3FBNB

Structure of the mediator submodule med7n/31
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
94
structure length
94
Chain Sequence
SDQNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification, structure, and functional requirement of the Mediator submodule Med7N/31
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Mediator of RNA polymerase II transcription subunit 7
total genus 28
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05669 Med31 SOH1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1340 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3fbnB00
3FBNB 3FBIB
chains in the Genus database with same CATH superfamily
2VI6A 2WADA 4U0WA 3S14J 4NQWB 2E35A 2EV6A 2HZTA 3QPTA 3V7CA 1G4DA 3OS2A 3HRMA 5DCMA 2Y9ZA 4BQAA 1E3HA 3TW6A 4ETSA 3E3VA 2JK3A 3T1BA 2IA0A 3HHHA 3OL3A 4F7ZA 1Z3XA 3BR3A 4YIIA 1Y56A 3PO3J 4ZDOA 2R7QA 3A0HC 3CCEI 4U87A 5CVIA 3D5RC 2BW3A 2ID6A 3EUKL 2VKHA 3OIQA 1FMWA 2JUCA 1J59A 4XOTA 4N4OB 3WE2A 1MBEA 3IUOA 3BG3A 3RPUD 4F93B 2WAQN 1MSFC 3QYFA 5F0CA 2EINH 1SD4A 4YIRX 1ONVA 3D0SA 2O3FA 4JX4A 3H5AA 1O7FA 2CQXA 1OCZH 1JKOC 4I0BA 3H0DA 1IV8A 2XDVA 3L1PA 1VQ7I 1IN7A 3VEPA 2NNNA 3DKWA 4FT8A 4RB3C 3L09A 4RLQA 1OPCA 2PJRB 1X1CA 2ZXIA 2M5WA 3K0LA 1WPKA 5FFXA 4CYDA 3WTWC 1MMGA 3GUDA 2P5VA 4KA4A 1VQLI 5CYVA 4I2OA 3M1EA 4N9HA 3CF2A 2JN6A 4EJTA 2OA4A 3HOTA 5ILVA 1QPMA 1J7KA 5L3DA 5L3FA 3FHZA 4KMFA 2A69F 1Y8RB 2MSYA 5CVJA 4CUGA 2Z9OA 3L7WA 1VQNI 1VTNC 1OMIA 2VODA 3TL4X 1ZGJA 1XS9A 4RAFA 4YEJA 1X3WB 2MD0A 4RM3A 1TWHJ 4ZZLA 4N9IA 1F43A 3DU5A 2KZGA 5F1RA 2W4SA 3HZJA 3CDHA 2J5PA 4Y7NJ 2WV0A 4JP0A 3DXJF 1B59A 3F3XA 1AHDP 1P9QC 1U9OA 1D8KA 2HXIA 2JPBA 1QNTA 2FA5A 2Z1DA 5EG0B 4G7HF 1FZPB 3FDYA 2W85A 3EPZA 1MNDA 2M34A 2W82A 3SEZA 2VOOA 2PI0A 4F55A 3K4LA 3WG9A 1S72I 2CWEA 1FYMA 1ETVA 3KP3A 3HOZJ 1F36A 4R1HA 4YRVA 2X1CA 4M6XA 1EJ9A 1WRJA 2IA2A 1WFXA 2MLGA 1CF7A 9ANTA 3I58A 4HG2A 2CG4A 1G3WA 3IKVA 2HDWA 3AL0B 4LIUA 4PGHA 3M8JA 4KN4X 4RGSA 4ZDPA 2NVQJ 4L9TA 1F4KA 1IW7F 3BR2A 2X0LA 4AYBN 3RI4A 2X9DA 2XRNA 3CESA 3EUHA 2XPVA 2MFZA 1GXPA 1BJAA 3HBLA 3CDIA 5K7HA 1U8RA 2HYGD 1XGMA 2FRHA 3CF5F 3EYIA 3V8KA 4HF2A 3RKXA 1XB4A 2IEKA 5J40A 2R5ZB 3PUFA 4IXAA 2Y48A 3BCAA 3OYCA 2QQAA 2Y30A 3QP5A 2RNJA 2BY0A 4BHCA 4ENNA 2H1KA 4Q4ZF 2DT6A 1SC7A 1TW2A 5KK1A 2HGCA 4D0PA 3I54A 1QHGA 2R92J 3DLAA 3EQLF 1MJAA 2DXIA 1M1EB 1S6LA 4MLOA 3TBIA 2CW8A 3F72A 3ESWB 2Q8KA 3CMAI 2DW4A 2OU2A 1NK3P 1I27A 4DOZA 3TQNA 5FRMA 3JAMZ 2QZ8A 3KP5A 2DN0A 2L01A 1Z6RA 2EFOA 4AU7A 2MGQA 2K85A 3HC7A 3WTTC 4XSXF 2M8GX 3MN2A 4ANJA 3GTMJ 1FJLA 4IHSA 2OTJI 5JLWA 4RLFA 3AFHA 1RC9A 3PNTA 1XG1A 2X1DA 3S2HJ 3ERMA 5J8CA 2HS5A 1B9NA 2XAGA 1HW2A 2VBXA 1QGPA 4UV8A 5K7FA 1X1BA 2ID3A 2AS5F 2QSGX 2FU4A 2BBYA 4YIFA 5IOYA 4AM3A 4I09A 1R1VA 3PM1A 2K9NA 3ISPA 4BJ5C 2VB6A 2O9LA 2EIKH 4EATA 3LMMA 2HI3A 4E6KG 4EGZA 3HTUA 1IDYA 2GQQA 5DM7F 3LSRA 3DKXA 1I39A 3S93A 1LQ1A 1FOKA 3BTLA 3GMEA 1U5TC 3MVPA 1XDUA 3F8MA 3W2VA 1EF4A 2P6TA 2DK5A 2KFDA 4Y52J 2FF4A 5E20A 5DTDA 3SZPA 5EG0A 2QA4I 4ESJA 3V4GA 1RKWA 3O8GA 1D1BA 3DEEA 1OCRH 2F5DA 2HU9A 3IV5A 3JRGA 5H6RA 5CJ9A 3KYDB 5LHIA 2H6CA 1QBJA 2B63J 3GFIA 5ICCA 1IXRC 3W3CA 1EKEA 1F5TA 4XIDA 2ZNYA 3O3KA 4PJJA 5FD6A 1X1AA 3BOQA 1LDJA 2E36A 3LSKA 1YTYA 1W36D 1V5EA 2DLLA 5FRNA 1REPC 4V19K 4AYBA 3V42A 5FGMA 3N97A 3KEYA 2VKVA 5IYBJ 1DGRM 1KGSA 2DJNA 4IHXA 1JI8A 1HW5A 4M9XA 2P4WA 1R1UA 4QLCU 2OAZA 1VQOI 4IKFA 2GA1A 4A0XA 4KDPA 3O8HA 3DTIA 3FX3A 2KL4A 1KZHA 3GVAA 4AD9A 1DGWY 3BTIA 3L9FA 5A2QK 4B3AA 1T2KA 2MA3A 4BU2A 2KIFA 3J7ZI 2MH2A 2PMHA 1LVKA 2VQHA 2R7VA 1MBKA 2V79A 4Y4RA 4FTHA 4RGXA 4R79A 3CLQA 4Y15A 1D0XA 1JTYA 2I8DA 1LFUP 1YX3A 3GTQJ 2W25A 3P9KA 1UCRA 3QP6A 3BY6A 1EA3A 1IN4A 2V6EA 1TQMA 1ITYA 2KIQA 3W6KB 1A04A 2ECCA 2GWRA 5JFRA 4RM2A 2PN6A 5D8LB 1YJNI 4LB6B 3PIOF 4LD5A 3R61A 2E71A 1X1PA 2CYYA 1GHCA 3FXKA 3SZGA 1SFEA 5J47A 3ZMDA 2V9VA 4IX7A 4NB5A 3MEXA 3JREA 5HNHA 4NNJA 1B72A 2YSRA 1ETXA 3CZ6A 1S7EA 4E7LA 1I3QJ 4MNUA 3HOSA 1K6OA 2IGNA 1MMSA 1AOYA 2VBZA 2Y0SN 2HKOA 2FMLA 2XAHA 3OIOA 1IXSB 3DEUA 2KRFA 2VXZA 1W5SA 3P5JA 4U0VA 1MBJA 4OAYA 5FLMJ 2XB0X 5E18F 1J09A 5C4XJ 1S7OA 2LY2A 2RQPA 3F8NA 3BTJA 3G6EI 4HDUA 4AIHA 1OR7A 2KP6A 3MMYB 3FMRA 4HF0A 2RREA 3T0YA 2K4BA 4C3IJ 2DO7A 4HA8A 1IJWC 1HA8A 2PMUA 4I76A 2QQ8A 2BV6A 1QPIA 3ERED 2LFBA 2X85A 3FISA 1B6AA 1X4OA 3HSRA 4QIWN 2W1OA 1WZ2A 1MGTA 1KQ9A 2ZO4A 3CC7I 1X2NA 2CU7A 4X0GA 4IHTA 3LFUA 1TBXA 1V5GA 1N77A 3MKZA 2LSOA 1H8AC 3OYBA 1U2WA 3H9GA 5J1UA 4J01A 3QOPA 2JSPA 4BY1J 4A0ZA 4TV7A 5HS8A 4CA0A 3JR9A 2E1OA 3FXMA 2BY1A 2NOGA 3FIWA 3HOVJ 3U2RA 1R7JA 4QWQA 3CJTB 2GBYA 1XN7A 3L2UA 2MH9A 1G59A 2XF5A 5FLXK 4HNUA 4HNVA 4XSZF 1MMNA 4NC7A 3JRIA 4LITA 3S1NJ 2CSOA 4F52A 3DV8A 1VQKI 4XK4A 5HLTA 4IHVA 1W36C 5FLVA 1RR7A 2DMTA 4G6DA 2GXAA 2F48A 4K2EA 5IP7J 2NAZA 3WTSC 1S3JA 2QBYA 4PJNA 2QM3A 3OY9A 1AKHA 3ZMZA 3Q9VA 1Z3YA 2KJCA 2M87A 2HOTA 2VQCA 4G12A 4XORA 3TO9A 3EUHC 4FE4A 5E3LA 3ECOA 3PUBA 3TOBA 3KIOA 1VQ8I 2RC4A 4M73A 1HF0A 1EV7A 5EZHA 2QF7A 2WAEA 5BQTA 1WGXA 3O6BB 2IVMA 1ZN2A 4E7IA 2K7LA 5D4SA 1G8XA 2V1XA 2EA2A 1JT6A 2LBFB 2VT3A 1SD6A 4LLNA 4UUTA 1T0FC 2FUG2 2R7OA 2OV7A 3EDPA 2X48A 2ME0A 2ZNZA 1WH5A 2JQ7A 3GYHX 3WU2C 2R7RA 4KJZA 1C0WA 3KETA 1W5CC 4RAGA 2G7HA 2CO5A 3G3ZA 4I98B 2WTEA 2E19A 4CCJA 2BY2A 1MIJA 4CZZA 2M9HA 1Z77A 2JVHA 2W84A 5J1YA 3KP6A 2ZMEB 3J80K 3RKQA 2V1NA 1T0FA 5CQGA 2DPDA 1HLVA 2O8XA 2VXDA 4O6JA 3B73A 1L0OC 3CD6I 3LSPA 2K40A 2NRAC 1FOYA 1WVRA 5EGOB 4KUMA 1OFCX 4B43A 3BZ6A 2GLOA 5HDGA 2DA7A 5KHDA 2QKLB 3I5UA 2L4AA 1I5ZA 3JCUC 1Y1VJ 1O3QA 1FTZA 4F92B 2HQRA 4FISA 4DJAA 4A3JJ 4PZJA 3LSJA 1ZG5A 4IPAA 3IAM2 2R7WA 2Z33A 5HS9A 4LK1F 4HV5A 4BJ6C 2JVGA 2MBFA 3PQJA 3KFWX 2VOPA 1AWCA 2P5LC 4E70A 3I4MJ 1H0MA 2KDOA 4MEYF 1HKSA 1JUMA 2ZCWA 5TISC 1KQ8A 3OYJA 2VJJA 3ZQLA 1OLTA 1PUFA 1I6HJ 1WJEA 1AU7A 3S1QJ 1E17A 4A5MA 5L3BA 1LFBA 3R4KA 2MG4A 2R7FA 3RTRA 2VE9A 1O3TA 3W2AA 3VSLA 2HDCA 3G2BA 4D9JA 2Y69H 3RKWA 1XGSA 5LGTA 1D1CA 4FHTA 3G1MA 3WTXC 3BR6A 4O5VA 3CJRB 3DTKA 2DA4A 2CW7A 2HVRA 3OYKA 4BJTA 1ZR4A 4RMNA 2AXTC 3LA7A 5LEJA 2IS6A 4UVAA 3OYEA 1ULYA 1CGPA 4A3KJ 3VB2A 2IGKA 2VUMJ 5GAGJ 4MTEA 1IN6A 2QSFX 2GM4A 3QPLA 1HXDA 5KCMA 3CCRI 1T95A 2HYJA 4NDLA 3LNQA 3OYLA 2K9QA 2LRDA 1USSA 4MGRA 2OJED 3TDUC 5D6EA 1IN5A 2DA3A 3OS1A 1HDPA 2RAEA 2Q2EA 2CGPA 3LOCA 3HOWJ 2PG4A 1B1BA 5JI6A 3S3OA 3TO6A 1A31A 1QU3A 1WJDA 4II3A 4WF2A 5F0FA 2VKDA 2R7SA 4DYCA 3AG2H 1LB2A 1N25A 1XCVA 4J19A 4JBAA 2WY8Q 4XQFA 1H89C 1B72B 5IOZA 1A6IA 1P2FA 1W4MA 2O03A 3GBGA 1SFXA 2E34A 3HM5A 1PVEA 4EJOA 1LNWA 3K9TA 5J4YA 3X2QH 2R7ZJ 4PUSA 3V7SA 2KT0A 2PX9A 1Y6IA 4XKWA 1HBXG 3S16J 1QZYA 2L02A 2O6GE 3AG1H 5LFAA 5M3FJ 1IV6A 1TNSA 2KQRA 1UHSA 1D0YA 3BC8A 2BXYA 2CRGA 2XUBA 3BPVA 3ABMH 5FKNA 4OOIA 2XGXA 2P8TA 3GO5A 2JPCA 5HOOA 4KN7X 4XKBA 2XHKA 5DEQA 1J0RA 3V7RA 4CXFA 2IS1A 1XC5A 1I1GA 4A93J 3I4NJ 5KAIC 4Z2YA 3KLNA 3IAS2 3T8TA 3JAMK 4NUBA 2M2EA 2GIVA 2Q1ZB 3E6MA 3L2WA 2ME6A 4PGGA 5M5YJ 2JTVA 1MSEC 2EQRA 2ELKA 2WAQA 5FD5A 3TW7A 1Z21A 3ZGKA 2B7EA 2VE8A 5DCFA 3ZQFA 4C2MJ 1KU2A 3CCVI 4I01A 5ILUA 2PMZN 3IH3A 2W7NA 5FKOA 1I50J 2COMA 2EV0A 3FM5A 3RIRA 2QGUA 1QZZA 2NYXA 2ZFWA 4A6EA 2X1EA 3LL7A 2B0LA 3GFJA 4HEA2 3GFMA 4XLFA 1ZGWA 2YR2A 3D1NI 3H3UA 3DBRB 1H88C 3HHGA 2ECBA 2QENA 3S2WA 2WBMA 5B1BH 3F9KA 3R6SA 2LF7A 1ZARA 3ULQB 2JUGA 1FIPA 1ZRDA 2QLZA 4CHUA 3KE2A 4OIQF 5K5OA 4AIJA 4WWCA 3N4MA 4PDKA 2WA0A 2F4IA 5GTIC 3OYAA 1VF9A 2EWNA 2HFHA 4IHWA 3SFIA 2LKXA 1WJBA 1W5TA 3DPTA 5E1WA 3OOUA 1ETQA 1MDMA 5DCMB 6PAXA 1UG2A 2LDUA 3H1CA 3GTOJ 4WK8F 5DV5A 1X1DA 4NQWA 2F5CA 1U5TA 5F0HA 2AQFA 1MZBA 1XMXA 3BG6A 2L9SA 2JZYA 1TC3C 3K1NA 1ETOA 3LAJA 5DYMA 3BR0A 3I64A 1R1TA 1X19A 4CZCA 3BROA 2ZBKA 1FTTA 3SDBA 3FHNA 3OYDA 1WHUA 2DT7B 3S32A 2CH0A 2F5VA 2V9KA 4Y17A 4P9UA 3R60A 4XRSA 3I3LA 1Y39A 1GT0C 2DOEA 3MWMA 3ZOBA 2DTZA 3AG4H 1R22A 4G8XA 3SJMA 4A12A 2Y2ZA 4W1UA 3HG9A 4DBRA 3E5UA 1FT9A 4OIOF 1ZG1A 4E7KA 2HZDA 2VBWA 4BXFA 1IDZA 1YG2A 4XICA 2AQEA 1QRYA 3ABLH 3F21A 1E3OC 2CUFA 3M8EA 5LHGA 2CUJA 3ZMVA 2A68F 1IF1A 3W6VA 4P55A 4A3DJ 1YS7A 3BP8A 2LKSA 3CCMI 2E5NA 1ZHFA 2VASA 1MD0A 1K79A 4Y13A 1ZELA 1K4TA 2C6YA 2H8WA 2OCEA 5H20A 2R7UA 1ACIA 3CLOA 2HDDA 3FM3A 4XKCA 2EFNA 4BEHA 4PJMA 2XAUA 1T33A 3QU3A 2OCCH 3MZ8A 4Q47A 5GADJ 5DS9A 4M71A 3QAHA 1Z0XA 2EZIA 3BJOA 4L0YB 2DOAA 3S15J 1ON1A 2A6TA 3M9AA 5GAHJ 2DOFA 3GTKJ 1E2XA 3E97A 1BOAA 2X6YA 3CP2A 4RA2A 4AC0A 2P7CB 3BT9A 2VONA 4PCQA 4GFBA 3K4KA 3CUQA 3VDXA 3GTLJ 2FOWA 1VQPI 3FMQA 4KYWA 3FXJA 4FX0A 3K70D 1XCBA 2QUFA 4F3QA 4OIPF 2LK2A 1HC8A 4Q5SF 2UUZA 4D7NA 1PYVA 1PP7U 1ETYA 3MCZA 5C4JJ 2IAIA 3WU1B 1GVDA 3LSIA 1O7LA 1XMKA 1R4MB 5AIPA 5FJ8J 2ZJRF 3OSGA 1P4XA 4ZC3A 5EJCA 2JA7J 4BNCA 3A01A 1VQ4I 2HPMA 1SMTA 4CYCA 2HXOA 4JX6A 2DDAA 3C2HA 4IJAA 5FROA 1XDSA 3C2BA 3OR1C 4BE2A 3HOUJ 2M0CA 5K5RA 3GLXA 4C3JJ 4C2UA 5KVRA 3JRDA 2LTPA 1ZTRA 3ZCOA 3VYRB 2HKXA 2OF7A 3I4PA 3K4BA 1BW6A 3ZPLA 2BXZA 3OOPA 2NVXJ 4WXCA 4O3MA 2ISYA 2V7FA 3IC7A 3IWZA 3F8FA 3A01B 3WTVC 3LAPA 5CVVA 4R8HA 1T39A 4XLNF 2A61A 2EH3A 2F5FA 3L2RA 3K1PA 3Q9SA 4PJLA 2IP2A 3IH4A 4A3GJ 1K6YA 4P5OA 2A3SA 2VJ4A 2BGCA 2QCOA 2M4GA 4M3GA 3OYGA 5HLHA 3LFKA 5ILSA 3OIPA 2O5RA 3HGYA 2K9LA 4Z6YA 1ETWA 2WV1A 5F6FA 2DMQA 3BG5A 5E8IA 1HSTA 3COAC 3JSOA 4XNFA 2LOOA 2AXLA 3RJPA 1UMQA 5LRRA 1O3RA 5JVGF 3ZXSA 4QPQA 3BZCA 5EEGA 2FEZA 4L18B 1FMVA 1YRNA 3CC2I 4V2FA 2XKPA 2QBYB 1J9IA 1UELB 2JA2A 2VPLA 4DBQA 1V5FA 1TTYA 5BNGA 2K86A 2L5QA 1U0JA 4BQOA 1H9TA 2WB1N 3KP2A 2P6SA 1ZH5A 2K3PA 3LSHA 3FK6A 2XGCA 3IL2A 3Q3SA 4I02A 2JA6J 1U8BA 2DFFA 3G73A 1ZG3A 4UB6C 4LG0A 1OCTC 3PFYA 2KDZA 1RNLA 1BR4A 5KNLA 5BPDA 3MD2A 4M72A 4XL9A 1CQTA 3SEQA 3ZMUA 4UV9A 3HDDA 3LSGA 1BC7C 3SYTA 4RGUA 1STZA 2XASA 3ROUA 4ZTJA 1IG7A 2LLKA 4AWXB 4QPOA 2XF6A 2HR3A 2CFOA 3HOYJ 3BR1A 3S1MJ 1RETA 1P4WA 2CV2A 1FP2A 2P81A 1PUEE 2Z2SB 2HNHA 4UVBA 4B47A 3IHUA 2O0YA 1SEUA 3CJNA 2PBIA 2KHMA 2HYFA 1BI2A 2CQNA 4BHBA 1UAAA 1FYLA 4PK4A 1N78A 4PSWA 4OIRF 1IC8A 2A5YB 1R5GA 4IQJA 4OU0A 4XLAA 1YJ9I 3SQNA 5K1YA 4YFNF 5BOXA 3QQAA 2F4MB 2R93J 3GLLA 5EEHA 1TWGJ 1JT0A 1XGOA 1BBYA 2RVCA 5J8FA 4X6AJ 2DA6A 3WG7H 2UXNA 5H2FC 3DWLE 2L4MA 5D8KB 1W0TA 3GWZA 2HTSA 2EFPA 2RV8A 4AIKA 4MTDA 4BXXJ 5DD4A 3QYBA 3PQKA 3ZQGA 2MC3A 2R7TA 1LE8B 4CICA 1WJCA 5J6XA 3HEFA 3J81K 4HLXA 4KT6A 2L3DA 2UXXA 4XLPF 3HYIA 3VSKA 1FYKA 2HOSA 2CFXA 3PIPF 3RPUA 2L9VA 3ZR8X 3QU6A 4A3BJ 2FOKA 5ICFA 5LEKA 3E5XA 2PMZA 3WGHA 1T38A 5F04A 1TL8A 2BHZA 1BL0A 5LLQA 1GVJA 1VQ5I 2MW8A 2JJ7A 3OV8A 4LLGF 2ZJPF 1EH7A 1MBHA 3K4CA 4GYIA 2R5YA 2EA4A 2HVQA 3HKZN 1SAXA 5GP9A 4D5FA 1BR1A 4LOCA 2VJ5A 3CJQB 5CVUA 3K2ZA 2WY7Q 3KLOA 5ERIA 3OS0A 1O3SA 1OCOH 3C3WA 5CLSA 1G3TA 3BJAA 4ITVA 1R5HA 2G0EA 5M5XJ 3TMOA 2HQNA 3G1LA 3H35A 2BW3B 2GOMA 2ZXWH 3HIFA 4IRHA 3HUGA 1KU9A 3JRFA 3IKTA 2QKMB 2KISA 5J4VA 4DZJA 5EGOA 1YO5C 4G9YA 4YFXF 2DU9A 2ZJQF 5IT9Z 3TGNA 2RNGA 4G7OF 2Q0OA 1MNMC 4GO1A 3ELKA 2XB5A 1LE8A 1IO2A 4U0YA 1FBQA 2DA2A 1TQPA 1YW8A 5EEAA 2ZJ2A 3SZTA 4M6VA 3NARA 2FXAA 1SFOJ 5HDKA 1BI0A 1U78A 1GDTA 2JWTA 2VLAA 2WB1A 1NH3A 1S9HA 3O2PE 3GZ6A 2FBIA 2A6EF 5E79C 4XLHA 2LG4A 3CCUI 1FEXA 1A35A 4GYGA 5D5WB 4XRMA 5E3OA 2P5KA 4CYCB 4CSWA 3I0TA 4BKXA 4JOMA 2CUEA 4MFDA 3E6CC 1SANA 1YOVB 3MKYB 1MJ9A 1T56A 4XR6A 4BE1A 2OUMA 2L7MP 2DMUA 4X1EA 1Q1VA 4P1WA 2MYSA 1OISA 1SVMA 2LC2A 3AL0C 4BDZA 2VBYA 3GF2A 1YW9A 2IA1A 1ON2A 1LVAA 2K9SA 2LVSA 3HSEA 1JUPA 1R36A 5TJJA 2QEXI 3DCFA 2BHYA 3WODF 3JRHA 2L2OA 5JVTA 3BQZA 4IO9F 4ENJA 1HKQA 1A36A 1ZR2A 3AG3H 1AKHB 2DA5A 2R4GA 3E7LA 1BN5A 1FWZA 3FXQA 3H3VK 2A5WA 4IOCF 3FKIJ 1ORKA 4UUSA 3L00A 4IQ4A 1ZREA 4M6YA 5LBQA 1TWAJ 3S17J 1T98A 2EBIA 3EETA 4UY8I 2ESNA 3U1KA 3K70C 1SD7A 3HGGA 3GTGJ 3F23A 2EILH 1PUFB 3H92A 2NVYJ 4HRIA 3OYIA 1WQ2A 3ZQQA 4CCLA 4HF1A 1V54H 4BEHB 1XTAA 2VL8A 2R5ZA 3ZQ7A 2X51A 1RI7A 3OR2C 4IVNA 2VIXA 1BJZA 2CV0A 1X2MA 4FETA 5HVQC 4BH9A 3JRAA 1X3ZB 2ZSHB 2HVSA 2H09A 4HSTA 4EJVA 1EH8A 1I3AA 4CCKA 5JR3A 2ELJA 2HPIA 4LG3A 2QYOA 5CPRB 2YX4A 1HOMA 1K78A 3S3MA 4KITB 2DYRH 5C44J 3Q0UA 3C2GA 1WH7A 1P6RA 3P9CA 1PDNC 1ZRCA 3F6VA 2K4JA 3DF8A 5EZGA 3J7YJ 1CF7B 2YX7A 2O8KA 4NHJA 2IPQX 4I7HA 2QVOA 4PSXA 2DPUA 4RB0A 1EH6A 3CCQI 4BQQA 1RUOA 3MFKA 4NC8A 2YPRA 1XPXA 2FNAA 5IP9J 2CS3A 2P7VB 2E2JJ 2HTJA 3CMMA 4CCNA 2RN7A 3DBHB 3C1DA 4A2UA 2ESHA 1FNNA 4EM1A 5FB2A 1ZKGA 5DUKA 1MBFA 3E5QA 4QSHA 2XAJA 4GXOA 2L9NA 3W2WA 1DUXC 1DU0A 3H9JA 1JKQC 4RB2C 1R00A 1RR8C 2K9MA 1Z7LA 3ASOH 4A5NA 2NS7A 2EB7A 3PL8A 3W6JB 4II2A 5ED4A 1JTXA 4DYQA 3WHCA 2L0KA 1MH3A 3V8JA 4XBFA 3IRRA 3PFIA 3I59A 1WWXA 1Z67A 3SFZA 2I5UA 2PEXA 2ZKZA 3KZYA 5E3MA 2FMYA 1FPQA 3HUGB 4ENMA 2RDPA 3CUQB 3KYCB 1S5LC 3DEWA 3DFGA 3UKGA 2IRFG 3ECHA 3AKZA 1NTCA 4HQEA 4A0YA 3VWBA 4E7JA 2DQRA 2PFBA 4ZYEA 1G6NA 1R23A 3CC4I 1ZAOA 5LGUA 2Z3YA 2VQLA 3BLYA 3UNGC 4ZYHA 3S1RJ 5IY5H 4N4NB 1MW7A 1ERDA 3IWFA 4IRIA 4IHYA 4WX9A 1LDKB 4P9FA 5IYDJ 2TDXA 4EM2A 3HOXJ 2OC6A 2R5YB 4BL0B 1R71A 3ZMSA 4FCYA 3WTUC 1X58A 2X4HA 4DZPA 2PLYA 5B66C 3ABTA 1Z05A 3NWSA 3LSTA 4A3MJ 1TNTA 3FXRA 3PO2J 3IH2A 1X3UA 5M5WJ 1G3SA 1IGNA 5AIQA 4RGRA 4MFEA 3PJRA 2IXSA 3T5XA 4EEFG 1R49A 1JKRC 2NXNB 3CP8A 3H36A 2XPUA 3FXOA 3U21A 4PFOA 3TKYA 3A1YA 3C18A 1ZLJA 5HLIA 2HWVA 1IAWA 4HAMA 2V4JC 4HYEA 3GFLA 1YJWI 3GCMA 2ISZA 2GOXB 2VN2A 3GXOA 5GAEJ 2KLOA 1RZ4A 2GZWA 5EF6A 4XRFA 5EYRA 4M3FA 2M7BA 5CVRA 2V1DA 2RGVA 4ON0A 3TP0A 4DQ2A 1APLC 3JRBA 1JJ8C 1GUUA 2OD5A 1W7PA 2JA8J 1QQIA 2V26A 2BEOA 2XSJC 1JHHA 2EZHA 2ETHA 2FQ3A 3OMYA 4ZH4F 2DTRA 2IJLA 5FKKA 4YG2F 3F22A 2LY9A 2FQ4A 1VQ9I 4HV6A 3E6BA 4L5JA 2JA5J 2LREA 4WXDA 1W7PB 4JYKA 1KQ0A 4ASNA 1FX7A 1Y8QB 1ODDA 4LIVA 4UB8C 2P0WA 1ENHA 3M4OJ 1ZK8A 2R3SA 3KEOA 2X6WA 2COBA 3GW2A 1U5TB 1L3LA 2WC2A 2QQBA 3I55I 1OYWA 1HCRA 2YUSA 1VNDA 1QVTA 3WGGA 1FBUA 4MO7A 3TP3A 4EVIA 5F1JA 2V9PA 3K7AJ 1D5YA 5D6FA 3VOEA 1Y0UA 3ONQA 5DUIA 2ZXJA 5DM6F 1Z9CA 5JHFA 5H6QA 3CUOA 4FE7A 4BBSJ 5FLXZ 4EMSA 2DCEA 5E8GA 2DK8A 1YHQI 4D7MA 4HLYA 2G7UA 4L5IA 1BIAA 1WI3A 4L5EA 4P96A 3MZYA 4BE0A 2FSWA 2GXGA 3VYTB 3F8CA 1VQMI 2GA2A 1OKRA 2QWWA 2RKHA 4DIQA 3CDLA 2F2EA 1KYWA 3M1CA 1X4PA 4OMZA 4KIGA 1T08B 3H3ZA 3HRTA 3KP4A 4MIMA 5HS7A 5TRDA 1ZGAA 4I99C 5JHUA 4V2GA 2BYVE 3DTEA 4CDGA 1DPUA 1K4SA 2W00A 1BA5A 1RPWA 1TWCJ 2AO9A 2IGMA 3G1OA 3HKZA 4XLEA 4S05A 1YI2I 2OZUA 1U6GA 2O7OA 3CUQC 3TEDA 1VQ6I 3M7GA 4HZFA 1LEAA 1WCMJ 3ZQHA 3HSFA 3CCSI 5GPAA 4KNYA 1ZLKA 4LB5A 3VPRA 5LGNA 2HQAA 3WTZA 1YITI 2XV4S 3VFZA 3J81Z 2DODA 3K4JA 2K27A 4BUPA 2KJBA 3KEQA 1GV5A 5L3CA 3I59B 2A6HF 2XKOA 2V6CA 2ZSIB 5EDNA 2CQ7A 3Q0VA 5E3NA 1TLHB 3FMSA 2GAUA 3REOA 4S0HB 1SFKA 3ZQIA 1YLFA 1I1SA 3FBNB 1OCCH 5LHHA 3CCLI 3B6AA 3RSNA 3M8FA 4FASD 3MQ0A 1HDDC 2PQ8A 2NOJB 2F4OB 3BG7A 3H0GJ 3SHFA 4B09A 1XSXA 2XRLA 1F1ZA 3JTHA 2FX0A 4CCOA 3D5SC 1LPQA 3CMYA 1KONA 2W57A 3GTJJ 5IPAA 4A3LJ 1SFUA 3F6OA 3R0AA 3DP7A 1QO0D 1IRXA 3C7JA 3G71I 3I71A 4CCMA 3GTPJ 2BZTA 2DMPA 2EPFA 2Q2EB 3QODA 3RYPA 5F64A 4HW0A 4QTRA 1LEBA 3F8BA 1IUFA 1PJRA 3LQQA 3ZQCA 3K4NA 4IOAF 4WXHA 2EZLA 2W24A 3K6GA 2DI3A 3DBLB 4MQVA 1RESA 5ICGA 1T8IA 1K78B 3BZKA 1E3PA 3IP4B 2JRTA 4ZJZA 1SMYF 3E6DA 1K7AA 2R0QC 1IUYA 3KZIC 1YIOA 3K2AA 1SAUA 1Y0NA 2LP0A 3HXLA 4UVCA 1WJAA 2WAFA 4B8XA 2D2WA 4W97A 4OINF 2MC4A 1R5ID 3ZMTA 3RQ4A 1BIBA 3KZZA 4BXUA 1DPRA 5BMZA 5GTHC 1JKPC 2Z99A 2LKPA 1RRJA 4FQGA 4EQQA 4ZDLA 4C2TA 3KPHA 4DNCA 4E7HA 2V1UA 5L3GA 1IN8A 1WJ5A 2QSHX 1SVLA 1FSEA 3G4SI 3ZRGA 3HJEA 1S29A 4LGWA 2J5OA 1RKTA 2M8EA 4DW6A 4EM0B 2D1HA 4M9ZA 4ESBA 2XC7A 1NG7A 4YELA 1VFCA 5FKLA 2ZFUA 5ICEA 2CW0F 5HLGA 5IT9K 4EJUA 3J80Z 2NNYA 2D45A 2E1CA 3I9V2 4B44A 5BPIA 4S04A 1ZQ3P 2JRMA 3SDGA 2DDBA 2DA1A 4KFCA 1B9MA 2DFIA 1Z6TA 2IW5A 4XN3A 4RDUA 1MMAA 3KCCA 1ZYRF 2M30A 4MHGA 4UUVA 5D4RA 2LF8A 3KX2A 3QPSA 3MKLA 3KP7A 2DJIA 1TT0A 2EFQA 2QQ9A 2NS8A 3FXUA 3BPXA 4HX8A 1U9NA 2DBBA 3BWGA 1POGA 2CQQA 3BCBA 4IRGA 3JRCA 1XSDA 4ZYGA 2K5CA 4CGZA 1PP8F 2LY1A 3MAJA 4GGGA 1FOXA 2JSCA 3LSMA 2XAQA 2TRTA 2NVTJ 3A02A 1TQIA 1BW5A 3GEZA 4KIFA 4AVPA 4GRIA 1RIOH 1N75A 1YX5A 4BY7J 1IRZA 1DU6A 2VJIA 3RKYA 1Z1DA 1LUJB 2YU3A 1A6QA 1B8IB 4BAYA 1FOWA 1TWFJ 5KAFC 3CO6C 2DAOA 2K3FA 4N0BA 2DQLA 3Q5FA 3WU0A 2LYCA 3E0JB 1YQAA 2EK5A 2M45A 2W48A 3UR3C 1DP3A 2L54A 5C3EJ 2BVMA 3ZN0A 4BGDA 4CO8A 2WWYA 1MDMB 4GDFA 2EIMH 4HX4A 3EUAA 1UFMA 2D5VA 4Q48A 2VPRA 2OTLI 5E1ZB 1JUSA 3GZ5A 2XPWA 4XKVA 3HPGA 4C30A 2A07F 5IP6A 4A69C 4RAYA 1P7JA 2XROA 4A6DA 2Z16A 5HDNA 5E17F 2ZMEC 2OQRA 4JK1X 5B5EC 2E60A 4C9YA 1G3YA 2ADUA 1E0EA 1YW7A 3QPHA 3LA3A 4NC6A 4L9JA 2DMNA 2H1LA 5IYCJ 3FXLA 1IXCA 1Z91A 3B6CA 3A03A 4HQMA 3U9GA 1OR7C 4Y33A 1V55H 1R6RA 3LA2A 1JHFA 2ZB9A 3BQYA 2M7AA 1SVOA 3GX4X 3ZP5A 1W0UA 3RPQA 2KRCA 3PNVA 1W1WE 3VYUB 1BI1A 1D5VA 5E1XA 4BDYA 5GPCA 2R7DA 2H6BA 1YRNB 3DKYA 5DD8A 3D5LA 2CV1A 3NRVA 3DPLC 4BS9A 1XD7A 2RQQA 1JGSA 2STTA 1D0ZA 2L7KA 1DQUA 4UHTA 3WGIA 2E1MB 4XMYA 5D5UB 3RZDJ 1R9TJ 1BC8C 1LFPA 2E2HJ 2XVCA 5L3EA 1HSJA 1USTA 4G6TB 4JX5A 5B3SH 4KICA 1T6SA 4EJWA 4U7DA 4ZTFA 3NWTA 4RB1A 3U1DA 1R58A 4E7ZA 3M07A 3HRUA 1O57A 3F0CA 4XN0A 1UG0A 4NBQA 4A3CJ 3K69A 2EJRA 2LR8A 3HB9A 1XGNA 3JSPA 1QA6A 1TT5B 1FBSA 2L9RA 5CKTA 4M3EA 3H9QA 1P92A 4F91B 3S2DJ 3Q0WA 4WCGA 2L7ZA 5F08A 1UB9A 4ZZDA 2IS2A 3OYMA 4RBOA 2VQGA 1Q1HA 3QRFF 4GCVA 3QOEA 2AHQA 5J1RA 2CJJA 3BDDA 4LLLA 4KT5C 2ACJA 1OCPA 4ESFA 5K7ZA 4LJZF 1DP7P 3L2VA 1QZEA 4HX7A 3RCOA 5M3MJ 1B8IA 1Y1WJ 2E7XA 4ABZA 3QWLA 3CTAA 3OWTA 1S8NA 2FBKA 1BI3A 1TP4A 3CCYA 3FKJA 4U88A 2PJPA 2FBHA 4A3IJ 2VKEA 1YE9A 2STWA 2FE3A 3CO7C 4EGYA 4ENKA 1A5JA 1HKTA 4D5CA 3DU6A 2OPTA 2YS9A 3IRQA 2CMPA 1S7AA 3ML6A 4OWRB 3I53A 2VC1A 2DFEA 3TDZC 2XF7A 1K83J 3PSFA 4Y3OA 3SXYA 1MJBA 3NQOA 4LG0B 5D5XB 2Y9YA 3JW4A 1FIAA 2E5ZA 1UJ8A 4LK0F 3H5RA 1JE8A 3BG9A 5FKMA 1RUNA 4ZYAA 4BYYA 4B1RA 2BOLA 2UV1A 4AIDA 4UNOA 1KU7A 4XRSG 3ASNH 2IS4A 4PJ0C 1B4AA 2LH9A 4IEJA 2EFWA 2B9SA 2F5EA 1JJ6C 2JMWA 1XMAA 4HBLA 2KMUA 2A05A 2FJ1A 5JLXA 2YU9J 3NEUA 4D1QA 1J2XA 1YS6A 3E1SA 3R0JA 1ZRFA 2BVLA 4G7ZF 4M9SA 1YIJI 1BM9A 4HOBA 4IL6C 2OBPA 3PSIA 2IT0A 3GZNB 5A2QZ 4A3FJ 3LWFA 1FP1D 3HL2A 5TGTA 1FSHA 4YFKF 1V3FA 3H5NA 1GV2A 1XX5A 3A0BC 3AAFA 2IBDA 4KIBA 2ZXHA 3N05A 1XSVA 1MBGA 2D1VA 1NK2P 3L2QA 3MZHA 5K5QA 5IT3A 1UHWA 3DQVC 4M74A 2N8GA 3PNYA 2KIUA 1OJLA 2X6XA 3HRSA 4XLCA 3VODA 5B1AH 1JGGA 2HOEA 1GXQA 1WI9A 2MD5A 5BS6A 1KA8A 2O61A 1F9NA 4LFUA 5DDGA 4J00A 3V8LA 4C3HJ 1J75A 2H8RA 2G9WA 4UXNA 3RYRA 1K61A 3OSFA 2UWMA 3J7AO 2Y0SA 3BJ6A 2ZMEA 1HQCA 1GLNA 1ETKA 3NAUA 4BBRJ 2BE5F 1MNEA 3FBIB 2GXBA 4HDVA 4H4KC 2Y75A 1FLIA 3I56I 4JQFA 3CMEI 1LDDA 3K1MA 3ABKH 5F27A 1H9GA 4L9VA 1UZCA 4HPQA 2DYSH 2TCTA 3P7NA 3FF5A 2DFHA 2OQGA 1DDNA 3ZN1A 3FZVA 1V4RA 3K4MA 3RDIA 1LKXA 3FK7A 2LBFA 3TOAA 2CQKA 5AONA 3HTSB 4IZZA 2F6CA 2UZKA 1BR2A 4U7BA 3A2KA 3QYEA 2K02A 1OYIA 4XOPA 1U3EM 1FY7A 1NG6A 2L7FP 1D1AA 1WKMA 2VT2A 3T8RA 3WTYC 2NS0A 3K10A 4XM3A 3M3YJ 2EIJH 1MMDA 2KZVA 2BY3A 2FNPA 2XIGA 3JTGA 4M3BA 2HQ5A 2IGOA 1AA7A 2NVUB 2Z5UA 2PJRA 2Y31A 1YYVA 5D5VB 2XAFA 2EV5A 4B48A 4BHPA 3J7AY 1SD5A 2MABA 4LMYA 5HNFA 1JXSA 4HNTA 1QVUA 3HPHA 4ZYDA 1KYZA 1LJ9A 4H0EA 1HW1A 1OYYA 2LMDA 2VC0A 3OYHA 2CUZA 1G2HA 1TW3A 1W7PD 4L9NA 4KISA 2MLKA 1BOBA 2ZC2A 2LNBA 2H94A 1O4XA 2HOAA 4CH7A 4L0ZB 1KU3A 4E4HA 4DGWB 4HSRA 4B3XA 4BACA 5CQEA 4A3EJ 1R4NB 4DYRA 1D8JA 4I6ZA 5LD2C 4XONA 2H27A 1P4AA 1IRGA 4UUSB 1D3YA 3B02A 5HODA 2XSDC 3RZOJ 2DT5A 3FWEA 5J3LA 4B4CA 4BQNA 4AVZA 4PFPA 3TO7A 3ABUA 2M4KA 4G6QA 2HEOA 2M1BA 4RAZA 1YFHA 4EV0A 3EYYA 1I6XA 2KKOA 3KYLA 4MQ9F 1MKMA 2Y0MA 4M3DA 5FO5A 4FX4A 4OMYA 2LD5A 1P7IA 3DLLF 1QHHD 3OL4A 4G94A 2M0MA 1IZ1A 1TZLA 3S8PA 3OYNA 2GIZA 2E7WA 2FD5A 2X6OA 1WJFA 2E1NA 4I0AA 2KRHA 2R7XA 2XGDA 4KMUX 1Z7UA 2XGEA 4MEXF 1OQYA 2KIMA 3DPUA 1FC3A 3P9IA 5LRSA 3OYFA 3WE3A 1MH4A 3LQRA 3VYSB 4AUXA 3L2CA 3CCJI 1VZ0A 2ELHA 3WHBA 4E7SA 3A4CA 1J5YA 2I10A 3S3NA 3MKWB 4IF4A 2E1MC 2ICWG 3BTCA 1WSUA 3CQZJ 4RS8A 2E2IJ 4OAZA 2EZKA 2OZ6A 3RQIA 1NHAA 1UHMA 2JT1A 3BR5A 2KPMA 1VI0A 5FFZA 1IRFA 2M3AA
chains in the Genus database with same CATH topology
2WADA 4NQWB 4B43A 3K6GA 3QYBA 5KHDA 3IP4B 2QKLB 3OS2A 4ZJZA 2R7TA 4F92B 1WJCA 4DJAA 4KT6A 3OL3A 1SAUA 1Z3XA 3VSKA 3IAM2 1Y56A 3HXLA 2R7WA 4ZDOA 2R7QA 1WJAA 2WAFA 4BJ6C 2JVGA 3ZR8X 2MC4A 4U87A 3D5RC 2BW3A 3EUKL 3RQ4A 2VKHA 3OIQA 1FMWA 2PMZA 4XOTA 2KDOA 4N4OB 3IUOA 3RPUD 4F93B 3OYJA 2VJJA 1OLTA 4ZDLA 1WJEA 3QYFA 4C2TA 4E7HA 1WJ5A 3H5AA 3K4CA 3ZRGA 3RTRA 2HVQA 3H0DA 3W2AA 2XDVA 3VSLA 3G2BA 1BR1A 4D9JA 2VJ5A 3CJQB 1D1CA 2WY7Q 4RLQA 1NG7A 4YELA 3OS0A 2XC7A 2ZFUA 2PJRB 3CJRB 1X1CA 2ZXIA 3DTKA 4ITVA 2CW7A 2HVRA 3I9V2 4B44A 3OYKA 1MMGA 4BJTA 3TMOA 3CF2A 4RMNA 2IS6A 3H35A 2BW3B 3OYEA 4XN3A 3HOTA 2GOMA 1MMAA 2IGKA 3KX2A 2QKMB 4CUGA 2DJIA 1TT0A 5KCMA 3TL4X 1T95A 2RNGA 4YEJA 3OYLA 2MD0A 4RM3A 3BCBA 3DU5A 2LRDA 2W4SA 2K5CA 2LY1A 3LSMA 3OS1A 1P9QC 4GRIA 1N75A 2Z1DA 1YX5A 3FDYA 2VLAA 3EPZA 1MNDA 2VJIA 2WB1A 2W82A 3SEZA 1S9HA 3S3OA 4F55A 1QU3A 1WJDA 4XLHA 2LG4A 4II3A 3K4LA 2VKDA 2R7SA 2WY8Q 4XQFA 4YRVA 2X1CA 2LYCA 3E0JB 4CSWA 3UR3C 3GBGA 4JOMA 1DP3A 1WFXA 2BVMA 4PUSA 3MKYB 4XR6A 4BGDA 4BE1A 4HG2A 2OUMA 1Y6IA 4XKWA 3EUAA 4P1WA 2HDWA 3AL0B 2MYSA 4LIUA 3M8JA 2LC2A 3AL0C 5LFAA 4ZDPA 4BDZA 4XKVA 3HPGA 2KQRA 4C30A 1D0YA 3BC8A 2Z16A 2L2OA 3CESA 2MFZA 5HOOA 2E60A 4XKBA 4C9YA 2IS1A 1E0EA 2R4GA 3IAS2 2A5WA 3BCAA 4NUBA 3OYCA 2Q1ZB 3L2WA 1OR7C 4IQ4A 4Y33A 1R6RA 2DT6A 2WAQA 2M7AA 1Z21A 3ZGKA 1QHGA 3K70C 2KRCA 3DLAA 3PNVA 3VYUB 2DXIA 2W7NA 4BDYA 4MLOA 3TBIA 2CW8A 3DKYA 4DOZA 4HRIA 3OYIA 5FRMA 3D5LA 2CV1A 3ZQQA 4CCLA 3DPLC 4AU7A 3HC7A 4BEHB 4BS9A 2X1EA 3LL7A 2VL8A 2RQQA 4ANJA 2X51A 4HEA2 1D0ZA 2L7KA 3OR2C 1DQUA 4XLFA 2VIXA 2CV0A 4FETA 4RLFA 2E1MB 5HVQC 4XMYA 3AFHA 2ZSHB 3PNTA 2WBMA 4HSTA 1LFPA 3F9KA 2X1DA 4G6TB 2JUGA 4CCKA 2ELJA 2HPIA 4LG3A 5CPRB 4ZTFA 3NWTA 1X1BA 3S3MA 2WA0A 2F4IA 4E7ZA 4KITB 3OYAA 4XN0A 1UG0A 3C2GA 1WJBA 4BJ5C 2VB6A 3DPTA 3OOUA 4EATA 5CKTA 3LMMA 1X1DA 3H9QA 4E6KG 4F91B 4PSXA 2AQFA 3DKXA 3BG6A 2L9SA 3S93A 4BQQA 2IS2A 4NC8A 3OYMA 2VQGA 2CS3A 1X19A 3QOEA 3W2VA 4CZCA 3SDBA 3FHNA 3L2VA 3OYDA 3CMMA 4CCNA 2DT7B 3S32A 2CH0A 2F5VA 1D1BA 2V9KA 3RCOA 3DEEA 2HU9A 3I3LA 2L9NA 3OWTA 3W2WA 3H9JA 3HG9A 3FKJA 4DBRA 2K9MA 1Z7LA 3W3CA 1YE9A 4E7KA 2HZDA 4BXFA 3DU6A 3PL8A 4PJJA 1X1AA 2CMPA 4II2A 2AQEA 4OWRB 3LSKA 1W36D 1V5EA 5FRNA 2CUJA 2XF7A 4Y3OA 3PSFA 4AYBA 3V42A 3HUGB 3KEYA 2E5NA 1DGRM 2E5ZA 1JI8A 2VASA 3H5RA 1ZELA 3AKZA 4ZYAA 4IKFA 2BOLA 2UV1A 2R7UA 3DTIA 3VWBA 4E7JA 4XKCA 2IS4A 2KL4A 2LH9A 4BEHA 2VQLA 3BLYA 1DGWY 3UNGC 2KMUA 4PJMA 4N4NB 1MW7A 1ERDA 2XAUA 4BU2A 1LDKB 4D1QA 1LVKA 2VQHA 2R7VA 3E1SA 2OC6A 4Y4RA 4BL0B 4R79A 1D0XA 2I8DA 2BVLA 2DOAA 1YX3A 2A6TA 1EA3A 2V6EA 2X6YA 3CP2A 3PSIA 3NWSA 3K4KA 4RM2A 3VDXA 5TGTA 3HL2A 3K70D 3H5NA 4F3QA 3PJRA 2IXSA 2ZXHA 2UUZA 3CP8A 1PYVA 3N05A 3U21A 4PFOA 3SZGA 3A1YA 3L2QA 2V4JC 4IX7A 3LSIA 2GOXB 2KLOA 4ZC3A 3DQVC 3PNYA 2M7BA 2X6XA 4NNJA 5HNHA 2HPMA 4XLCA 3C2HA 5FROA 3CZ6A 3OR1C 4J00A 4BE2A 4E7LA 4C2UA 3HOSA 2IGNA 2V26A 2UWMA 2Y0SA 3ZCOA 3VYRB 1GLNA 2XSJC 3OMYA 2HVSA 1MNEA 3K4BA 2VXZA 3FBIB 4H4KC 4OAYA 2LREA 2V7FA 4JQFA 1J09A 2LY2A 4LIVA 2P0WA 3MMYB 2KP6A 2RREA 4HPQA 2X6WA 3L2RA 4PJLA 1HA8A 1K6YA 3K4MA 4P5OA 1LKXA 2VJ4A 2LBFA 2M4GA 2X85A 4IZZA 3OYGA 2F6CA 1BR2A 4U7BA 1X4OA 3ONQA 3A2KA 3QYEA 2W1OA 3OIPA 2O5RA 5JHFA 4XOPA 2K9LA 2DCEA 1NG6A 4X0GA 3LFUA 1D1AA 1V5GA 1N77A 3MKZA 3K10A 4XNFA 2LOOA 3OYBA 4XM3A 1MMDA 2KZVA 3H9GA 4J01A 2JSPA 4BE0A 3VYTB 3ZXSA 4CA0A 4QPQA 4DIQA 3M1CA 1X4PA 2IGOA 1FMVA 1AA7A 2PJRA 1UELB 2JA2A 2VPLA 3L2UA 4B48A 1V5FA 4DBQA 1G59A 2XF5A 3J7AY 3DTEA 4HNUA 2MABA 2L5QA 5HNFA 2W00A 1MMNA 3HPHA 4NC7A 4HNTA 4LITA 2IGMA 1U0JA 4XLEA 4BQOA 4F52A 3HKZA 3OYHA 5HLTA 2CUZA 2K3PA 1W36C 3LSHA 4KISA 1BOBA 4CH7A 4E4HA 4DGWB 4HSRA 4B3XA 4PJNA 4BACA 5CQEA 3OY9A 2M3AA 5LD2C 3PFYA 1Z3YA 4XONA 2VQCA 1BR4A 5KNLA 4XORA 2HQAA 3EUHC 3MD2A 4XL9A 3PUBA 3SEQA 3K4JA 4BQNA 4AVZA 4BUPA 4PFPA 2WAEA 3LSGA 2M4KA 3SYTA 2ZSIB 3KYLA 4E7IA 4ZTJA 1G8XA 4QPOA 2XF6A 1QHHD 3OL4A 2LBFB 2CFOA 1SFKA 2M0MA 1TZLA 1T0FC 2FUG2 2R7OA 3FBNB 2OV7A 3S8PA 3OYNA 2CV2A 2Z2SB 2HNHA 3RSNA 4FASD 4B47A 1WJFA 2NOJB 3BG7A 2KHMA 2KRHA 2R7XA 2R7RA 1UAAA 4KJZA 4CCOA 4PK4A 3DPUA 3D5SC 1N78A 4PSWA 1KONA 4CCJA 3OYFA 3VYSB 4IQJA 1VZ0A 4XLAA 2JVHA 4E7SA 3A4CA 3S3NA 1IRXA 2V1NA 2E1MC 5CQGA 3MKWB 4CCMA 4OAZA 2VXDA 3DWLE 2Q2EB 3QODA 2KPMA 1PJRA 3K4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBN B;  3FBI B; 
#chains in the Genus database with same CATH topology
 2VI6 A;  2WAD A;  4U0W A;  3S14 J;  4NQW B;  2E35 A;  2EV6 A;  2HZT A;  3QPT A;  3V7C A;  1G4D A;  3OS2 A;  3HRM A;  5DCM A;  2Y9Z A;  4BQA A;  1E3H A;  3TW6 A;  4ETS A;  3E3V A;  2JK3 A;  3T1B A;  2IA0 A;  3HHH A;  3OL3 A;  4F7Z A;  1Z3X A;  3BR3 A;  4YII A;  1Y56 A;  3PO3 J;  4ZDO A;  2R7Q A;  3A0H C;  3CCE I;  4U87 A;  5CVI A;  3D5R C;  2BW3 A;  2ID6 A;  3EUK L;  2VKH A;  3OIQ A;  1FMW A;  2JUC A;  1J59 A;  4XOT A;  4N4O B;  3WE2 A;  1MBE A;  3IUO A;  3BG3 A;  3RPU D;  4F93 B;  2WAQ N;  1MSF C;  3QYF A;  5F0C A;  2EIN H;  1SD4 A;  4YIR X;  1ONV A;  3D0S A;  2O3F A;  4JX4 A;  3H5A A;  1O7F A;  2CQX A;  1OCZ H;  1JKO C;  4I0B A;  3H0D A;  1IV8 A;  2XDV A;  3L1P A;  1VQ7 I;  1IN7 A;  3VEP A;  2NNN A;  3DKW A;  4FT8 A;  4RB3 C;  3L09 A;  4RLQ A;  1OPC A;  2PJR B;  1X1C A;  2ZXI A;  2M5W A;  3K0L A;  1WPK A;  5FFX A;  4CYD A;  3WTW C;  1MMG A;  3GUD A;  2P5V A;  4KA4 A;  1VQL I;  5CYV A;  4I2O A;  3M1E A;  4N9H A;  3CF2 A;  2JN6 A;  4EJT A;  2OA4 A;  3HOT A;  5ILV A;  1QPM A;  1J7K A;  5L3D A;  5L3F A;  3FHZ A;  4KMF A;  2A69 F;  1Y8R B;  2MSY A;  5CVJ A;  4CUG A;  2Z9O A;  3L7W A;  1VQN I;  1VTN C;  1OMI A;  2VOD A;  3TL4 X;  1ZGJ A;  1XS9 A;  4RAF A;  4YEJ A;  1X3W B;  2MD0 A;  4RM3 A;  1TWH J;  4ZZL A;  4N9I A;  1F43 A;  3DU5 A;  2KZG A;  5F1R A;  2W4S A;  3HZJ A;  3CDH A;  2J5P A;  4Y7N J;  2WV0 A;  4JP0 A;  3DXJ F;  1B59 A;  3F3X A;  1AHD P;  1P9Q C;  1U9O A;  1D8K A;  2HXI A;  2JPB A;  1QNT A;  2FA5 A;  2Z1D A;  5EG0 B;  4G7H F;  1FZP B;  3FDY A;  2W85 A;  3EPZ A;  1MND A;  2M34 A;  2W82 A;  3SEZ A;  2VOO A;  2PI0 A;  4F55 A;  3K4L A;  3WG9 A;  1S72 I;  2CWE A;  1FYM A;  1ETV A;  3KP3 A;  3HOZ J;  1F36 A;  4R1H A;  4YRV A;  2X1C A;  4M6X A;  1EJ9 A;  1WRJ A;  2IA2 A;  1WFX A;  2MLG A;  1CF7 A;  9ANT A;  3I58 A;  4HG2 A;  2CG4 A;  1G3W A;  3IKV A;  2HDW A;  3AL0 B;  4LIU A;  4PGH A;  3M8J A;  4KN4 X;  4RGS A;  4ZDP A;  2NVQ J;  4L9T A;  1F4K A;  1IW7 F;  3BR2 A;  2X0L A;  4AYB N;  3RI4 A;  2X9D A;  2XRN A;  3CES A;  3EUH A;  2XPV A;  2MFZ A;  1GXP A;  1BJA A;  3HBL A;  3CDI A;  5K7H A;  1U8R A;  2HYG D;  1XGM A;  2FRH A;  3CF5 F;  3EYI A;  3V8K A;  4HF2 A;  3RKX A;  1XB4 A;  2IEK A;  5J40 A;  2R5Z B;  3PUF A;  4IXA A;  2Y48 A;  3BCA A;  3OYC A;  2QQA A;  2Y30 A;  3QP5 A;  2RNJ A;  2BY0 A;  4BHC A;  4ENN A;  2H1K A;  4Q4Z F;  2DT6 A;  1SC7 A;  1TW2 A;  5KK1 A;  2HGC A;  4D0P A;  3I54 A;  1QHG A;  2R92 J;  3DLA A;  3EQL F;  1MJA A;  2DXI A;  1M1E B;  1S6L A;  4MLO A;  3TBI A;  2CW8 A;  3F72 A;  3ESW B;  2Q8K A;  3CMA I;  2DW4 A;  2OU2 A;  1NK3 P;  1I27 A;  4DOZ A;  3TQN A;  5FRM A;  3JAM Z;  2QZ8 A;  3KP5 A;  2DN0 A;  2L01 A;  1Z6R A;  2EFO A;  4AU7 A;  2MGQ A;  2K85 A;  3HC7 A;  3WTT C;  4XSX F;  2M8G X;  3MN2 A;  4ANJ A;  3GTM J;  1FJL A;  4IHS A;  2OTJ I;  5JLW A;  4RLF A;  3AFH A;  1RC9 A;  3PNT A;  1XG1 A;  2X1D A;  3S2H J;  3ERM A;  5J8C A;  2HS5 A;  1B9N A;  2XAG A;  1HW2 A;  2VBX A;  1QGP A;  4UV8 A;  5K7F A;  1X1B A;  2ID3 A;  2AS5 F;  2QSG X;  2FU4 A;  2BBY A;  4YIF A;  5IOY A;  4AM3 A;  4I09 A;  1R1V A;  3PM1 A;  2K9N A;  3ISP A;  4BJ5 C;  2VB6 A;  2O9L A;  2EIK H;  4EAT A;  3LMM A;  2HI3 A;  4E6K G;  4EGZ A;  3HTU A;  1IDY A;  2GQQ A;  5DM7 F;  3LSR A;  3DKX A;  1I39 A;  3S93 A;  1LQ1 A;  1FOK A;  3BTL A;  3GME A;  1U5T C;  3MVP A;  1XDU A;  3F8M A;  3W2V A;  1EF4 A;  2P6T A;  2DK5 A;  2KFD A;  4Y52 J;  2FF4 A;  5E20 A;  5DTD A;  3SZP A;  5EG0 A;  2QA4 I;  4ESJ A;  3V4G A;  1RKW A;  3O8G A;  1D1B A;  3DEE A;  1OCR H;  2F5D A;  2HU9 A;  3IV5 A;  3JRG A;  5H6R A;  5CJ9 A;  3KYD B;  5LHI A;  2H6C A;  1QBJ A;  2B63 J;  3GFI A;  5ICC A;  1IXR C;  3W3C A;  1EKE A;  1F5T A;  4XID A;  2ZNY A;  3O3K A;  4PJJ A;  5FD6 A;  1X1A A;  3BOQ A;  1LDJ A;  2E36 A;  3LSK A;  1YTY A;  1W36 D;  1V5E A;  2DLL A;  5FRN A;  1REP C;  4V19 K;  4AYB A;  3V42 A;  5FGM A;  3N97 A;  3KEY A;  2VKV A;  5IYB J;  1DGR M;  1KGS A;  2DJN A;  4IHX A;  1JI8 A;  1HW5 A;  4M9X A;  2P4W A;  1R1U A;  4QLC U;  2OAZ A;  1VQO I;  4IKF A;  2GA1 A;  4A0X A;  4KDP A;  3O8H A;  3DTI A;  3FX3 A;  2KL4 A;  1KZH A;  3GVA A;  4AD9 A;  1DGW Y;  3BTI A;  3L9F A;  5A2Q K;  4B3A A;  1T2K A;  2MA3 A;  4BU2 A;  2KIF A;  3J7Z I;  2MH2 A;  2PMH A;  1LVK A;  2VQH A;  2R7V A;  1MBK A;  2V79 A;  4Y4R A;  4FTH A;  4RGX A;  4R79 A;  3CLQ A;  4Y15 A;  1D0X A;  1JTY A;  2I8D A;  1LFU P;  1YX3 A;  3GTQ J;  2W25 A;  3P9K A;  1UCR A;  3QP6 A;  3BY6 A;  1EA3 A;  1IN4 A;  2V6E A;  1TQM A;  1ITY A;  2KIQ A;  3W6K B;  1A04 A;  2ECC A;  2GWR A;  5JFR A;  4RM2 A;  2PN6 A;  5D8L B;  1YJN I;  4LB6 B;  3PIO F;  4LD5 A;  3R61 A;  2E71 A;  1X1P A;  2CYY A;  1GHC A;  3FXK A;  3SZG A;  1SFE A;  5J47 A;  3ZMD A;  2V9V A;  4IX7 A;  4NB5 A;  3MEX A;  3JRE A;  5HNH A;  4NNJ A;  1B72 A;  2YSR A;  1ETX A;  3CZ6 A;  1S7E A;  4E7L A;  1I3Q J;  4MNU A;  3HOS A;  1K6O A;  2IGN A;  1MMS A;  1AOY A;  2VBZ A;  2Y0S N;  2HKO A;  2FML A;  2XAH A;  3OIO A;  1IXS B;  3DEU A;  2KRF A;  2VXZ A;  1W5S A;  3P5J A;  4U0V A;  1MBJ A;  4OAY A;  5FLM J;  2XB0 X;  5E18 F;  1J09 A;  5C4X J;  1S7O A;  2LY2 A;  2RQP A;  3F8N A;  3BTJ A;  3G6E I;  4HDU A;  4AIH A;  1OR7 A;  2KP6 A;  3MMY B;  3FMR A;  4HF0 A;  2RRE A;  3T0Y A;  2K4B A;  4C3I J;  2DO7 A;  4HA8 A;  1IJW C;  1HA8 A;  2PMU A;  4I76 A;  2QQ8 A;  2BV6 A;  1QPI A;  3ERE D;  2LFB A;  2X85 A;  3FIS A;  1B6A A;  1X4O A;  3HSR A;  4QIW N;  2W1O A;  1WZ2 A;  1MGT A;  1KQ9 A;  2ZO4 A;  3CC7 I;  1X2N A;  2CU7 A;  4X0G A;  4IHT A;  3LFU A;  1TBX A;  1V5G A;  1N77 A;  3MKZ A;  2LSO A;  1H8A C;  3OYB A;  1U2W A;  3H9G A;  5J1U A;  4J01 A;  3QOP A;  2JSP A;  4BY1 J;  4A0Z A;  4TV7 A;  5HS8 A;  4CA0 A;  3JR9 A;  2E1O A;  3FXM A;  2BY1 A;  2NOG A;  3FIW A;  3HOV J;  3U2R A;  1R7J A;  4QWQ A;  3CJT B;  2GBY A;  1XN7 A;  3L2U A;  2MH9 A;  1G59 A;  2XF5 A;  5FLX K;  4HNU A;  4HNV A;  4XSZ F;  1MMN A;  4NC7 A;  3JRI A;  4LIT A;  3S1N J;  2CSO A;  4F52 A;  3DV8 A;  1VQK I;  4XK4 A;  5HLT A;  4IHV A;  1W36 C;  5FLV A;  1RR7 A;  2DMT A;  4G6D A;  2GXA A;  2F48 A;  4K2E A;  5IP7 J;  2NAZ A;  3WTS C;  1S3J A;  2QBY A;  4PJN A;  2QM3 A;  3OY9 A;  1AKH A;  3ZMZ A;  3Q9V A;  1Z3Y A;  2KJC A;  2M87 A;  2HOT A;  2VQC A;  4G12 A;  4XOR A;  3TO9 A;  3EUH C;  4FE4 A;  5E3L A;  3ECO A;  3PUB A;  3TOB A;  3KIO A;  1VQ8 I;  2RC4 A;  4M73 A;  1HF0 A;  1EV7 A;  5EZH A;  2QF7 A;  2WAE A;  5BQT A;  1WGX A;  3O6B B;  2IVM A;  1ZN2 A;  4E7I A;  2K7L A;  5D4S A;  1G8X A;  2V1X A;  2EA2 A;  1JT6 A;  2LBF B;  2VT3 A;  1SD6 A;  4LLN A;  4UUT A;  1T0F C;  2FUG 2;  2R7O A;  2OV7 A;  3EDP A;  2X48 A;  2ME0 A;  2ZNZ A;  1WH5 A;  2JQ7 A;  3GYH X;  3WU2 C;  2R7R A;  4KJZ A;  1C0W A;  3KET A;  1W5C C;  4RAG A;  2G7H A;  2CO5 A;  3G3Z A;  4I98 B;  2WTE A;  2E19 A;  4CCJ A;  2BY2 A;  1MIJ A;  4CZZ A;  2M9H A;  1Z77 A;  2JVH A;  2W84 A;  5J1Y A;  3KP6 A;  2ZME B;  3J80 K;  3RKQ A;  2V1N A;  1T0F A;  5CQG A;  2DPD A;  1HLV A;  2O8X A;  2VXD A;  4O6J A;  3B73 A;  1L0O C;  3CD6 I;  3LSP A;  2K40 A;  2NRA C;  1FOY A;  1WVR A;  5EGO B;  4KUM A;  1OFC X;  4B43 A;  3BZ6 A;  2GLO A;  5HDG A;  2DA7 A;  5KHD A;  2QKL B;  3I5U A;  2L4A A;  1I5Z A;  3JCU C;  1Y1V J;  1O3Q A;  1FTZ A;  4F92 B;  2HQR A;  4FIS A;  4DJA A;  4A3J J;  4PZJ A;  3LSJ A;  1ZG5 A;  4IPA A;  3IAM 2;  2R7W A;  2Z33 A;  5HS9 A;  4LK1 F;  4HV5 A;  4BJ6 C;  2JVG A;  2MBF A;  3PQJ A;  3KFW X;  2VOP A;  1AWC A;  2P5L C;  4E70 A;  3I4M J;  1H0M A;  2KDO A;  4MEY F;  1HKS A;  1JUM A;  2ZCW A;  5TIS C;  1KQ8 A;  3OYJ A;  2VJJ A;  3ZQL A;  1OLT A;  1PUF A;  1I6H J;  1WJE A;  1AU7 A;  3S1Q J;  1E17 A;  4A5M A;  5L3B A;  1LFB A;  3R4K A;  2MG4 A;  2R7F A;  3RTR A;  2VE9 A;  1O3T A;  3W2A A;  3VSL A;  2HDC A;  3G2B A;  4D9J A;  2Y69 H;  3RKW A;  1XGS A;  5LGT A;  1D1C A;  4FHT A;  3G1M A;  3WTX C;  3BR6 A;  4O5V A;  3CJR B;  3DTK A;  2DA4 A;  2CW7 A;  2HVR A;  3OYK A;  4BJT A;  1ZR4 A;  4RMN A;  2AXT C;  3LA7 A;  5LEJ A;  2IS6 A;  4UVA A;  3OYE A;  1ULY A;  1CGP A;  4A3K J;  3VB2 A;  2IGK A;  2VUM J;  5GAG J;  4MTE A;  1IN6 A;  2QSF X;  2GM4 A;  3QPL A;  1HXD A;  5KCM A;  3CCR I;  1T95 A;  2HYJ A;  4NDL A;  3LNQ A;  3OYL A;  2K9Q A;  2LRD A;  1USS A;  4MGR A;  2OJE D;  3TDU C;  5D6E A;  1IN5 A;  2DA3 A;  3OS1 A;  1HDP A;  2RAE A;  2Q2E A;  2CGP A;  3LOC A;  3HOW J;  2PG4 A;  1B1B A;  5JI6 A;  3S3O A;  3TO6 A;  1A31 A;  1QU3 A;  1WJD A;  4II3 A;  4WF2 A;  5F0F A;  2VKD A;  2R7S A;  4DYC A;  3AG2 H;  1LB2 A;  1N25 A;  1XCV A;  4J19 A;  4JBA A;  2WY8 Q;  4XQF A;  1H89 C;  1B72 B;  5IOZ A;  1A6I A;  1P2F A;  1W4M A;  2O03 A;  3GBG A;  1SFX A;  2E34 A;  3HM5 A;  1PVE A;  4EJO A;  1LNW A;  3K9T A;  5J4Y A;  3X2Q H;  2R7Z J;  4PUS A;  3V7S A;  2KT0 A;  2PX9 A;  1Y6I A;  4XKW A;  1HBX G;  3S16 J;  1QZY A;  2L02 A;  2O6G E;  3AG1 H;  5LFA A;  5M3F J;  1IV6 A;  1TNS A;  2KQR A;  1UHS A;  1D0Y A;  3BC8 A;  2BXY A;  2CRG A;  2XUB A;  3BPV A;  3ABM H;  5FKN A;  4OOI A;  2XGX A;  2P8T A;  3GO5 A;  2JPC A;  5HOO A;  4KN7 X;  4XKB A;  2XHK A;  5DEQ A;  1J0R A;  3V7R A;  4CXF A;  2IS1 A;  1XC5 A;  1I1G A;  4A93 J;  3I4N J;  5KAI C;  4Z2Y A;  3KLN A;  3IAS 2;  3T8T A;  3JAM K;  4NUB A;  2M2E A;  2GIV A;  2Q1Z B;  3E6M A;  3L2W A;  2ME6 A;  4PGG A;  5M5Y J;  2JTV A;  1MSE C;  2EQR A;  2ELK A;  2WAQ A;  5FD5 A;  3TW7 A;  1Z21 A;  3ZGK A;  2B7E A;  2VE8 A;  5DCF A;  3ZQF A;  4C2M J;  1KU2 A;  3CCV I;  4I01 A;  5ILU A;  2PMZ N;  3IH3 A;  2W7N A;  5FKO A;  1I50 J;  2COM A;  2EV0 A;  3FM5 A;  3RIR A;  2QGU A;  1QZZ A;  2NYX A;  2ZFW A;  4A6E A;  2X1E A;  3LL7 A;  2B0L A;  3GFJ A;  4HEA 2;  3GFM A;  4XLF A;  1ZGW A;  2YR2 A;  3D1N I;  3H3U A;  3DBR B;  1H88 C;  3HHG A;  2ECB A;  2QEN A;  3S2W A;  2WBM A;  5B1B H;  3F9K A;  3R6S A;  2LF7 A;  1ZAR A;  3ULQ B;  2JUG A;  1FIP A;  1ZRD A;  2QLZ A;  4CHU A;  3KE2 A;  4OIQ F;  5K5O A;  4AIJ A;  4WWC A;  3N4M A;  4PDK A;  2WA0 A;  2F4I A;  5GTI C;  3OYA A;  1VF9 A;  2EWN A;  2HFH A;  4IHW A;  3SFI A;  2LKX A;  1WJB A;  1W5T A;  3DPT A;  5E1W A;  3OOU A;  1ETQ A;  1MDM A;  5DCM B;  6PAX A;  1UG2 A;  2LDU A;  3H1C A;  3GTO J;  4WK8 F;  5DV5 A;  1X1D A;  4NQW A;  2F5C A;  1U5T A;  5F0H A;  2AQF A;  1MZB A;  1XMX A;  3BG6 A;  2L9S A;  2JZY A;  1TC3 C;  3K1N A;  1ETO A;  3LAJ A;  5DYM A;  3BR0 A;  3I64 A;  1R1T A;  1X19 A;  4CZC A;  3BRO A;  2ZBK A;  1FTT A;  3SDB A;  3FHN A;  3OYD A;  1WHU A;  2DT7 B;  3S32 A;  2CH0 A;  2F5V A;  2V9K A;  4Y17 A;  4P9U A;  3R60 A;  4XRS A;  3I3L A;  1Y39 A;  1GT0 C;  2DOE A;  3MWM A;  3ZOB A;  2DTZ A;  3AG4 H;  1R22 A;  4G8X A;  3SJM A;  4A12 A;  2Y2Z A;  4W1U A;  3HG9 A;  4DBR A;  3E5U A;  1FT9 A;  4OIO F;  1ZG1 A;  4E7K A;  2HZD A;  2VBW A;  4BXF A;  1IDZ A;  1YG2 A;  4XIC A;  2AQE A;  1QRY A;  3ABL H;  3F21 A;  1E3O C;  2CUF A;  3M8E A;  5LHG A;  2CUJ A;  3ZMV A;  2A68 F;  1IF1 A;  3W6V A;  4P55 A;  4A3D J;  1YS7 A;  3BP8 A;  2LKS A;  3CCM I;  2E5N A;  1ZHF A;  2VAS A;  1MD0 A;  1K79 A;  4Y13 A;  1ZEL A;  1K4T A;  2C6Y A;  2H8W A;  2OCE A;  5H20 A;  2R7U A;  1ACI A;  3CLO A;  2HDD A;  3FM3 A;  4XKC A;  2EFN A;  4BEH A;  4PJM A;  2XAU A;  1T33 A;  3QU3 A;  2OCC H;  3MZ8 A;  4Q47 A;  5GAD J;  5DS9 A;  4M71 A;  3QAH A;  1Z0X A;  2EZI A;  3BJO A;  4L0Y B;  2DOA A;  3S15 J;  1ON1 A;  2A6T A;  3M9A A;  5GAH J;  2DOF A;  3GTK J;  1E2X A;  3E97 A;  1BOA A;  2X6Y A;  3CP2 A;  4RA2 A;  4AC0 A;  2P7C B;  3BT9 A;  2VON A;  4PCQ A;  4GFB A;  3K4K A;  3CUQ A;  3VDX A;  3GTL J;  2FOW A;  1VQP I;  3FMQ A;  4KYW A;  3FXJ A;  4FX0 A;  3K70 D;  1XCB A;  2QUF A;  4F3Q A;  4OIP F;  2LK2 A;  1HC8 A;  4Q5S F;  2UUZ A;  4D7N A;  1PYV A;  1PP7 U;  1ETY A;  3MCZ A;  5C4J J;  2IAI A;  3WU1 B;  1GVD A;  3LSI A;  1O7L A;  1XMK A;  1R4M B;  5AIP A;  5FJ8 J;  2ZJR F;  3OSG A;  1P4X A;  4ZC3 A;  5EJC A;  2JA7 J;  4BNC A;  3A01 A;  1VQ4 I;  2HPM A;  1SMT A;  4CYC A;  2HXO A;  4JX6 A;  2DDA A;  3C2H A;  4IJA A;  5FRO A;  1XDS A;  3C2B A;  3OR1 C;  4BE2 A;  3HOU J;  2M0C A;  5K5R A;  3GLX A;  4C3J J;  4C2U A;  5KVR A;  3JRD A;  2LTP A;  1ZTR A;  3ZCO A;  3VYR B;  2HKX A;  2OF7 A;  3I4P A;  3K4B A;  1BW6 A;  3ZPL A;  2BXZ A;  3OOP A;  2NVX J;  4WXC A;  4O3M A;  2ISY A;  2V7F A;  3IC7 A;  3IWZ A;  3F8F A;  3A01 B;  3WTV C;  3LAP A;  5CVV A;  4R8H A;  1T39 A;  4XLN F;  2A61 A;  2EH3 A;  2F5F A;  3L2R A;  3K1P A;  3Q9S A;  4PJL A;  2IP2 A;  3IH4 A;  4A3G J;  1K6Y A;  4P5O A;  2A3S A;  2VJ4 A;  2BGC A;  2QCO A;  2M4G A;  4M3G A;  3OYG A;  5HLH A;  3LFK A;  5ILS A;  3OIP A;  2O5R A;  3HGY A;  2K9L A;  4Z6Y A;  1ETW A;  2WV1 A;  5F6F A;  2DMQ A;  3BG5 A;  5E8I A;  1HST A;  3COA C;  3JSO A;  4XNF A;  2LOO A;  2AXL A;  3RJP A;  1UMQ A;  5LRR A;  1O3R A;  5JVG F;  3ZXS A;  4QPQ A;  3BZC A;  5EEG A;  2FEZ A;  4L18 B;  1FMV A;  1YRN A;  3CC2 I;  4V2F A;  2XKP A;  2QBY B;  1J9I A;  1UEL B;  2JA2 A;  2VPL A;  4DBQ A;  1V5F A;  1TTY A;  5BNG A;  2K86 A;  2L5Q A;  1U0J A;  4BQO A;  1H9T A;  2WB1 N;  3KP2 A;  2P6S A;  1ZH5 A;  2K3P A;  3LSH A;  3FK6 A;  2XGC A;  3IL2 A;  3Q3S A;  4I02 A;  2JA6 J;  1U8B A;  2DFF A;  3G73 A;  1ZG3 A;  4UB6 C;  4LG0 A;  1OCT C;  3PFY A;  2KDZ A;  1RNL A;  1BR4 A;  5KNL A;  5BPD A;  3MD2 A;  4M72 A;  4XL9 A;  1CQT A;  3SEQ A;  3ZMU A;  4UV9 A;  3HDD A;  3LSG A;  1BC7 C;  3SYT A;  4RGU A;  1STZ A;  2XAS A;  3ROU A;  4ZTJ A;  1IG7 A;  2LLK A;  4AWX B;  4QPO A;  2XF6 A;  2HR3 A;  2CFO A;  3HOY J;  3BR1 A;  3S1M J;  1RET A;  1P4W A;  2CV2 A;  1FP2 A;  2P81 A;  1PUE E;  2Z2S B;  2HNH A;  4UVB A;  4B47 A;  3IHU A;  2O0Y A;  1SEU A;  3CJN A;  2PBI A;  2KHM A;  2HYF A;  1BI2 A;  2CQN A;  4BHB A;  1UAA A;  1FYL A;  4PK4 A;  1N78 A;  4PSW A;  4OIR F;  1IC8 A;  2A5Y B;  1R5G A;  4IQJ A;  4OU0 A;  4XLA A;  1YJ9 I;  3SQN A;  5K1Y A;  4YFN F;  5BOX A;  3QQA A;  2F4M B;  2R93 J;  3GLL A;  5EEH A;  1TWG J;  1JT0 A;  1XGO A;  1BBY A;  2RVC A;  5J8F A;  4X6A J;  2DA6 A;  3WG7 H;  2UXN A;  5H2F C;  3DWL E;  2L4M A;  5D8K B;  1W0T A;  3GWZ A;  2HTS A;  2EFP A;  2RV8 A;  4AIK A;  4MTD A;  4BXX J;  5DD4 A;  3QYB A;  3PQK A;  3ZQG A;  2MC3 A;  2R7T A;  1LE8 B;  4CIC A;  1WJC A;  5J6X A;  3HEF A;  3J81 K;  4HLX A;  4KT6 A;  2L3D A;  2UXX A;  4XLP F;  3HYI A;  3VSK A;  1FYK A;  2HOS A;  2CFX A;  3PIP F;  3RPU A;  2L9V A;  3ZR8 X;  3QU6 A;  4A3B J;  2FOK A;  5ICF A;  5LEK A;  3E5X A;  2PMZ A;  3WGH A;  1T38 A;  5F04 A;  1TL8 A;  2BHZ A;  1BL0 A;  5LLQ A;  1GVJ A;  1VQ5 I;  2MW8 A;  2JJ7 A;  3OV8 A;  4LLG F;  2ZJP F;  1EH7 A;  1MBH A;  3K4C A;  4GYI A;  2R5Y A;  2EA4 A;  2HVQ A;  3HKZ N;  1SAX A;  5GP9 A;  4D5F A;  1BR1 A;  4LOC A;  2VJ5 A;  3CJQ B;  5CVU A;  3K2Z A;  2WY7 Q;  3KLO A;  5ERI A;  3OS0 A;  1O3S A;  1OCO H;  3C3W A;  5CLS A;  1G3T A;  3BJA A;  4ITV A;  1R5H A;  2G0E A;  5M5X J;  3TMO A;  2HQN A;  3G1L A;  3H35 A;  2BW3 B;  2GOM A;  2ZXW H;  3HIF A;  4IRH A;  3HUG A;  1KU9 A;  3JRF A;  3IKT A;  2QKM B;  2KIS A;  5J4V A;  4DZJ A;  5EGO A;  1YO5 C;  4G9Y A;  4YFX F;  2DU9 A;  2ZJQ F;  5IT9 Z;  3TGN A;  2RNG A;  4G7O F;  2Q0O A;  1MNM C;  4GO1 A;  3ELK A;  2XB5 A;  1LE8 A;  1IO2 A;  4U0Y A;  1FBQ A;  2DA2 A;  1TQP A;  1YW8 A;  5EEA A;  2ZJ2 A;  3SZT A;  4M6V A;  3NAR A;  2FXA A;  1SFO J;  5HDK A;  1BI0 A;  1U78 A;  1GDT A;  2JWT A;  2VLA A;  2WB1 A;  1NH3 A;  1S9H A;  3O2P E;  3GZ6 A;  2FBI A;  2A6E F;  5E79 C;  4XLH A;  2LG4 A;  3CCU I;  1FEX A;  1A35 A;  4GYG A;  5D5W B;  4XRM A;  5E3O A;  2P5K A;  4CYC B;  4CSW A;  3I0T A;  4BKX A;  4JOM A;  2CUE A;  4MFD A;  3E6C C;  1SAN A;  1YOV B;  3MKY B;  1MJ9 A;  1T56 A;  4XR6 A;  4BE1 A;  2OUM A;  2L7M P;  2DMU A;  4X1E A;  1Q1V A;  4P1W A;  2MYS A;  1OIS A;  1SVM A;  2LC2 A;  3AL0 C;  4BDZ A;  2VBY A;  3GF2 A;  1YW9 A;  2IA1 A;  1ON2 A;  1LVA A;  2K9S A;  2LVS A;  3HSE A;  1JUP A;  1R36 A;  5TJJ A;  2QEX I;  3DCF A;  2BHY A;  3WOD F;  3JRH A;  2L2O A;  5JVT A;  3BQZ A;  4IO9 F;  4ENJ A;  1HKQ A;  1A36 A;  1ZR2 A;  3AG3 H;  1AKH B;  2DA5 A;  2R4G A;  3E7L A;  1BN5 A;  1FWZ A;  3FXQ A;  3H3V K;  2A5W A;  4IOC F;  3FKI J;  1ORK A;  4UUS A;  3L00 A;  4IQ4 A;  1ZRE A;  4M6Y A;  5LBQ A;  1TWA J;  3S17 J;  1T98 A;  2EBI A;  3EET A;  4UY8 I;  2ESN A;  3U1K A;  3K70 C;  1SD7 A;  3HGG A;  3GTG J;  3F23 A;  2EIL H;  1PUF B;  3H92 A;  2NVY J;  4HRI A;  3OYI A;  1WQ2 A;  3ZQQ A;  4CCL A;  4HF1 A;  1V54 H;  4BEH B;  1XTA A;  2VL8 A;  2R5Z A;  3ZQ7 A;  2X51 A;  1RI7 A;  3OR2 C;  4IVN A;  2VIX A;  1BJZ A;  2CV0 A;  1X2M A;  4FET A;  5HVQ C;  4BH9 A;  3JRA A;  1X3Z B;  2ZSH B;  2HVS A;  2H09 A;  4HST A;  4EJV A;  1EH8 A;  1I3A A;  4CCK A;  5JR3 A;  2ELJ A;  2HPI A;  4LG3 A;  2QYO A;  5CPR B;  2YX4 A;  1HOM A;  1K78 A;  3S3M A;  4KIT B;  2DYR H;  5C44 J;  3Q0U A;  3C2G A;  1WH7 A;  1P6R A;  3P9C A;  1PDN C;  1ZRC A;  3F6V A;  2K4J A;  3DF8 A;  5EZG A;  3J7Y J;  1CF7 B;  2YX7 A;  2O8K A;  4NHJ A;  2IPQ X;  4I7H A;  2QVO A;  4PSX A;  2DPU A;  4RB0 A;  1EH6 A;  3CCQ I;  4BQQ A;  1RUO A;  3MFK A;  4NC8 A;  2YPR A;  1XPX A;  2FNA A;  5IP9 J;  2CS3 A;  2P7V B;  2E2J J;  2HTJ A;  3CMM A;  4CCN A;  2RN7 A;  3DBH B;  3C1D A;  4A2U A;  2ESH A;  1FNN A;  4EM1 A;  5FB2 A;  1ZKG A;  5DUK A;  1MBF A;  3E5Q A;  4QSH A;  2XAJ A;  4GXO A;  2L9N A;  3W2W A;  1DUX C;  1DU0 A;  3H9J A;  1JKQ C;  4RB2 C;  1R00 A;  1RR8 C;  2K9M A;  1Z7L A;  3ASO H;  4A5N A;  2NS7 A;  2EB7 A;  3PL8 A;  3W6J B;  4II2 A;  5ED4 A;  1JTX A;  4DYQ A;  3WHC A;  2L0K A;  1MH3 A;  3V8J A;  4XBF A;  3IRR A;  3PFI A;  3I59 A;  1WWX A;  1Z67 A;  3SFZ A;  2I5U A;  2PEX A;  2ZKZ A;  3KZY A;  5E3M A;  2FMY A;  1FPQ A;  3HUG B;  4ENM A;  2RDP A;  3CUQ B;  3KYC B;  1S5L C;  3DEW A;  3DFG A;  3UKG A;  2IRF G;  3ECH A;  3AKZ A;  1NTC A;  4HQE A;  4A0Y A;  3VWB A;  4E7J A;  2DQR A;  2PFB A;  4ZYE A;  1G6N A;  1R23 A;  3CC4 I;  1ZAO A;  5LGU A;  2Z3Y A;  2VQL A;  3BLY A;  3UNG C;  4ZYH A;  3S1R J;  5IY5 H;  4N4N B;  1MW7 A;  1ERD A;  3IWF A;  4IRI A;  4IHY A;  4WX9 A;  1LDK B;  4P9F A;  5IYD J;  2TDX A;  4EM2 A;  3HOX J;  2OC6 A;  2R5Y B;  4BL0 B;  1R71 A;  3ZMS A;  4FCY A;  3WTU C;  1X58 A;  2X4H A;  4DZP A;  2PLY A;  5B66 C;  3ABT A;  1Z05 A;  3NWS A;  3LST A;  4A3M J;  1TNT A;  3FXR A;  3PO2 J;  3IH2 A;  1X3U A;  5M5W J;  1G3S A;  1IGN A;  5AIQ A;  4RGR A;  4MFE A;  3PJR A;  2IXS A;  3T5X A;  4EEF G;  1R49 A;  1JKR C;  2NXN B;  3CP8 A;  3H36 A;  2XPU A;  3FXO A;  3U21 A;  4PFO A;  3TKY A;  3A1Y A;  3C18 A;  1ZLJ A;  5HLI A;  2HWV A;  1IAW A;  4HAM A;  2V4J C;  4HYE A;  3GFL A;  1YJW I;  3GCM A;  2ISZ A;  2GOX B;  2VN2 A;  3GXO A;  5GAE J;  2KLO A;  1RZ4 A;  2GZW A;  5EF6 A;  4XRF A;  5EYR A;  4M3F A;  2M7B A;  5CVR A;  2V1D A;  2RGV A;  4ON0 A;  3TP0 A;  4DQ2 A;  1APL C;  3JRB A;  1JJ8 C;  1GUU A;  2OD5 A;  1W7P A;  2JA8 J;  1QQI A;  2V26 A;  2BEO A;  2XSJ C;  1JHH A;  2EZH A;  2ETH A;  2FQ3 A;  3OMY A;  4ZH4 F;  2DTR A;  2IJL A;  5FKK A;  4YG2 F;  3F22 A;  2LY9 A;  2FQ4 A;  1VQ9 I;  4HV6 A;  3E6B A;  4L5J A;  2JA5 J;  2LRE A;  4WXD A;  1W7P B;  4JYK A;  1KQ0 A;  4ASN A;  1FX7 A;  1Y8Q B;  1ODD A;  4LIV A;  4UB8 C;  2P0W A;  1ENH A;  3M4O J;  1ZK8 A;  2R3S A;  3KEO A;  2X6W A;  2COB A;  3GW2 A;  1U5T B;  1L3L A;  2WC2 A;  2QQB A;  3I55 I;  1OYW A;  1HCR A;  2YUS A;  1VND A;  1QVT A;  3WGG A;  1FBU A;  4MO7 A;  3TP3 A;  4EVI A;  5F1J A;  2V9P A;  3K7A J;  1D5Y A;  5D6F A;  3VOE A;  1Y0U A;  3ONQ A;  5DUI A;  2ZXJ A;  5DM6 F;  1Z9C A;  5JHF A;  5H6Q A;  3CUO A;  4FE7 A;  4BBS J;  5FLX Z;  4EMS A;  2DCE A;  5E8G A;  2DK8 A;  1YHQ I;  4D7M A;  4HLY A;  2G7U A;  4L5I A;  1BIA A;  1WI3 A;  4L5E A;  4P96 A;  3MZY A;  4BE0 A;  2FSW A;  2GXG A;  3VYT B;  3F8C A;  1VQM I;  2GA2 A;  1OKR A;  2QWW A;  2RKH A;  4DIQ A;  3CDL A;  2F2E A;  1KYW A;  3M1C A;  1X4P A;  4OMZ A;  4KIG A;  1T08 B;  3H3Z A;  3HRT A;  3KP4 A;  4MIM A;  5HS7 A;  5TRD A;  1ZGA A;  4I99 C;  5JHU A;  4V2G A;  2BYV E;  3DTE A;  4CDG A;  1DPU A;  1K4S A;  2W00 A;  1BA5 A;  1RPW A;  1TWC J;  2AO9 A;  2IGM A;  3G1O A;  3HKZ A;  4XLE A;  4S05 A;  1YI2 I;  2OZU A;  1U6G A;  2O7O A;  3CUQ C;  3TED A;  1VQ6 I;  3M7G A;  4HZF A;  1LEA A;  1WCM J;  3ZQH A;  3HSF A;  3CCS I;  5GPA A;  4KNY A;  1ZLK A;  4LB5 A;  3VPR A;  5LGN A;  2HQA A;  3WTZ A;  1YIT I;  2XV4 S;  3VFZ A;  3J81 Z;  2DOD A;  3K4J A;  2K27 A;  4BUP A;  2KJB A;  3KEQ A;  1GV5 A;  5L3C A;  3I59 B;  2A6H F;  2XKO A;  2V6C A;  2ZSI B;  5EDN A;  2CQ7 A;  3Q0V A;  5E3N A;  1TLH B;  3FMS A;  2GAU A;  3REO A;  4S0H B;  1SFK A;  3ZQI A;  1YLF A;  1I1S A;  3FBN B;  1OCC H;  5LHH A;  3CCL I;  3B6A A;  3RSN A;  3M8F A;  4FAS D;  3MQ0 A;  1HDD C;  2PQ8 A;  2NOJ B;  2F4O B;  3BG7 A;  3H0G J;  3SHF A;  4B09 A;  1XSX A;  2XRL A;  1F1Z A;  3JTH A;  2FX0 A;  4CCO A;  3D5S C;  1LPQ A;  3CMY A;  1KON A;  2W57 A;  3GTJ J;  5IPA A;  4A3L J;  1SFU A;  3F6O A;  3R0A A;  3DP7 A;  1QO0 D;  1IRX A;  3C7J A;  3G71 I;  3I71 A;  4CCM A;  3GTP J;  2BZT A;  2DMP A;  2EPF A;  2Q2E B;  3QOD A;  3RYP A;  5F64 A;  4HW0 A;  4QTR A;  1LEB A;  3F8B A;  1IUF A;  1PJR A;  3LQQ A;  3ZQC A;  3K4N A;  4IOA F;  4WXH A;  2EZL A;  2W24 A;  3K6G A;  2DI3 A;  3DBL B;  4MQV A;  1RES A;  5ICG A;  1T8I A;  1K78 B;  3BZK A;  1E3P A;  3IP4 B;  2JRT A;  4ZJZ A;  1SMY F;  3E6D A;  1K7A A;  2R0Q C;  1IUY A;  3KZI C;  1YIO A;  3K2A A;  1SAU A;  1Y0N A;  2LP0 A;  3HXL A;  4UVC A;  1WJA A;  2WAF A;  4B8X A;  2D2W A;  4W97 A;  4OIN F;  2MC4 A;  1R5I D;  3ZMT A;  3RQ4 A;  1BIB A;  3KZZ A;  4BXU A;  1DPR A;  5BMZ A;  5GTH C;  1JKP C;  2Z99 A;  2LKP A;  1RRJ A;  4FQG A;  4EQQ A;  4ZDL A;  4C2T A;  3KPH A;  4DNC A;  4E7H A;  2V1U A;  5L3G A;  1IN8 A;  1WJ5 A;  2QSH X;  1SVL A;  1FSE A;  3G4S I;  3ZRG A;  3HJE A;  1S29 A;  4LGW A;  2J5O A;  1RKT A;  2M8E A;  4DW6 A;  4EM0 B;  2D1H A;  4M9Z A;  4ESB A;  2XC7 A;  1NG7 A;  4YEL A;  1VFC A;  5FKL A;  2ZFU A;  5ICE A;  2CW0 F;  5HLG A;  5IT9 K;  4EJU A;  3J80 Z;  2NNY A;  2D45 A;  2E1C A;  3I9V 2;  4B44 A;  5BPI A;  4S04 A;  1ZQ3 P;  2JRM A;  3SDG A;  2DDB A;  2DA1 A;  4KFC A;  1B9M A;  2DFI A;  1Z6T A;  2IW5 A;  4XN3 A;  4RDU A;  1MMA A;  3KCC A;  1ZYR F;  2M30 A;  4MHG A;  4UUV A;  5D4R A;  2LF8 A;  3KX2 A;  3QPS A;  3MKL A;  3KP7 A;  2DJI A;  1TT0 A;  2EFQ A;  2QQ9 A;  2NS8 A;  3FXU A;  3BPX A;  4HX8 A;  1U9N A;  2DBB A;  3BWG A;  1POG A;  2CQQ A;  3BCB A;  4IRG A;  3JRC A;  1XSD A;  4ZYG A;  2K5C A;  4CGZ A;  1PP8 F;  2LY1 A;  3MAJ A;  4GGG A;  1FOX A;  2JSC A;  3LSM A;  2XAQ A;  2TRT A;  2NVT J;  3A02 A;  1TQI A;  1BW5 A;  3GEZ A;  4KIF A;  4AVP A;  4GRI A;  1RIO H;  1N75 A;  1YX5 A;  4BY7 J;  1IRZ A;  1DU6 A;  2VJI A;  3RKY A;  1Z1D A;  1LUJ B;  2YU3 A;  1A6Q A;  1B8I B;  4BAY A;  1FOW A;  1TWF J;  5KAF C;  3CO6 C;  2DAO A;  2K3F A;  4N0B A;  2DQL A;  3Q5F A;  3WU0 A;  2LYC A;  3E0J B;  1YQA A;  2EK5 A;  2M45 A;  2W48 A;  3UR3 C;  1DP3 A;  2L54 A;  5C3E J;  2BVM A;  3ZN0 A;  4BGD A;  4CO8 A;  2WWY A;  1MDM B;  4GDF A;  2EIM H;  4HX4 A;  3EUA A;  1UFM A;  2D5V A;  4Q48 A;  2VPR A;  2OTL I;  5E1Z B;  1JUS A;  3GZ5 A;  2XPW A;  4XKV A;  3HPG A;  4C30 A;  2A07 F;  5IP6 A;  4A69 C;  4RAY A;  1P7J A;  2XRO A;  4A6D A;  2Z16 A;  5HDN A;  5E17 F;  2ZME C;  2OQR A;  4JK1 X;  5B5E C;  2E60 A;  4C9Y A;  1G3Y A;  2ADU A;  1E0E A;  1YW7 A;  3QPH A;  3LA3 A;  4NC6 A;  4L9J A;  2DMN A;  2H1L A;  5IYC J;  3FXL A;  1IXC A;  1Z91 A;  3B6C A;  3A03 A;  4HQM A;  3U9G A;  1OR7 C;  4Y33 A;  1V55 H;  1R6R A;  3LA2 A;  1JHF A;  2ZB9 A;  3BQY A;  2M7A A;  1SVO A;  3GX4 X;  3ZP5 A;  1W0U A;  3RPQ A;  2KRC A;  3PNV A;  1W1W E;  3VYU B;  1BI1 A;  1D5V A;  5E1X A;  4BDY A;  5GPC A;  2R7D A;  2H6B A;  1YRN B;  3DKY A;  5DD8 A;  3D5L A;  2CV1 A;  3NRV A;  3DPL C;  4BS9 A;  1XD7 A;  2RQQ A;  1JGS A;  2STT A;  1D0Z A;  2L7K A;  1DQU A;  4UHT A;  3WGI A;  2E1M B;  4XMY A;  5D5U B;  3RZD J;  1R9T J;  1BC8 C;  1LFP A;  2E2H J;  2XVC A;  5L3E A;  1HSJ A;  1UST A;  4G6T B;  4JX5 A;  5B3S H;  4KIC A;  1T6S A;  4EJW A;  4U7D A;  4ZTF A;  3NWT A;  4RB1 A;  3U1D A;  1R58 A;  4E7Z A;  3M07 A;  3HRU A;  1O57 A;  3F0C A;  4XN0 A;  1UG0 A;  4NBQ A;  4A3C J;  3K69 A;  2EJR A;  2LR8 A;  3HB9 A;  1XGN A;  3JSP A;  1QA6 A;  1TT5 B;  1FBS A;  2L9R A;  5CKT A;  4M3E A;  3H9Q A;  1P92 A;  4F91 B;  3S2D J;  3Q0W A;  4WCG A;  2L7Z A;  5F08 A;  1UB9 A;  4ZZD A;  2IS2 A;  3OYM A;  4RBO A;  2VQG A;  1Q1H A;  3QRF F;  4GCV A;  3QOE A;  2AHQ A;  5J1R A;  2CJJ A;  3BDD A;  4LLL A;  4KT5 C;  2ACJ A;  1OCP A;  4ESF A;  5K7Z A;  4LJZ F;  1DP7 P;  3L2V A;  1QZE A;  4HX7 A;  3RCO A;  5M3M J;  1B8I A;  1Y1W J;  2E7X A;  4ABZ A;  3QWL A;  3CTA A;  3OWT A;  1S8N A;  2FBK A;  1BI3 A;  1TP4 A;  3CCY A;  3FKJ A;  4U88 A;  2PJP A;  2FBH A;  4A3I J;  2VKE A;  1YE9 A;  2STW A;  2FE3 A;  3CO7 C;  4EGY A;  4ENK A;  1A5J A;  1HKT A;  4D5C A;  3DU6 A;  2OPT A;  2YS9 A;  3IRQ A;  2CMP A;  1S7A A;  3ML6 A;  4OWR B;  3I53 A;  2VC1 A;  2DFE A;  3TDZ C;  2XF7 A;  1K83 J;  3PSF A;  4Y3O A;  3SXY A;  1MJB A;  3NQO A;  4LG0 B;  5D5X B;  2Y9Y A;  3JW4 A;  1FIA A;  2E5Z A;  1UJ8 A;  4LK0 F;  3H5R A;  1JE8 A;  3BG9 A;  5FKM A;  1RUN A;  4ZYA A;  4BYY A;  4B1R A;  2BOL A;  2UV1 A;  4AID A;  4UNO A;  1KU7 A;  4XRS G;  3ASN H;  2IS4 A;  4PJ0 C;  1B4A A;  2LH9 A;  4IEJ A;  2EFW A;  2B9S A;  2F5E A;  1JJ6 C;  2JMW A;  1XMA A;  4HBL A;  2KMU A;  2A05 A;  2FJ1 A;  5JLX A;  2YU9 J;  3NEU A;  4D1Q A;  1J2X A;  1YS6 A;  3E1S A;  3R0J A;  1ZRF A;  2BVL A;  4G7Z F;  4M9S A;  1YIJ I;  1BM9 A;  4HOB A;  4IL6 C;  2OBP A;  3PSI A;  2IT0 A;  3GZN B;  5A2Q Z;  4A3F J;  3LWF A;  1FP1 D;  3HL2 A;  5TGT A;  1FSH A;  4YFK F;  1V3F A;  3H5N A;  1GV2 A;  1XX5 A;  3A0B C;  3AAF A;  2IBD A;  4KIB A;  2ZXH A;  3N05 A;  1XSV A;  1MBG A;  2D1V A;  1NK2 P;  3L2Q A;  3MZH A;  5K5Q A;  5IT3 A;  1UHW A;  3DQV C;  4M74 A;  2N8G A;  3PNY A;  2KIU A;  1OJL A;  2X6X A;  3HRS A;  4XLC A;  3VOD A;  5B1A H;  1JGG A;  2HOE A;  1GXQ A;  1WI9 A;  2MD5 A;  5BS6 A;  1KA8 A;  2O61 A;  1F9N A;  4LFU A;  5DDG A;  4J00 A;  3V8L A;  4C3H J;  1J75 A;  2H8R A;  2G9W A;  4UXN A;  3RYR A;  1K61 A;  3OSF A;  2UWM A;  3J7A O;  2Y0S A;  3BJ6 A;  2ZME A;  1HQC A;  1GLN A;  1ETK A;  3NAU A;  4BBR J;  2BE5 F;  1MNE A;  3FBI B;  2GXB A;  4HDV A;  4H4K C;  2Y75 A;  1FLI A;  3I56 I;  4JQF A;  3CME I;  1LDD A;  3K1M A;  3ABK H;  5F27 A;  1H9G A;  4L9V A;  1UZC A;  4HPQ A;  2DYS H;  2TCT A;  3P7N A;  3FF5 A;  2DFH A;  2OQG A;  1DDN A;  3ZN1 A;  3FZV A;  1V4R A;  3K4M A;  3RDI A;  1LKX A;  3FK7 A;  2LBF A;  3TOA A;  2CQK A;  5AON A;  3HTS B;  4IZZ A;  2F6C A;  2UZK A;  1BR2 A;  4U7B A;  3A2K A;  3QYE A;  2K02 A;  1OYI A;  4XOP A;  1U3E M;  1FY7 A;  1NG6 A;  2L7F P;  1D1A A;  1WKM A;  2VT2 A;  3T8R A;  3WTY C;  2NS0 A;  3K10 A;  4XM3 A;  3M3Y J;  2EIJ H;  1MMD A;  2KZV A;  2BY3 A;  2FNP A;  2XIG A;  3JTG A;  4M3B A;  2HQ5 A;  2IGO A;  1AA7 A;  2NVU B;  2Z5U A;  2PJR A;  2Y31 A;  1YYV A;  5D5V B;  2XAF A;  2EV5 A;  4B48 A;  4BHP A;  3J7A Y;  1SD5 A;  2MAB A;  4LMY A;  5HNF A;  1JXS A;  4HNT A;  1QVU A;  3HPH A;  4ZYD A;  1KYZ A;  1LJ9 A;  4H0E A;  1HW1 A;  1OYY A;  2LMD A;  2VC0 A;  3OYH A;  2CUZ A;  1G2H A;  1TW3 A;  1W7P D;  4L9N A;  4KIS A;  2MLK A;  1BOB A;  2ZC2 A;  2LNB A;  2H94 A;  1O4X A;  2HOA A;  4CH7 A;  4L0Z B;  1KU3 A;  4E4H A;  4DGW B;  4HSR A;  4B3X A;  4BAC A;  5CQE A;  4A3E J;  1R4N B;  4DYR A;  1D8J A;  4I6Z A;  5LD2 C;  4XON A;  2H27 A;  1P4A A;  1IRG A;  4UUS B;  1D3Y A;  3B02 A;  5HOD A;  2XSD C;  3RZO J;  2DT5 A;  3FWE A;  5J3L A;  4B4C A;  4BQN A;  4AVZ A;  4PFP A;  3TO7 A;  3ABU A;  2M4K A;  4G6Q A;  2HEO A;  2M1B A;  4RAZ A;  1YFH A;  4EV0 A;  3EYY A;  1I6X A;  2KKO A;  3KYL A;  4MQ9 F;  1MKM A;  2Y0M A;  4M3D A;  5FO5 A;  4FX4 A;  4OMY A;  2LD5 A;  1P7I A;  3DLL F;  1QHH D;  3OL4 A;  4G94 A;  2M0M A;  1IZ1 A;  1TZL A;  3S8P A;  3OYN A;  2GIZ A;  2E7W A;  2FD5 A;  2X6O A;  1WJF A;  2E1N A;  4I0A A;  2KRH A;  2R7X A;  2XGD A;  4KMU X;  1Z7U A;  2XGE A;  4MEX F;  1OQY A;  2KIM A;  3DPU A;  1FC3 A;  3P9I A;  5LRS A;  3OYF A;  3WE3 A;  1MH4 A;  3LQR A;  3VYS B;  4AUX A;  3L2C A;  3CCJ I;  1VZ0 A;  2ELH A;  3WHB A;  4E7S A;  3A4C A;  1J5Y A;  2I10 A;  3S3N A;  3MKW B;  4IF4 A;  2E1M C;  2ICW G;  3BTC A;  1WSU A;  3CQZ J;  4RS8 A;  2E2I J;  4OAZ A;  2EZK A;  2OZ6 A;  3RQI A;  1NHA A;  1UHM A;  2JT1 A;  3BR5 A;  2KPM A;  1VI0 A;  5FFZ A;  1IRF A;  2M3A A; 
#chains in the Genus database with same CATH homology
 2WAD A;  4NQW B;  4B43 A;  3K6G A;  3QYB A;  5KHD A;  3IP4 B;  2QKL B;  3OS2 A;  4ZJZ A;  2R7T A;  4F92 B;  1WJC A;  4DJA A;  4KT6 A;  3OL3 A;  1SAU A;  1Z3X A;  3VSK A;  3IAM 2;  1Y56 A;  3HXL A;  2R7W A;  4ZDO A;  2R7Q A;  1WJA A;  2WAF A;  4BJ6 C;  2JVG A;  3ZR8 X;  2MC4 A;  4U87 A;  3D5R C;  2BW3 A;  3EUK L;  3RQ4 A;  2VKH A;  3OIQ A;  1FMW A;  2PMZ A;  4XOT A;  2KDO A;  4N4O B;  3IUO A;  3RPU D;  4F93 B;  3OYJ A;  2VJJ A;  1OLT A;  4ZDL A;  1WJE A;  3QYF A;  4C2T A;  4E7H A;  1WJ5 A;  3H5A A;  3K4C A;  3ZRG A;  3RTR A;  2HVQ A;  3H0D A;  3W2A A;  2XDV A;  3VSL A;  3G2B A;  1BR1 A;  4D9J A;  2VJ5 A;  3CJQ B;  1D1C A;  2WY7 Q;  4RLQ A;  1NG7 A;  4YEL A;  3OS0 A;  2XC7 A;  2ZFU A;  2PJR B;  3CJR B;  1X1C A;  2ZXI A;  3DTK A;  4ITV A;  2CW7 A;  2HVR A;  3I9V 2;  4B44 A;  3OYK A;  1MMG A;  4BJT A;  3TMO A;  3CF2 A;  4RMN A;  2IS6 A;  3H35 A;  2BW3 B;  3OYE A;  4XN3 A;  3HOT A;  2GOM A;  1MMA A;  2IGK A;  3KX2 A;  2QKM B;  4CUG A;  2DJI A;  1TT0 A;  5KCM A;  3TL4 X;  1T95 A;  2RNG A;  4YEJ A;  3OYL A;  2MD0 A;  4RM3 A;  3BCB A;  3DU5 A;  2LRD A;  2W4S A;  2K5C A;  2LY1 A;  3LSM A;  3OS1 A;  1P9Q C;  4GRI A;  1N75 A;  2Z1D A;  1YX5 A;  3FDY A;  2VLA A;  3EPZ A;  1MND A;  2VJI A;  2WB1 A;  2W82 A;  3SEZ A;  1S9H A;  3S3O A;  4F55 A;  1QU3 A;  1WJD A;  4XLH A;  2LG4 A;  4II3 A;  3K4L A;  2VKD A;  2R7S A;  2WY8 Q;  4XQF A;  4YRV A;  2X1C A;  2LYC A;  3E0J B;  4CSW A;  3UR3 C;  3GBG A;  4JOM A;  1DP3 A;  1WFX A;  2BVM A;  4PUS A;  3MKY B;  4XR6 A;  4BGD A;  4BE1 A;  4HG2 A;  2OUM A;  1Y6I A;  4XKW A;  3EUA A;  4P1W A;  2HDW A;  3AL0 B;  2MYS A;  4LIU A;  3M8J A;  2LC2 A;  3AL0 C;  5LFA A;  4ZDP A;  4BDZ A;  4XKV A;  3HPG A;  2KQR A;  4C30 A;  1D0Y A;  3BC8 A;  2Z16 A;  2L2O A;  3CES A;  2MFZ A;  5HOO A;  2E60 A;  4XKB A;  4C9Y A;  2IS1 A;  1E0E A;  2R4G A;  3IAS 2;  2A5W A;  3BCA A;  4NUB A;  3OYC A;  2Q1Z B;  3L2W A;  1OR7 C;  4IQ4 A;  4Y33 A;  1R6R A;  2DT6 A;  2WAQ A;  2M7A A;  1Z21 A;  3ZGK A;  1QHG A;  3K70 C;  2KRC A;  3DLA A;  3PNV A;  3VYU B;  2DXI A;  2W7N A;  4BDY A;  4MLO A;  3TBI A;  2CW8 A;  3DKY A;  4DOZ A;  4HRI A;  3OYI A;  5FRM A;  3D5L A;  2CV1 A;  3ZQQ A;  4CCL A;  3DPL C;  4AU7 A;  3HC7 A;  4BEH B;  4BS9 A;  2X1E A;  3LL7 A;  2VL8 A;  2RQQ A;  4ANJ A;  2X51 A;  4HEA 2;  1D0Z A;  2L7K A;  3OR2 C;  1DQU A;  4XLF A;  2VIX A;  2CV0 A;  4FET A;  4RLF A;  2E1M B;  5HVQ C;  4XMY A;  3AFH A;  2ZSH B;  3PNT A;  2WBM A;  4HST A;  1LFP A;  3F9K A;  2X1D A;  4G6T B;  2JUG A;  4CCK A;  2ELJ A;  2HPI A;  4LG3 A;  5CPR B;  4ZTF A;  3NWT A;  1X1B A;  3S3M A;  2WA0 A;  2F4I A;  4E7Z A;  4KIT B;  3OYA A;  4XN0 A;  1UG0 A;  3C2G A;  1WJB A;  4BJ5 C;  2VB6 A;  3DPT A;  3OOU A;  4EAT A;  5CKT A;  3LMM A;  1X1D A;  3H9Q A;  4E6K G;  4F91 B;  4PSX A;  2AQF A;  3DKX A;  3BG6 A;  2L9S A;  3S93 A;  4BQQ A;  2IS2 A;  4NC8 A;  3OYM A;  2VQG A;  2CS3 A;  1X19 A;  3QOE A;  3W2V A;  4CZC A;  3SDB A;  3FHN A;  3L2V A;  3OYD A;  3CMM A;  4CCN A;  2DT7 B;  3S32 A;  2CH0 A;  2F5V A;  1D1B A;  2V9K A;  3RCO A;  3DEE A;  2HU9 A;  3I3L A;  2L9N A;  3OWT A;  3W2W A;  3H9J A;  3HG9 A;  3FKJ A;  4DBR A;  2K9M A;  1Z7L A;  3W3C A;  1YE9 A;  4E7K A;  2HZD A;  4BXF A;  3DU6 A;  3PL8 A;  4PJJ A;  1X1A A;  2CMP A;  4II2 A;  2AQE A;  4OWR B;  3LSK A;  1W36 D;  1V5E A;  5FRN A;  2CUJ A;  2XF7 A;  4Y3O A;  3PSF A;  4AYB A;  3V42 A;  3HUG B;  3KEY A;  2E5N A;  1DGR M;  2E5Z A;  1JI8 A;  2VAS A;  3H5R A;  1ZEL A;  3AKZ A;  4ZYA A;  4IKF A;  2BOL A;  2UV1 A;  2R7U A;  3DTI A;  3VWB A;  4E7J A;  4XKC A;  2IS4 A;  2KL4 A;  2LH9 A;  4BEH A;  2VQL A;  3BLY A;  1DGW Y;  3UNG C;  2KMU A;  4PJM A;  4N4N B;  1MW7 A;  1ERD A;  2XAU A;  4BU2 A;  1LDK B;  4D1Q A;  1LVK A;  2VQH A;  2R7V A;  3E1S A;  2OC6 A;  4Y4R A;  4BL0 B;  4R79 A;  1D0X A;  2I8D A;  2BVL A;  2DOA A;  1YX3 A;  2A6T A;  1EA3 A;  2V6E A;  2X6Y A;  3CP2 A;  3PSI A;  3NWS A;  3K4K A;  4RM2 A;  3VDX A;  5TGT A;  3HL2 A;  3K70 D;  3H5N A;  4F3Q A;  3PJR A;  2IXS A;  2ZXH A;  2UUZ A;  3CP8 A;  1PYV A;  3N05 A;  3U21 A;  4PFO A;  3SZG A;  3A1Y A;  3L2Q A;  2V4J C;  4IX7 A;  3LSI A;  2GOX B;  2KLO A;  4ZC3 A;  3DQV C;  3PNY A;  2M7B A;  2X6X A;  4NNJ A;  5HNH A;  2HPM A;  4XLC A;  3C2H A;  5FRO A;  3CZ6 A;  3OR1 C;  4J00 A;  4BE2 A;  4E7L A;  4C2U A;  3HOS A;  2IGN A;  2V26 A;  2UWM A;  2Y0S A;  3ZCO A;  3VYR B;  1GLN A;  2XSJ C;  3OMY A;  2HVS A;  1MNE A;  3K4B A;  2VXZ A;  3FBI B;  4H4K C;  4OAY A;  2LRE A;  2V7F A;  4JQF A;  1J09 A;  2LY2 A;  4LIV A;  2P0W A;  3MMY B;  2KP6 A;  2RRE A;  4HPQ A;  2X6W A;  3L2R A;  4PJL A;  1HA8 A;  1K6Y A;  3K4M A;  4P5O A;  1LKX A;  2VJ4 A;  2LBF A;  2M4G A;  2X85 A;  4IZZ A;  3OYG A;  2F6C A;  1BR2 A;  4U7B A;  1X4O A;  3ONQ A;  3A2K A;  3QYE A;  2W1O A;  3OIP A;  2O5R A;  5JHF A;  4XOP A;  2K9L A;  2DCE A;  1NG6 A;  4X0G A;  3LFU A;  1D1A A;  1V5G A;  1N77 A;  3MKZ A;  3K10 A;  4XNF A;  2LOO A;  3OYB A;  4XM3 A;  1MMD A;  2KZV A;  3H9G A;  4J01 A;  2JSP A;  4BE0 A;  3VYT B;  3ZXS A;  4CA0 A;  4QPQ A;  4DIQ A;  3M1C A;  1X4P A;  2IGO A;  1FMV A;  1AA7 A;  2PJR A;  1UEL B;  2JA2 A;  2VPL A;  3L2U A;  4B48 A;  1V5F A;  4DBQ A;  1G59 A;  2XF5 A;  3J7A Y;  3DTE A;  4HNU A;  2MAB A;  2L5Q A;  5HNF A;  2W00 A;  1MMN A;  3HPH A;  4NC7 A;  4HNT A;  4LIT A;  2IGM A;  1U0J A;  4XLE A;  4BQO A;  4F52 A;  3HKZ A;  3OYH A;  5HLT A;  2CUZ A;  2K3P A;  1W36 C;  3LSH A;  4KIS A;  1BOB A;  4CH7 A;  4E4H A;  4DGW B;  4HSR A;  4B3X A;  4PJN A;  4BAC A;  5CQE A;  3OY9 A;  2M3A A;  5LD2 C;  3PFY A;  1Z3Y A;  4XON A;  2VQC A;  1BR4 A;  5KNL A;  4XOR A;  2HQA A;  3EUH C;  3MD2 A;  4XL9 A;  3PUB A;  3SEQ A;  3K4J A;  4BQN A;  4AVZ A;  4BUP A;  4PFP A;  2WAE A;  3LSG A;  2M4K A;  3SYT A;  2ZSI B;  3KYL A;  4E7I A;  4ZTJ A;  1G8X A;  4QPO A;  2XF6 A;  1QHH D;  3OL4 A;  2LBF B;  2CFO A;  1SFK A;  2M0M A;  1TZL A;  1T0F C;  2FUG 2;  2R7O A;  3FBN B;  2OV7 A;  3S8P A;  3OYN A;  2CV2 A;  2Z2S B;  2HNH A;  3RSN A;  4FAS D;  4B47 A;  1WJF A;  2NOJ B;  3BG7 A;  2KHM A;  2KRH A;  2R7X A;  2R7R A;  1UAA A;  4KJZ A;  4CCO A;  4PK4 A;  3DPU A;  3D5S C;  1N78 A;  4PSW A;  1KON A;  4CCJ A;  3OYF A;  3VYS B;  4IQJ A;  1VZ0 A;  4XLA A;  2JVH A;  4E7S A;  3A4C A;  3S3N A;  1IRX A;  2V1N A;  2E1M C;  5CQG A;  3MKW B;  4CCM A;  4OAZ A;  2VXD A;  3DWL E;  2Q2E B;  3QOD A;  2KPM A;  1PJR A;  3K4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...