5TB 2VIXA 1MNMC 4BBRJ 2Q8KA 1XSVA 4M74A 2HDDA 3M4OJ 4F93B 3CF2A 2A07F 4NUBA 2CH0A 3E6BA 4RBOA 2GOMA 4N4OB 4A3GJ 3S1MJ 3WGIA 3EUHA 1WHUA 1YI2I 1KGSA 3ML6A 1VQKI 2K40A 4YIIA 1MMDA 3QYFA 3O2PE 1BA5A 2VPLA 3WHCA 5LGTA 5E3NA 1KU2A 2F5CA 4ZYGA 4IF4A 3HPHA 3REOA 3HUGA 5EG0B 5ICEA 1R22A 3HYIA 1TL8A 4HV6A 2HPIA 1WVRA 5B1BH 1QGPA 1X3WB 3L2VA 2ZMEC 3D1NI 5BOXA 1T38A 2BW3B 3SYTA 2KIUA 4PJJA 2LREA 1IRZA 1IXSB 2F5EA 1BIBA 3BY6A 1YS7A 2QBYA 3IH3A 1HSJA 1SFEA 2EZKA 2WBMA 5KHDA 3DQVC 4MEXF 2FJ1A 3LFKA 3A4CA 4HLXA 4XRSA 1YJNI 1HLVA 2HDCA 1HQCA 1TC3C 1KYWA 2F6CA 1S7EA 5HOOA 4A3BJ 1FIAA 5C44J 3TW6A 5H2FC 2E7XA 2M7AA 2O7OA 3I5UA 2PQ8A 2EV5A 2Q2EB 4YG2F 3GVAA 2EK5A 2RNJA 2WC2A 2C6YA 4BQOA 2V1NA 3KLOA 2LY9A 3DBLB 1WRJA 2ZJPF 2VOOA 1YS6A 3F8FA 2Z3YA 2PEXA 3K4KA 5ILVA 1P4AA 2HOEA 4BY7J 2FMLA 2DT6A 1A31A 3FXUA 4XLNF 4U0YA 3OYDA 1KZHA 2Y31A 4IQ4A 2CU7A 2JN6A 3DTIA 2CFXA 1JTXA 2LNBA 4R1HA 5F0CA 3IAM2 4FASD 2H27A 1L0OC 3F8NA 3GTOJ 3H5AA 4I02A 2PLYA 5D6FA 3S3OA 1VQ9I 2KISA 4KIBA 2IBDA 4GDFA 3H36A 2ELJA 3PUFA 4ABZA 3F6VA 1Y0UA 3SZGA 3TO7A 4E7ZA 3K4NA 5A2QZ 4ENMA 3I55I 1GV5A 3DXJF 4Q4ZF 1PUFA 5FO5A 1WJCA 1QZZA 4A3MJ 4I98B 2E19A 1QPIA 2FF4A 4CZZA 2MABA 4NQWA 3DPUA 1HSTA 1X1PA 2FBIA 3PUBA 4B48A 5E3OA 1WJAA 2K3PA 4BHPA 3CC7I 1XG1A 2DAOA 3F22A 2JQ7A 4MIMA 4XLPF 1G59A 2GZWA 5F1RA 4M71A 2O5RA 4IRHA 3V42A 5ICFA 2GWRA 3TKYA 4PJLA 2EFPA 3UKGA 4II2A 2ZXWH 2CQXA 2ECBA 2JWTA 1TT0A 4PGHA 4IHVA 2DW4A 2Y0SN 5B3SH 1C0WA 1FOWA 1BC7C 1ZARA 1UHWA 3M7GA 2XAQA 1RZ4A 2E7WA 3LA3A 2R7TA 2PMZA 1J09A 3LA7A 2IS2A 4DQ2A 2NS7A 2YU3A 3GTQJ 1SFKA 2VBWA 3IV5A 4RB2C 5ICCA 4OMZA 3A0BC 4FE7A 2O8XA 4RGRA 3WHBA 2XF6A 3F6OA 4W1UA 4AC0A 5LFAA 1YOVB 1TWHJ 3KP6A 1I3AA 3EYIA 1H8AC 4XM3A 4CGZA 4ESJA 5GAEJ 5DCFA 5FLXK 3CO6C 1BI2A 4RGUA 3CJRB 4AIJA 3U1DA 1ZREA 4A0ZA 4ZZDA 4XN3A 5HLHA 1SFXA 2O6GE 3K6GA 2A6HF 1CF7A 3MKWB 1NK2P 2W84A 3PJRA 5FFZA 2R92J 3ZQQA 3FHZA 4G8XA 4LJZF 5CVRA 4E7LA 2EA2A 4Q5SF 2BY1A 2GQQA 5EEGA 4N9HA 5FKKA 4UUTA 4F7ZA 3A01A 2X6WA 3L9FA 2QSHX 1OYIA 4EGYA 5K7FA 1R7JA 1AKHB 1I1GA 3IKTA 1S9HA 3R0AA 4UY8I 4GXOA 2GXBA 1HC8A 1AWCA 4HG2A 1V54H 3P5JA 4N0BA 3EUAA 3V7RA 2WY7Q 4L5EA 4ETSA 5DDGA 3OL3A 2GBYA 3VFZA 2NS8A 1ETXA 2Y69H 3VYSB 3BG9A 4C30A 3V7CA 3CLQA 2YUSA 1VQOI 2COBA 5HS8A 1YIJI 3WG7H 3IC7A 2E1CA 4DBRA 2ELHA 1V5GA 1OCRH 2QGUA 2D45A 1PP7U 4ENJA 2ZKZA 4BJ6C 2CG4A 3JR9A 5KAFC 1KONA 4I0AA 2QWWA 3ECHA 4UVBA 3VODA 1ZRDA 4QSHA 4BQQA 4CCNA 1T33A 2DK8A 3J81K 2RAEA 2DMQA 2E34A 3JSOA 2K02A 2X9DA 3JRFA 3KFWX 2XF5A 1TT5B 3ZR8X 2NVXJ 2XKPA 3B6CA 3FMQA 1RUNA 4LB5A 1QVUA 3S16J 2DBBA 5D5XB 1SD5A 1WH7A 4RM3A 5L3CA 1BW6A 3CC4I 3Q9VA 2V7FA 1S7AA 2FSWA 1VZ0A 1T39A 1D5VA 1ORKA 1R00A 3JTHA 2R7QA 4XNFA 2ZJQF 4M3EA 3G71I 3IAS2 3HIFA 3VB2A 2IT0A 4KISA 4OIQF 2HYJA 3KEQA 5F08A 1I1SA 4C2TA 5FRMA 1TQPA 1KQ8A 4UB6C 1FNNA 4YIFA 3BTLA 3HKZN 1EKEA 2NAZA 4ZTJA 4LLLA 3BTJA 3HUGB 2DA4A 1B72A 4AM3A 2XAUA 2DLLA 1JKOC 2ZB9A 1VQPI 4CYCA 3PL8A 3FMRA 3ZQCA 3BCBA 1ZG1A 1DU0A 2VC0A 3Q3SA 4WXDA 2EIKH 3H3ZA 2OU2A 2M7BA 4GFBA 5L3BA 2JJ7A 2LY1A 2ADUA 1U9OA 2K86A 4FISA 4I0BA 4DYQA 1YO5C 2QBYB 6PAXA 2AXLA 4UUSA 3KCCA 5J4YA 1Z3YA 4HOBA 3F0CA 1XS9A 5HDGA 1IF1A 2R0QC 4OIRF 2I5UA 1TWAJ 4CZCA 4U7DA 3Q0WA 4V2FA 5LGNA 2VKVA 2HNHA 4C9YA 2FD5A 2V6EA 3NQOA 1QQIA 2KIMA 3KEYA 2L4AA 3BOQA 1H9TA 1R5ID 1VQ6I 2CWEA 5IPAA 3WU0A 2BVLA 1SFOJ 1JKRC 3CZ6A 1R6RA 1X4PA 2GIZA 4LD5A 4O5VA 5HDKA 2JVHA 2V4JC 4LLGF 5J4VA 2IRFG 1W5TA 2LKPA 3S1RJ 2EJRA 2G7UA 1MMAA 1MH4A 5D5UB 3CCSI 4CCOA 1IRXA 4DZJA 1MDMA 4I7HA 2BGCA 1NG7A 2XRLA 2YX4A 1FTTA 3FKJA 5KNLA 1QHHD 2IW5A 3DTKA 4JOMA 4KITB 4ENNA 3SJMA 2IGNA 2XPUA 4BQNA 4BDZA 2QYOA 4H0EA 2EQRA 2CW7A 3TL4X 1D0XA 3R61A 1WH5A 2Q0OA 1K83J 2W24A 3EUHC 4U0WA 3S32A 4F92B 4G6QA 5J8CA 2HTJA 1YRNA 1GHCA 4MQVA 3ZCOA 1PUFB 1XX5A 3ZRGA 2DA6A 3HRTA 2KDOA 3HGYA 4RA2A 4NQWB 4BY1J 3B02A 3QYBA 5IY5H 4JYKA 3FF5A 1MMGA 1ZELA 3RPQA 3K4CA 2QENA 2NRAC 4R79A 1ZKGA 1Y0NA 2A69F 5FROA 3ZOBA 3S1QJ 3I56I 2CSOA 4A69C 3BQYA 3HRMA 5ERIA 3A1YA 5L3GA 3WE3A 3KP2A 3WG9A 1KU9A 4M6VA 1GT0C 3GXOA 2XF7A 4A3EJ 4KT5C 2Z1DA 2OZUA 4M9ZA 5EZGA 2UXNA 3G4SI 4XONA 4KYWA 1SVOA 1ZTRA 1XGNA 4O6JA 1VI0A 1IN8A 4O3MA 2L5QA 4HF2A 2FMYA 1P7JA 2VN2A 3H9GA 4XRFA 3RCOA 3GZ6A 2F5VA 4LB6B 1F9NA 3ISPA 2AXTC 3HSFA 1HF0A 4ZTFA 1Z6TA 3GTJJ 4KMUX 2LR8A 3IUOA 4B47A 5FD6A 2TCTA 2CW0F 2XAGA 2CQQA 3BR0A 4FX4A 2R7FA 3U2RA 4YFNF 1ETVA 1H9GA 3BC8A 5HNFA 2HYFA 2JRTA 4M3DA 4XBFA 3P9CA 3ZXSA 3V7SA 2JPCA 3G1OA 4ASNA 3TGNA 3FHNA 3U1KA 2W82A 2UUZA 5F64A 4F91B 5IT9Z 3TOBA 2AQEA 2HQAA 1V55H 1CF7B 1LJ9A 4F52A 2B63J 1GDTA 1YFHA 3DU6A 3MCZA 1ODDA 2M30A 2FUG2 2VJ4A 2L7ZA 1V3FA 3HEFA 3E5UA 5CLSA 3S2DJ 1XTAA 4UVCA 3A01B 4RS8A 4BHCA 3CMMA 2ZSHB 4FT8A 2D5VA 3DLAA 3FKIJ 1FC3A 1VF9A 4M9SA 5KAIC 1G3SA 5E3LA 1Z67A 3EYYA 4KIGA 4BBSJ 2WWYA 1U2WA 2FOKA 4WF2A 1LDJA 3R0JA 2KP6A 2XGEA 4XK4A 3QODA 2BV6A 2M87A 1BR1A 1YX5A 2ZFUA 4EEFG 2XIGA 4L18B 4RB0A 3CP8A 3HL2A 4L0YB 1A5JA 3FK6A 2ESHA 2F4MB 1TQMA 3OL4A 1XMKA 1STZA 1VTNC 2RGVA 1FZPB 3BTIA 3LWFA 1GXPA 2A6EF 3CCRI 1XCBA 2HVRA 2RN7A 4MFEA 5BMZA 3BR6A 1QZYA 2QKLB 1JUSA 2QZ8A 3WTSC 2R7RA 3KYDB 1D8KA 4ZYEA 3I64A 5F1JA 3DFGA 1XGOA 3RKWA 5KVRA 1TNSA 3I4MJ 1HOMA 3KZZA 1MGTA 1HKTA 5F0FA 3HOUJ 3BP8A 2JVGA 4PDKA 2L9RA 3FXJA 4CCLA 4L9TA 5FFXA 4EJOA 3M8FA 1B8IA 5BNGA 1OCZH 3LL7A 5E1ZB 1QU3A 1FT9A 3KP5A 2KJBA 2MGQA 5LBQA 1HW2A 1REPC 3OIPA 1E17A 1WI3A 2EIJH 2VKDA 1JGSA 3JRHA 2EB7A 1B72B 4J01A 5HDNA 1BM9A 2GA1A 2BYVE 4M3BA 2W25A 4KUMA 4CYCB 4PCQA 4X0GA 1IUFA 4P9FA 1NHAA 2HQNA 1N78A 3K4MA 1EH7A 1ON2A 2FNAA 2MA3A 2ZO4A 5LRRA 1T8IA 2LLKA 2VKEA 1W5SA 4XSXF 1WFXA 2ZNZA 3H5NA 3LMMA 3WTUC 1Y1VJ 3C1DA 1ETKA 4Q47A 3L2WA 2COMA 4UUSB 1BI3A 1YITI 1PP8F 2WTEA 1JKQC 2IA2A 4DIQA 2E1MC 4CHUA 1F36A 3BWGA 1V5EA 2DFEA 1XPXA 4M9XA 3BPVA 2DFIA 3I4NJ 3CMAI 3HHHA 2ZMEB 5JI6A 3MAJA 2W57A 1AHDP 1VQNI 1BW5A 2JSCA 3QYEA 3JSPA 2R7VA 2FQ3A 2HZTA 3FIWA 2HOSA 2V1XA 4N9IA 2JK3A 3F8CA 2IGKA 2V1DA 4E70A 1D0YA 2QF7A 4NC7A 3WGHA 1WPKA 1OMIA 3VOEA 1D5YA 4D9JA 1A6QA 3BDDA 1FX7A 4W97A 3T0YA 1YYVA 4HZFA 5LRSA 2DI3A 3G6EI 1MDMB 1IG7A 2P6SA 5IT9K 2DK5A 1R1UA 3DWLE 5DEQA 4HF1A 1IN6A 2J5PA 2BEOA 2LTPA 2ZC2A 3KP4A 1YTYA 1FP1D 5CVJA 4J19A 2R7ZJ 1TWGJ 1LEAA 4A5MA 1FOXA 3CCEI 4MEYF 3HSRA 2XSJC 4HRIA 3HB9A 3FBNB 1YW9A 2Y2ZA 3ESWB 4AIDA 1VQ4I 3AKZA 4E7KA 4PZJA 3HOZJ 2M2EA 3FXLA 1YRNB 2VXDA 2STWA 4M3GA 2PJRA 5LEJA 1X1DA 2L54A 4CYDA 2HEOA 1ETQA 4ZDOA 2Y0SA 3TMOA 2CUFA 4BE1A 3GTKJ 2GAUA 3V8LA 1ZLKA 3F23A 2IEKA 2CO5A 3IH2A 5GP9A 2D1HA 3CUQA 5ICGA 3JTGA 4G6TB 4ZYDA 1D0ZA 4B43A 1ULYA 2ETHA 2EBIA 2DA5A 2WB1N 1U78A 2IPQX 2DDBA 2JA5J 2H94A 4M6XA 3CCUI 1HKSA 5FLXZ 2XPVA 3PSIA 3BG6A 4PJNA 3AL0C 4IX7A 3S8PA 2FOWA 4A3CJ 1U8BA 3D5RC 5K5OA 2ISYA 2GM4A 2R7UA 3LSIA 2UWMA 1T6SA 4ESFA 5HVQC 3JRBA 5LD2C 1VFCA 2BE5F 4Z2YA 1JT6A 5GTHC 3Q0VA 4A0YA 3BZKA 4YFXF 1IDZA 3HHGA 1U8RA 1RI7A 2JTVA 3P7NA 1K7AA 3L09A 1G3TA 1LKXA 3FISA 5EGOA 2R3SA 2A68F 3ABUA 2ZNYA 1TLHB 2KL4A 2KMUA 2LKSA 2EFQA 4Y7NJ 2PX9A 3FXQA 5D8LB 2PI0A 3RJPA 5CVIA 3WU2C 4PSWA 3QWLA 4IPAA 4HLYA 1ENHA 1XDUA 4IHTA 1X2MA 4EV0A 2WA0A 2E71A 2XB0X 4UXNA 2ME6A 1MBEA 2JZYA 3PSFA 4AVZA 2FA5A 1JHFA 3CMEI 1RR7A 3OIOA 2IA0A 3M07A 2Z9OA 1SANA 1PDNC 1OYYA 1KYZA 3I9V2 4B8XA 5DD4A 1IDYA 1UELB 3ZQFA 2HVSA 2RDPA 1H88C 1IN5A 3LSMA 4CO8A 5C3EJ 2Z2SB 4I01A 4RB3C 4II3A 5CQEA 3J81Z 1DGWY 4BYYA 4RM2A 4FTHA 2DODA 2HTSA 4GYIA 4FETA 1HCRA 1JUMA 3QPSA 2M8GX 4BH9A 2BHYA 4B3XA 5KCMA 3B73A 4IVNA 5LEKA 3WTTC 1OCCH 3GCMA 4A12A 3TP0A 3OOPA 3SEZA 1I5ZA 1MJ9A 1FY7A 3OYKA 2EZHA 2O03A 4EQQA 1J5YA 1R5GA 4RAYA 3M1CA 3RPUA 3OWTA 3FX3A 1N25A 3PNYA 3HGGA 2KHMA 5D5VB 2VT3A 5BPDA 2IA1A 1I27A 3H35A 3OV8A 3RSNA 2XC7A 4U0VA 1W0UA 1EA3A 4KICA 3S2WA 1MD0A 2HU9A 4ITVA 2EIMH 5BPIA 2KRFA 3H3UA 3OOUA 3OS1A 2QA4I 5GPAA
chains in the Genus database with same CATH topology
2MYSA 3BCBA 3HKZA 4OAYA 4P5OA 5CKTA 3PNVA 2E60A 2WAQA 4HNUA 2LYCA 2M7BA 4OWRB 2Z16A 2LY1A 3VSLA 3S3MA 2IGMA 1W36C 2KPMA 1Z3YA 2R4GA 1X4OA 4XKVA 3MKZA 4YRVA 1FMVA 3MD2A 4DJAA 3TBIA 4CZCA 3ONQA 2MFZA 2HNHA 2VXZA 3C2HA 2LH9A 3VDXA 5CPRB 4C9YA 2V6EA 3KEYA 4OAZA 4PFOA 4PUSA 4BXFA 3D5LA 3VYRB 2BVLA 2M4GA 3CZ6A 3H0DA 1R6RA 1X4PA 2JVHA 2V4JC 1X1BA 2LY2A 4QPOA 3H9QA 4RLFA 1Z7LA 2IS6A 2X1CA 4XL9A 1MMAA 4U7BA 4CCOA 1IRXA 3PNTA 4BEHB 2IGOA 2K9MA 1NG7A 4XLAA 4LITA 4HEA2 2KZVA 1YX3A 3FKJA 5KNLA 1QHHD 1DGRM 3DTKA 4JOMA 4ZC3A 4KITB 2IGNA 4BQNA 4E4HA 4BDZA 2V9KA 3OYGA 2VQHA 2CW7A 3TL4X 4CH7A 1D0XA 2ZXHA 3EUHC 2ZSIB 1TZLA 3E1SA 4XORA 4F92B 4XOTA 3S32A 1OLTA 2DJIA 3D5SC 1GLNA 3L2QA 2IXSA 4DGWB 3ZCOA 3ZRGA 4KJZA 4NNJA 1WJ5A 4E7SA 2KDOA 4NQWB 4XLHA 3OYNA 3QYBA 4BUPA 2GOXB 4Y3OA 3J7AY 2WY8Q 1MMGA 2DT7B 1ZELA 2XDVA 3OR1C 3K4CA 2KLOA 3DPLC 4BU2A 2MC4A 1P9QC 3K4BA 2CV2A 4CCMA 4R79A 5FROA 4YELA 2W1OA 2P0WA 3OR2C 4AYBA 4CCJA 3DEEA 4ZJZA 1D1AA 3A1YA 1Y56A 3A2KA 2WAEA 2L9NA 1X1CA 2VL8A 3IP4B 5FRNA 3OS2A 2XF7A 3AFHA 2RQQA 2VJ5A 2Z1DA 4XONA 3F9KA 3OYLA 2KQRA 2PJRB 2X51A 4PK4A 2L5QA 2L9SA 3RCOA 3H9GA 2IS1A 2F5VA 3BLYA 1NG6A 4ZTFA 5CQGA 3LSHA 1Z21A 3BCAA 4ZYAA 3NWTA 3IUOA 1UAAA 3VYTB 2K9LA 4B47A 2JSPA 2CS3A 4IQJA 2R7OA 4XQFA 1N75A 4XKCA 2Q1ZB 2LBFA 3KYLA 4J00A 3BC8A 5HNFA 2X6YA 3LSGA 3C2GA 3ZXSA 2F4IA 4QPQA 3OYJA 3W2WA 1W36D 1AA7A 3FHNA 2WAFA 2W82A 2UUZA 4F91B 4E7HA 4C2UA 2AQEA 2HQAA 2AQFA 2OUMA 3EUKL 2VQCA 4F52A 2OV7A 1WJEA 2CFOA 3DU6A 3L2RA 1SAUA 2FUG2 1G8XA 2VJ4A 4PJMA 2L2OA 2L7KA 4PSXA 2WADA 4CCKA 5JHFA 3CMMA 2ZSHB 4BJTA 4F3QA 3DLAA 3VWBA 4D1QA 2VKHA 4U87A 2QKMB 1T0FC 3S93A 3FDYA 2KP6A 1UG0A 3QODA 1BR1A 1YX5A 2A5WA 2ZFUA 3OYHA 2X85A 2VIXA 5TGTA 3CP8A 4F93B 3CF2A 3HL2A 4NUBA 2CH0A 2GOMA 2NOJB 4N4OB 2VB6A 2M4KA 1BOBA 1BR4A 3OL4A 1LFPA 2A6TA 1MMDA 3QYFA 4BACA 4HSRA 2X1EA 2LOOA 2VPLA 1BR2A 2W4SA 3HPGA 2HVRA 3HPHA 2QKLB 4LIUA 4RLQA 3NWSA 2R7RA 3CESA 3OYAA 2HPIA 4XKWA 2HDWA 4XLFA 3W2VA 1T95A 2VQGA 3G2BA 3L2VA 4XMYA 4DBQA 2BW3B 2VASA 3SYTA 4ANJA 4PJJA 2LREA 3DKYA 2RNGA 3K10A 3OIQA 2W00A 3HC7A 2JVGA 1Z3XA 3CJQB 4CCLA 1U0JA 4BGDA 2OC6A 2WBMA 1MMNA 5KHDA 3DQVC 3A4CA 1Y6IA 3LL7A 2CMPA 1QU3A 1DP3A 2F6CA 4EATA 3OIPA 5HOOA 3MMYB 2I8DA 1PJRA 3OYBA 2VKDA 5HLTA 2M7AA 3QOEA 4BJ5C 3PFYA 2Q2EB 4J01A 4BQOA 2V1NA 4X0GA 3VSKA 3HOSA 1N78A 3GBGA 3K4MA 2CUZA 4P1WA 3K4KA 1X1AA 3HOTA 3W3CA 2DT6A 1WFXA 3H5NA 3LMMA 3OYDA 2ZXIA 3UR3C 4JQFA 4BEHA 3L2WA 4IQ4A 2R7WA 2HPMA 2E5ZA 4DIQA 2E1MC 4HNTA 3DTIA 2CW8A 1V5EA 4XKBA 3S3NA 3IAM2 4FASD 4E7JA 3VYUB 4CA0A 2W7NA 3H5AA 4MLOA 4XN0A 3S3OA 3OY9A 1MNEA 3QYEA 3OYCA 2R7VA 4AU7A 2ELJA 3N05A 4CUGA 3SZGA 4XLEA 4E7ZA 3K4NA 1N77A 2IGKA 3OYMA 1D0YA 4NC7A 4LIVA 3SEQA 3RQ4A 1WJCA 1WJFA 4D9JA 2LG4A 2MABA 2KRHA 3DPUA 2V26A 4BE0A 3DWLE 3PUBA 4B48A 1WJAA 2K3PA 3DU5A 1PYVA 1WJBA 3DTEA 1YE9A 2XSJC 1G59A 4HRIA 3HXLA 1OR7C 1LDKB 2O5RA 3FBNB 3V42A 2IS4A 3DPTA 4PJLA 3U21A 1FMWA 4II2A 2E5NA 3AKZA 4E7KA 3K70C 1TT0A 5HNHA 3ZGKA 4BL0B 2BOLA 2VXDA 3FBIB 3I3LA 1K6YA 2JA2A 2E1MB 4B44A 2PJRA 3H5RA 1X1DA 2VLAA 3OYEA 1HA8A 1D1BA 2R7TA 2PMZA 4ZDOA 2Y0SA 3TMOA 1J09A 4BE1A 2IS2A 2BVMA 1SFKA 2CV0A 1X19A 4XR6A 2DOAA 4XLCA 3OS0A 3W2AA 4HSTA 4G6TB 1WJDA 2XF6A 5LFAA 1D0ZA 4B43A 3UNGC 4XM3A 1V5FA 2HZDA 3PSIA 1MW7A 3BG6A 4PJNA 3CJRB 4Y4RA 3AL0C 3L2UA 4IX7A 3S8PA 2WB1A 4XN3A 3K6GA 3MKWB 3PJRA 3ZQQA 3D5RC 3E0JB 2VJJA 2R7UA 3LSIA 2DXIA 4E7LA 2UWMA 3EPZA 2R7XA 2KRCA 1E0EA 5HVQC 5LD2C 2X6WA 2CV1A 3K4JA 2HVQA 3OYFA 3LFUA 2K5CA 2LRDA 1LKXA 3M8JA 2LBFB 2MD0A 2KL4A 2KMUA 1S9HA 4HPQA 1ERDA 4PSWA 2R7SA 2M3AA 4HG2A 4YEJA 4E7IA 4F55A 3EUAA 2WY7Q 2WA0A 3OL3A 3VYSB 4C30A 3PSFA 4AVZA 4IZZA 4DBRA 1V5GA 3I9V2 2UV1A 4BJ6C 1UELB 4GRIA 2VQLA 1KONA 3MKYB 2HVSA 4LG3A 4XOPA 3LSMA 2Z2SB 4CSWA 4II3A 5CQEA 2LC2A 3SDBA 1DGWY 3RTRA 4BQQA 1LVKA 4CCNA 4BDYA 4DOZA 2JUGA 4RM2A 3AL0B 2VJIA 4KT6A 1MNDA 2RREA 4H4KC 3OMYA 4FETA 2DCEA 2X6XA 4PFPA 2XF5A 3ZR8X 1DQUA 2BW3A 4RMNA 3KX2A 4ZDLA 4B3XA 5KCMA 4BS9A 3HG9A 4E6KG 4RM3A 1D1CA 3BG7A 3DKXA 2V7FA 3H9JA 1JI8A 3K4LA 1VZ0A 4XNFA 2R7QA 4N4NB 3SEZA 3OYKA 3IAS2 3LSKA 2M0MA 4KISA 4Y33A 3M1CA 2X1DA 3OWTA 1QHGA 3OYIA 4C2TA 3PNYA 5FRMA 2KHMA 3RPUD 3K70D 3CP2A 3H35A 4NC8A 3RSNA 2XC7A 1EA3A 4ITVA 2HU9A 4ZDPA 4ZTJA 4IKFA 3HUGB 2XAUA 3OOUA 3OS1A 4BE2A 3PL8A 2CUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBN B;  3FBI B; 
#chains in the Genus database with same CATH topology
 3DBR B;  2E1O A;  3HKZ A;  1RUO A;  2Z33 A;  1ZHF A;  3AAF A;  3PNV A;  1EV7 A;  1Y8Q B;  2OD5 A;  2G0E A;  2MH9 A;  4HNU A;  2F48 A;  2LYC A;  3I54 A;  4KMF A;  1XMX A;  2DN0 A;  3GLX A;  2Z16 A;  4AD9 A;  1UST A;  1FIP A;  3W6J B;  1X3U A;  4AVP A;  1O3Q A;  3ELK A;  3S3M A;  2B9S A;  5IP6 A;  1B8I B;  1R4M B;  3RIR A;  3BQZ A;  4HDU A;  1W36 C;  5J1Y A;  3LSP A;  3GTG J;  5EYR A;  1FYL A;  3MKZ A;  2ZCW A;  1IUY A;  1FMV A;  4UV8 A;  4DJA A;  4JP0 A;  2MFZ A;  1NTC A;  4A3I J;  5E17 F;  1BJA A;  2DYS H;  1A04 A;  2A5Y B;  1IXC A;  5FKN A;  2QUF A;  4OAZ A;  3ERE D;  4PUS A;  2FE3 A;  3D5L A;  5GAG J;  1IV8 A;  2M4G A;  3V8J A;  4EM0 B;  1JT0 A;  3H0D A;  1O3S A;  3L00 A;  4WX9 A;  1X1B A;  4OMY A;  4QPO A;  4RLF A;  2IS6 A;  1HKQ A;  2X1C A;  5EJC A;  3KPH A;  1ETW A;  1WKM A;  3K2Z A;  3PNT A;  1BIA A;  2DFF A;  3ZQL A;  1FSE A;  1QZE A;  2HYG D;  1RKT A;  5JVG F;  4XLA A;  2EIN H;  1R9T J;  3E7L A;  2GXG A;  1RRJ A;  1G4D A;  1DGR M;  5E20 A;  5M5W J;  2VOP A;  2A05 A;  3MZH A;  3KZI C;  3ZMU A;  2OTJ I;  4E4H A;  2VBY A;  3JRG A;  4WCG A;  4CH7 A;  1KQ9 A;  3LA2 A;  2OCC H;  2ZSI B;  1TZL A;  5FKO A;  4XOR A;  4QTR A;  3GO5 A;  1ZG3 A;  4OOI A;  4HF0 A;  3G1L A;  4IRG A;  4QWQ A;  5TIS C;  1GLN A;  2EFN A;  2ESN A;  2IXS A;  4NNJ A;  1WJ5 A;  1EH6 A;  4E7S A;  2DPD A;  2PMU A;  3OYN A;  5DUI A;  2GOX B;  5JLW A;  2WV0 A;  4Y3O A;  5IYD J;  4Y13 A;  2XDV A;  3GFM A;  4ZZL A;  1P9Q C;  3QU3 A;  1S5L C;  3EQL F;  3LQQ A;  3ECO A;  2P0W A;  1KQ0 A;  1OCO H;  2W85 A;  2E1N A;  1XDS A;  2H1L A;  2O9L A;  4DYR A;  1HDD C;  3DEE A;  5C4X J;  4ZJZ A;  2ID6 A;  2QQB A;  1Y56 A;  2DA2 A;  3A2K A;  1MMS A;  2J5O A;  3BTC A;  2VON A;  3SFZ A;  1X1C A;  2VL8 A;  3TOA A;  1FBQ A;  5FB2 A;  3ABL H;  3OS2 A;  4IJA A;  5K1Y A;  3WTW C;  1Q1V A;  3OYL A;  1MZB A;  2MSY A;  1W0T A;  2PJR B;  3M9A A;  2X51 A;  4PK4 A;  4NC6 A;  1VQ8 I;  2L9S A;  1O7L A;  2UZK A;  4V2G A;  3QAH A;  2X6O A;  1NG6 A;  3GWZ A;  2P5L C;  2NVU B;  3LSH A;  3BCA A;  1MSF C;  2E2H J;  2JSP A;  3CUQ B;  2GA2 A;  5FD5 A;  1J7K A;  4XQF A;  1N75 A;  2MH2 A;  2Q1Z B;  1ZAO A;  2RVC A;  4ESB A;  5IP7 J;  1IN4 A;  3JW4 A;  2OCE A;  4J00 A;  1NH3 A;  2X6Y A;  4IEJ A;  2FEZ A;  3W2W A;  3O8G A;  1W36 D;  1AA7 A;  3O3K A;  2WAF A;  1U9N A;  2TRT A;  2XGX A;  3G73 A;  4C2U A;  5CJ9 A;  1F5T A;  2RC4 A;  2AQF A;  2OUM A;  3EUK L;  1WJE A;  1E2X A;  2HR3 A;  2DTZ A;  5DTD A;  3L2R A;  2B7E A;  2L9V A;  1Y8R B;  2XSD C;  2CGP A;  4NDL A;  5CYV A;  4IOA F;  4PSX A;  2WAD A;  5JHF A;  4F3Q A;  4M3F A;  3BJA A;  1SD6 A;  2VI6 A;  3AG3 H;  4FQG A;  4BXU A;  3WU1 B;  5EGO B;  1RNL A;  1TW3 A;  1T0F C;  2HXO A;  4A3L J;  1QRY A;  1XGS A;  2OZ6 A;  2HKX A;  3D0S A;  3FDY A;  2DQL A;  4DYC A;  4LGW A;  3ZQI A;  2ELK A;  1GV2 A;  2M9H A;  2JRM A;  1SC7 A;  2A5W A;  3OYH A;  3K1P A;  4HW0 A;  3SHF A;  1IZ1 A;  2NOJ B;  2VB6 A;  2M4K A;  1SEU A;  3HJE A;  1BOB A;  5E1X A;  1BR4 A;  2NVT J;  2P8T A;  3MKL A;  1WZ2 A;  4AUX A;  4BAC A;  2X1E A;  1XD7 A;  3HZJ A;  4EVI A;  1JGG A;  3CQZ J;  3WTY C;  3PIP F;  1DU6 A;  3J80 K;  3DP7 A;  1R5H A;  3HPG A;  2AHQ A;  2UXX A;  2K9N A;  3ZQ7 A;  4RLQ A;  1JXS A;  1ZR2 A;  2DMT A;  2K4J A;  3CES A;  3OYA A;  3HSE A;  2XGC A;  4A3J J;  2HDW A;  4XLF A;  2R93 J;  3W2V A;  1T95 A;  2VQG A;  4BNC A;  3CUQ C;  2VAS A;  4ANJ A;  1WSU A;  2PFB A;  5E1W A;  4AIH A;  3DKY A;  5DS9 A;  2RNG A;  2KIF A;  3K10 A;  2W00 A;  4HNV A;  5M5Y J;  3HC7 A;  4UUV A;  2H6B A;  1M1E B;  3CJQ B;  5B1A H;  4BGD A;  4A3F J;  3M3Y J;  1MMN A;  4HYE A;  4JX4 A;  5LHH A;  2P81 A;  4EM1 A;  1GVD A;  4XRM A;  4C3J J;  2CMP A;  2H1K A;  2DMN A;  4RGX A;  5JHU A;  3PFI A;  3HTU A;  1QBJ A;  1DP3 A;  1B59 A;  2PBI A;  5E8G A;  3OYB A;  1K6O A;  5HLT A;  4BJ5 C;  4MHG A;  3IL2 A;  2Y30 A;  3OSG A;  2STT A;  3BG3 A;  3T1B A;  3HTS B;  3HOS A;  1W1W E;  1MSE C;  2MC3 A;  4P1W A;  1X1A A;  3HOT A;  3O6B B;  4JBA A;  3W3C A;  2E2J J;  3KLN A;  3I58 A;  4JX6 A;  1I3Q J;  4RGS A;  1HW1 A;  1G3W A;  2VBX A;  3CDL A;  2ZXI A;  3UR3 C;  4JQF A;  1R49 A;  2DA7 A;  1FTZ A;  4MFD A;  1OCT C;  2A61 A;  5ED4 A;  2HPM A;  3ZN0 A;  4D5C A;  2L4M A;  2OF7 A;  3S3N A;  2EZL A;  2NS0 A;  1UB9 A;  3I0T A;  5FGM A;  3T8R A;  3L2C A;  4E7J A;  4CA0 A;  2FBK A;  1MJB A;  2K9Q A;  3ABT A;  5J6X A;  2HOT A;  4MLO A;  4UV9 A;  5TRD A;  4D0P A;  4G9Y A;  3OYC A;  4B4C A;  2DU9 A;  1UHS A;  4CUG A;  3KZY A;  3W6K B;  2PJP A;  3CCY A;  2HOA A;  4KA4 A;  1ZRF A;  1N77 A;  2DT5 A;  4LIV A;  3K9T A;  3WTV C;  3GEZ A;  4C2M J;  4D5F A;  3QPH A;  5C4J J;  1K4T A;  4QIW N;  5FKM A;  2IVM A;  4YIR X;  2KRH A;  1ZGA A;  2V26 A;  2V1U A;  2V9P A;  4BE0 A;  1ETY A;  3ZMT A;  3DU5 A;  2M1B A;  1PYV A;  3K2A A;  2JUC A;  1WJB A;  4OU0 A;  2EH3 A;  1FSH A;  1YE9 A;  1X3Z B;  2VE8 A;  3ABK H;  3HXL A;  1OR7 C;  5EDN A;  1SFU A;  2KKO A;  3DPT A;  3JRA A;  2YS9 A;  3MQ0 A;  4DW6 A;  2EFW A;  4HDV A;  3K70 C;  5HNH A;  1L3L A;  3ZGK A;  2CQN A;  4BL0 B;  5FLV A;  2GXA A;  3I3L A;  1TW2 A;  1LFB A;  1K6Y A;  2JA2 A;  2E1M B;  4B44 A;  1JKP C;  3OYE A;  4IRI A;  1RKW A;  4UVA A;  1D1B A;  5HLG A;  4EMS A;  2ZFW A;  4P96 A;  2BVM A;  1X2N A;  2FRH A;  2Y48 A;  4L5J A;  1U6G A;  2CV0 A;  4KFC A;  3DCF A;  1JTY A;  2DOA A;  4XLC A;  4FX0 A;  1WQ2 A;  4BHB A;  3KP7 A;  3NEU A;  3CC2 I;  4HST A;  2O0Y A;  3QU6 A;  3LAJ A;  1UCR A;  3FZV A;  4RAF A;  1ETO A;  1IRF A;  1FBS A;  2DFH A;  3F8M A;  1FJL A;  1VQM I;  3UNG C;  2LKX A;  1JE8 A;  3HOX J;  1LE8 A;  3BR1 A;  1O3T A;  4L9N A;  3RKX A;  3HOV J;  1P92 A;  3L2U A;  2WB1 A;  3J7Y J;  4G7H F;  4X6A J;  4JK1 X;  2Y0M A;  3KE2 A;  4HA8 A;  1O4X A;  3H3V K;  2FX0 A;  2HS5 A;  4UNO A;  2VJJ A;  2MLK A;  3CJN A;  4EJW A;  4S0H B;  5FLM J;  1E0E A;  2KZG A;  3C7J A;  1IN7 A;  2Y75 A;  4C3H J;  5JVT A;  3ZMV A;  4Y15 A;  5L3E A;  3CLO A;  2HVQ A;  4B3A A;  4WWC A;  3I71 A;  3BR5 A;  3W6V A;  3M8J A;  3TO6 A;  5HOD A;  2I10 A;  2MD0 A;  3SZP A;  3S15 J;  1G6N A;  1ERD A;  1ZQ3 P;  3QP6 A;  2O61 A;  2VOD A;  2XVC A;  2R7S A;  1LB2 A;  2YPR A;  1G3Y A;  2M3A A;  4YEJ A;  3IWF A;  1QO0 D;  3LQR A;  2CQ7 A;  2DOF A;  1QVT A;  3ZQG A;  2H6C A;  1S72 I;  2LMD A;  4IZZ A;  1SVL A;  3FMS A;  3MEX A;  4P9U A;  2UV1 A;  2QCO A;  1R1T A;  1RPW A;  2VQL A;  2Z99 A;  4HX7 A;  2AS5 F;  3CD6 I;  2HFH A;  2QQ8 A;  4PGG A;  4XOP A;  5CVU A;  5GAH J;  1F4K A;  2CJJ A;  1LVK A;  2P5K A;  2HKO A;  4RB1 A;  2NVY J;  2GIV A;  3AL0 B;  1LNW A;  1MND A;  2RRE A;  3C2B A;  4H4K C;  3OMY A;  2DCE A;  2VT2 A;  2X6X A;  1ZYR F;  2MG4 A;  5EEH A;  1VQ7 I;  4PFP A;  1DQU A;  5GTI C;  3KX2 A;  3K1M A;  4ZDL A;  4BS9 A;  4MTD A;  3HG9 A;  2IP2 A;  2XAJ A;  1D1C A;  3DKX A;  2ZJR F;  4OIP F;  4G7O F;  3K4L A;  1BOA A;  2XRN A;  3COA C;  3LSK A;  4EJV A;  2M0M A;  4Y33 A;  3FWE A;  1S6L A;  2X1D A;  1P4X A;  1T0F A;  1Z9C A;  1MH3 A;  4I09 A;  1QHG A;  5CVV A;  2LDU A;  1E3P A;  3RPU D;  3CTA A;  3CP2 A;  5DM7 F;  2DO7 A;  2NOG A;  4NC8 A;  3K70 D;  4G12 A;  1SVM A;  1TP4 A;  3GFJ A;  4MQ9 F;  2NNY A;  1D8J A;  2WAQ N;  4JX5 A;  3ULQ B;  2K27 A;  1IGN A;  4BE2 A;  2HWV A;  3F21 A;  3ABM H;  3BR2 A;  2MYS A;  3EET A;  3TW7 A;  4KN4 X;  1B6A A;  1TBX A;  5CKT A;  5LGU A;  1Y1W J;  2XV4 S;  2E60 A;  1ZN2 A;  3FXR A;  4OWR B;  1HBX G;  3VSL A;  1SMY F;  1Z6R A;  3MN2 A;  4B1R A;  2Z5U A;  1AU7 A;  2IGM A;  3HDD A;  2CQK A;  1QA6 A;  2BY0 A;  3DEW A;  2EV0 A;  2R4G A;  2EIL H;  1LUJ B;  4HV5 A;  4XKV A;  1FP2 A;  3BPX A;  4IL6 C;  3X2Q H;  4YRV A;  5L3D A;  1FEX A;  4XIC A;  5IOZ A;  4OIO F;  2XPW A;  3M1E A;  3C2H A;  3TDZ C;  1R4N B;  2LH9 A;  2NVQ J;  2VPR A;  2TDX A;  4YFK F;  1BI1 A;  4PFO A;  3T8T A;  1ITY A;  4BXF A;  1W7P A;  1ONV A;  2LY2 A;  3LOC A;  1OYW A;  3H9Q A;  1Z7L A;  2EA4 A;  2FXA A;  3BZC A;  2BY3 A;  2QSG X;  4U7B A;  1OIS A;  1POG A;  2LVS A;  2QEX I;  5DCM A;  4XSZ F;  2K9M A;  2VE9 A;  1KU3 A;  2MD5 A;  4LIT A;  2KZV A;  2DOE A;  1QNT A;  4QLC U;  1YLF A;  3DV8 A;  1VND A;  2V9K A;  2RKH A;  2VQH A;  1J59 A;  1YHQ I;  4RAG A;  4UHT A;  1Y39 A;  2ZXH A;  1USS A;  3E1S A;  3LST A;  9ANT A;  3E5X A;  2FU4 A;  2WV1 A;  1B4A A;  2K3F A;  3D5S C;  3FXM A;  2QQ9 A;  2HI3 A;  2XAF A;  4IHS A;  1SD4 A;  4KJZ A;  3RYR A;  3H92 A;  5HS9 A;  3C18 A;  3CDI A;  3PQK A;  1OQY A;  4BUP A;  3K0L A;  4AYB N;  3N4M A;  2P7V B;  3J7A Y;  2WY8 Q;  3LAP A;  2DT7 B;  3OR1 C;  2H8W A;  2CV2 A;  2ZBK A;  1EF4 A;  3MZ8 A;  4YEL A;  2W1O A;  3IHU A;  4G7Z F;  1LEB A;  2XB5 A;  3OR2 C;  3PQJ A;  1OKR A;  5H6Q A;  3PO3 J;  5H6R A;  4CCJ A;  3I4P A;  3TP3 A;  1D1A A;  2JA6 J;  3JRD A;  3TQN A;  5D8K B;  4S05 A;  3CCQ I;  2L9N A;  3A02 A;  2ICW G;  1FYM A;  5FRN A;  2BBY A;  2VJ5 A;  2P6T A;  2E36 A;  1CQT A;  2YX7 A;  1YG2 A;  1D3Y A;  3V8K A;  3GUD A;  1YQA A;  2BXZ A;  3CCV I;  3F9K A;  4HQE A;  3LSJ A;  4GYG A;  4AWX B;  4HAM A;  3F72 A;  2F4O B;  4PJ0 C;  5M3M J;  2IS1 A;  3BLY A;  1OR7 A;  3TED A;  2L3D A;  1Z21 A;  3Q0U A;  4HX8 A;  1Z0X A;  5JFR A;  1U5T C;  1UAA A;  2K9L A;  1SD7 A;  2CS3 A;  2NXN B;  2R7O A;  4MNU A;  3M8E A;  3I59 A;  2LBF A;  3KYL A;  3Q9S A;  1TQI A;  5D5W B;  3F8B A;  3G1M A;  4BKX A;  4ENK A;  3CO7 C;  1WI9 A;  3CJT B;  3AG4 H;  3C2G A;  3FK7 A;  3LSG A;  5TJJ A;  3R60 A;  3FM5 A;  2F4I A;  1S7O A;  4BQA A;  3RDI A;  3LNQ A;  3KEO A;  5IYC J;  1LE8 B;  4E7H A;  2R7D A;  4MGR A;  3GZN B;  5M5X J;  1QPM A;  2MLG A;  2M8E A;  4AIK A;  4Y52 J;  2CFO A;  2H09 A;  3EDP A;  3F3X A;  5EEA A;  4IHW A;  1G8X A;  2DMP A;  1DPR A;  2VUM J;  3DBH B;  2L2O A;  2L7K A;  1IW7 F;  1FBU A;  5J1R A;  4LFU A;  5D4R A;  2LFB A;  4BJT A;  1IJW C;  3VWB A;  2VKH A;  3HRU A;  4FHT A;  2CRG A;  3K69 A;  3TO9 A;  2PMH A;  2QKM B;  1Z7U A;  2VBZ A;  4GCV A;  4Q48 A;  5D4S A;  5J47 A;  3S93 A;  1CGP A;  1NK3 P;  2ECC A;  3GW2 A;  3QRF F;  3ZN1 A;  4A3K J;  1UG0 A;  1DDN A;  3S17 J;  2X85 A;  4EJT A;  5TGT A;  3BZ6 A;  2KT0 A;  5JLX A;  1K78 A;  2L0K A;  3ROU A;  3JRI A;  1LFP A;  2A6T A;  4U88 A;  4CXF A;  4HSR A;  1JUP A;  2LOO A;  3FXO A;  4A2U A;  1W4M A;  1BR2 A;  3JRC A;  2W4S A;  1W5C C;  1IXR C;  3J80 Z;  1MJA A;  1MIJ A;  2DTR A;  2FNP A;  4I6Z A;  3BJ6 A;  2DJN A;  1MBK A;  1KU7 A;  4LIU A;  1A36 A;  3NWS A;  3RQI A;  3FXK A;  4XKW A;  4CDG A;  5DD8 A;  1BL0 A;  3G2B A;  2HQ5 A;  4XMY A;  4DBQ A;  3DF8 A;  4BAY A;  2RQP A;  3BT9 A;  1TNT A;  5F6F A;  3OIQ A;  3PO2 J;  3WOD F;  1Z3X A;  3J7Z I;  2OA4 A;  1U0J A;  2OC6 A;  5J40 A;  1Y6I A;  5JR3 A;  2BHZ A;  1UG2 A;  2GLO A;  1RES A;  4EAT A;  2M34 A;  4I99 C;  2F5D A;  1Z77 A;  3MMY B;  2FBH A;  1PJR A;  1A6I A;  1UJ8 A;  2I8D A;  1AOY A;  2P5V A;  3QOE A;  1UMQ A;  3PFY A;  3VPR A;  2NYX A;  1XGM A;  1P4W A;  3H1C A;  3E6M A;  3TDU C;  3VSK A;  2R5Y A;  5K7Z A;  3GBG A;  1SAX A;  2CUZ A;  1T98 A;  3J7A O;  4LOC A;  1V4R A;  4RDU A;  1XMA A;  2N8G A;  1K61 A;  3CCJ I;  2BY2 A;  4P55 A;  2ZXJ A;  3RI4 A;  4KDP A;  1O57 A;  2XUB A;  4BEH A;  3DEU A;  5E18 F;  3P9K A;  2ME0 A;  2R7W A;  3T5X A;  1VQ5 I;  2EZI A;  2EPF A;  4Y17 A;  2E5Z A;  4HNT A;  5H20 A;  2PN6 A;  2CW8 A;  2R5Z A;  3ZPL A;  3NRV A;  4XKB A;  1E3H A;  2ACJ A;  1LVA A;  2LSO A;  5KK1 A;  3VYU B;  4FE4 A;  4ZH4 F;  2W7N A;  1UHM A;  1S29 A;  2BXY A;  4ZYH A;  4XN0 A;  3OY9 A;  2DDA A;  1MNE A;  3BG5 A;  4WXC A;  3KET A;  4LLN A;  4AU7 A;  3N05 A;  4L9V A;  5HS7 A;  3NAU A;  4XLE A;  5A2Q K;  3CMY A;  4CIC A;  3OYM A;  1W7P B;  3SEQ A;  3E3V A;  3RQ4 A;  1OJL A;  3BJO A;  1O3R A;  1WJF A;  3LSR A;  2LG4 A;  2RV8 A;  2B0L A;  5AON A;  1LPQ A;  3GTP J;  3S14 J;  5DCM B;  2QM3 A;  5F04 A;  5M3F J;  1ZR4 A;  5IP9 J;  4G6D A;  2L01 A;  1SMT A;  2XRO A;  2OJE D;  3DTE A;  4IXA A;  4NHJ A;  1LDK B;  4NB5 A;  5ILS A;  4B09 A;  1J9I A;  3FM3 A;  1B1B A;  2IS4 A;  4G94 A;  1FWZ A;  3MZY A;  5K5R A;  4LMY A;  1WCM J;  3U21 A;  1FMW A;  3JAM Z;  1ACI A;  2QSF X;  2V79 A;  2E5N A;  3ZMD A;  4DZP A;  2PMZ N;  2BOL A;  3U9G A;  5J1U A;  3FBI B;  5E8I A;  1FOK A;  3IH4 A;  3MVP A;  2H8R A;  4KNY A;  2LF8 A;  3H5R A;  1E3O C;  1MBH A;  1DPU A;  2VLA A;  2Y9Z A;  5BS6 A;  5ILU A;  1Z05 A;  1HA8 A;  1XC5 A;  1O7F A;  4HBL A;  1G2H A;  3CCM I;  3KP3 A;  5LLQ A;  3JRE A;  3WTZ A;  4LK1 F;  5D6E A;  1IO2 A;  1BJZ A;  1X19 A;  3G3Z A;  3KIO A;  4XR6 A;  2ZME A;  3GLL A;  3OS0 A;  5F0H A;  5LHG A;  3W2A A;  2M0C A;  4L5I A;  4WK8 F;  5BQT A;  2V9V A;  1WJD A;  3HBL A;  1YJW I;  5B66 C;  3K1N A;  1YIO A;  3RKQ A;  3QPL A;  4M72 A;  3GF2 A;  2AO9 A;  4FCY A;  1V5F A;  2YSR A;  2HZD A;  4GO1 A;  1MW7 A;  1R71 A;  1J75 A;  4Y4R A;  1U3E M;  3CCL I;  1T56 A;  2DQR A;  1GUU A;  4LG0 A;  4DNC A;  2OBP A;  4D7N A;  1RIO H;  3E0J B;  2DXI A;  2R7X A;  3EPZ A;  3MFK A;  2KRC A;  4NBQ A;  5DV5 A;  1APL C;  4L0Z B;  4KIF A;  4A6E A;  2CV1 A;  3K4J A;  1MBF A;  2HQR A;  3OYF A;  3LFU A;  2K5C A;  2LRD A;  2X0L A;  3IKV A;  1ZH5 A;  1GVJ A;  1Z1D A;  3I59 B;  3GZ5 A;  2LBF B;  1OFC X;  1K79 A;  3DLL F;  2D2W A;  2KIQ A;  4HPQ A;  4K2E A;  3A03 A;  3ZP5 A;  1EJ9 A;  2L7F P;  1X58 A;  3E5Q A;  3L7W A;  2X4H A;  3ASO H;  4E7I A;  4F55 A;  4XID A;  2JA8 J;  1KA8 A;  3ZMS A;  1U5T A;  3RZD J;  2IJL A;  1J2X A;  3BRO A;  2K85 A;  2YU9 J;  4EGZ A;  1ON1 A;  3RZO J;  4S04 A;  3P9I A;  2K7L A;  4M6Y A;  3WTX C;  4EM2 A;  4GRI A;  2OAZ A;  3MKY B;  5IOY A;  4LG3 A;  5J3L A;  4CSW A;  3SDB A;  4BDY A;  2LC2 A;  5EG0 A;  3RTR A;  5DUK A;  2G9W A;  2ZJ2 A;  2JUG A;  4DOZ A;  3KYC B;  2VJI A;  2KDZ A;  4KT6 A;  1IC8 A;  1XB4 A;  3S1N J;  5EF6 A;  2BW3 A;  4RMN A;  3VEP A;  1I39 A;  2O8K A;  2JT1 A;  3ERM A;  4E6K G;  1WGX A;  3BG7 A;  2LF7 A;  4R8H A;  3GFL A;  3H9J A;  1JI8 A;  3SFI A;  1TWC J;  3AG1 H;  4N4N B;  1S8N A;  3I53 A;  3JCU C;  5EZH A;  2ID3 A;  2Y9Y A;  4A6D A;  1K78 B;  2DMU A;  2D1V A;  4X1E A;  3SDG A;  4IO9 F;  1TTY A;  3OYI A;  1R58 A;  4HX4 A;  2HGC A;  1BI0 A;  2FQ4 A;  5FKL A;  4IKF A;  4ZDP A;  2Q2E A;  3NAR A;  5DM6 F;  1MBJ A;  1YJ9 I;  2CUJ A;  2O3F A;  4ON0 A;  2E2I J;  4OAY A;  2QQA A;  4P5O A;  3JAM K;  2EFO A;  2WAQ A;  3OSF A;  2DA1 A;  5GAD J;  4MO7 A;  1LFU P;  1XCV A;  4A93 J;  5AIP A;  2NNN A;  4WXH A;  1JJ8 C;  2KPM A;  3B6A A;  1IRG A;  1X4O A;  3GTL J;  4D7M A;  3N97 A;  3GYH X;  1GXQ A;  2MW8 A;  2V6C A;  5AIQ A;  3MD2 A;  5GPC A;  3QOP A;  5K5Q A;  3TBI A;  1JJ6 C;  4A0X A;  3ONQ A;  5E79 C;  1R1V A;  1I6X A;  2VXZ A;  3VDX A;  5CPR B;  4A5N A;  1HXD A;  5IT3 A;  3IWZ A;  4V19 K;  1XSD A;  1YW7 A;  3S2H J;  3VYR B;  1K4S A;  1VQL I;  3SQN A;  2R5Y B;  1EH8 A;  3ASN H;  3ZQH A;  1ZLJ A;  4LK0 F;  2L7M P;  3RKY A;  2K4B A;  1P6R A;  2L02 A;  1ZGJ A;  1W7P D;  4XL9 A;  2LK2 A;  3V4G A;  3SZT A;  2LP0 A;  3E97 A;  2QLZ A;  4BEH B;  2LD5 A;  2IGO A;  1FLI A;  4GGG A;  1MBG A;  4HEA 2;  1IV6 A;  1RET A;  1TWF J;  4M73 A;  1YX3 A;  1LDD A;  5IYB J;  1FOY A;  2R5Z B;  1FYK A;  2E35 A;  4ZC3 A;  1R36 A;  4IOC F;  2CUE A;  5HLI A;  1T2K A;  1DP7 P;  1OPC A;  2F5F A;  2P4W A;  3OYG A;  2DYR H;  1RC9 A;  1OCP A;  3RYP A;  1PVE A;  4XOT A;  4UB8 C;  1OLT A;  2DJI A;  2JA7 J;  3L2Q A;  3C3W A;  2XHK A;  4DGW B;  1ZRC A;  3SXY A;  2F2E A;  1ZG5 A;  1XN7 A;  1UFM A;  3QQA A;  3CUO A;  2XAH A;  2K9S A;  4XLH A;  2G7H A;  4IHX A;  3O8H A;  4BU2 A;  1ZK8 A;  2KLO A;  3DPL C;  4BXX J;  2MC4 A;  3E6D A;  3DKW A;  3K4B A;  4Z6Y A;  3HM5 A;  4CCM A;  5L3F A;  3HRS A;  1Z91 A;  3HOW J;  3PM1 A;  1F1Z A;  2KFD A;  1UZC A;  4AYB A;  5K7H A;  4L9J A;  4C3I J;  4IHY A;  3R4K A;  2WAE A;  2M5W A;  1P2F A;  4XRS G;  1JHH A;  3IP4 B;  1ZGW A;  3AFH A;  2RQQ A;  1H89 C;  3HOY J;  1H0M A;  2ISZ A;  2QVO A;  4A3D J;  3MWM A;  1MKM A;  4MTE A;  5FJ8 J;  3ZMZ A;  2KQR A;  3BR3 A;  3IRQ A;  2EWN A;  5E3M A;  3K7A J;  3L1P A;  3A0H C;  3WGG A;  2PG4 A;  2JPB A;  1S3J A;  1A35 A;  2BZT A;  3Q5F A;  2JMW A;  5CQG A;  4ZYA A;  1P7I A;  1B9M A;  3NWT A;  4OIN F;  4I2O A;  3VYT B;  4TV7 A;  3GX4 X;  1BN5 A;  3H0G J;  4RAZ A;  4IQJ A;  1AKH A;  3E6C C;  4KN7 X;  4HQM A;  4XKC A;  5LHI A;  2CYY A;  5B5E C;  2OQG A;  2P7C B;  1J0R A;  1F43 A;  1PUE E;  2DPU A;  4QPQ A;  2X48 A;  3OYJ A;  1I6H J;  5DYM A;  1DUX C;  1HDP A;  3CF5 F;  2A3S A;  1XSX A;  1WWX A;  1RR8 C;  2DA3 A;  2XKO A;  3GTM J;  4LG0 B;  3GFI A;  2VQC A;  2OV7 A;  3R6S A;  1BC8 C;  2XAS A;  1Q1H A;  1SAU A;  4PJM A;  3WE2 A;  1YW8 A;  3QP5 A;  2OQR A;  3AG2 H;  1IAW A;  1B9N A;  3IRR A;  3GME A;  4CCK A;  1BBY A;  2XGD A;  2VC1 A;  3CDH A;  2W48 A;  4D1Q A;  2M45 A;  2HXI A;  4EJU A;  5J8F A;  4U87 A;  1HW5 A;  2YR2 A;  4I76 A;  3QPT A;  1FPQ A;  2OTL I;  2OPT A;  1I50 J;  5F27 A;  1LQ1 A;  3PIO F;  2EV6 A;  2KJC A;  1T08 B;  2IAI A;  2MBF A;  1R23 A;  1U5T B;  2VIX A;  1MNM C;  4BBR J;  2Q8K A;  1XSV A;  4M74 A;  2HDD A;  3M4O J;  4F93 B;  3CF2 A;  2A07 F;  4NUB A;  2CH0 A;  3E6B A;  4RBO A;  2GOM A;  4N4O B;  4A3G J;  3S1M J;  3WGI A;  3EUH A;  1WHU A;  1YI2 I;  1KGS A;  3ML6 A;  1VQK I;  2K40 A;  4YII A;  1MMD A;  3QYF A;  3O2P E;  1BA5 A;  2VPL A;  3WHC A;  5LGT A;  5E3N A;  1KU2 A;  2F5C A;  4ZYG A;  4IF4 A;  3HPH A;  3REO A;  3HUG A;  5EG0 B;  5ICE A;  1R22 A;  3HYI A;  1TL8 A;  4HV6 A;  2HPI A;  1WVR A;  5B1B H;  1QGP A;  1X3W B;  3L2V A;  2ZME C;  3D1N I;  5BOX A;  1T38 A;  2BW3 B;  3SYT A;  2KIU A;  4PJJ A;  2LRE A;  1IRZ A;  1IXS B;  2F5E A;  1BIB A;  3BY6 A;  1YS7 A;  2QBY A;  3IH3 A;  1HSJ A;  1SFE A;  2EZK A;  2WBM A;  5KHD A;  3DQV C;  4MEX F;  2FJ1 A;  3LFK A;  3A4C A;  4HLX A;  4XRS A;  1YJN I;  1HLV A;  2HDC A;  1HQC A;  1TC3 C;  1KYW A;  2F6C A;  1S7E A;  5HOO A;  4A3B J;  1FIA A;  5C44 J;  3TW6 A;  5H2F C;  2E7X A;  2M7A A;  2O7O A;  3I5U A;  2PQ8 A;  2EV5 A;  2Q2E B;  4YG2 F;  3GVA A;  2EK5 A;  2RNJ A;  2WC2 A;  2C6Y A;  4BQO A;  2V1N A;  3KLO A;  2LY9 A;  3DBL B;  1WRJ A;  2ZJP F;  2VOO A;  1YS6 A;  3F8F A;  2Z3Y A;  2PEX A;  3K4K A;  5ILV A;  1P4A A;  2HOE A;  4BY7 J;  2FML A;  2DT6 A;  1A31 A;  3FXU A;  4XLN F;  4U0Y A;  3OYD A;  1KZH A;  2Y31 A;  4IQ4 A;  2CU7 A;  2JN6 A;  3DTI A;  2CFX A;  1JTX A;  2LNB A;  4R1H A;  5F0C A;  3IAM 2;  4FAS D;  2H27 A;  1L0O C;  3F8N A;  3GTO J;  3H5A A;  4I02 A;  2PLY A;  5D6F A;  3S3O A;  1VQ9 I;  2KIS A;  4KIB A;  2IBD A;  4GDF A;  3H36 A;  2ELJ A;  3PUF A;  4ABZ A;  3F6V A;  1Y0U A;  3SZG A;  3TO7 A;  4E7Z A;  3K4N A;  5A2Q Z;  4ENM A;  3I55 I;  1GV5 A;  3DXJ F;  4Q4Z F;  1PUF A;  5FO5 A;  1WJC A;  1QZZ A;  4A3M J;  4I98 B;  2E19 A;  1QPI A;  2FF4 A;  4CZZ A;  2MAB A;  4NQW A;  3DPU A;  1HST A;  1X1P A;  2FBI A;  3PUB A;  4B48 A;  5E3O A;  1WJA A;  2K3P A;  4BHP A;  3CC7 I;  1XG1 A;  2DAO A;  3F22 A;  2JQ7 A;  4MIM A;  4XLP F;  1G59 A;  2GZW A;  5F1R A;  4M71 A;  2O5R A;  4IRH A;  3V42 A;  5ICF A;  2GWR A;  3TKY A;  4PJL A;  2EFP A;  3UKG A;  4II2 A;  2ZXW H;  2CQX A;  2ECB A;  2JWT A;  1TT0 A;  4PGH A;  4IHV A;  2DW4 A;  2Y0S N;  5B3S H;  1C0W A;  1FOW A;  1BC7 C;  1ZAR A;  1UHW A;  3M7G A;  2XAQ A;  1RZ4 A;  2E7W A;  3LA3 A;  2R7T A;  2PMZ A;  1J09 A;  3LA7 A;  2IS2 A;  4DQ2 A;  2NS7 A;  2YU3 A;  3GTQ J;  1SFK A;  2VBW A;  3IV5 A;  4RB2 C;  5ICC A;  4OMZ A;  3A0B C;  4FE7 A;  2O8X A;  4RGR A;  3WHB A;  2XF6 A;  3F6O A;  4W1U A;  4AC0 A;  5LFA A;  1YOV B;  1TWH J;  3KP6 A;  1I3A A;  3EYI A;  1H8A C;  4XM3 A;  4CGZ A;  4ESJ A;  5GAE J;  5DCF A;  5FLX K;  3CO6 C;  1BI2 A;  4RGU A;  3CJR B;  4AIJ A;  3U1D A;  1ZRE A;  4A0Z A;  4ZZD A;  4XN3 A;  5HLH A;  1SFX A;  2O6G E;  3K6G A;  2A6H F;  1CF7 A;  3MKW B;  1NK2 P;  2W84 A;  3PJR A;  5FFZ A;  2R92 J;  3ZQQ A;  3FHZ A;  4G8X A;  4LJZ F;  5CVR A;  4E7L A;  2EA2 A;  4Q5S F;  2BY1 A;  2GQQ A;  5EEG A;  4N9H A;  5FKK A;  4UUT A;  4F7Z A;  3A01 A;  2X6W A;  3L9F A;  2QSH X;  1OYI A;  4EGY A;  5K7F A;  1R7J A;  1AKH B;  1I1G A;  3IKT A;  1S9H A;  3R0A A;  4UY8 I;  4GXO A;  2GXB A;  1HC8 A;  1AWC A;  4HG2 A;  1V54 H;  3P5J A;  4N0B A;  3EUA A;  3V7R A;  2WY7 Q;  4L5E A;  4ETS A;  5DDG A;  3OL3 A;  2GBY A;  3VFZ A;  2NS8 A;  1ETX A;  2Y69 H;  3VYS B;  3BG9 A;  4C30 A;  3V7C A;  3CLQ A;  2YUS A;  1VQO I;  2COB A;  5HS8 A;  1YIJ I;  3WG7 H;  3IC7 A;  2E1C A;  4DBR A;  2ELH A;  1V5G A;  1OCR H;  2QGU A;  2D45 A;  1PP7 U;  4ENJ A;  2ZKZ A;  4BJ6 C;  2CG4 A;  3JR9 A;  5KAF C;  1KON A;  4I0A A;  2QWW A;  3ECH A;  4UVB A;  3VOD A;  1ZRD A;  4QSH A;  4BQQ A;  4CCN A;  1T33 A;  2DK8 A;  3J81 K;  2RAE A;  2DMQ A;  2E34 A;  3JSO A;  2K02 A;  2X9D A;  3JRF A;  3KFW X;  2XF5 A;  1TT5 B;  3ZR8 X;  2NVX J;  2XKP A;  3B6C A;  3FMQ A;  1RUN A;  4LB5 A;  1QVU A;  3S16 J;  2DBB A;  5D5X B;  1SD5 A;  1WH7 A;  4RM3 A;  5L3C A;  1BW6 A;  3CC4 I;  3Q9V A;  2V7F A;  1S7A A;  2FSW A;  1VZ0 A;  1T39 A;  1D5V A;  1ORK A;  1R00 A;  3JTH A;  2R7Q A;  4XNF A;  2ZJQ F;  4M3E A;  3G71 I;  3IAS 2;  3HIF A;  3VB2 A;  2IT0 A;  4KIS A;  4OIQ F;  2HYJ A;  3KEQ A;  5F08 A;  1I1S A;  4C2T A;  5FRM A;  1TQP A;  1KQ8 A;  4UB6 C;  1FNN A;  4YIF A;  3BTL A;  3HKZ N;  1EKE A;  2NAZ A;  4ZTJ A;  4LLL A;  3BTJ A;  3HUG B;  2DA4 A;  1B72 A;  4AM3 A;  2XAU A;  2DLL A;  1JKO C;  2ZB9 A;  1VQP I;  4CYC A;  3PL8 A;  3FMR A;  3ZQC A;  3BCB A;  1ZG1 A;  1DU0 A;  2VC0 A;  3Q3S A;  4WXD A;  2EIK H;  3H3Z A;  2OU2 A;  2M7B A;  4GFB A;  5L3B A;  2JJ7 A;  2LY1 A;  2ADU A;  1U9O A;  2K86 A;  4FIS A;  4I0B A;  4DYQ A;  1YO5 C;  2QBY B;  6PAX A;  2AXL A;  4UUS A;  3KCC A;  5J4Y A;  1Z3Y A;  4HOB A;  3F0C A;  1XS9 A;  5HDG A;  1IF1 A;  2R0Q C;  4OIR F;  2I5U A;  1TWA J;  4CZC A;  4U7D A;  3Q0W A;  4V2F A;  5LGN A;  2VKV A;  2HNH A;  4C9Y A;  2FD5 A;  2V6E A;  3NQO A;  1QQI A;  2KIM A;  3KEY A;  2L4A A;  3BOQ A;  1H9T A;  1R5I D;  1VQ6 I;  2CWE A;  5IPA A;  3WU0 A;  2BVL A;  1SFO J;  1JKR C;  3CZ6 A;  1R6R A;  1X4P A;  2GIZ A;  4LD5 A;  4O5V A;  5HDK A;  2JVH A;  2V4J C;  4LLG F;  5J4V A;  2IRF G;  1W5T A;  2LKP A;  3S1R J;  2EJR A;  2G7U A;  1MMA A;  1MH4 A;  5D5U B;  3CCS I;  4CCO A;  1IRX A;  4DZJ A;  1MDM A;  4I7H A;  2BGC A;  1NG7 A;  2XRL A;  2YX4 A;  1FTT A;  3FKJ A;  5KNL A;  1QHH D;  2IW5 A;  3DTK A;  4JOM A;  4KIT B;  4ENN A;  3SJM A;  2IGN A;  2XPU A;  4BQN A;  4BDZ A;  2QYO A;  4H0E A;  2EQR A;  2CW7 A;  3TL4 X;  1D0X A;  3R61 A;  1WH5 A;  2Q0O A;  1K83 J;  2W24 A;  3EUH C;  4U0W A;  3S32 A;  4F92 B;  4G6Q A;  5J8C A;  2HTJ A;  1YRN A;  1GHC A;  4MQV A;  3ZCO A;  1PUF B;  1XX5 A;  3ZRG A;  2DA6 A;  3HRT A;  2KDO A;  3HGY A;  4RA2 A;  4NQW B;  4BY1 J;  3B02 A;  3QYB A;  5IY5 H;  4JYK A;  3FF5 A;  1MMG A;  1ZEL A;  3RPQ A;  3K4C A;  2QEN A;  2NRA C;  4R79 A;  1ZKG A;  1Y0N A;  2A69 F;  5FRO A;  3ZOB A;  3S1Q J;  3I56 I;  2CSO A;  4A69 C;  3BQY A;  3HRM A;  5ERI A;  3A1Y A;  5L3G A;  3WE3 A;  3KP2 A;  3WG9 A;  1KU9 A;  4M6V A;  1GT0 C;  3GXO A;  2XF7 A;  4A3E J;  4KT5 C;  2Z1D A;  2OZU A;  4M9Z A;  5EZG A;  2UXN A;  3G4S I;  4XON A;  4KYW A;  1SVO A;  1ZTR A;  1XGN A;  4O6J A;  1VI0 A;  1IN8 A;  4O3M A;  2L5Q A;  4HF2 A;  2FMY A;  1P7J A;  2VN2 A;  3H9G A;  4XRF A;  3RCO A;  3GZ6 A;  2F5V A;  4LB6 B;  1F9N A;  3ISP A;  2AXT C;  3HSF A;  1HF0 A;  4ZTF A;  1Z6T A;  3GTJ J;  4KMU X;  2LR8 A;  3IUO A;  4B47 A;  5FD6 A;  2TCT A;  2CW0 F;  2XAG A;  2CQQ A;  3BR0 A;  4FX4 A;  2R7F A;  3U2R A;  4YFN F;  1ETV A;  1H9G A;  3BC8 A;  5HNF A;  2HYF A;  2JRT A;  4M3D A;  4XBF A;  3P9C A;  3ZXS A;  3V7S A;  2JPC A;  3G1O A;  4ASN A;  3TGN A;  3FHN A;  3U1K A;  2W82 A;  2UUZ A;  5F64 A;  4F91 B;  5IT9 Z;  3TOB A;  2AQE A;  2HQA A;  1V55 H;  1CF7 B;  1LJ9 A;  4F52 A;  2B63 J;  1GDT A;  1YFH A;  3DU6 A;  3MCZ A;  1ODD A;  2M30 A;  2FUG 2;  2VJ4 A;  2L7Z A;  1V3F A;  3HEF A;  3E5U A;  5CLS A;  3S2D J;  1XTA A;  4UVC A;  3A01 B;  4RS8 A;  4BHC A;  3CMM A;  2ZSH B;  4FT8 A;  2D5V A;  3DLA A;  3FKI J;  1FC3 A;  1VF9 A;  4M9S A;  5KAI C;  1G3S A;  5E3L A;  1Z67 A;  3EYY A;  4KIG A;  4BBS J;  2WWY A;  1U2W A;  2FOK A;  4WF2 A;  1LDJ A;  3R0J A;  2KP6 A;  2XGE A;  4XK4 A;  3QOD A;  2BV6 A;  2M87 A;  1BR1 A;  1YX5 A;  2ZFU A;  4EEF G;  2XIG A;  4L18 B;  4RB0 A;  3CP8 A;  3HL2 A;  4L0Y B;  1A5J A;  3FK6 A;  2ESH A;  2F4M B;  1TQM A;  3OL4 A;  1XMK A;  1STZ A;  1VTN C;  2RGV A;  1FZP B;  3BTI A;  3LWF A;  1GXP A;  2A6E F;  3CCR I;  1XCB A;  2HVR A;  2RN7 A;  4MFE A;  5BMZ A;  3BR6 A;  1QZY A;  2QKL B;  1JUS A;  2QZ8 A;  3WTS C;  2R7R A;  3KYD B;  1D8K A;  4ZYE A;  3I64 A;  5F1J A;  3DFG A;  1XGO A;  3RKW A;  5KVR A;  1TNS A;  3I4M J;  1HOM A;  3KZZ A;  1MGT A;  1HKT A;  5F0F A;  3HOU J;  3BP8 A;  2JVG A;  4PDK A;  2L9R A;  3FXJ A;  4CCL A;  4L9T A;  5FFX A;  4EJO A;  3M8F A;  1B8I A;  5BNG A;  1OCZ H;  3LL7 A;  5E1Z B;  1QU3 A;  1FT9 A;  3KP5 A;  2KJB A;  2MGQ A;  5LBQ A;  1HW2 A;  1REP C;  3OIP A;  1E17 A;  1WI3 A;  2EIJ H;  2VKD A;  1JGS A;  3JRH A;  2EB7 A;  1B72 B;  4J01 A;  5HDN A;  1BM9 A;  2GA1 A;  2BYV E;  4M3B A;  2W25 A;  4KUM A;  4CYC B;  4PCQ A;  4X0G A;  1IUF A;  4P9F A;  1NHA A;  2HQN A;  1N78 A;  3K4M A;  1EH7 A;  1ON2 A;  2FNA A;  2MA3 A;  2ZO4 A;  5LRR A;  1T8I A;  2LLK A;  2VKE A;  1W5S A;  4XSX F;  1WFX A;  2ZNZ A;  3H5N A;  3LMM A;  3WTU C;  1Y1V J;  3C1D A;  1ETK A;  4Q47 A;  3L2W A;  2COM A;  4UUS B;  1BI3 A;  1YIT I;  1PP8 F;  2WTE A;  1JKQ C;  2IA2 A;  4DIQ A;  2E1M C;  4CHU A;  1F36 A;  3BWG A;  1V5E A;  2DFE A;  1XPX A;  4M9X A;  3BPV A;  2DFI A;  3I4N J;  3CMA I;  3HHH A;  2ZME B;  5JI6 A;  3MAJ A;  2W57 A;  1AHD P;  1VQN I;  1BW5 A;  2JSC A;  3QYE A;  3JSP A;  2R7V A;  2FQ3 A;  2HZT A;  3FIW A;  2HOS A;  2V1X A;  4N9I A;  2JK3 A;  3F8C A;  2IGK A;  2V1D A;  4E70 A;  1D0Y A;  2QF7 A;  4NC7 A;  3WGH A;  1WPK A;  1OMI A;  3VOE A;  1D5Y A;  4D9J A;  1A6Q A;  3BDD A;  1FX7 A;  4W97 A;  3T0Y A;  1YYV A;  4HZF A;  5LRS A;  2DI3 A;  3G6E I;  1MDM B;  1IG7 A;  2P6S A;  5IT9 K;  2DK5 A;  1R1U A;  3DWL E;  5DEQ A;  4HF1 A;  1IN6 A;  2J5P A;  2BEO A;  2LTP A;  2ZC2 A;  3KP4 A;  1YTY A;  1FP1 D;  5CVJ A;  4J19 A;  2R7Z J;  1TWG J;  1LEA A;  4A5M A;  1FOX A;  3CCE I;  4MEY F;  3HSR A;  2XSJ C;  4HRI A;  3HB9 A;  3FBN B;  1YW9 A;  2Y2Z A;  3ESW B;  4AID A;  1VQ4 I;  3AKZ A;  4E7K A;  4PZJ A;  3HOZ J;  2M2E A;  3FXL A;  1YRN B;  2VXD A;  2STW A;  4M3G A;  2PJR A;  5LEJ A;  1X1D A;  2L54 A;  4CYD A;  2HEO A;  1ETQ A;  4ZDO A;  2Y0S A;  3TMO A;  2CUF A;  4BE1 A;  3GTK J;  2GAU A;  3V8L A;  1ZLK A;  3F23 A;  2IEK A;  2CO5 A;  3IH2 A;  5GP9 A;  2D1H A;  3CUQ A;  5ICG A;  3JTG A;  4G6T B;  4ZYD A;  1D0Z A;  4B43 A;  1ULY A;  2ETH A;  2EBI A;  2DA5 A;  2WB1 N;  1U78 A;  2IPQ X;  2DDB A;  2JA5 J;  2H94 A;  4M6X A;  3CCU I;  1HKS A;  5FLX Z;  2XPV A;  3PSI A;  3BG6 A;  4PJN A;  3AL0 C;  4IX7 A;  3S8P A;  2FOW A;  4A3C J;  1U8B A;  3D5R C;  5K5O A;  2ISY A;  2GM4 A;  2R7U A;  3LSI A;  2UWM A;  1T6S A;  4ESF A;  5HVQ C;  3JRB A;  5LD2 C;  1VFC A;  2BE5 F;  4Z2Y A;  1JT6 A;  5GTH C;  3Q0V A;  4A0Y A;  3BZK A;  4YFX F;  1IDZ A;  3HHG A;  1U8R A;  1RI7 A;  2JTV A;  3P7N A;  1K7A A;  3L09 A;  1G3T A;  1LKX A;  3FIS A;  5EGO A;  2R3S A;  2A68 F;  3ABU A;  2ZNY A;  1TLH B;  2KL4 A;  2KMU A;  2LKS A;  2EFQ A;  4Y7N J;  2PX9 A;  3FXQ A;  5D8L B;  2PI0 A;  3RJP A;  5CVI A;  3WU2 C;  4PSW A;  3QWL A;  4IPA A;  4HLY A;  1ENH A;  1XDU A;  4IHT A;  1X2M A;  4EV0 A;  2WA0 A;  2E71 A;  2XB0 X;  4UXN A;  2ME6 A;  1MBE A;  2JZY A;  3PSF A;  4AVZ A;  2FA5 A;  1JHF A;  3CME I;  1RR7 A;  3OIO A;  2IA0 A;  3M07 A;  2Z9O A;  1SAN A;  1PDN C;  1OYY A;  1KYZ A;  3I9V 2;  4B8X A;  5DD4 A;  1IDY A;  1UEL B;  3ZQF A;  2HVS A;  2RDP A;  1H88 C;  1IN5 A;  3LSM A;  4CO8 A;  5C3E J;  2Z2S B;  4I01 A;  4RB3 C;  4II3 A;  5CQE A;  3J81 Z;  1DGW Y;  4BYY A;  4RM2 A;  4FTH A;  2DOD A;  2HTS A;  4GYI A;  4FET A;  1HCR A;  1JUM A;  3QPS A;  2M8G X;  4BH9 A;  2BHY A;  4B3X A;  5KCM A;  3B73 A;  4IVN A;  5LEK A;  3WTT C;  1OCC H;  3GCM A;  4A12 A;  3TP0 A;  3OOP A;  3SEZ A;  1I5Z A;  1MJ9 A;  1FY7 A;  3OYK A;  2EZH A;  2O03 A;  4EQQ A;  1J5Y A;  1R5G A;  4RAY A;  3M1C A;  3RPU A;  3OWT A;  3FX3 A;  1N25 A;  3PNY A;  3HGG A;  2KHM A;  5D5V B;  2VT3 A;  5BPD A;  2IA1 A;  1I27 A;  3H35 A;  3OV8 A;  3RSN A;  2XC7 A;  4U0V A;  1W0U A;  1EA3 A;  4KIC A;  3S2W A;  1MD0 A;  2HU9 A;  4ITV A;  2EIM H;  5BPI A;  2KRF A;  3H3U A;  3OOU A;  3OS1 A;  2QA4 I;  5GPA A; 
#chains in the Genus database with same CATH homology
 2MYS A;  3BCB A;  3HKZ A;  4OAY A;  4P5O A;  5CKT A;  3PNV A;  2E60 A;  2WAQ A;  4HNU A;  2LYC A;  2M7B A;  4OWR B;  2Z16 A;  2LY1 A;  3VSL A;  3S3M A;  2IGM A;  1W36 C;  2KPM A;  1Z3Y A;  2R4G A;  1X4O A;  4XKV A;  3MKZ A;  4YRV A;  1FMV A;  3MD2 A;  4DJA A;  3TBI A;  4CZC A;  3ONQ A;  2MFZ A;  2HNH A;  2VXZ A;  3C2H A;  2LH9 A;  3VDX A;  5CPR B;  4C9Y A;  2V6E A;  3KEY A;  4OAZ A;  4PFO A;  4PUS A;  4BXF A;  3D5L A;  3VYR B;  2BVL A;  2M4G A;  3CZ6 A;  3H0D A;  1R6R A;  1X4P A;  2JVH A;  2V4J C;  1X1B A;  2LY2 A;  4QPO A;  3H9Q A;  4RLF A;  1Z7L A;  2IS6 A;  2X1C A;  4XL9 A;  1MMA A;  4U7B A;  4CCO A;  1IRX A;  3PNT A;  4BEH B;  2IGO A;  2K9M A;  1NG7 A;  4XLA A;  4LIT A;  4HEA 2;  2KZV A;  1YX3 A;  3FKJ A;  5KNL A;  1QHH D;  1DGR M;  3DTK A;  4JOM A;  4ZC3 A;  4KIT B;  2IGN A;  4BQN A;  4E4H A;  4BDZ A;  2V9K A;  3OYG A;  2VQH A;  2CW7 A;  3TL4 X;  4CH7 A;  1D0X A;  2ZXH A;  3EUH C;  2ZSI B;  1TZL A;  3E1S A;  4XOR A;  4F92 B;  4XOT A;  3S32 A;  1OLT A;  2DJI A;  3D5S C;  1GLN A;  3L2Q A;  2IXS A;  4DGW B;  3ZCO A;  3ZRG A;  4KJZ A;  4NNJ A;  1WJ5 A;  4E7S A;  2KDO A;  4NQW B;  4XLH A;  3OYN A;  3QYB A;  4BUP A;  2GOX B;  4Y3O A;  3J7A Y;  2WY8 Q;  1MMG A;  2DT7 B;  1ZEL A;  2XDV A;  3OR1 C;  3K4C A;  2KLO A;  3DPL C;  4BU2 A;  2MC4 A;  1P9Q C;  3K4B A;  2CV2 A;  4CCM A;  4R79 A;  5FRO A;  4YEL A;  2W1O A;  2P0W A;  3OR2 C;  4AYB A;  4CCJ A;  3DEE A;  4ZJZ A;  1D1A A;  3A1Y A;  1Y56 A;  3A2K A;  2WAE A;  2L9N A;  1X1C A;  2VL8 A;  3IP4 B;  5FRN A;  3OS2 A;  2XF7 A;  3AFH A;  2RQQ A;  2VJ5 A;  2Z1D A;  4XON A;  3F9K A;  3OYL A;  2KQR A;  2PJR B;  2X51 A;  4PK4 A;  2L5Q A;  2L9S A;  3RCO A;  3H9G A;  2IS1 A;  2F5V A;  3BLY A;  1NG6 A;  4ZTF A;  5CQG A;  3LSH A;  1Z21 A;  3BCA A;  4ZYA A;  3NWT A;  3IUO A;  1UAA A;  3VYT B;  2K9L A;  4B47 A;  2JSP A;  2CS3 A;  4IQJ A;  2R7O A;  4XQF A;  1N75 A;  4XKC A;  2Q1Z B;  2LBF A;  3KYL A;  4J00 A;  3BC8 A;  5HNF A;  2X6Y A;  3LSG A;  3C2G A;  3ZXS A;  2F4I A;  4QPQ A;  3OYJ A;  3W2W A;  1W36 D;  1AA7 A;  3FHN A;  2WAF A;  2W82 A;  2UUZ A;  4F91 B;  4E7H A;  4C2U A;  2AQE A;  2HQA A;  2AQF A;  2OUM A;  3EUK L;  2VQC A;  4F52 A;  2OV7 A;  1WJE A;  2CFO A;  3DU6 A;  3L2R A;  1SAU A;  2FUG 2;  1G8X A;  2VJ4 A;  4PJM A;  2L2O A;  2L7K A;  4PSX A;  2WAD A;  4CCK A;  5JHF A;  3CMM A;  2ZSH B;  4BJT A;  4F3Q A;  3DLA A;  3VWB A;  4D1Q A;  2VKH A;  4U87 A;  2QKM B;  1T0F C;  3S93 A;  3FDY A;  2KP6 A;  1UG0 A;  3QOD A;  1BR1 A;  1YX5 A;  2A5W A;  2ZFU A;  3OYH A;  2X85 A;  2VIX A;  5TGT A;  3CP8 A;  4F93 B;  3CF2 A;  3HL2 A;  4NUB A;  2CH0 A;  2GOM A;  2NOJ B;  4N4O B;  2VB6 A;  2M4K A;  1BOB A;  1BR4 A;  3OL4 A;  1LFP A;  2A6T A;  1MMD A;  3QYF A;  4BAC A;  4HSR A;  2X1E A;  2LOO A;  2VPL A;  1BR2 A;  2W4S A;  3HPG A;  2HVR A;  3HPH A;  2QKL B;  4LIU A;  4RLQ A;  3NWS A;  2R7R A;  3CES A;  3OYA A;  2HPI A;  4XKW A;  2HDW A;  4XLF A;  3W2V A;  1T95 A;  2VQG A;  3G2B A;  3L2V A;  4XMY A;  4DBQ A;  2BW3 B;  2VAS A;  3SYT A;  4ANJ A;  4PJJ A;  2LRE A;  3DKY A;  2RNG A;  3K10 A;  3OIQ A;  2W00 A;  3HC7 A;  2JVG A;  1Z3X A;  3CJQ B;  4CCL A;  1U0J A;  4BGD A;  2OC6 A;  2WBM A;  1MMN A;  5KHD A;  3DQV C;  3A4C A;  1Y6I A;  3LL7 A;  2CMP A;  1QU3 A;  1DP3 A;  2F6C A;  4EAT A;  3OIP A;  5HOO A;  3MMY B;  2I8D A;  1PJR A;  3OYB A;  2VKD A;  5HLT A;  2M7A A;  3QOE A;  4BJ5 C;  3PFY A;  2Q2E B;  4J01 A;  4BQO A;  2V1N A;  4X0G A;  3VSK A;  3HOS A;  1N78 A;  3GBG A;  3K4M A;  2CUZ A;  4P1W A;  3K4K A;  1X1A A;  3HOT A;  3W3C A;  2DT6 A;  1WFX A;  3H5N A;  3LMM A;  3OYD A;  2ZXI A;  3UR3 C;  4JQF A;  4BEH A;  3L2W A;  4IQ4 A;  2R7W A;  2HPM A;  2E5Z A;  4DIQ A;  2E1M C;  4HNT A;  3DTI A;  2CW8 A;  1V5E A;  4XKB A;  3S3N A;  3IAM 2;  4FAS D;  4E7J A;  3VYU B;  4CA0 A;  2W7N A;  3H5A A;  4MLO A;  4XN0 A;  3S3O A;  3OY9 A;  1MNE A;  3QYE A;  3OYC A;  2R7V A;  4AU7 A;  2ELJ A;  3N05 A;  4CUG A;  3SZG A;  4XLE A;  4E7Z A;  3K4N A;  1N77 A;  2IGK A;  3OYM A;  1D0Y A;  4NC7 A;  4LIV A;  3SEQ A;  3RQ4 A;  1WJC A;  1WJF A;  4D9J A;  2LG4 A;  2MAB A;  2KRH A;  3DPU A;  2V26 A;  4BE0 A;  3DWL E;  3PUB A;  4B48 A;  1WJA A;  2K3P A;  3DU5 A;  1PYV A;  1WJB A;  3DTE A;  1YE9 A;  2XSJ C;  1G59 A;  4HRI A;  3HXL A;  1OR7 C;  1LDK B;  2O5R A;  3FBN B;  3V42 A;  2IS4 A;  3DPT A;  4PJL A;  3U21 A;  1FMW A;  4II2 A;  2E5N A;  3AKZ A;  4E7K A;  3K70 C;  1TT0 A;  5HNH A;  3ZGK A;  4BL0 B;  2BOL A;  2VXD A;  3FBI B;  3I3L A;  1K6Y A;  2JA2 A;  2E1M B;  4B44 A;  2PJR A;  3H5R A;  1X1D A;  2VLA A;  3OYE A;  1HA8 A;  1D1B A;  2R7T A;  2PMZ A;  4ZDO A;  2Y0S A;  3TMO A;  1J09 A;  4BE1 A;  2IS2 A;  2BVM A;  1SFK A;  2CV0 A;  1X19 A;  4XR6 A;  2DOA A;  4XLC A;  3OS0 A;  3W2A A;  4HST A;  4G6T B;  1WJD A;  2XF6 A;  5LFA A;  1D0Z A;  4B43 A;  3UNG C;  4XM3 A;  1V5F A;  2HZD A;  3PSI A;  1MW7 A;  3BG6 A;  4PJN A;  3CJR B;  4Y4R A;  3AL0 C;  3L2U A;  4IX7 A;  3S8P A;  2WB1 A;  4XN3 A;  3K6G A;  3MKW B;  3PJR A;  3ZQQ A;  3D5R C;  3E0J B;  2VJJ A;  2R7U A;  3LSI A;  2DXI A;  4E7L A;  2UWM A;  3EPZ A;  2R7X A;  2KRC A;  1E0E A;  5HVQ C;  5LD2 C;  2X6W A;  2CV1 A;  3K4J A;  2HVQ A;  3OYF A;  3LFU A;  2K5C A;  2LRD A;  1LKX A;  3M8J A;  2LBF B;  2MD0 A;  2KL4 A;  2KMU A;  1S9H A;  4HPQ A;  1ERD A;  4PSW A;  2R7S A;  2M3A A;  4HG2 A;  4YEJ A;  4E7I A;  4F55 A;  3EUA A;  2WY7 Q;  2WA0 A;  3OL3 A;  3VYS B;  4C30 A;  3PSF A;  4AVZ A;  4IZZ A;  4DBR A;  1V5G A;  3I9V 2;  2UV1 A;  4BJ6 C;  1UEL B;  4GRI A;  2VQL A;  1KON A;  3MKY B;  2HVS A;  4LG3 A;  4XOP A;  3LSM A;  2Z2S B;  4CSW A;  4II3 A;  5CQE A;  2LC2 A;  3SDB A;  1DGW Y;  3RTR A;  4BQQ A;  1LVK A;  4CCN A;  4BDY A;  4DOZ A;  2JUG A;  4RM2 A;  3AL0 B;  2VJI A;  4KT6 A;  1MND A;  2RRE A;  4H4K C;  3OMY A;  4FET A;  2DCE A;  2X6X A;  4PFP A;  2XF5 A;  3ZR8 X;  1DQU A;  2BW3 A;  4RMN A;  3KX2 A;  4ZDL A;  4B3X A;  5KCM A;  4BS9 A;  3HG9 A;  4E6K G;  4RM3 A;  1D1C A;  3BG7 A;  3DKX A;  2V7F A;  3H9J A;  1JI8 A;  3K4L A;  1VZ0 A;  4XNF A;  2R7Q A;  4N4N B;  3SEZ A;  3OYK A;  3IAS 2;  3LSK A;  2M0M A;  4KIS A;  4Y33 A;  3M1C A;  2X1D A;  3OWT A;  1QHG A;  3OYI A;  4C2T A;  3PNY A;  5FRM A;  2KHM A;  3RPU D;  3K70 D;  3CP2 A;  3H35 A;  4NC8 A;  3RSN A;  2XC7 A;  1EA3 A;  4ITV A;  2HU9 A;  4ZDP A;  4ZTJ A;  4IKF A;  3HUG B;  2XAU A;  3OOU A;  3OS1 A;  4BE2 A;  3PL8 A;  2CUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...