3FBUA

The crystal structure of the acetyltransferase (gnat family) from bacillus anthracis
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
168
structure length
166
Chain Sequence
MFIKAERLLIRKFEFKDWEAVHEYTSDSDVMKYIPEGVFTEEDTRNFVNKNMGAKNFPVILIGENILVGHIVFHKYFGEHTYEIGWVFNPKYFNKGYASEAAQATLKYGFKEMKLHRIIATCQPENTPSYRVMEKIGMRREGYFKKCIPHGNEWWDEYYYAILEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title The crystal structure of the acetyltransferase (GNAT family) from Bacillus anthracis
rcsb
source organism Bacillus anthracis str. sterne
molecule tags Transferase
total genus 43
structure length 166
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fbuA00
4QB9A 4CAVA 2FT0A 3RYOA 2WPXA 3D2PA 1KUXA 5F47A 3B8GA 3FBUA 4QBJA 4IF5A 3F5BA 1IB1E 4IUSA 4NF1A 4B5PA 1IYLA 4UBRA 4MY0A 2Q4VA 1P0HA 3BJ7A 4PK3A 1NMTA 4KOVA 2P6EA 1TIQA 3PZJA 3FRMA 1CM0A 1IYKA 3DNSA 5IV0A 1Z4RA 3BLNA 4AVCA 4GS4A 1M4DA 1P4NA 2B5GB 4FD5A 5FVJA 3FIXA 1M4IA 4KUBA 3KKWA 5H86A 4F0YA 3FB3A 4KOTA 2FIAA 2ZW7A 3G3SA 1WWZA 4B5OA 1QSMA 4KZTA 1WK4A 3R1KA 1YREA 4Y49C 3WR7A 2B4BA 1L0CA 2G0BA 2ZPAA 3P2FA 2A4NA 2J8RA 2CY2A 1MJBA 1YLEA 2VI7A 1YVKA 1N71A 3JVNA 3W6XA 4DNCA 3QAHA 4E8OA 2PR1A 4FD4A 2I79A 5I0CA 5KTDA 4ORFA 3F8KA 1XMTA 1Y9WA 2AE6A 2QIRA 2VXKA 3SXNA 2PSWA 5C82A 1IIDA 1V0CA 3DDDA 4E0AA 4CS0B 3PGPA 3T9YA 2F5IA 2P6FA 3SXOA 1U6MA 1M1DA 2HQYA 2D4OA 3I9SA 3IGRA 4XNHB 2KCWA 4JD6A 3QB8A 2PR8A 5F49A 1I1DA 4OADA 4H6UA 1LRZA 1VKCA 3TFYA 2R7HA 2P0WA 4XPKA 5E96A 2Q4YA 1QSRA 3N7ZA 1K4JA 2R98A 1M44A 4U9YA 1Q2CA 4OAEA 3TO7A 2GANA 3S6KA 5F48A 4MBUA 4JXQA 4II9A 1XIXA 4CRYB 2GE3A 2DXQA 3VWDA 1B6BA 4R3LA 3DSBA 2Z10A 1Y7RA 3DR6A 4KLVA 1BOBA 1RXTA 4HNXB 1KUYA 1YK3A 4AG9A 2IL4A 4Y49B 2B3VA 2OZHA 5IB0A 4KOWA 1BO4A 4RS2A 3W91A 1SQHA 3CXSA 2Y0MA 2JDDA 4MJ8A 2ZXVA 4YGOA 1NSLA 3H4QA 5KTAA 1KUVA 3BJ8A 2G3AA 3S6HA 4ONUA 4R57A 4KUAA 2EUIA 1MJAA 1NE9A 4UA3A 3F0AA 3CXQA 2I00A 3D2MA 3DR8A 2VBQA 5CNPA 2CNMA 2D4PA 4BMHA 4EVYA 3S6GA 4JJXA 4MI4A 2C27A 3R9GA 3EXNA 1CJWA 4XPDC 1S60A 2AJ6A 1R57A 1XEBA 2Z0ZA 2VZZA 4KLWA 3LODA 4MHDA 5EBVA 4QC6A 2B5GA 2CNTA 4NEXA 3T90A 3ZZIA 1MJ9A 2R8VA 2B4DB 2FS5A 2X7BA 3R9FA 2OH1A 4KORA 3TO6A 2PQ8A 3R96A 4I49A 2QMLA 4KOSA 2OB0A 2K5TA 4HNWB 4J3GA 2FXFA 3R95A 2ZW5A 2OU2A 2O28A 4M85A 4ZBGA 3G8WA 4B5PB 3D8PA 2BL1A 3C26A 3GY9A 3TE4A 5ISVA 1S7NA 4NSQA 2NMTA 3TT2A 4K30A 1M4GA 4CAXA 2FE7A 4CRZB 5C88A 5F46A 3R9EA 3I3GA 2Q04A 4LUAA 2FCKA 3S6FA 4JXRA 3TOBA 2Q7BA 4AVBA 4R3KA 4H6ZA 4H89A 5H84A 3D3SA 3ZJ0A 4NCZA 3EC4A 4KOYA 1PU9A 2EVNA 2J8MA 4UWJA 1RO5A 4KOUA 2ARHA 3LD2A 4L8AA 4HNYB 1YVOA 2VEZA 2CNSA 2R1IA 1OZPA 4OLLA 3V8IA 3FYNA 2BEIA 2OZGA 3P2HA 3W6SA 5J8FA 4AB7A 1PUAA 4HKFA 5DWMA 1QSNA 4QUSA 1QSOA 4MY3A 1Y9KA 1KZFA 3NE7A 3EFAA 4L89A 4PK2A 2Q0YA 2Z11A 1FY7A 1QSTA 1S7KA 2Q44A 4LX9A 2PRBA 1J4JA 1VHSA 4FD7A 4UWIA 4XPDB 2J8NA 2BUEA 4R9MA 4PSXA 4FD6A 2B58A 2QECA 3VWEA 4QVTA 1Z4EA 5JQ4A 1ON0A 2REEA 4PV6A 1IICA 4KVOE 1XF8A 2RC4A 4KVXA 2REFA 2ZW6A 3JUWA 5DWNA 4R87A 2FL4A 3E0KA 1XE4A 4KOXA 4JLYA 3TTHA 2HV2A 2G3TA 3IWGA 4F6AA 3CXPA 1YR0A 1YX0A 1I21A 4AG7A 2OZUA 3TOAA 2PC1A 1Q2DA 5J8CA 4X5KA 3MGDA 3GYAA 2FSRA 4U9ZA 4XPLA 3OWCA 4KVME 5GCNA 5IX3A 4U5YA 4AVAA 2BSWA 3FXTA 4E2AA 2VQYA 3UY5A 2JDCA 3FNCA 1S7LA 4NXYA 4YRHA 5JPHA 1GHEA 5HH1A 4YFJA 1S3ZA 1B87A 2B3UA 3TO9A 1Z9UA 2H5MA 1S7FA 3EY5A 3TCVA 2PDOA 4JWPA 5EC4A 1YGHA 2FIWA 2JLMA 1I12A 3EO4A 4PSWA 5KTCA 1Q2YA 2ATRA 1MK4A 2JEVA 2GIVA 3PP9A 2VZYA 3GKRA 4M3SA 2WPWA 5HMNA 4CAWA 2P6GA 3K9UA 2B4DA 2ZW4A 2HUZA 1S5KA 3SHPA 1UFHA 4RI1A 4XNHC
chains in the Genus database with same CATH superfamily
2YNCC 4QB9A 2GLJA 2HB6A 2FT0A 4CAVA 3RYOA 1CPXA 1ARLA 1KWMA 5CBMA 1JWQA 3D68A 3BI0A 2WPXA 4M6GA 3D2PA 3VARA 1CPSA 1KUXA 1LAMA 4R8FA 4Q36A 5I4MA 4WJBA 2PJ9A 5F47A 2Q4ZA 3B8GA 3FBUA 4QBJA 3NFZA 4IF5A 3F5BA 3IWWA 1LFWA 4EVYA 1IB1E 2PRQA 4IUSA 4NF1A 4B5PA 5ELYA 1IYLA 4ZY1A 4M6HA 4UBRA 4MY0A 4P4EA 2Q4VA 5IB0A 3H8FA 1P0HA 3BJ7A 3SJGA 4MFQA 2YGWA 1AYEA 3FX6A 1ZG8A 4PK3A 1NMTA 4MRIA 4KOVA 2P6EA 2Z3NA 1TIQA 1AUGA 1TKFA 3PZJA 4PXCA 3FRMA 1CM0A 2BOAA 1IYKA 3DNSA 2ZEDA 4B11A 5IV0A 4ZY2A 1Z4RA 3GUXA 1DTDA 2J9AA 4FBEA 3BLNA 3H5ZA 4Q7AA 4AVCA 4GS4A 4PPZA 1M4DA 3B3CA 4R7MA 1P4NA 2B5GB 4XNHC 4FD5A 2PE3A 3MN8A 4NJRA 5FVJA 3FIXA 2ZENA 1M4IA 4KUBA 3KKWA 5H86A 4F0YA 4A32A 3FB3A 4KOTA 4Q38A 3WABA 2FIAA 1VHEA 2PJ4A 2F7VA 4OC4A 2ZW7A 3FEDA 1WWZA 3G3SA 4OKOA 4B5OA 1QSMA 4OC2A 4KZTA 2Q7SA 1WK4A 3R1KA 2AFOA 5BWAB 3B2YA 5DS0A 1YREA 4Y49C 3SJFA 3WR7A 2B4BA 1L0CA 2G0BA 2Z3PA 2ZPAA 3NA6A 2NYQA 3P2FA 2A4NA 2OOTA 3IC1A 5LRJA 2J8RA 4B12A 2CY2A 2AFSA 4UCPA 1MJBA 3PB4X 1YLEA 2AFUA 2VI7A 4A95A 1YVKA 4UEZA 4CYNA 1N71A 3JVNA 3LMSA 3KR5A 4LQ6A 3W6XA 4DNCA 3KGQA 2QYVA 3QAHA 2CXAA 3RAMA 4E8OA 2PR1A 1CBXA 4FD4A 4UFVA 3SI0A 2I79A 5I0CA 5KTDA 4ORFA 4OC1A 2AFZA 3SJXA 3F8KA 3BHXA 1XMTA 1Y9WA 2AE6A 1TF9A 2IJZA 2QIRA 5AG5A 5HVGA 2VXKA 2C6CA 3SXNA 2DF5A 2PSWA 2F8HA 5C82A 1IIDA 4G1PA 1V0CA 3DDDA 3N5FA 4E0AA 4CS0B 3PGPA 3L2NA 5LYFA 2QVPA 3T9YA 5HVFA 4ZY0A 2ZEEA 3D7HA 5LYDA 5K8OA 2PJCA 2PJ7A 4CAFA 2F5IA 2P6FA 3SXOA 4EWTA 4OC0A 1U6MA 4KSAA 4CGNA 1M1DA 3K9TA 2HQYA 4A38A 4F9VA 1CX8A 2D4OA 3KQZA 4C2YA 4Z65A 2EWBA 2GLFA 1QQ9A 5EMIA 4CYQA 3I9SA 3IGRA 3LACA 4IK2A 4MFJA 4XNHB 1XOVA 2ZEHA 3FH4A 4NGPA 2KCWA 3PBBA 1TXRA 5AG6A 4JD6A 3QB8A 4WWVA 3PRTA 2PJ1A 2PR8A 5F49A 4RUHA 5LRGA 1IOFA 1I1DA 2PJ5A 3VH9A 1ELMP 1Z8WA 2V8GA 3I1UA 4OADA 4R6TA 4AXVA 5A28A 1YSJA 4H6UA 1LRZA 1ZG9A 3RNZA 1VKCA 3TFYA 2ZEFA 3B35A 2JEWA 2R7HA 3S9NA 4PQAA 2P0WA 1OBRA 2HC9A 4XPKA 1BPNA 4MMOA 3SJEA 5E96A 2Q4YA 1QSRA 2V77A 2Z3MA 3N7ZA 1K4JA 2VL1A 2R98A 4FUUA 3B3SA 3ISZA 1M44A 4U9YA 1Q2CA 3FMCA 4OAEA 3TO7A 2GANA 3A9LA 3S6KA 1Z5RA 3CT9A 2Z3KA 4UFXA 3KR4A 4BINA 2V8VA 5F48A 4MBUA 1CP6A 1IGBA 4A37A 4JXQA 2GU2A 4II9A 4B6ZA 1XIXA 4CRYB 2GE3A 2DXQA 2WZNA 3VWDA 3CPXA 4A39A 4F8ZA 1ARMA 1B6BA 4R3LA 3DSBA 2Z10A 4GM5A 3DLJA 1Y7RA 3B3TA 4NGNA 4R76A 1DE4C 4UEEA 2O4HA 3DR6A 4MFKA 4KLVA 4OP4A 2PIZA 1BOBA 2BO9A 3IO1A 3WC6A 1RXTA 4HNXB 4B10A 5AG4A 1KUYA 1YK3A 3IFEA 3RO0A 4AG9A 2ZELA 4KS9A 2IL4A 4X3RA 4Y49B 2OZHA 1LCPA 2B3VA 1BPMA 2CTBA 4KSIA 4MCRA 3PB7X 4KOWA 4NGRA 1BO4A 4RS2A 4BBHA 5CPAA 3W91A 1SQHA 1H8LA 3CXSA 2Y0MA 2JDDA 3SI2A 4MJ8A 1HEEA 2ZXVA 4NGTA 3RZAA 4YGOA 4A31A 1NSLA 3H4QA 5KTAA 1Q7LA 1KUVA 4PXEA 3BJ8A 2G3AA 4YU9A 3S6HA 1F2PA 3B7IA 4ONUA 4R57A 4MHPA 4KUAA 2EUIA 1MJAA 1NE9A 3D67A 4UA3A 2ZOGA 4P10A 3T8WA 2PJAA 3F0AA 4UF4A 3BI1A 3CXQA 4C2ZA 2EK8A 1FNOA 2I00A 2IQ6A 4IAVA 3FVLA 4EMEA 3D2MA 4OMEA 3DR8A 2VBQA 4OIDA 1TKHA 4C7HA 5CNPA 2CNMA 2D4PA 2DEAA 3KASA 1Z8TA 3PBEA 5THWA 1A2ZA 4BMHA 4P4JA 4P4IA 1IU8A 3S6GA 2XEFA 4JJXA 1X10A 4MI4A 4MHYA 2C27A 3R9GA 2RB7A 3EXNA 2C6GA 2WUUA 1CJWA 4JYWA 4XPDC 1S60A 2AJ6A 1R57A 1XEBA 2Z0ZA 2PVWA 3PB6X 3PB9X 4CGMA 2GREA 2VZZA 4FWUA 4KLWA 1VIXA 4P6YA 3LODA 1R3NA 2I3CA 4MHDA 3KZWA 1QMUA 2BCOA 3D7GA 2ZOFA 3PFOA 3HLPA 5EBVA 4QC6A 3ISXA 2B5GA 2CNTA 4MFZA 4NEXA 3T90A 2PJBA 4MHZA 3WT4A 3ZZIA 1MJ9A 2R8VA 2B4DB 2FS5A 2X7BA 3R9FA 3TC8A 2OH1A 2Z3OA 4KORA 3D7FA 4P45A 2CF4A 3TO6A 4A30A 2PQ8A 4KSFA 3R96A 4I49A 1EE3P 2Q51A 2QMLA 4KOSA 5AG7A 5G1ZA 4C68A 1TKJA 3WC5A 2OB0A 2K5TA 4H2KA 1ZG7A 5J1QA 4HNWB 4J3GA 3IU2A 2FXFA 3R95A 1VGYA 2C1CA 4PXBA 2ZW5A 2OU2A 7CPAA 2YNEA 2IMOA 2O28A 4M85A 4ZBGA 3G8WA 2PIYA 4B5PB 2CTCA 4CYPA 3D8PA 2BL1A 3C26A 3GY9A 3TE4A 4FAIA 4IHMA 2ZEOA 5ISVA 1S7NA 1JQGA 5F09A 2AFMA 4NSQA 2NMTA 3CDXA 3TT2A 4A2ZA 3IJ3A 4MFLA 2ZEMA 4K30A 2CIJA 1M4GA 4CAXA 3NE8A 2FE7A 4CRZB 5C88A 5F46A 4CPAA 2PJ8A 3R9EA 3I3GA 4B14A 2Q04A 4LUAA 2FCKA 3S6FA 4JXRA 3TOBA 2Q7BA 3PEIA 1ELLP 1NSAA 1YQEA 4H6ZA 4H89A 4R3KA 5H84A 4P4BA 4AVBA 3D3SA 4TWEA 5HVHA 3ZJ0A 4BD9A 4NCZA 3EC4A 2ZEGA 5G21A 4KOYA 3IEHA 4X2TA 1PU9A 4CGPA 2EVNA 2J8MA 4UWJA 2POKA 1RO5A 4KOUA 2ARHA 4NGMA 3V7ZA 3LD2A 1IY7A 2V8DA 1XBUA 4HNYB 1YVOA 4L8AA 2DPSA 4A33A 2VEZA 1YW6A 4CGLA 4MHNA 5G22A 1Y7EA 2EK9A 2FVGA 5D29A 3PB8X 2CNSA 1HDUA 3BXMA 4MCSA 1ZLHA 1Z2LA 1CP7A 4P4FA 1XJOA 2R1IA 1OZPA 1BLLE 4OLLA 4DUKA 1CG2A 1XFOA 3V8IA 2YNDA 3FYNA 4M6IA 3GLJA 4LQGA 2BEIA 1LANA 2OZGA 2YNCA 4YWYA 2V8HA 1F2OA 3P2HA 3KQXA 5A27A 3WC7A 2RFHA 3W6SA 3LWUA 5J8FA 4AB7A 1VHOA 1PUAA 4HKFA 5JGFA 5DWMA 1QSNA 4QUSA 5LRKA 1Y0RA 1QSOA 4JZ0A 2EBJA 4MY3A 1Y9KA 1KZFA 2ANPA 3NE7A 3EFAA 3SI1A 4L89A 4W9YA 3VATA 4PK2A 1RTQA 4DYOA 3CZXA 2Q0YA 1R43A 2Z11A 3NH8A 4MFPA 1FY7A 1QSTA 1S7KA 2Q44A 4LX9A 2PRBA 1IOIA 1J4JA 1VHSA 3D4UA 3JTKA 3KHZA 3KI9A 4FD7A 2PJ6A 4CGOA 4UWIA 4F9UA 5K8NA 2Q43A 4XPDB 2J8NA 4NGQA 2BUEA 4R9MA 1AMPA 2EO8A 4FD6A 1LAPA 4PSXA 4B13A 2B58A 3MRUA 4NJQA 4MCPA 2QECA 1BAVA 3FEEA 3VWEA 4K3NA 1Z4EA 3K2KA 4QVTA 5JQ4A 1ON0A 5G20A 3GB0A 4UIAA 2REEA 3KHXA 4PV6A 1IICA 4KVOE 1XF8A 2RC4A 4KVXA 4HPSA 2PVVA 3QAYA 1PCAA 2REFA 2ZW6A 2JBKA 2O53A 4ZX9A 3JUWA 2WYRA 3S9MA 5LYLA 5DWNA 3B3WA 4R87A 2FL4A 3KL9A 4P4DA 4ZYQA 3E0KA 1LOKA 1XE4A 5K8PA 4KOXA 4JLYA 3GIUA 1TF8A 4MXUA 3TTHA 1HDQA 2HV2A 3RBUA 4C7IA 6CPAA 2G3TA 5LYIA 3IWGA 2GFQA 2ABZA 3HUVA 4F6AA 3CXPA 1YR0A 2AFWA 5IB9A 1YX0A 1I21A 4NFRA 3TX8A 1UWYA 4AG7A 2OZUA 2Z3LA 3TOAA 2PC1A 4GXHA 1Q2DA 3DGVA 1M4LA 4EFDA 3JRUA 4CAEA 4ZX8A 1FT7A 5J8CA 2PJ2A 4UIBA 2G9DA 3PFEA 3MGDA 4X5KA 3GYAA 2FSRA 3D7DA 4U9ZA 4XPLA 3FECA 5JH9A 3OWCA 3IIBA 4KVME 4ONWA 5AGEA 1Z8LA 2ZEPA 5GCNA 1Y0YA 1X12A 5IX3A 2PCUA 4U5YA 4AVAA 5JM6A 2BSWA 3FXTA 4ZI6A 2JBJA 4OC3A 4E2AA 2VQYA 1YW4A 4PXDA 3UY5A 2JDCA 3FNCA 1S7LA 3IU1A 4NXYA 1XRYA 1YMEA 2XEIA 2XEGA 2QJ8A 4YRHA 1ZO0A 4F0XA 4NGSA 5D8NA 2XEJA 5JPHA 2AFXA 1GHEA 4CYOA 3S9LA 5HH1A 4YFJA 1S3ZA 1B87A 2B3UA 3TO9A 1Z9UA 4ZGYB 3NH4A 3QNVA 4RN7A 2ODFA 2H5MA 1S7FA 4UEFA 4DJLA 3EY5A 3FF3A 4P44A 1ZLIA 2PJ0A 3TCVA 1GYTA 4TNUA 2PDOA 4UCMA 4JWPA 5EC4A 3NH5A 1XMBA 1YGHA 2FIWA 2JLMA 1I12A 4UFWA 3EO4A 1Z8XA 4PSWA 5KTCA 1Q2YA 3V38A 2ATRA 1MK4A 2JEVA 2WSAA 4C2XA 2GIVA 3H8GA 3PP9A 4UCNA 2VZYA 3GKRA 2C6PA 4M3SA 5K8MA 2WPWA 4OIWA 3CPAA 3D66A 8CPAA 3IWEA 5HMNA 4CAWA 4X8IA 2P6GA 2DPTA 2PJ3A 4OC5A 3K9UA 3FJUA 2B4DA 2ZW4A 3B3VA 5HXDA 1PYTB 2HUZA 1S5KA 1F57A 2NSMA 1YLOA 3H8EA 4O23A 3SHPA 4A94A 2OR4A 1UFHA 4RI1A 4MCQA
chains in the Genus database with same CATH topology
2YNCC 4QB9A 4CAVA 2FT0A 3RYOA 2WPXA 3D2PA 1KUXA 4Q36A 5F47A 3B8GA 3FBUA 4QBJA 4IF5A 3F5BA 1IB1E 4IUSA 4NF1A 4B5PA 1IYLA 4UBRA 4MY0A 2Q4VA 1P0HA 3BJ7A 4MFQA 2YGWA 4PK3A 1NMTA 4KOVA 2P6EA 2Z3NA 1TIQA 3PZJA 3FRMA 1CM0A 1IYKA 3DNSA 4B11A 5IV0A 1Z4RA 3BLNA 3H5ZA 4AVCA 4GS4A 1M4DA 1P4NA 2B5GB 4FD5A 5FVJA 3FIXA 1M4IA 4KUBA 3KKWA 5H86A 4F0YA 4A32A 3FB3A 4KOTA 4Q38A 2FIAA 2ZW7A 3G3SA 1WWZA 4B5OA 1QSMA 4KZTA 1WK4A 3R1KA 5BWAB 1YREA 4Y49C 3WR7A 2B4BA 1L0CA 2G0BA 2Z3PA 2ZPAA 3P2FA 2A4NA 2J8RA 4B12A 2CY2A 4UCPA 1MJBA 4CYNA 1YLEA 2VI7A 4A95A 1YVKA 1N71A 3JVNA 3W6XA 4DNCA 3QAHA 2CXAA 4E8OA 2PR1A 4FD4A 4UFVA 2I79A 5I0CA 5KTDA 4ORFA 3F8KA 1XMTA 1Y9WA 2AE6A 2QIRA 5AG5A 2VXKA 3SXNA 2PSWA 5C82A 1IIDA 1V0CA 3DDDA 4E0AA 4CS0B 3PGPA 3T9YA 4CAFA 2F5IA 2P6FA 3SXOA 1U6MA 4KSAA 4CGNA 1M1DA 2HQYA 2D4OA 4C2YA 4CYQA 3I9SA 3IGRA 4MFJA 4XNHB 2KCWA 5AG6A 4JD6A 3QB8A 2PR8A 5F49A 1I1DA 5A28A 4OADA 4H6UA 1LRZA 1VKCA 3TFYA 2R7HA 2P0WA 4XPKA 5E96A 2Q4YA 1QSRA 2Z3MA 3N7ZA 1K4JA 2R98A 1M44A 4U9YA 1Q2CA 4OAEA 3TO7A 2GANA 3A9LA 3S6KA 4UFXA 2Z3KA 5F48A 4MBUA 4JXQA 4II9A 1XIXA 4CRYB 2GE3A 2DXQA 3VWDA 1B6BA 4R3LA 3DSBA 2Z10A 1Y7RA 3DR6A 4MFKA 4KLVA 1BOBA 1RXTA 4HNXB 4B10A 5AG4A 1KUYA 1YK3A 4AG9A 4KS9A 2IL4A 4Y49B 2B3VA 2OZHA 5IB0A 4KOWA 1BO4A 4RS2A 4BBHA 3W91A 1SQHA 3CXSA 2Y0MA 2JDDA 4MJ8A 2ZXVA 4YGOA 4A31A 1NSLA 3H4QA 5KTAA 1KUVA 3BJ8A 2G3AA 3S6HA 4ONUA 4R57A 4KUAA 2EUIA 1MJAA 1NE9A 4UA3A 3F0AA 3CXQA 4C2ZA 2I00A 3D2MA 3DR8A 2VBQA 4C7HA 5CNPA 2CNMA 2D4PA 4BMHA 4EVYA 3S6GA 4JJXA 4MI4A 2C27A 3R9GA 3EXNA 2WUUA 1CJWA 4XPDC 1S60A 2AJ6A 1R57A 1XEBA 2Z0ZA 4CGMA 2VZZA 4KLWA 3LODA 4MHDA 5EBVA 4QC6A 2B5GA 2CNTA 4MFZA 4NEXA 3T90A 3ZZIA 1MJ9A 2R8VA 2B4DB 2FS5A 2X7BA 3R9FA 2OH1A 2Z3OA 4KORA 3TO6A 4A30A 2PQ8A 4KSFA 3R96A 4I49A 2QMLA 4KOSA 5G1ZA 4C68A 5AG7A 2OB0A 2K5TA 4HNWB 4J3GA 3IU2A 2FXFA 3R95A 2ZW5A 2OU2A 2YNEA 2O28A 4M85A 4ZBGA 3G8WA 4B5PB 4CYPA 3D8PA 2BL1A 3C26A 3GY9A 3TE4A 5ISVA 1S7NA 4NSQA 2NMTA 3TT2A 4A2ZA 4MFLA 4K30A 1M4GA 4CAXA 2FE7A 4CRZB 5C88A 5F46A 3R9EA 3I3GA 4B14A 2Q04A 4LUAA 2FCKA 3S6FA 4JXRA 3TOBA 2Q7BA 4AVBA 4R3KA 4H6ZA 4H89A 5H84A 3D3SA 3ZJ0A 4NCZA 3EC4A 5G21A 4KOYA 1PU9A 4CGPA 2EVNA 2J8MA 4UWJA 1RO5A 4KOUA 2ARHA 3LD2A 4L8AA 4HNYB 1YVOA 4CGLA 2DPSA 4A33A 2VEZA 5G22A 2CNSA 2R1IA 1OZPA 4OLLA 3V8IA 2YNDA 3FYNA 2BEIA 2OZGA 2YNCA 3P2HA 5A27A 3W6SA 5J8FA 4AB7A 1PUAA 4HKFA 5DWMA 1QSNA 4QUSA 1QSOA 4MY3A 1Y9KA 1KZFA 3NE7A 3EFAA 4L89A 4PK2A 2Q0YA 2Z11A 4MFPA 1FY7A 1QSTA 1S7KA 2Q44A 4LX9A 2PRBA 1J4JA 1VHSA 4CGOA 3JTKA 4FD7A 4UWIA 4XPDB 2J8NA 2BUEA 4R9MA 4PSXA 4FD6A 4B13A 2B58A 2QECA 3VWEA 4QVTA 1Z4EA 5JQ4A 1ON0A 5G20A 2REEA 4PV6A 1IICA 4KVOE 1XF8A 2RC4A 4KVXA 2REFA 2ZW6A 3JUWA 5DWNA 4R87A 2FL4A 3E0KA 1XE4A 4KOXA 4JLYA 3TTHA 2HV2A 4C7IA 2G3TA 3IWGA 4F6AA 3CXPA 1YR0A 1YX0A 1I21A 4AG7A 2OZUA 2Z3LA 3TOAA 2PC1A 1Q2DA 4CAEA 5J8CA 4X5KA 3MGDA 3GYAA 2FSRA 4U9ZA 4XPLA 3OWCA 4KVME 5AGEA 5GCNA 5IX3A 4U5YA 4AVAA 2BSWA 3FXTA 4E2AA 2VQYA 3UY5A 2JDCA 3FNCA 1S7LA 3IU1A 4NXYA 4YRHA 1ZO0A 4F0XA 5JPHA 4CYOA 1GHEA 5HH1A 4YFJA 1S3ZA 1B87A 2B3UA 3TO9A 1Z9UA 4ZGYB 2H5MA 1S7FA 3EY5A 3TCVA 2PDOA 4UCMA 4JWPA 5EC4A 1YGHA 2FIWA 2JLMA 1I12A 4UFWA 3EO4A 4PSWA 5KTCA 1Q2YA 2ATRA 1MK4A 2JEVA 2WSAA 4C2XA 2GIVA 3PP9A 4UCNA 2VZYA 3GKRA 4M3SA 2WPWA 3IWEA 5HMNA 4CAWA 2P6GA 2DPTA 3K9UA 2B4DA 2ZW4A 2HUZA 1S5KA 3SHPA 1UFHA 4RI1A 4XNHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QB9 A;  4CAV A;  2FT0 A;  3RYO A;  2WPX A;  3D2P A;  1KUX A;  5F47 A;  3B8G A;  3FBU A;  4QBJ A;  4IF5 A;  3F5B A;  1IB1 E;  4IUS A;  4NF1 A;  4B5P A;  1IYL A;  4UBR A;  4MY0 A;  2Q4V A;  1P0H A;  3BJ7 A;  4PK3 A;  1NMT A;  4KOV A;  2P6E A;  1TIQ A;  3PZJ A;  3FRM A;  1CM0 A;  1IYK A;  3DNS A;  5IV0 A;  1Z4R A;  3BLN A;  4AVC A;  4GS4 A;  1M4D A;  1P4N A;  2B5G B;  4FD5 A;  5FVJ A;  3FIX A;  1M4I A;  4KUB A;  3KKW A;  5H86 A;  4F0Y A;  3FB3 A;  4KOT A;  2FIA A;  2ZW7 A;  3G3S A;  1WWZ A;  4B5O A;  1QSM A;  4KZT A;  1WK4 A;  3R1K A;  1YRE A;  4Y49 C;  3WR7 A;  2B4B A;  1L0C A;  2G0B A;  2ZPA A;  3P2F A;  2A4N A;  2J8R A;  2CY2 A;  1MJB A;  1YLE A;  2VI7 A;  1YVK A;  1N71 A;  3JVN A;  3W6X A;  4DNC A;  3QAH A;  4E8O A;  2PR1 A;  4FD4 A;  2I79 A;  5I0C A;  5KTD A;  4ORF A;  3F8K A;  1XMT A;  1Y9W A;  2AE6 A;  2QIR A;  2VXK A;  3SXN A;  2PSW A;  5C82 A;  1IID A;  1V0C A;  3DDD A;  4E0A A;  4CS0 B;  3PGP A;  3T9Y A;  2F5I A;  2P6F A;  3SXO A;  1U6M A;  1M1D A;  2HQY A;  2D4O A;  3I9S A;  3IGR A;  4XNH B;  2KCW A;  4JD6 A;  3QB8 A;  2PR8 A;  5F49 A;  1I1D A;  4OAD A;  4H6U A;  1LRZ A;  1VKC A;  3TFY A;  2R7H A;  2P0W A;  4XPK A;  5E96 A;  2Q4Y A;  1QSR A;  3N7Z A;  1K4J A;  2R98 A;  1M44 A;  4U9Y A;  1Q2C A;  4OAE A;  3TO7 A;  2GAN A;  3S6K A;  5F48 A;  4MBU A;  4JXQ A;  4II9 A;  1XIX A;  4CRY B;  2GE3 A;  2DXQ A;  3VWD A;  1B6B A;  4R3L A;  3DSB A;  2Z10 A;  1Y7R A;  3DR6 A;  4KLV A;  1BOB A;  1RXT A;  4HNX B;  1KUY A;  1YK3 A;  4AG9 A;  2IL4 A;  4Y49 B;  2B3V A;  2OZH A;  5IB0 A;  4KOW A;  1BO4 A;  4RS2 A;  3W91 A;  1SQH A;  3CXS A;  2Y0M A;  2JDD A;  4MJ8 A;  2ZXV A;  4YGO A;  1NSL A;  3H4Q A;  5KTA A;  1KUV A;  3BJ8 A;  2G3A A;  3S6H A;  4ONU A;  4R57 A;  4KUA A;  2EUI A;  1MJA A;  1NE9 A;  4UA3 A;  3F0A A;  3CXQ A;  2I00 A;  3D2M A;  3DR8 A;  2VBQ A;  5CNP A;  2CNM A;  2D4P A;  4BMH A;  4EVY A;  3S6G A;  4JJX A;  4MI4 A;  2C27 A;  3R9G A;  3EXN A;  1CJW A;  4XPD C;  1S60 A;  2AJ6 A;  1R57 A;  1XEB A;  2Z0Z A;  2VZZ A;  4KLW A;  3LOD A;  4MHD A;  5EBV A;  4QC6 A;  2B5G A;  2CNT A;  4NEX A;  3T90 A;  3ZZI A;  1MJ9 A;  2R8V A;  2B4D B;  2FS5 A;  2X7B A;  3R9F A;  2OH1 A;  4KOR A;  3TO6 A;  2PQ8 A;  3R96 A;  4I49 A;  2QML A;  4KOS A;  2OB0 A;  2K5T A;  4HNW B;  4J3G A;  2FXF A;  3R95 A;  2ZW5 A;  2OU2 A;  2O28 A;  4M85 A;  4ZBG A;  3G8W A;  4B5P B;  3D8P A;  2BL1 A;  3C26 A;  3GY9 A;  3TE4 A;  5ISV A;  1S7N A;  4NSQ A;  2NMT A;  3TT2 A;  4K30 A;  1M4G A;  4CAX A;  2FE7 A;  4CRZ B;  5C88 A;  5F46 A;  3R9E A;  3I3G A;  2Q04 A;  4LUA A;  2FCK A;  3S6F A;  4JXR A;  3TOB A;  2Q7B A;  4AVB A;  4R3K A;  4H6Z A;  4H89 A;  5H84 A;  3D3S A;  3ZJ0 A;  4NCZ A;  3EC4 A;  4KOY A;  1PU9 A;  2EVN A;  2J8M A;  4UWJ A;  1RO5 A;  4KOU A;  2ARH A;  3LD2 A;  4L8A A;  4HNY B;  1YVO A;  2VEZ A;  2CNS A;  2R1I A;  1OZP A;  4OLL A;  3V8I A;  3FYN A;  2BEI A;  2OZG A;  3P2H A;  3W6S A;  5J8F A;  4AB7 A;  1PUA A;  4HKF A;  5DWM A;  1QSN A;  4QUS A;  1QSO A;  4MY3 A;  1Y9K A;  1KZF A;  3NE7 A;  3EFA A;  4L89 A;  4PK2 A;  2Q0Y A;  2Z11 A;  1FY7 A;  1QST A;  1S7K A;  2Q44 A;  4LX9 A;  2PRB A;  1J4J A;  1VHS A;  4FD7 A;  4UWI A;  4XPD B;  2J8N A;  2BUE A;  4R9M A;  4PSX A;  4FD6 A;  2B58 A;  2QEC A;  3VWE A;  4QVT A;  1Z4E A;  5JQ4 A;  1ON0 A;  2REE A;  4PV6 A;  1IIC A;  4KVO E;  1XF8 A;  2RC4 A;  4KVX A;  2REF A;  2ZW6 A;  3JUW A;  5DWN A;  4R87 A;  2FL4 A;  3E0K A;  1XE4 A;  4KOX A;  4JLY A;  3TTH A;  2HV2 A;  2G3T A;  3IWG A;  4F6A A;  3CXP A;  1YR0 A;  1YX0 A;  1I21 A;  4AG7 A;  2OZU A;  3TOA A;  2PC1 A;  1Q2D A;  5J8C A;  4X5K A;  3MGD A;  3GYA A;  2FSR A;  4U9Z A;  4XPL A;  3OWC A;  4KVM E;  5GCN A;  5IX3 A;  4U5Y A;  4AVA A;  2BSW A;  3FXT A;  4E2A A;  2VQY A;  3UY5 A;  2JDC A;  3FNC A;  1S7L A;  4NXY A;  4YRH A;  5JPH A;  1GHE A;  5HH1 A;  4YFJ A;  1S3Z A;  1B87 A;  2B3U A;  3TO9 A;  1Z9U A;  2H5M A;  1S7F A;  3EY5 A;  3TCV A;  2PDO A;  4JWP A;  5EC4 A;  1YGH A;  2FIW A;  2JLM A;  1I12 A;  3EO4 A;  4PSW A;  5KTC A;  1Q2Y A;  2ATR A;  1MK4 A;  2JEV A;  2GIV A;  3PP9 A;  2VZY A;  3GKR A;  4M3S A;  2WPW A;  5HMN A;  4CAW A;  2P6G A;  3K9U A;  2B4D A;  2ZW4 A;  2HUZ A;  1S5K A;  3SHP A;  1UFH A;  4RI1 A;  4XNH C; 
#chains in the Genus database with same CATH topology
 2YNC C;  4QB9 A;  2GLJ A;  2HB6 A;  2FT0 A;  4CAV A;  3RYO A;  1CPX A;  1ARL A;  1KWM A;  5CBM A;  1JWQ A;  3D68 A;  3BI0 A;  2WPX A;  4M6G A;  3D2P A;  3VAR A;  1CPS A;  1KUX A;  1LAM A;  4R8F A;  4Q36 A;  5I4M A;  4WJB A;  2PJ9 A;  5F47 A;  2Q4Z A;  3B8G A;  3FBU A;  4QBJ A;  3NFZ A;  4IF5 A;  3F5B A;  3IWW A;  1LFW A;  4EVY A;  1IB1 E;  2PRQ A;  4IUS A;  4NF1 A;  4B5P A;  5ELY A;  1IYL A;  4ZY1 A;  4M6H A;  4UBR A;  4MY0 A;  4P4E A;  2Q4V A;  5IB0 A;  3H8F A;  1P0H A;  3BJ7 A;  3SJG A;  4MFQ A;  2YGW A;  1AYE A;  3FX6 A;  1ZG8 A;  4PK3 A;  1NMT A;  4MRI A;  4KOV A;  2P6E A;  2Z3N A;  1TIQ A;  1AUG A;  1TKF A;  3PZJ A;  4PXC A;  3FRM A;  1CM0 A;  2BOA A;  1IYK A;  3DNS A;  2ZED A;  4B11 A;  5IV0 A;  4ZY2 A;  1Z4R A;  3GUX A;  1DTD A;  2J9A A;  4FBE A;  3BLN A;  3H5Z A;  4Q7A A;  4AVC A;  4GS4 A;  4PPZ A;  1M4D A;  3B3C A;  4R7M A;  1P4N A;  2B5G B;  4XNH C;  4FD5 A;  2PE3 A;  3MN8 A;  4NJR A;  5FVJ A;  3FIX A;  2ZEN A;  1M4I A;  4KUB A;  3KKW A;  5H86 A;  4F0Y A;  4A32 A;  3FB3 A;  4KOT A;  4Q38 A;  3WAB A;  2FIA A;  1VHE A;  2PJ4 A;  2F7V A;  4OC4 A;  2ZW7 A;  3FED A;  1WWZ A;  3G3S A;  4OKO A;  4B5O A;  1QSM A;  4OC2 A;  4KZT A;  2Q7S A;  1WK4 A;  3R1K A;  2AFO A;  5BWA B;  3B2Y A;  5DS0 A;  1YRE A;  4Y49 C;  3SJF A;  3WR7 A;  2B4B A;  1L0C A;  2G0B A;  2Z3P A;  2ZPA A;  3NA6 A;  2NYQ A;  3P2F A;  2A4N A;  2OOT A;  3IC1 A;  5LRJ A;  2J8R A;  4B12 A;  2CY2 A;  2AFS A;  4UCP A;  1MJB A;  3PB4 X;  1YLE A;  2AFU A;  2VI7 A;  4A95 A;  1YVK A;  4UEZ A;  4CYN A;  1N71 A;  3JVN A;  3LMS A;  3KR5 A;  4LQ6 A;  3W6X A;  4DNC A;  3KGQ A;  2QYV A;  3QAH A;  2CXA A;  3RAM A;  4E8O A;  2PR1 A;  1CBX A;  4FD4 A;  4UFV A;  3SI0 A;  2I79 A;  5I0C A;  5KTD A;  4ORF A;  4OC1 A;  2AFZ A;  3SJX A;  3F8K A;  3BHX A;  1XMT A;  1Y9W A;  2AE6 A;  1TF9 A;  2IJZ A;  2QIR A;  5AG5 A;  5HVG A;  2VXK A;  2C6C A;  3SXN A;  2DF5 A;  2PSW A;  2F8H A;  5C82 A;  1IID A;  4G1P A;  1V0C A;  3DDD A;  3N5F A;  4E0A A;  4CS0 B;  3PGP A;  3L2N A;  5LYF A;  2QVP A;  3T9Y A;  5HVF A;  4ZY0 A;  2ZEE A;  3D7H A;  5LYD A;  5K8O A;  2PJC A;  2PJ7 A;  4CAF A;  2F5I A;  2P6F A;  3SXO A;  4EWT A;  4OC0 A;  1U6M A;  4KSA A;  4CGN A;  1M1D A;  3K9T A;  2HQY A;  4A38 A;  4F9V A;  1CX8 A;  2D4O A;  3KQZ A;  4C2Y A;  4Z65 A;  2EWB A;  2GLF A;  1QQ9 A;  5EMI A;  4CYQ A;  3I9S A;  3IGR A;  3LAC A;  4IK2 A;  4MFJ A;  4XNH B;  1XOV A;  2ZEH A;  3FH4 A;  4NGP A;  2KCW A;  3PBB A;  1TXR A;  5AG6 A;  4JD6 A;  3QB8 A;  4WWV A;  3PRT A;  2PJ1 A;  2PR8 A;  5F49 A;  4RUH A;  5LRG A;  1IOF A;  1I1D A;  2PJ5 A;  3VH9 A;  1ELM P;  1Z8W A;  2V8G A;  3I1U A;  4OAD A;  4R6T A;  4AXV A;  5A28 A;  1YSJ A;  4H6U A;  1LRZ A;  1ZG9 A;  3RNZ A;  1VKC A;  3TFY A;  2ZEF A;  3B35 A;  2JEW A;  2R7H A;  3S9N A;  4PQA A;  2P0W A;  1OBR A;  2HC9 A;  4XPK A;  1BPN A;  4MMO A;  3SJE A;  5E96 A;  2Q4Y A;  1QSR A;  2V77 A;  2Z3M A;  3N7Z A;  1K4J A;  2VL1 A;  2R98 A;  4FUU A;  3B3S A;  3ISZ A;  1M44 A;  4U9Y A;  1Q2C A;  3FMC A;  4OAE A;  3TO7 A;  2GAN A;  3A9L A;  3S6K A;  1Z5R A;  3CT9 A;  2Z3K A;  4UFX A;  3KR4 A;  4BIN A;  2V8V A;  5F48 A;  4MBU A;  1CP6 A;  1IGB A;  4A37 A;  4JXQ A;  2GU2 A;  4II9 A;  4B6Z A;  1XIX A;  4CRY B;  2GE3 A;  2DXQ A;  2WZN A;  3VWD A;  3CPX A;  4A39 A;  4F8Z A;  1ARM A;  1B6B A;  4R3L A;  3DSB A;  2Z10 A;  4GM5 A;  3DLJ A;  1Y7R A;  3B3T A;  4NGN A;  4R76 A;  1DE4 C;  4UEE A;  2O4H A;  3DR6 A;  4MFK A;  4KLV A;  4OP4 A;  2PIZ A;  1BOB A;  2BO9 A;  3IO1 A;  3WC6 A;  1RXT A;  4HNX B;  4B10 A;  5AG4 A;  1KUY A;  1YK3 A;  3IFE A;  3RO0 A;  4AG9 A;  2ZEL A;  4KS9 A;  2IL4 A;  4X3R A;  4Y49 B;  2OZH A;  1LCP A;  2B3V A;  1BPM A;  2CTB A;  4KSI A;  4MCR A;  3PB7 X;  4KOW A;  4NGR A;  1BO4 A;  4RS2 A;  4BBH A;  5CPA A;  3W91 A;  1SQH A;  1H8L A;  3CXS A;  2Y0M A;  2JDD A;  3SI2 A;  4MJ8 A;  1HEE A;  2ZXV A;  4NGT A;  3RZA A;  4YGO A;  4A31 A;  1NSL A;  3H4Q A;  5KTA A;  1Q7L A;  1KUV A;  4PXE A;  3BJ8 A;  2G3A A;  4YU9 A;  3S6H A;  1F2P A;  3B7I A;  4ONU A;  4R57 A;  4MHP A;  4KUA A;  2EUI A;  1MJA A;  1NE9 A;  3D67 A;  4UA3 A;  2ZOG A;  4P10 A;  3T8W A;  2PJA A;  3F0A A;  4UF4 A;  3BI1 A;  3CXQ A;  4C2Z A;  2EK8 A;  1FNO A;  2I00 A;  2IQ6 A;  4IAV A;  3FVL A;  4EME A;  3D2M A;  4OME A;  3DR8 A;  2VBQ A;  4OID A;  1TKH A;  4C7H A;  5CNP A;  2CNM A;  2D4P A;  2DEA A;  3KAS A;  1Z8T A;  3PBE A;  5THW A;  1A2Z A;  4BMH A;  4P4J A;  4P4I A;  1IU8 A;  3S6G A;  2XEF A;  4JJX A;  1X10 A;  4MI4 A;  4MHY A;  2C27 A;  3R9G A;  2RB7 A;  3EXN A;  2C6G A;  2WUU A;  1CJW A;  4JYW A;  4XPD C;  1S60 A;  2AJ6 A;  1R57 A;  1XEB A;  2Z0Z A;  2PVW A;  3PB6 X;  3PB9 X;  4CGM A;  2GRE A;  2VZZ A;  4FWU A;  4KLW A;  1VIX A;  4P6Y A;  3LOD A;  1R3N A;  2I3C A;  4MHD A;  3KZW A;  1QMU A;  2BCO A;  3D7G A;  2ZOF A;  3PFO A;  3HLP A;  5EBV A;  4QC6 A;  3ISX A;  2B5G A;  2CNT A;  4MFZ A;  4NEX A;  3T90 A;  2PJB A;  4MHZ A;  3WT4 A;  3ZZI A;  1MJ9 A;  2R8V A;  2B4D B;  2FS5 A;  2X7B A;  3R9F A;  3TC8 A;  2OH1 A;  2Z3O A;  4KOR A;  3D7F A;  4P45 A;  2CF4 A;  3TO6 A;  4A30 A;  2PQ8 A;  4KSF A;  3R96 A;  4I49 A;  1EE3 P;  2Q51 A;  2QML A;  4KOS A;  5AG7 A;  5G1Z A;  4C68 A;  1TKJ A;  3WC5 A;  2OB0 A;  2K5T A;  4H2K A;  1ZG7 A;  5J1Q A;  4HNW B;  4J3G A;  3IU2 A;  2FXF A;  3R95 A;  1VGY A;  2C1C A;  4PXB A;  2ZW5 A;  2OU2 A;  7CPA A;  2YNE A;  2IMO A;  2O28 A;  4M85 A;  4ZBG A;  3G8W A;  2PIY A;  4B5P B;  2CTC A;  4CYP A;  3D8P A;  2BL1 A;  3C26 A;  3GY9 A;  3TE4 A;  4FAI A;  4IHM A;  2ZEO A;  5ISV A;  1S7N A;  1JQG A;  5F09 A;  2AFM A;  4NSQ A;  2NMT A;  3CDX A;  3TT2 A;  4A2Z A;  3IJ3 A;  4MFL A;  2ZEM A;  4K30 A;  2CIJ A;  1M4G A;  4CAX A;  3NE8 A;  2FE7 A;  4CRZ B;  5C88 A;  5F46 A;  4CPA A;  2PJ8 A;  3R9E A;  3I3G A;  4B14 A;  2Q04 A;  4LUA A;  2FCK A;  3S6F A;  4JXR A;  3TOB A;  2Q7B A;  3PEI A;  1ELL P;  1NSA A;  1YQE A;  4H6Z A;  4H89 A;  4R3K A;  5H84 A;  4P4B A;  4AVB A;  3D3S A;  4TWE A;  5HVH A;  3ZJ0 A;  4BD9 A;  4NCZ A;  3EC4 A;  2ZEG A;  5G21 A;  4KOY A;  3IEH A;  4X2T A;  1PU9 A;  4CGP A;  2EVN A;  2J8M A;  4UWJ A;  2POK A;  1RO5 A;  4KOU A;  2ARH A;  4NGM A;  3V7Z A;  3LD2 A;  1IY7 A;  2V8D A;  1XBU A;  4HNY B;  1YVO A;  4L8A A;  2DPS A;  4A33 A;  2VEZ A;  1YW6 A;  4CGL A;  4MHN A;  5G22 A;  1Y7E A;  2EK9 A;  2FVG A;  5D29 A;  3PB8 X;  2CNS A;  1HDU A;  3BXM A;  4MCS A;  1ZLH A;  1Z2L A;  1CP7 A;  4P4F A;  1XJO A;  2R1I A;  1OZP A;  1BLL E;  4OLL A;  4DUK A;  1CG2 A;  1XFO A;  3V8I A;  2YND A;  3FYN A;  4M6I A;  3GLJ A;  4LQG A;  2BEI A;  1LAN A;  2OZG A;  2YNC A;  4YWY A;  2V8H A;  1F2O A;  3P2H A;  3KQX A;  5A27 A;  3WC7 A;  2RFH A;  3W6S A;  3LWU A;  5J8F A;  4AB7 A;  1VHO A;  1PUA A;  4HKF A;  5JGF A;  5DWM A;  1QSN A;  4QUS A;  5LRK A;  1Y0R A;  1QSO A;  4JZ0 A;  2EBJ A;  4MY3 A;  1Y9K A;  1KZF A;  2ANP A;  3NE7 A;  3EFA A;  3SI1 A;  4L89 A;  4W9Y A;  3VAT A;  4PK2 A;  1RTQ A;  4DYO A;  3CZX A;  2Q0Y A;  1R43 A;  2Z11 A;  3NH8 A;  4MFP A;  1FY7 A;  1QST A;  1S7K A;  2Q44 A;  4LX9 A;  2PRB A;  1IOI A;  1J4J A;  1VHS A;  3D4U A;  3JTK A;  3KHZ A;  3KI9 A;  4FD7 A;  2PJ6 A;  4CGO A;  4UWI A;  4F9U A;  5K8N A;  2Q43 A;  4XPD B;  2J8N A;  4NGQ A;  2BUE A;  4R9M A;  1AMP A;  2EO8 A;  4FD6 A;  1LAP A;  4PSX A;  4B13 A;  2B58 A;  3MRU A;  4NJQ A;  4MCP A;  2QEC A;  1BAV A;  3FEE A;  3VWE A;  4K3N A;  1Z4E A;  3K2K A;  4QVT A;  5JQ4 A;  1ON0 A;  5G20 A;  3GB0 A;  4UIA A;  2REE A;  3KHX A;  4PV6 A;  1IIC A;  4KVO E;  1XF8 A;  2RC4 A;  4KVX A;  4HPS A;  2PVV A;  3QAY A;  1PCA A;  2REF A;  2ZW6 A;  2JBK A;  2O53 A;  4ZX9 A;  3JUW A;  2WYR A;  3S9M A;  5LYL A;  5DWN A;  3B3W A;  4R87 A;  2FL4 A;  3KL9 A;  4P4D A;  4ZYQ A;  3E0K A;  1LOK A;  1XE4 A;  5K8P A;  4KOX A;  4JLY A;  3GIU A;  1TF8 A;  4MXU A;  3TTH A;  1HDQ A;  2HV2 A;  3RBU A;  4C7I A;  6CPA A;  2G3T A;  5LYI A;  3IWG A;  2GFQ A;  2ABZ A;  3HUV A;  4F6A A;  3CXP A;  1YR0 A;  2AFW A;  5IB9 A;  1YX0 A;  1I21 A;  4NFR A;  3TX8 A;  1UWY A;  4AG7 A;  2OZU A;  2Z3L A;  3TOA A;  2PC1 A;  4GXH A;  1Q2D A;  3DGV A;  1M4L A;  4EFD A;  3JRU A;  4CAE A;  4ZX8 A;  1FT7 A;  5J8C A;  2PJ2 A;  4UIB A;  2G9D A;  3PFE A;  3MGD A;  4X5K A;  3GYA A;  2FSR A;  3D7D A;  4U9Z A;  4XPL A;  3FEC A;  5JH9 A;  3OWC A;  3IIB A;  4KVM E;  4ONW A;  5AGE A;  1Z8L A;  2ZEP A;  5GCN A;  1Y0Y A;  1X12 A;  5IX3 A;  2PCU A;  4U5Y A;  4AVA A;  5JM6 A;  2BSW A;  3FXT A;  4ZI6 A;  2JBJ A;  4OC3 A;  4E2A A;  2VQY A;  1YW4 A;  4PXD A;  3UY5 A;  2JDC A;  3FNC A;  1S7L A;  3IU1 A;  4NXY A;  1XRY A;  1YME A;  2XEI A;  2XEG A;  2QJ8 A;  4YRH A;  1ZO0 A;  4F0X A;  4NGS A;  5D8N A;  2XEJ A;  5JPH A;  2AFX A;  1GHE A;  4CYO A;  3S9L A;  5HH1 A;  4YFJ A;  1S3Z A;  1B87 A;  2B3U A;  3TO9 A;  1Z9U A;  4ZGY B;  3NH4 A;  3QNV A;  4RN7 A;  2ODF A;  2H5M A;  1S7F A;  4UEF A;  4DJL A;  3EY5 A;  3FF3 A;  4P44 A;  1ZLI A;  2PJ0 A;  3TCV A;  1GYT A;  4TNU A;  2PDO A;  4UCM A;  4JWP A;  5EC4 A;  3NH5 A;  1XMB A;  1YGH A;  2FIW A;  2JLM A;  1I12 A;  4UFW A;  3EO4 A;  1Z8X A;  4PSW A;  5KTC A;  1Q2Y A;  3V38 A;  2ATR A;  1MK4 A;  2JEV A;  2WSA A;  4C2X A;  2GIV A;  3H8G A;  3PP9 A;  4UCN A;  2VZY A;  3GKR A;  2C6P A;  4M3S A;  5K8M A;  2WPW A;  4OIW A;  3CPA A;  3D66 A;  8CPA A;  3IWE A;  5HMN A;  4CAW A;  4X8I A;  2P6G A;  2DPT A;  2PJ3 A;  4OC5 A;  3K9U A;  3FJU A;  2B4D A;  2ZW4 A;  3B3V A;  5HXD A;  1PYT B;  2HUZ A;  1S5K A;  1F57 A;  2NSM A;  1YLO A;  3H8E A;  4O23 A;  3SHP A;  4A94 A;  2OR4 A;  1UFH A;  4RI1 A;  4MCQ A; 
#chains in the Genus database with same CATH homology
 2YNC C;  4QB9 A;  4CAV A;  2FT0 A;  3RYO A;  2WPX A;  3D2P A;  1KUX A;  4Q36 A;  5F47 A;  3B8G A;  3FBU A;  4QBJ A;  4IF5 A;  3F5B A;  1IB1 E;  4IUS A;  4NF1 A;  4B5P A;  1IYL A;  4UBR A;  4MY0 A;  2Q4V A;  1P0H A;  3BJ7 A;  4MFQ A;  2YGW A;  4PK3 A;  1NMT A;  4KOV A;  2P6E A;  2Z3N A;  1TIQ A;  3PZJ A;  3FRM A;  1CM0 A;  1IYK A;  3DNS A;  4B11 A;  5IV0 A;  1Z4R A;  3BLN A;  3H5Z A;  4AVC A;  4GS4 A;  1M4D A;  1P4N A;  2B5G B;  4FD5 A;  5FVJ A;  3FIX A;  1M4I A;  4KUB A;  3KKW A;  5H86 A;  4F0Y A;  4A32 A;  3FB3 A;  4KOT A;  4Q38 A;  2FIA A;  2ZW7 A;  3G3S A;  1WWZ A;  4B5O A;  1QSM A;  4KZT A;  1WK4 A;  3R1K A;  5BWA B;  1YRE A;  4Y49 C;  3WR7 A;  2B4B A;  1L0C A;  2G0B A;  2Z3P A;  2ZPA A;  3P2F A;  2A4N A;  2J8R A;  4B12 A;  2CY2 A;  4UCP A;  1MJB A;  4CYN A;  1YLE A;  2VI7 A;  4A95 A;  1YVK A;  1N71 A;  3JVN A;  3W6X A;  4DNC A;  3QAH A;  2CXA A;  4E8O A;  2PR1 A;  4FD4 A;  4UFV A;  2I79 A;  5I0C A;  5KTD A;  4ORF A;  3F8K A;  1XMT A;  1Y9W A;  2AE6 A;  2QIR A;  5AG5 A;  2VXK A;  3SXN A;  2PSW A;  5C82 A;  1IID A;  1V0C A;  3DDD A;  4E0A A;  4CS0 B;  3PGP A;  3T9Y A;  4CAF A;  2F5I A;  2P6F A;  3SXO A;  1U6M A;  4KSA A;  4CGN A;  1M1D A;  2HQY A;  2D4O A;  4C2Y A;  4CYQ A;  3I9S A;  3IGR A;  4MFJ A;  4XNH B;  2KCW A;  5AG6 A;  4JD6 A;  3QB8 A;  2PR8 A;  5F49 A;  1I1D A;  5A28 A;  4OAD A;  4H6U A;  1LRZ A;  1VKC A;  3TFY A;  2R7H A;  2P0W A;  4XPK A;  5E96 A;  2Q4Y A;  1QSR A;  2Z3M A;  3N7Z A;  1K4J A;  2R98 A;  1M44 A;  4U9Y A;  1Q2C A;  4OAE A;  3TO7 A;  2GAN A;  3A9L A;  3S6K A;  4UFX A;  2Z3K A;  5F48 A;  4MBU A;  4JXQ A;  4II9 A;  1XIX A;  4CRY B;  2GE3 A;  2DXQ A;  3VWD A;  1B6B A;  4R3L A;  3DSB A;  2Z10 A;  1Y7R A;  3DR6 A;  4MFK A;  4KLV A;  1BOB A;  1RXT A;  4HNX B;  4B10 A;  5AG4 A;  1KUY A;  1YK3 A;  4AG9 A;  4KS9 A;  2IL4 A;  4Y49 B;  2B3V A;  2OZH A;  5IB0 A;  4KOW A;  1BO4 A;  4RS2 A;  4BBH A;  3W91 A;  1SQH A;  3CXS A;  2Y0M A;  2JDD A;  4MJ8 A;  2ZXV A;  4YGO A;  4A31 A;  1NSL A;  3H4Q A;  5KTA A;  1KUV A;  3BJ8 A;  2G3A A;  3S6H A;  4ONU A;  4R57 A;  4KUA A;  2EUI A;  1MJA A;  1NE9 A;  4UA3 A;  3F0A A;  3CXQ A;  4C2Z A;  2I00 A;  3D2M A;  3DR8 A;  2VBQ A;  4C7H A;  5CNP A;  2CNM A;  2D4P A;  4BMH A;  4EVY A;  3S6G A;  4JJX A;  4MI4 A;  2C27 A;  3R9G A;  3EXN A;  2WUU A;  1CJW A;  4XPD C;  1S60 A;  2AJ6 A;  1R57 A;  1XEB A;  2Z0Z A;  4CGM A;  2VZZ A;  4KLW A;  3LOD A;  4MHD A;  5EBV A;  4QC6 A;  2B5G A;  2CNT A;  4MFZ A;  4NEX A;  3T90 A;  3ZZI A;  1MJ9 A;  2R8V A;  2B4D B;  2FS5 A;  2X7B A;  3R9F A;  2OH1 A;  2Z3O A;  4KOR A;  3TO6 A;  4A30 A;  2PQ8 A;  4KSF A;  3R96 A;  4I49 A;  2QML A;  4KOS A;  5G1Z A;  4C68 A;  5AG7 A;  2OB0 A;  2K5T A;  4HNW B;  4J3G A;  3IU2 A;  2FXF A;  3R95 A;  2ZW5 A;  2OU2 A;  2YNE A;  2O28 A;  4M85 A;  4ZBG A;  3G8W A;  4B5P B;  4CYP A;  3D8P A;  2BL1 A;  3C26 A;  3GY9 A;  3TE4 A;  5ISV A;  1S7N A;  4NSQ A;  2NMT A;  3TT2 A;  4A2Z A;  4MFL A;  4K30 A;  1M4G A;  4CAX A;  2FE7 A;  4CRZ B;  5C88 A;  5F46 A;  3R9E A;  3I3G A;  4B14 A;  2Q04 A;  4LUA A;  2FCK A;  3S6F A;  4JXR A;  3TOB A;  2Q7B A;  4AVB A;  4R3K A;  4H6Z A;  4H89 A;  5H84 A;  3D3S A;  3ZJ0 A;  4NCZ A;  3EC4 A;  5G21 A;  4KOY A;  1PU9 A;  4CGP A;  2EVN A;  2J8M A;  4UWJ A;  1RO5 A;  4KOU A;  2ARH A;  3LD2 A;  4L8A A;  4HNY B;  1YVO A;  4CGL A;  2DPS A;  4A33 A;  2VEZ A;  5G22 A;  2CNS A;  2R1I A;  1OZP A;  4OLL A;  3V8I A;  2YND A;  3FYN A;  2BEI A;  2OZG A;  2YNC A;  3P2H A;  5A27 A;  3W6S A;  5J8F A;  4AB7 A;  1PUA A;  4HKF A;  5DWM A;  1QSN A;  4QUS A;  1QSO A;  4MY3 A;  1Y9K A;  1KZF A;  3NE7 A;  3EFA A;  4L89 A;  4PK2 A;  2Q0Y A;  2Z11 A;  4MFP A;  1FY7 A;  1QST A;  1S7K A;  2Q44 A;  4LX9 A;  2PRB A;  1J4J A;  1VHS A;  4CGO A;  3JTK A;  4FD7 A;  4UWI A;  4XPD B;  2J8N A;  2BUE A;  4R9M A;  4PSX A;  4FD6 A;  4B13 A;  2B58 A;  2QEC A;  3VWE A;  4QVT A;  1Z4E A;  5JQ4 A;  1ON0 A;  5G20 A;  2REE A;  4PV6 A;  1IIC A;  4KVO E;  1XF8 A;  2RC4 A;  4KVX A;  2REF A;  2ZW6 A;  3JUW A;  5DWN A;  4R87 A;  2FL4 A;  3E0K A;  1XE4 A;  4KOX A;  4JLY A;  3TTH A;  2HV2 A;  4C7I A;  2G3T A;  3IWG A;  4F6A A;  3CXP A;  1YR0 A;  1YX0 A;  1I21 A;  4AG7 A;  2OZU A;  2Z3L A;  3TOA A;  2PC1 A;  1Q2D A;  4CAE A;  5J8C A;  4X5K A;  3MGD A;  3GYA A;  2FSR A;  4U9Z A;  4XPL A;  3OWC A;  4KVM E;  5AGE A;  5GCN A;  5IX3 A;  4U5Y A;  4AVA A;  2BSW A;  3FXT A;  4E2A A;  2VQY A;  3UY5 A;  2JDC A;  3FNC A;  1S7L A;  3IU1 A;  4NXY A;  4YRH A;  1ZO0 A;  4F0X A;  5JPH A;  4CYO A;  1GHE A;  5HH1 A;  4YFJ A;  1S3Z A;  1B87 A;  2B3U A;  3TO9 A;  1Z9U A;  4ZGY B;  2H5M A;  1S7F A;  3EY5 A;  3TCV A;  2PDO A;  4UCM A;  4JWP A;  5EC4 A;  1YGH A;  2FIW A;  2JLM A;  1I12 A;  4UFW A;  3EO4 A;  4PSW A;  5KTC A;  1Q2Y A;  2ATR A;  1MK4 A;  2JEV A;  2WSA A;  4C2X A;  2GIV A;  3PP9 A;  4UCN A;  2VZY A;  3GKR A;  4M3S A;  2WPW A;  3IWE A;  5HMN A;  4CAW A;  2P6G A;  2DPT A;  3K9U A;  2B4D A;  2ZW4 A;  2HUZ A;  1S5K A;  3SHP A;  1UFH A;  4RI1 A;  4XNH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...