3FBWA

Structure of rhodococcus rhodochrous haloalkane dehalogenase dhaa mutant c176y
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
b'EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Atomic resolution studies of haloalkane dehalogenases DhaA04, DhaA14 and DhaA15 with engineered access tunnels.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
total genus 107
structure length 292
sequence length 292
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2008-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fbwA00
1WM1A 1U65A 4ARAA 1MTZA 5AM2A 1WB6A 1XKLA 5JD5A 1CIJA 3IUJA 2C7BA 2OCKA 1G66A 1HLGA 3BIXA 3PICA 1QIHA 2VJAA 3I2KA 1ZD3A 3IUMA 5AI8A 3SK0A 2HRQA 4MWSA 5FP0A 2XI4A 1U4NA 5AM3A 1ZJ5A 4EY8A 2PPLA 3WIBA 5LKRA 2ECFA 1CUGA 4G4JA 2G4LA 1GPNA 3MUNA 1D07A 3EIOA 3BF8A 1E5TA 4W1PA 3OG9A 1QJ4A 1EI9A 2WJ4A 2ZJ6A 3G8YA 3D59A 3IURA 4XX1A 3HXKA 4N8EA 2QOEA 1H22A 1ZOIA 2JGFA 1XROA 4DGQA 3QITA 5HKBA 3DJYA 1A7UA 2CUTA 1TKRA 3ANTA 2H7CA 3KDAA 3G0DA 3FVTA 3I2HA 5BOVA 2XUFA 1U8EA 5AM1A 3F98A 1WHTA 2CB9A 2YYSA 2YASA 1DTEA 5JZBA 4UBJA 4EY4A 2HA6A 3HI4A 1ACJA 2HM7A 4W9RA 3PFBA 3YASA 4FLEA 3WWOA 1E8NA 4ETWA 4AX4A 5I8PA 1Q83A 3DQZA 1YS1X 2X8BA 4FDMA 1CUDA 1H2ZA 2GBFA 2WJ6A 3WKAA 2RHTA 2WUGA 3WL7A 1QIDA 2HA7A 4BZWA 4ZGBA 3VVMA 4X97A 2GBCA 5JALA 4EA6A 1XLVA 1F0NA 2VAXA 4CCWA 1W76A 2BFNA 4D9JA 2QXUA 2WFLA 4X85A 2XMGA 4WCVA 2ZJFA 5LZ5A 4RPCA 2ROQA 1XLUA 5AKJA 1W52X 3W9BA 4EUSA 3WL8A 5T4BA 2OCGA 2HRRA 1CUJA 4N8DA 1CUVA 3FLBA 4GXNA 4YASA 5EIHA 5EGNA 5AP9A 5ALQA 3A6ZA 5AKGA 1A88A 4OB7A 1XZAA 1C7JA 3I2JA 3C87A 3R0VA 1VLQA 5C8XA 4IQ4A 5F4ZA 5CXXA 3BE8A 5ALJA 3A70A 3R3UA 5A71A 4Q3OA 4DIUA 4I3FA 4ZI5A 3LLCA 2VAVA 3F97A 4OD0A 4ZV7A 3FVRA 1USWA 2I3ZA 4Q82A 5FOQA 3D3NA 4C89A 3RKSA 3F67A 4FBLA 5AKIA 3SWWA 4HTAA 4J0CA 1QE3A 3M83A 1O6GA 5LZ8A 4Z49A 1Q0RA 3OOSA 3QMWA 4H18A 2PBLA 1RP1A 2WFZA 4B81A 1C7IA 3NGMA 3WKBA 2BJHA 1J06A 3IB3A 3L1HA 1A8SA 5ALGA 4BDTA 4HXGA 4XIIA 4Y2JA 3I2FA 5FXMA 1QIIA 1MPXA 1WB4A 2XQGA 1VE6A 3G0BA 4YK7A 2B61A 1E8MA 1B6GA 2QJRA 4KRYA 4H7HA 1DQYA 2IITA 1CUSA 4F5ZA 4K2AA 4GI1A 3W9UA 5JD4A 1ODCA 4B6GA 4CFSA 5ALZA 3ZLUA 1XZFA 3R3WA 3RM3A 1EB8A 2PM8A 5HCUA 3AZOA 4U2CA 1MN6A 4CG3A 4QA9A 1GKLA 3I1IA 5AKEA 1BN7A 4H7DA 3HLKA 4F0JA 4FLMA 4J0GA 1UK9A 1EDDA 4BVLA 2YH2A 4UUQA 5FRDA 5H3HA 4P08A 5T4FA 4AO8A 2WUEA 3P2MA 1DT5A 1GGVA 1HPLA 1QO7A 3H2IA 3NWOA 4KEAA 1GQRA 4AO7A 1CUHA 2HU7A 4KJXA 4B82A 4DLNA 2HA0A 4BATA 3C8HA 5CXUA 4JNCA 4X6XA 3EQ8A 2AJCA 2O7VA 4UBLA 4M0MA 2JGIA 2HDWA 4QLOA 4YPVA 6YASA 4XWGA 3K2IA 1ZIYA 1AX9A 3AZQA 2ZVDA 2XDWA 1QIFA 1XZCA 4PSUA 3C6XA 5C8ZA 3A2MA 2QVBA 2ZYHA 4W1SA 1VA4A 4NS4A 2XUKA 2XUIA 3HC7A 3MGAA 2O2HA 2Y2VA 3BF7A 1CPYA 2PUJA 4UHBA 5DNWA 3CN7A 1BN6A 3WWDA 5CT4A 4TPKA 5CMLA 4OYLA 1XRRA 5SYNA 2PSEA 3GBSA 3BIWA 5CT6A 2C58A 3WKEA 1R4ZA 3D2AA 1FFEA 2RI6A 4X93A 4IH4A 5ALUA 4HXEB 3R3YA 3GZJA 1YB7A 3F8SA 4AZ3A 4C88A 1YS2X 5CT5A 1IUOA 1LPSA 2HA3A 1E8DA 3HSSA 1EB9A 1IUNA 4AQDA 2Z5GA 1DT3A 2AJBA 4GLBA 4FKBA 1CUXA 3N0TA 2BUCA 4Q3LA 1CR6A 4AMZA 2VJDA 2BUAA 3WKCA 1CQWA 1KU6A 5AKKA 3D4LA 2WJ3A 1UKBA 2VATA 2I78A 3ED1A 4OB6A 1LPAB 1AQLA 3SC2A 2WILA 4XJVA 3IUQA 3R3ZA 2GYWA 1OCEA 4ITVA 5AK3A 5AIAA 3I1YA 2ZJ7A 2XE4A 1R88A 1XRPA 3HRHA 4LXHA 2XLBA 3VVLA 1L7QA 2BCEA 3MVEA 2W22A 5EHQA 2OCIA 2HFKA 1NU6A 3LIPA 1W6RA 1WCYA 2GYVA 5A2GA 3ZI7A 2VT6A 1TAHA 4EZIA 5EI5A 5SYMA 3C6BA 1LNSA 1EK1A 1YCDA 3KWJA 4UBIA 4Y2TA 3DDUA 1I6WA 4KRXA 1ACLA 4UBOA 2HL6A 2RIPA 2DQYA 1J07A 1X70A 1ZICA 2Y6VA 3UMJA 3DOHA 3R3XA 1VXOA 1YAJA 4AXBA 2WFMA 4OB8A 2JGMA 3FYUC 3G0CA 1ORWA 3S8YA 5KBYA 3B5EA 3FCXA 1UXOA 4WFIA 4K6GA 3FNBA 3IUNA 5E4YA 5ALPA 4OSEA 5DLPA 5CBKA 4G8BA 3FYTA 1ZI6A 2XMSA 4H35A 2CEKA 3O9VA 1B41A 3H2JA 1QTRA 3QVMA 4KE9A 1DINA 1MAAA 3LS2A 4ZXFA 1R1DA 2OCLA 1LPNA 5A6VA 1UOOA 1ZI8A 5E2IA 4BRSA 1XFDA 2XUQA 1XZIA 2O7RA 2E3JA 1AGYA 2C5GA 4JYPA 4HZGA 2O2IA 4G9GA 5ALDA 4LKOA 4GDMA 4QZVA 2UZ0A 2G63A 3BDVA 4IHAA 4YX9A 3HACA 1FJ2A 1PJAA 2C0PA 2Q0XA 1O6FA 5CH3A 5T4HA 3NOXA 5HF6A 2FX5A 4HRYA 4UHHA 5HFAA 4WFKA 1L7RA 5KWIA 3I6MA 3JYHA 1JI3A 4FNMA 1CQZA 2Y1KA 2P8SA 2DFPA 3R40A 1P0QA 2WU4A 1Z68A 1SCKA 3LIIA 4KE8A 3DNMA 2GZRA 1H23A 1XZHA 4L0CA 1WHSA 3KSRA 4DYHA 1EH5A 1CUIA 3KD2A 4Y2VA 3FOBA 3K6KA 5AJHA 2B4KA 2DHEA 1Q0ZA 2NW6A 1SCIA 1BU8A 5I9IA 3H18A 2D0DA 1QIJA 2WIDA 3D2CA 4X91A 5JD6A 4QDXA 3IULA 4UFPA 2WG1A 4UBNA 5DNVA 4K5QA 4ZRDA 5AI6A 5AICA 3WWPA 2WIFA 3DYIA 4BBZA 2OQIA 5K3EA 2JBWA 2EDAA 3V1MA 1VZ2A 2Z3WA 3BWXA 4Y2RA 2LIPA 1XQVA 2FUKA 2Z3ZA 4U2GA 4EY7A 3PFCA 2V98A 5AIBA 3ZLVA 2WM2A 4I19A 3OURA 3FAKA 4QEKA 4H7KA 3DCNA 3IIIA 1QTIA 2ZYSA 1JMKC 3U0VA 1XZLA 1PV1A 4X3CA 4B9AA 2PSFA 3G0IA 3WMRA 2ORYA 5CRIA 1PFQA 3DEAA 4FMPA 2BAGA 2I03A 1CLEA 5ALXA 2Y2UA 4PW0A 3EQ9A 3WWEA 4BYMA 4BCDA 2ACKA 5BWCA 3WIOA 2PU7A 2ZYRA 1G4HA 3VJMA 4J0IA 3QH4A 4X90A 1ZIXA 1TK3A 1KEZA 3QYJA 3AZPA 5ALNA 1L7AA 4W1QA 5IH7A 1FFBA 3ILSA 1VZ3A 4C4ZA 4EY5A 2JIDA 5LP1A 4H7IA 1SOMA 1SFRA 4GBGA 3UUEA 1GKKA 5HK9A 4C87A 2VJBA 1IZ8A 1LPPA 4G5XA 3O4HA 2RGUA 3H1AA 3KWFA 3QMMA 1QGED 4BAZA 3WLAA 4IH9A 4MWTA 3WK9A 3WQHA 4C4YA 5AKLA 5ALIA 3AIOA 1E66A 2QXTA 4K6HA 1HDEA 2O2GA 4O08A 5LZ7A 4MEAA 2J3QA 3D7RA 4DSAA 3QMVA 5E4JA 1HL7A 1UT6A 1LZKA 3V1LA 1N8SA 5EFZA 1AUOA 4CI9A 3D2BA 3N2ZB 5AI0A 2VA9A 3OM8A 1R9MA 5YASA 4G4GA 2CKMA 5IKXA 2ZSIA 1P0PA 1CUAA 1Q84A 4RGYA 5EIAA 2CMFA 2PL5A 4PNZA 2BKLA 2V96A 3ICWA 3WA7A 1H2YA 3DLTA 3VKFA 1XRMA 2XQJA 5AM0A 2PVSA 2WHPB 2XMRA 3G9ZA 2OAGA 2XT0A 5LZ9A 4LIPD 3T52A 1EVEA 5JAUA 5JYCA 4ZREA 3NUZA 3VJLA 3QZUA 3GROA 5ALTA 1XZGA 5FKJA 1X2BA 1FFDA 3V9AA 3U1TA 2WHQA 4C01A 4UPDA 4H7EA 2VF2A 4PQEA 5CURA 5JAHA 5ALWA 3L1IA 3ESCA 4P92A 1LGYA 5I7UA 1UKAA 1UK8A 1MNQA 5K5EA 5JZ9A 1ODSA 1AMNA 4RE5A 4JYMA 2HA4A 1W75A 1CUWA 5LKAA 2EEPA 1DWPA 2OGZA 3FSGD 4Q05A 3IA2A 5JADA 1VOTA 4ZWNA 3BJRA 1DX6A 5AHXA 2B9VA 4JUIA 4GEGA 4MQLA 5D3ZA 4UHFA 3H2KA 4C4XA 2WU3A 3I6YA 5AKZA 3C6YA 3KXPA 5AKHA 5FV4A 3C5VA 4LYEA 3WA6A 2XQFA 2CBGA 4F60A 3HYSA 4M0EA 4DMKA 3W06A 4G9EA 1JJIA 3O4GA 1Y37A 1XZMA 1H2WA 4ARBA 3CCBA 3DOIA 5DWDA 1GT6A 1UZAA 2QR5A 3FWHA 3G9UA 2H1IA 1TCBA 1CUCA 4E46A 1THTA 3C70A 5ALVA 2CZQA 1ORVA 3JW8A 1JFRA 4AN1A 2XUOA 4EY6A 1P0IA 2WHPA 3F9CA 1H2XA 2XUHA 5C8VA 3E0XA 2VT7A 5AK4A 5CTAA 5DYYA 4J0KA 5KWJA 5JANA 3IVMA 4LHEA 1NX9A 3WK6A 3OC0A 4H0CA 3AINA 4OCZA 4OU4A 2RHWA 3WZMA 2PU5A 2QTBA 1CRLA 2OGSA 4FOLA 5KREA 2WG2A 3QM1A 4NVRA 5AM4A 4BAUA 2XMZA 3QPCA 3S2ZA 3AIKA 4MEBA 4DTCA 3FYUB 1UKCA 1JJBA 3CXUA 5EHZA 1OILA 1G5FA 5AM5A 1XQYA 4N8SA 3STUA 2QKYA 5JARA 3FLAA 1RYYA 4FTWA 5ALHA 3G7NA 5ALLA 2C5FA 2V9ZA 1YAHA 2XUJA 1A8UA 3R3VA 5HF9A 4DNPA 1MO2A 4J0DA 3F96A 5FLKA 1YASA 4KR0A 5LZ4A 1HBJA 1YB6A 3QPDA 4BTVA 4HVTA 2WQZA 3I2GA 3H1BA 2WIGA 1XZJA 3RLIA 5K3CA 5C81A 2GBGA 4BE9A 3TGLA 5FDFA 4PSCA 4DNFA 5LYYA 4Y2XA 2XLCA 4PF1A 4A5SA 3C8DA 4PV7A 4EBBA 3PI6A 4P9NA 5JIBA 2G5PA 1BE0A 4TVKA 3ESDA 5AH0A 4FLFA 2J3DA 5D6OA 4HS9A 2DHDA 2Y6UA 1QFMA 3A2NA 3IBTA 4J7AA 4LXIA 1JU3A 1YA4A 3HJUA 4N5IX 3H19A 1AZWA 4BB0A 1R3DA 1IVYA 4UBKA 2H7XA 5LZ2A 1GXSA 5ALYA 3M81A 4WFJA 1K4YA 5FPPA 2VEOA 3H0CA 3B3QA 3UUFA 1YSCA 4BVJA 4AB1A 3CN9A 1CUYA 3H2GA 4X95A 4MYDA 4UHCA 1T4MA 4QDUA 3V1KA 1TCCA 2DCMA 2WUFA 3D0KA 3M3DA 5JASA 4Y7DA 3ZV7A 1EHYA 1AURA 1LPMA 1YA8A 2XMQA 5JAPA 3PUHA 4FNGA 2QS9A 3G9XA 1EX9A 1T2NA 3FYUA 5HF5A 5ALEA 2OG1A 4NMWA 4BE4A 4WJLA 4Y2SA 2J4CA 1F0PA 4QDTA 1XZEA 3STVA 5IVHA 3O9MA 1ISPA 2JF0A 4F21A 4MQMA 1UWCA 3O95A 2HU5A 1DU4A 1QO9A 3PDCA 1N1MA 3AFIA 1DX4A 2HHAA 2AJLI 4PO3X 1OXMA 2IX9A 1VKHA 3V1NA 1C4XA 2HIHA 3QPAA 5HQ3B 5ALMA 5ALRA 4MYSA 2JEZA 4WDQA 5IVIA 5CH5A 1A8QA 1QOZA 2XQIA 4X92A 1EINA 4IH1A 1F6WA 2WFLB 4H7JA 4UFOA 4WY5A 1CV2A 1BS9A 3O0DA 3G0GA 3X3HA 2WIJA 1QONA 1K63A 5DJ5A 4BC0A 3H2HA 2V97A 4BP9A 2WKWA 2CJPA 4HAIA 1LPOA 3RARA 3GELA 1J2EA 3FBWA 4E11A 3VJKA 4MJ3A 4LXGA 1JKMA 1XZBA 1IUPA 1G42A 5AI9A 4CIBA 4FBMA 4CG2A 2XUPA 1NU8A 2VJCA 4J3JA 4UHDA 4B7ZA 4BVKA 2JGEA 2OQVA 4WDRA 4X00A 4E15A 4H7FA 4UHEA 3AILA 5HFNA 5ISMA 2BGNA 5BV7A 3AUKA 1DQZA 4CCYB 4E14A 4AZ0A 5IVDA 3ESAA 3WJ1A 1N5RA 4U2BA 3TRDA 4OU5A 3ESBA 3CCCA 3JWEA 5HKAA 3C5WP 4OYYA 4BRZA 4DNOA 3STWA 3DKRA 2VQ6A 1TRHA 1SCQA 1ZD4A 3D5EA 3E1GA 4W1RA 4J03A 2JGJA 4UFNA 3BDIA 4GHWA 1R9NA 3EQ7A 2H7YA 1XKTA 2QUBA 3I6ZA 4L9AA 1N5MA 3WYNA 4BAGA 1P0MA 2AXEA 3EBLA 2QMQA 1XZDA 1WOMA 4KAJA 1JU4A 1YR2A 3WI7A 3PF9A 4KACA 5AOBA 4FWBA 2DQZA 2W6CX 5HQ3A 2JGKA 2QZPA 1GPKA 5FPQA 3TEJA 5BWBA 4G1FA 4M0FA 1VXRA 1U2EA 2OLEA 3AIMA 7YASA 4Q3KA 1E3QA 2G5TA 3O4JA 4DMCA 4OPMA 1EXWA 4Y2QA 4U2FA 3Q8WA 1WPXA 3RK4A 3FCYA 1XQXA 2QJWA 4J0HA 1R50A 4JEIA 4FHZA 4Y2PA 3LP5A 5IVKA 2J4FA 1FFAA 3H04A 1ZGBA 3WK7A 3DS8A 2DHCA 4C6HA 3HABA 5AOAA 3FSGA 3DL4A 4KYVA 4BTLA 3STTA 1QIMA 4Y9SA 1ETHA 2WHRA 2WSLA 4B83A 4Q1VA 4KE6A 1UOPA 2OPHA 1XZKA 3C45A 4AO6A 4CCYA 1MAHA 1K5PA 2HA5A 4A23A 4TGLA 3L1JA 2AJ8A 2X5XA 1QIEA 5AK5A 3VISA 1CUZA 5A7FA 3G9TA 1JT2A 1CUBA 4EB0A 2QUAA 2HU8A 5HF8A 4X6YA 4X6UA 4P93A 4QE3A 1F8UA 3E3AA 1AKNA 2WLSA 1ZJ4A 1DWOA 5LIPA 3STXA 5AI5A 3FLEA 4DMHA 3OPMA 5ALSA 4KAAA 4ZV9A 3IDAA 3ZPXA 1GPLA 2PSHA 3DKKA 5LLSA 5AOCA 1VA5A 5D3KA 1THGA 2HA2A 5AO9A 1UK6A 2OXEA 4A16A 4QLAA 4L3WA 5FUMA 1UK7A 4MXDA 2PSDA 2GYUA 1RWQA 2RONA 1CUUA 1XLWA 1TCAA 1J1IA 5ALFA 2ZYIA 5AI4A 2BUBA 2I3DA 3WK4A 4B84A 5HZGA 1LBSA 4QWWA 1QFSA 2JGLA 5DTJA 4UBMA 4B9EA 1X2EA 2Z8ZA 1Y7IA 4W63A 2PX6A 1HKHA 2VTVA 3WJ2A 3HZOA 3A2LA 4KE7A 4G8DA 4BZZA 2QT9A 5CT9A 2XB6A 4OUKX 1TQHA 4BCBA 1UFOA 2HADA 3V48A 2H9YA 1WPRA 1QZ3A 1FFCA 3DYVA 5K3AA 4AN0A 1S8OA 4DM7A 4HRXA 4U2DA 3WL6A 1GQSA 2ES4A 1W1IA 2XUAA 4Y2UA 3QBJA 4J0JA 5CT8A 2WUDA 4Y2YA 2QM0A 5EIEA 4GW3A 1FSSA 4H77A 1BCSA 2B20A 4V2IA 3MUOA 3C6ZA 3WL5A 3DL7A 3Q0TA 1CEXA 5HK8A 3ANSA 2ONCA 2PSJA 1W4LA 3W05A 2GZSA 2XQKA 3SX4A 5DNUA 4K6KA 4LYDA 1ZI9A 2PKYX 5DYWA 3PE6A 1WB5A 1EVQA 2YXPX 3H17A 3WWCA 1CVLA 1EDBA 2FJPA 4X94A 5JATA 4X7BA 3PUIA 4BDSA 4KAFA 1MX5A 4G4IA 5A7GA 2R11A 3E4DA 1IMJA 2ACEA 1MJ5A 4S0XA 5E4TA 3W04A 4FFWA 1XRLA 1EDEA 4JH0A 1ZD5A 4GECA 1AC5A 3WK5A 3BL8A 2R8BA 3B12A 4QNNA 1HQDA 2XMBA 1LLFA 3K9BA 5JAOA 3T4UA 4AMYA 1QIGA 4GWLA 1BRTA 3ZWQA 2C4HA 5K3FB 2OGTA 4RNCA 3HEAA 1MU0A 2RAUA 3I28A 5CH8A 4QDOA 2XMCA 3VXKA 1K6EA 1XRQA 5A62A 3G02A 5AKYA 1BCRA 1XQWA 4RE6A 5ESRA 4CG1A 1LZLA 3GUUA 2XMDA 3ZLTA 2BGRA 1M33A 3GFFA 2WIKA 1CFJA 4DNQA 5AK6A 2IIVA 4XVCA 1KU0A 5EHXA 4QDZA 1BEZA 4FFVA 4ROTA 5JZSA 5K3DA 4B0PA 1BEEA 2AJDA 3TJMA 3WKDA 1EK2A 5D7BA 3VDXA 4B0OA 1GZ7A 2D5LA 3C43A 5C7YA 4Q34A 1K8QA 1JMYA 2GBIA 5DTIA 5T4EA 3WYDA 4B85A 4BCCA 3LCRA 5DYTA 4B80A 5ALKA 1QLWA 2PUHA 4DMFA 4U2EA 1XRNA 2HFJA 4WY8A 2DSNA 1JJFA 2JEYA 2Z8XA 1VE7A 1ZGCA 2WTMA 2K2QB 1TIBA 3KOOA 4DSZA 2OAEA 4N5HX 1ZD2P 2ZSHA 3STYA 4NZZA 2XUGA 4I4CA 3M82A 3WK8A 3I2IA 1E89A 1MX9A 4INZA 1CUFA 1Y7HA 1VJ5A 3OTQA 1UOQA 1QIKA 2WG0A 4IO0A 5A7HA 5ALOA 1EA5A 3GA7A 4G8CA 3BXPA 4CIAA 2C0QA 4BP8A 1IZ7A 2XUDA 5K3BA 3PF8A 1DWQA 5CW2A 2EDCA 4X71A 1MX1A 2WTNA 1MT3A 2FJ0A 1LBTA 4HXFB 3W2TA 3WZLA 3BJMA 1LPBB 1ODTC 3DD5A 2X76A 4EHBA 4L72A 2VSQA 4BC1A 5K3FA 4PSDA 4QWMA 1CUEA 3R41A 3AJAA 1MNAA 2DR0A 2QRUA 5EHNA 1BROA 5AKXA 5J3JA 1SC9A 3EF3A 3ICVA 3O4IA
chains in the Genus database with same CATH superfamily
5FR2A 4AECA 1WM1A 1OJLA 1CNFA 2RK3A 2XNJA 2JJQA 3U4DA 4D79A 4ZK2A 1YZLA 3BMQB 1GTMA 3PEUA 5KDOA 4ARAA 2ZXUA 4YUVA 2DX7A 2I4NA 1CB0A 4WBXC 4FFRA 4MGZR 4UDNA 2CLCX 3INYA 5BQ3A 4X8OA 1VCHA 4AROA 3OKAA 3BD9A 1T3HA 1V8ZA 2B8TA 2VNKA 5ERYA 3O3CA 1V8BA 3EBPA 1P4GA 4ZJYA 3DMTC 2QW8A 4R5MA 4JN6B 3ZBQA 4P2GA 5DNYB 1H8HA 5JJLA 5KVCA 3BIXA 3PICA 2FFJA 1ZZGA 1L7EA 2J0VA 2VJAA 3I2KA 4IQ0A 2KS6A 4IXTA 4BVBA 3IQXA 2VC2B 2Q2QA 4OHCA 4E3WA 3CJRA 1PDVA 3KVOA 3BK2A 4WXRA 2HRQA 3B78A 4FOOA 4F4HA 3R4VA 2BI7A 4JKOA 4Q4HA 3PNPA 3ROEA 3PDHA 4KBYA 3ZQ6A 4BU1A 1ZJ5A 3SQWA 2Y67A 2PPLA 2NUAB 4YCBA 4C3OB 4KCGA 1QF6A 2I2CA 4D5EA 1QH8B 3OPXA 2BFDB 4G4JA 4I1OA 1GPNA 4Q1FA 3UV3A 1D03A 4JXXA 4HDRA 3EIOA 1B8PA 4ER6A 1B8NA 2PZAA 1KJJA 1MB3A 2JCXA 2R6HA 3IP6A 4X8MA 1T1GA 1HRKA 1S89A 4HCJA 4W1PA 3IEMA 5CM9C 3VR4D 1O0SA 2RHJA 3DC2A 1VG8A 3OAAD 3K70C 5DGDA 1GLGA 1QJ4A 1EAYA 1HTTA 1EI9A 3FF1A 2KJQA 3N3AC 2PUBA 3DR3A 1U1IA 3F5QA 1KOLA 3NHWA 4CKEB 1KS9A 1RKUA 3IURA 4M8SA 3HCOA 3HXKA 1T8PA 3GYGA 4OQQA 4PLPA 4Z3OA 1ZOIA 4F4IA 2I67A 1XROA 2C9CA 2Q28A 4IKOA 1YI1A 1S3GA 4XH9B 5CXSA 5AJWA 1A9YA 1I4LD 1BU5A 1DC5A 2E0IA 3QITA 1U0GA 1XOIA 1I5EA 1WVIA 3IRVA 1TVKB 2RCNA 3EC1A 1P81A 2GAFA 4HEA1 2CUTA 2JB9A 3AJ8A 3DMTA 3U49A 3FVTA 2RHHA 4KODA 3UA3A 3SLKA 1V2HE 3BXEA 1M7BA 2XUFA 3C3YA 2YDXA 5ECGC 3U7JA 2PT6A 4D46A 3IAEA 1OXBB 5CIQA 1ZAYA 2GNAA 2JH8A 2NO5A 1QKKA 1EXNA 2YASA 4TUYF 5IJWA 1GT91 3I45A 4XUGB 3CIOA 1J5XA 3H3XA 3JQ9A 4RQAA 4LJYA 3TZEA 3FGPA 1Y8RB 1XD8A 2HA6A 3EGEA 2IS1A 3YASA 4GM4A 1S5PA 2HHCA 3QUTA 1EFRD 3P19A 4FR5A 4KIJA 3KQHA 1U8UA 2QX7A 3DZJA 1E94E 5I8PA 1NYTA 3AF3A 2H2WA 4HDKB 2FY8A 2J33A 3EARA 1YBAA 2X8BA 4WEOA 5L6LB 1G6OA 1XTVA 3UGJA 1M2GA 4FDMA 4D0GA 4LHYA 1H2ZA 4Y6RA 1EK6A 1SHUX 3WDSA 4Z54A 4YECA 3RSLA 2D62A 3Q7RA 4WXMA 2J9FB 2WUGA 4H16A 1I51A 4RY2A 4IOMA 4L7QA 1DC4A 3TTYA 3OIGA 4Z0NA 4HL6A 4ZGBA 1U98A 4NZNA 2ZAIA 5CFOA 1YJ5A 1QRTA 3R7WB 3QI2A 3FKSD 1PDOA 3B6MA 4DA0A 4EA6A 3K5PA 1ENYA 1T9DA 3VHXB 1F0NA 1BXZA 4ZOBA 1KBQA 4XGKA 3AY3A 3VYSB 1X9GA 5J43A 5LSAA 5DK4A 3L01A 3W5UA 4D9JA 2QXUA 3PC7A 2IXEA 2P7HA 3IQWA 3GEGA 1NDUA 3CKKA 2XMGA 4FCCA 2YVQA 3Q88A 4P3OA 4XFJA 5C2JB 1EZ4A 2Q6IA 3PUZA 1DUSA 2G1JA 1BHO1 2V03A 1QG2A 2JL1A 2ROQA 1I6LA 9LDTA 1WEHA 1SXJC 4RCVA 3G59A 5D7NA 3JSAA 3IBSA 1QNLA 1KOGA 3CX4A 1EG2A 2CXOA 4ZANA 2Q5LA 4DR5B 1IJBA 4FMCF 4EUSA 1FUEA 2C95A 3GJYA 3C85A 5T4BA 4EG1A 2AYXA 1FS4A 3G9QA 2JCGA 4FHFA 4YIKA 1CUJA 4N5MA 5T7BA 5SY4A 4F8YA 3KAKA 4FEEA 1J90A 2H1RA 1DTWB 1OFUA 1PWEA 2J32A 4IY1A 4REMA 1SUSA 5EGNA 5I7HA 4IDPA 2OWDA 3B6ZA 3ZTYA 3P2KA 1WU7A 2Z98A 3IV9A 2CE2X 3A6ZA 4TLAA 2J0EA 2CFSA 3M6AA 4QDKA 5AKGA 5ALQA 4QTXA 1CY7A 3ISVA 1Z2EA 3F6BX 3HWWA 1E96A 2OWEA 3LO8A 1LVGA 4KBGA 1KA9H 2WP8J 1OJ7A 3R0VA 1ELOA 2FSIA 2RGEA 1KJ8A 4K6CA 3A25A 3AF5A 5TEVA 4EMBA 1KO8A 2B98A 3CNOA 2PR2A 3IPRA 3ZHRA 2QZ9A 5IJ0A 5JCJD 1TKBA 3B5IA 3DBLA 1DBVO 3JX9A 3WLNA 2ZYGA 2MSKA 2P5UA 4OKSA 1HOXA 2W6ZA 3EH1A 4RFSB 4C4SA 3RU2A 1BDMA 3GJ6A 1IEVA 3I6BA 3QEMA 1D6MA 4YJ3A 3GGJA 3ZY3A 3BE8A 3FVVA 5BW5A 2ZUBA 3QU7A 4PXYA 5AJZA 2D74A 3FDIA 4FOSA 1FFSA 4YMLA 3GCZA 2RCYA 4IJMA 2B1QA 3NTOA 3BBLA 1SVOA 1YZKA 3IDZA 1YL7A 4YT5A 1GPAA 4BLRA 4BYGA 5K01A 2C4NA 4GSKA 2YOHA 3VNRA 2NO1A 3WSWA 2G80A 4CTKA 3OZTA 4KFCA 3AESA 5KQPA 4ZV7A 1OF1A 2PR7A 1MV5A 3OIWA 4H1VA 1PQPA 1USWA 4WNCA 2JCVA 3FKQA 5B58T 2I3ZA 3OQ6A 2LRHA 2D0IA 5HM8A 4EK9A 1QJCA 4QQ8A 4FBLA 4OMFG 5AKIA 3SWWA 1M2VB 2FHPA 5J4VA 3L6EA 3HJGA 4GR4A 1O6GA 5LZ8A 4AG3A 3T54A 4MV6A 4RADA 1KAHA 3B1VA 3MWJA 3OQIA 4Y8VA 1JLLB 5FOXA 3TFQA 3KXLA 2IPOA 2F90A 2YWJA 3K0KA 3PD1A 1RJ9A 5JFOA 3EXIA 5KOHB 3DWEX 4DUGD 4ENTA 2F2TA 3LXMA 5IARA 3E48A 4G3XA 1EAMA 3KPWA 1T2UA 2V55B 2WFZA 5G4LA 4LF5B 2J0UA 2QXYA 4FC6A 2NU9A 3D2LA 3RKUA 3RWBA 1N2GA 1UXGA 3BILA 5AVKA 1JFSA 4H3VA 2BJHA 3JVDA 4KH1A 1RXEA 2VPZA 3QIVA 3L1HA 1A8SA 4NH0A 5ALGA 1CVIA 1PYOA 3AR6A 2H85A 1O57A 2GK6A 3PPIA 2OESA 1PFVA 2NZUG 3H16A 2P2CA 3QWHA 5FAXA 3W8DA 3REOA 3NOQA 2EW1A 3KZ1E 1MPXA 4FSDA 4GMGA 4EHHA 4MUFA 4HK4A 3PC8C 2B4YA 1JDSA 4Q66C 1B6GA 3TPCA 4E5UA 4MYHA 2QDXA 3IOBA 3ZCQA 1CVRA 2I76A 4ICIA 1MEJA 1DQYA 3OZBA 3QEKA 1ABBA 4QREA 4ZOLB 5HX7A 4RVDA 1B7GO 3A6DA 4QUHA 2WVAA 4EEKA 4YXWD 1XTRA 3AOGA 5DISB 5EA2A 5AHOA 4Q9AA 5LYJA 3SMQA 1E64A 1UMBB 2UZ3A 4XPIA 1ODCA 4P58A 3ZIDA 4ZO6A 3O47A 1PVVA 2V45A 1BAPA 4KSYA 1PGOA 1LX7A 4DIFA 4CN8A 4W5RA 5E7JA 1JHMA 3QX3A 1ADCA 3R3WA 3HDHA 5EJMA 3PT5A 4G0VA 2FPMA 2ADFA 1AF4A 2ARKA 3TLGB 4CGZA 4G37A 3B1ZA 2AUTA 3A1VA 3U37A 3IVRA 3AZOA 4UE3S 4CDRA 2G9RA 4CG3A 2ZB4A 1FSFA 2ZWVA 4MIKA 3T8YA 4TT3A 1GKLA 2Q2NA 3K9LA 3RD5A 4LF6B 1J9ZA 2DB3A 1BN7A 4H7DA 4LV6A 3ZVLA 1QS0B 5GIOE 1L3BA 3SC2B 3SYTA 1IK4A 5K0TA 1CP3A 1BX3A 1ODJA 3OM1A 4D25A 3WLJA 4YRGA 3GEDA 1RAHA 2YH2A 2FG7C 2E5FA 5FRDA 5BV8A 3ZDAA 1VLHA 5A6SA 5T4FA 3UMSA 1NN0A 1P4HA 3VC1A 4AO8A 4FFBB 4MV0A 3VYRB 1NMZA 1XN4A 2YIVX 1DT5A 3G6KA 4KQWA 1XHEA 4Q6BA 2QRJA 2I8LA 4LYFA 3RW9A 2XXAB 1DFHA 1Z6XA 3DP9A 3HYTA 4BMPB 4K0KB 1GUBA 2QSYA 3NWJA 4KO1S 3TOSA 2HU7A 3RREA 2H4FA 3K6SA 2UZIR 4J0FA 4NHEA 4UPVA 1WF6A 2I7VA 1MC5A 2HEGA 4BO3A 3PQFA 2DH5A 4I1SA 2AQ8A 4KUHA 1VLLA 1LC3A 5C5DA 4ZT7A 4PAGA 1R18A 2ZYAA 2AZTA 3H3FA 3LM8A 4C14A 5HWSA 1QYIA 5LMUB 3GT4A 5GWXA 1ZEJA 1PF7E 1RQNA 2AC4A 2CCJA 2I7DA 2FXIA 2Q6OA 3QKIA 5JFGA 1XEAA 1ECJA 5F3DA 5C3MA 4M0MA 4UEJA 2GPWA 2AQKA 2CCKA 2CJFA 3N07A 4BO1A 4D6YA 4I5EA 2OK7A 1R12A 3SM9A 3WLOA 4UE2A 2GZMA 1J22A 3D8TA 5INTA 1L1RA 2C9MA 3O9ZA 5EJFA 1C0PA 3AZQA 4R6WA 1U2QA 1JPNA 1X1SA 2XDWA 4LJRA 5F7OA 1RFLA 5F78A 4CEJB 1KETA 3N7TA 4CQJA 4BO6A 1I0LA 2GRUA 1S2MA 2FZVA 1Q95A 2QVBA 4BGEA 4K6OA 4IIFA 3E3OA 4W1SA 2R00A 2FU5C 1BNCA 1KMHA 3MSCA 3FOZA 5I48A 1PKXA 2OZEA 3HC7A 4CQMD 3MGAA 1FNMA 4QU0A 1UPUA 1M8KA 3IS3A 3U3XA 2WFAA 5FFFA 1ZP6A 2HSZA 2W2LD 5H8WA 4MGEA 1BN6A 1FRVA 2OA0A 4AS1A 4AKGA 4Z4HA 2ZI3A 5CT4A 3LA8A 3DULA 5K2OA 1KSHA 3FMGA 5CMLA 5L3QA 1SC3A 1JAIA 2X2EA 4MRMB 5HM6A 1DBPA 5GQSA 1UAAA 4N12A 4GM1A 1MOQA 4OGGA 1RDFA 3VZPA 1P62B 2YMPA 1Z5NA 2XTAA 1XMQB 2PSEA 5L7TA 1J70A 1PW5A 3A9WA 3DXXA 3JU3A 5G2OA 3QWFA 1CEEA 1GXSB 3JRWA 3WGUA 4NX2A 4IX9A 5KUTA 3WAKA 4YYZA 3C3DA 5CT6A 4AWBA 3WKEA 1EDZA 5FX2A 1EWKA 3OU6A 4CTNA 4DCNA 1HL3A 1ZJJA 3IB6A 3OFSA 3D2AA 4K9LA 1FFEA 4ZCSA 2A58A 2Z09A 1ZLYA 3KVVA 2RI6A 1TF7A 4IH4A 2V4MA 4QAJA 5DIZA 5AOVA 3S27A 4EEXA 2YFYA 3AM3A 2DKOA 4KFUA 3GAFA 4YJKA 3NLLA 3QVGA 5TB5A 4AP6A 3F7OA 1NE2A 4YMWA 3JR7A 4KQ2A 2UAGA 4U5XA 4WLVA 2VPXA 4RK6A 3ANYB 2LKDA 3GZJA 1YB7A 2N46A 3PEFA 4BO0A 1CR2A 1HT3A 2AQHA 3DNPA 4AZ3A 4CNQA 1UKVY 2FPGB 1JR3E 1YFJA 5EZYA 1KC3A 3ETCA 4G65A 1YS2X 4JUAA 5E4FA 2WTXA 3GG2A 4BP3A 3E18A 4LV5B 3W9YA 4AVYA 3SQXA 4XYLA 1VHDA 1LPSA 1NF8A 1JHAA 4D8UA 2V7TA 3Q3GE 2R86A 3UAXA 3L02A 1IBRA 5CIWA 3UXHA 1NQXA 4JY7A 4NZOA 4D3SA 1NW9B 4PM4A 3RT7A 2JFXA 3CSSA 2MWMA 4AQDA 3U39A 4A0HA 1BRMA 1U0FA 2Z5GA 4EJ0A 3ESZA 1OV6A 4WTOA 4FKBA 2DT8A 4JEUA 2A7XA 4AUNA 2JAPA 3GRZA 1CUXA 4HBZA 1F4PA 1P72A 2BUCA 3EW9A 3IPLA 4Q3LA 2PGXA 4P3NA 4AKTA 1CR6A 3KG2A 4XGQA 4F97A 2BMEA 1JAYA 2P6NA 4IVNA 5AW1A 2JH3A 1AXGA 2PS0A 3LZ6A 2AUMA 1RE1A 2CY0A 2GN1A 2VJDA 2JD1A 2JKYA 3MMSA 1DQPA 2JHCA 1TMYA 4M88A 1Y1QA 4NY1A 3OFVA 4BV9A 4JEHA 5ILOA 1KU6A 3UCXA 3EIEA 1U0RA 1P4AA 2D3WA 1W2GA 1YJAA 2XUZA 4MPRA 3UHJA 1STOA 2G9NA 3COJA 4CLDA 1P17A 4FYVA 3R3ZA 4PRYA 2IDJA 2GYWA 1OH8A 3OU7A 4ITVA 3G2JA 3LUCA 2B3TA 3HDGA 1O96A 3LG2A 5D1HA 3VSDA 1E3SA 5IK2A 3WBBA 4B2IA 3FBGA 3QWAA 1U0BB 1RYHA 3QLVC 5H1YA 5IANA 4A15A 3DA8A 1XRPA 3KVNA 4DDUA 2HLNA 3F6RA 4FDUA 4HDNA 3FVQA 4LXHA 3RVOA 4IDEA 3MVEA 4GS5A 2BFEB 1F8GA 4EMTA 4ERXA 4HVLA 3NM6B 2ZSFA 5LDDC 3GARA 3WGZA 2HFKA 1I1NA 2ALJA 2WMOB 1XJ0A 3HCCA 3VOAA 4ZYWA 2VQDA 1ML4A 4G5FA 3FB4A 1C4WA 4PWZA 2HLPA 4BKMA 2VPQA 1J8FA 2A5FA 1U7ZA 2A1TR 1S2GA 2BHNA 3AKYA 3H11B 4JB0A 3BWYA 1TK2A 2ZRNA 3BMCA 3LUFA 4LE2A 1L7BA 3P0HA 3U4QB 4HS4A 4MRRA 5KYWB 4BLOA 3OCJA 1K5HA 3UAVA 4I7EA 3NTVA 2WSMA 2AH5A 4H4CA 1CZRA 2JFYA 3QLTA 2OLJA 3HYLA 1N0WA 4BNXA 4FS8A 3OM9A 1YCDA 4IIHA 4A6PA 5T67A 3AX6A 1Z0KA 2ATCA 1I6WA 1KS2A 4HKTA 3R7DA 2EP7A 4HX2A 2Z58A 4C76A 3AKDA 1BYUA 1NV9A 2QZSA 5LQSA 3A4MA 3HKEA 5FI1B 2WMYA 1V9LA 2PQMA 3K53A 2ZQZA 4UBOA 4ENUA 2ODNA 2PUCA 1I32A 2ZVQX 2DQYA 1QKIA 4C03A 2NSDA 4PYQA 1J07A 1ZICA 4P2BA 4DV4B 1NBWB 2Y6VA 1KJYA 4X41A 2IU3A 3TD9A 3TQCA 1UEXC 3K8QA 4D9FA 1KO7A 3RC9A 4KZKA 1YVDA 2ATIA 3ZH2A 3Q3HA 4DVGA 2O2YA 1ITZA 4DXAA 3E3NA 2PWZA 2CLFB 3ZV5A 3ESXA 3R0IA 1WBJB 5KBYA 1NL3A 3I62A 4M0CA 3S2YA 4AF8A 2WJAA 2NP6A 2AOTB 3KZVA 3B5EA 3JSXA 4G0ZA 1SUBA 2W6IA 1VP3A 3GFGA 3OQOA 3FNBA 5CP8A 3BCSA 5ALPA 4U9UA 5EMLA 1P9LA 3GLVA 1ZWKA 4YI3A 1ICIA 5THQA 4OHMA 3TSCA 5K9ZA 2YUTA 4G8BA 4MRAA 5HZHA 3FYTA 1KP3A 1XBTA 4CR8A 4D9EA 5BW4A 4L5BA 1PWYE 3LHFA 1GUZA 4J16C 3H2JA 4YO7A 5DNAA 5HP4A 2VP9A 1J0EA 1QTRA 5F2EA 1C7ZA 1F3OA 3AYZB 4CMIA 2ZJBA 1XQ1A 2JAUA 3VTAA 2AX3A 4XQCA 2QMHA 3JALB 4GLFA 2DE0X 4AUKA 2BMDA 3O8DA 4KNWA 3MUFA 5D3MB 5FWXA 3O83A 1R1DA 3RHFA 2NQTA 4BWGA 3ZQ4A 4X60A 1SBIA 1CS0A 1XMSA 2JBHA 2OENG 2QTTA 3G2QA 3NGXA 4HZIA 1UOOA 4R7ZA 3X44A 1XPJA 2WE7A 4DCGA 1T24A 3T5AA 1UP6A 3GJRA 5M04A 4H2DA 5KTOA 3NTLA 1P2FA 2PD6A 2IP2A 3ZHQA 2O7RA 1XG5A 2E3JA 4GT1A 5JYBA 3W3AA 1BA2A 3RSCA 1NMEA 2PX5A 4Q1EA 4TV9F 3U7IA 1YONA 1VE5A 2C3UA 4HZGA 3S55A 1QVWA 3OESA 2QX9A 5DRTA 3RK1A 5ALDA 1YOVB 2DBVO 4LKOA 4GDMA 4LDJA 4QZVA 2UZ0A 1P2DA 3WWZA 5AQ1A 1SBNE 1Z12A 1Q16A 4IHAA 1EWVA 3PKIA 4LX8A 4O1MA 5GV8A 3ZTTA 3D43A 4MLPA 3A1WA 3B7GA 4CMAA 4R2JA 2Q0XA 1O6FA 4NEGA 2KQUA 2Z08A 3H84A 2HHLA 4ZT3A 4UOEA 1W36C 1SUEA 1N78A 4QO7A 1YNSA 4WOJA 4RD4A 4DTIA 3NOXA 2KYRA 2FX5A 2PFGA 2IYLD 2QMZA 3QWIA 2AN3A 4IHQA 1UJ2A 5KIAA 1Y8AA 3H5TA 1POWA 2VF5X 2FZEA 3MTIA 1HRDA 3OLWA 2IYAA 5E3IA 4WFKA 4BQOA 1UT8A 2DHRA 1YTUA 3IPYA 4J16A 4MW7A 3GN1A 3RVLA 3JYHA 4QATA 5TMEA 4TMTA 5HVNA 2R1ZA 1GAXA 4ZQFA 1NVEA 3FTDA 1D8AA 3ZCVA 4C7OA 2OFXA 1HNNA 1CQZA 1SVUA 3CX8A 4FGJA 4KPUB 2DFPA 3R40A 1P1IA 4MGKR 4RMJA 5EZ5A 3O73A 5DW0A 2C9YA 4PBSA 1Z68A 4OJYA 1T9HA 4JQSA 5BYBA 4U02A 1GCIA 1UFVA 3H9QA 4F11A 1U9YA 3AVPA 2GZRA 3DE5X 3LBAA 1GDTA 2H1OA 2GDJA 2AKEA 4DYHA 1E6EA 1VI5A 1O6BA 3GGOA 4R81A 2WWXA 4QGFA 1DBQA 1JZQA 1PJ8A 4QD3A 4YTEA 2X0FA 3TNJA 1DLJA 1BX0A 3RC7A 3MBKA 1E2FA 4BU0A 1LS1A 1UJNA 3JQBA 4IHJB 4K81B 2HKIA 1P39A 4PIMA 3SFVA 5CB4F 4Y2VA 1E2HA 4C5AA 4PRLA 1H8ED 3DV2A 4DSNA 1Q6YA 3DSRA 2C2GA 1SXIA 4P7JA 4ZAGA 2YVAA 3L41A 3P97A 1YDEA 1Z4KA 2RB4A 2W8BB 1BU8A 1H65A 4JVLA 3OEYA 1TF5A 4HZUB 2HMAA 3H18A 4S1VA 3TSOA 5I9IA 2HQOA 2D0DA 4TMYA 3UJ6A 2H92A 4LBYA 4X91A 4JP3A 4KX5A 3D0QA 3IULA 1IPFA 1FMCA 1LI4A 2IYOA 3ZD8A 1RCTE 1XEWX 1EFDN 1DOZA 3HCBA 4Q12A 3ZWMA 4J8PA 3AL0C 1Q2UA 2E1RA 3QFSA 2WG1A 3MCWA 5LLTA 5BWOA 4OHVA 5AI6A 5AICA 3RAJA 3V8MA 3WWPA 4E5NA 3QF4B 5CW1A 4D99A 1GQYA 2OQIA 4DBLE 1HNXB 5J1TB 3R7BA 4RK0A 4C0XA 4EYSA 4DR6B 3P2YA 5AVZA 2X7HA 2JBWA 1MH9A 4QGSA 1N2IA 5BSGA 1RJDA 5KNDA 1OFTA 1MO6A 2CDCA 3ZKWB 3L6DA 2LIPA 1I1OA 1XQVA 1XVLA 2VRCA 2YWFA 2Z3ZA 2ACWA 4R2MA 5CDTA 3KZMA 4MJXA 221PA 2VH1A 3GJ4A 4XI9A 1CYEA 1NW8A 2PKQO 4E5SA 3BGWA 2QQ0A 5F3WB 4KQ9A 4CBVA 5KZMB 4FMDB 5BXYA 2HCFA 1FK8A 1GZ6A 4I19A 2XCRB 3ZDBA 1NJSA 3ES9A 2DF8A 2G8LA 4JJ4A 1V16A 3F2IA 3UFBA 4CIYA 5BXQC 3DCNA 4MEAA 1WSAA 4B4DA 1KZGB 3DFZA 5FNVF 1B0AA 3T06B 3KQPA 1ECBA 2WV9A 4QJ5A 1IQUA 1EP3B 1KDRA 1XTSA 4OTZA 3PJRA 1X42A 1SG9A 2AWNA 2D5CA 3GFQA 4DY4A 1WBBA 3KLPX 3HCRA 3E23A 2E37A 2I2WA 4B9AA 3GX1A 4RORA 4C0QC 5A4JA 4OXKA 5I9SA 2Z5FA 3WMRA 1C9KA 2AWOA 5TS2A 1PFQA 1G0NA 2JBAB 3DEAA 4XLTA 4L73A 1KI3A 3RVKA 3SEFA 4RTQA 5IJ9A 2C00A 2I03A 5IABA 5F51A 3TMKA 3U3OA 1TEZA 2QG4A 3LYUA 3K92A 5FTNA 3L7CA 4ZD6A 2FYTA 1ZN2A 2XMPA 1QRUA 3RJTA 3HUUA 5CGQB 2O9JA 4MUEA 3AB8A 4B5KA 2ZJ2A 4A3SA 2RK4A 2WC1A 1J9EA 5C7LO 1B1CA 1QF9A 4GYYA 1E3WA 4DR7B 5K4HA 3AWIA 3SY8A 4F9FA 3TIIA 5BWCA 1IY2A 2PU7A 4RW0A 1G4HA 1K3UB 1L8XA 2GT1A 2JLUA 4BB9A 4KXUA 3ZDDA 1V95A 3QH4A 4X90A 1LVUA 1LW7A 5TMPA 1NIJA 4EM6A 4H15A 5GM1A 2GHQA 1KJIA 4RL6A 3F4KA 1AA6A 4N41A 1A96A 1DPFA 4QYXA 5CA0B 2HZBA 2H17A 5IH7A 2HCBA 1AUVA 4WCFC 4XIYA 5L3SA 3B85A 1X1EA 1SIUA 1JH9A 1SMKA 3PNQA 1CE8A 1Z6TA 4LK2A 4S1OA 1QZUA 4CR6A 5LP1A 2YXLA 1YFKA 4V24A 4ZV4A 2ZSBA 1N7JA 1SFRA 3NB0A 1VHJA 4RKYA 4C3UA 1G3MA 4ENRA 3F73A 4JC0A 1JALA 3NIWA 3BIJA 4HMQA 1DKPA 4JBNA 2I1WA 1JQEA 2VDQB 4C87A 2VJBA 3FPBA 4MV8A 2QZZA 3J81A 3NH6A 1MRZA 2PX2A 4AYTA 4GI5A 1LPPA 2ZSKA 1LI7A 4RPHA 2J30A 3RNOA 4YRSA 5LDHA 3HDJA 3I0NA 3PNOA 3QMMA 4WLOA 2HYIC 2RGWA 4F38A 3WLAA 4IH9A 4YAUA 3FTFA 2NT3A 4F7DA 1KI2A 1ZPDA 2OUIA 3BSYA 3E7PA 3PDJA 4OAQA 4I55A 1SZDA 3GI1A 1ORHA 2P62A 4C5BA 2BFPA 5D5PA 4F56A 1PZXA 5C5CA 1OLUB 3IA7A 2PA3A 1Z5PA 3N3BC 1WZEA 4WX2B 1LW6E 2GEKA 4K6HA 2JHAA 4QHSA 3PEYA 4ZMBA 4H1WA 3JARA 4V39A 4RZIA 4O08A 5LZ7A 3L6CA 4AD8A 4YRBA 1WTAA 2J3QA 3D7RA 4LZJA 2C5HA 3AK4A 2I1VB 2HSJA 3QMVA 1HL7A 2Z4RA 3SG0A 2IKSA 4QT0A 5FB3A 1LZKA 3V1LA 1YOBA 5ER6A 4PR0A 5GMOA 4KO4S 1BMFD 5EFZA 4B6FA 4BLVA 1RD4A 4QUJA 1UZNA 2VPWA 4OHUA 4AMUA 1BXKA 1A7JA 1A4RA 1ARZA 2FUG6 3D2BA 3L0BA 5CDFE 4GXTA 2VA9A 3KQOA 1YU9A 3NWBA 5JY1A 2MHCA 2OXCA 4ZMSA 3TW6A 5LFAA 4RIIA 1GGHA 3AHCA 3ADBA 5JROA 3CPSA 4HUQB 4PG7A 4XOUA 1HDYA 1QPBA 3V5NA 2ZSIA 2FZ5A 1U31A 1PJQA 3MWLA 1H3FA 4ND6A 1U2PA 1NF3A 1OXXK 3IEVA 4AG5A 1Q84A 4FFNA 3WXMA 2ZLBA 2CMFA 4MYRA 3T7SA 1OKKD 1FQJA 2XVYA 4P86A 4ZQEA 2JVKA 1JLSA 3EGIA 1L0BA 2LV8A 3DEYX 1HK7A 2D06A 3PNKA 1J00A 2YZ7A 3HKBB 3M4JA 3GJ0A 2MMGA 3SAJA 5JXJA 2FKAA 2NTVA 3KBBA 2F8MA 5F2KA 4MV4A 2O1EA 4S1NA 4RLFA 5TQ2B 3VHRA 1H2YA 1H2EA 4FZJA 2PS9A 2I6GA 3QU9A 4UVIA 3QX8A 1SAYA 3T3EA 2QUIA 2XQJA 2DPYA 3A0RB 1A72A 3Q87B 3ELUA 1K2WA 5BWNA 4Z4GA 1TTPB 3LX6A 2ZS8A 3M1AA 4DR4B 3URKA 2VZEA 1JIVA 1JQBA 2J46A 1XK6A 2XMRA 1R5NA 3R7SA 2HLDD 5B7NA 3L4KA 1V35A 1IOWA 1W9HA 3NYIA 5KJ6A 2RH8A 1CX9B 1GJRA 2XT0A 1A9QA 3VC2A 4DJAA 2E89A 1RWMA 1PNTA 3TIVA 1TLTA 4BWVA 4CR7A 3HXQA 3BWMA 4LIPD 1A9SA 1BFUA 3T52A 1EVEA 1EGMB 2DU8A 3PXAA 5K51A 3VR4H 4AF7A 1NJ2A 4A2WA 1AD2A 1C2YA 3JQ8A 3L0ZA 1ZGHA 4XTRA 4BUJA 5IDXA 4Y6LA 3COZA 3TKLA 3VR5A 3WHPA 4KGXA 1GUAA 4ZK6A 4YV7A 3A4LA 1ST2A 3E9RA 3OT1A 5JSHA 2I6FA 1EJBA 5ALTA 3K20A 1DV1A 1XZGA 1SU6A 4GZLA 2H57A 1YH3A 3ROXA 3MBOA 3SU8A 3CTMA 3M3HA 3GH1A 1U2GC 1WR8A 2ZQYA 4S2EA 3SIPA 4CUJA 5SY9A 4YRIA 2JJ2A 2AMYA 1E62A 2II6A 3H6KA 1EQUA 2YHUA 3AUYA 3RVNA 3ZBTA 3LPAA 4BE7B 1Q92A 4H7EA 4O4IB 4UVEA 1JF8A 2RGAA 4YA6A 4ILKA 3OZGA 4G25A 1DJNA 1T3ZA 3ZZNA 2MR5A 1QQ7A 4PQEA 1G8GA 4L0QA 5JSKA 5CDUA 1DI0A 4JQZA 3AERB 2WOOA 3T5CA 3KB1A 3X1MA 3ICPA 4NENA 3FW1A 2JK1A 5TY0A 3LUHA 3N6XA 1Z0SA 2VUHB 4MHTA 5LA6A 1OYWA 4QYIA 4XASA 2BZ1A 4EI8A 1MNQA 1T6ZA 3OJ0A 4LK3A 5HXAA 1WBDA 2D13A 3RASA 4L9RA 2Q45A 4EF4A 1JAHA 3NHFA 2ZOSA 4GC5A 4YP1A 5HKLA 4E32A 1GRVA 1GKYA 3FJOA 2GXUA 4YUAA 1QANA 3LBIA 5AVQA 5IYZF 1HWYA 4RE5A 5F1OA 2Q6LA 3ASUA 2CLIB 4ZYTA 2HA4A 4JJ7A 2I62A 1W75A 2V6BA 4V0QA 1N9KA 1WPGA 5FQOA 4CDGA 4GC9A 4ESEA 1IL0A 3A04A 1MVOA 4RHYA 1DWPA 4O4LA 2Z8YA 2FAXA 5BNFA 2RHCA 4N9QA 4UVHA 3GL9A 1UPXA 4RD3A 2FRVA 3B8EA 4Q05A 5EXDA 4EF5A 1G98A 3IUPA 4EB3A 1HYBA 3GZTB 4D2IA 5JADA 1JDBB 4KO8A 4MJLA 2NQ2C 1P7WA 2ZE7A 1FDRA 2HRBA 3HP1A 2EFCB 3KP1A 2A2ZA 2ZWMA 2EJUA 1JVBA 2WEKA 4EEZA 2EX1A 5DLDA 2CK3A 5L6MB 1I2CA 3CRZA 3KJHA 3ZCTA 4EFLA 4FFSA 2N3ZA 4XDHA 4DV5B 3OEEA 4LRSB 2EIHA 3RU7A 3SDSA 3U3JA 4ZT4A 5C31A 2E5WA 2GZDA 3MRSA 1QM5A 1SCDA 1W49A 2EXXA 3JAKB 1VHTA 3EC2A 3TQIA 1HE1C 2ZW9A 3FPCA 2A9PA 1ABFA 3O4FA 1EVJA 4IP0A 2D54A 1J9GA 4L95C 4L2IB 5JE8A 3P2JA 1P1KA 5FV4A 4GYJA 1BD4A 2XRYA 2XQFA 2QAJA 4M99A 4TRJA 2RHLA 2PH3A 1PJ2A 4KUEA 4M9SA 4O1IA 5D87A 2QYSA 3UGQA 1TZMA 1RBYA 2XWSA 2GCPA 4KQ1A 4CL0A 3CCBA 3K7EA 1GT6A 4QBIA 2ZXEA 5L3VA 2R6DA 3OHPA 1MC4A 4E1AA 2ERXA 3IR5A 3A4YA 5KYUA 3UEOA 4DJ5X 3ZWCA 4RVHA 3J80A 2J9XB 3VU0A 1TCBA 4KFSA 4E46A 5B12A 1THTA 3C70A 4MUAA 5HIAA 3BXXA 2DUUA 1CTQA 3PWKA 4OK3A 5C8YA 4HYYA 4I08A 3RRYA 2Y77A 3KT3A 4D8YA 1LKZA 1K3TA 5LNK6 3AEQB 1N5LA 5H80A 1GRQA 3TM4A 2PHZA 4N49A 1P0IA 3DZ8A 1UP4A 3F9CA 3FRHA 4ZHQB 3L7BA 1GFZA 1EJ6A 3E0XA 3UH1A 2VT7A 3TQHA 5DYYA 4J0KA 2P2SA 1WSBA 2IOQA 2A86A 4YJGB 2WZCA 4YT8A 3PJFA 4CM3A 3H5RA 4MVJD 3HM9A 1DQNA 2C59A 3H8WA 4O5OA 5H3LA 4F86A 3N58A 3IVMA 1GSAA 2GQ0A 3TRIA 3IAFA 3I8XA 4Q7KA 3GRVA 4IIJF 4JJGA 5IM4A 3EVBA 3CT4A 2WYHA 3CQ9A 3EK2A 3HNPA 2B1IA 3O2NA 3OLCX 4H0CA 5HGJA 3GWGA 4GDFA 4U2KA 1J33A 3IKVA 3O8OA 4HFNA 1L5LA 2O1SA 1T1SA 1BQ3A 4DV6B 2QN2A 4HQ6A 2EW2A 2QTBA 3TI7A 3BMOA 3IAAA 2OGSA 4AYWA 4G24A 4IS3A 4O1HA 5GVRA 3HB7A 2IE0A 2FP3A 3BRWD 4GSYA 2GCOA 3U7QA 3HJAA 1O5OA 4V03A 5AM4A 2Z6QA 1T8YA 2XMZA 4RGQA 3AIKA 5FYDA 4RYLA 1IPEA 2W2KB 1NYLA 1C1XB 3EAGA 2AHRA 4P3XA 2O54A 1UKCA 2YIMA 2PZ8A 5F64A 4HWPA 1F1JA 5EHZA 3WMWA 2O5CA 1R0CA 3FDZB 4I55F 4Z8YA 3GWZA 3NC0C 2Z2KA 4PGHA 3LY5A 3PQ2A 2XTJA 1R8YA 5AM5A 4TVSA 2FUEA 3E2IA 1T6NA 1MORA 3FHLA 4MVXA 4LOAA 2IOYA 3G6WA 4PWYA 4FU0A 4WHMA 4WN9B 8MHTA 3TX2A 2E4WA 2XA9A 3GFOA 4A0RA 3LOUA 1W85A 2G77B 4YCSA 2ZBPA 4L27A 3CLUC 4FB4A 5J2UA 1NN1A 3LC7O 5B64A 4YRTA 2OP1A 4NDZA 5JCXA 1XC7A 4GP6A 3S2GA 1ENPA 4C5CA 3ONVA 1BJKA 1IH8A 2XUJA 4M46A 1X1TA 5HF9A 4NKRA 5KNLA 4BO8A 4BEJA 4DS3A 3WOHA 2FSHA 1TM7E 1SJ9A 1GDDA 2P11A 4TTTS 3EN0A 4KR0A 1UIMA 1HBJA 3EWNA 1Z34A 4L8VA 1MW8X 2P9CA 2BELA 1T3TA 4HVTA 2O0LA 4OJNA 1E3MA 1YR9A 3BTVA 2E4AA 3HN6A 4MUXA 2ORWA 1XZJA 3BHMA 2HTEA 4DARA 5EJGA 2XHEA 1WAMA 1TJ3A 4BLPA 3F7MA 1I0IA 4P7GA 2C3MA 2EQBA 2V7BA 3ILXA 1FVXA 1BW9A 2R66A 1G3UA 2QTCA 1ISSA 5LYYA 2B30A 1IB6A 3ZI4A 2RHBA 2XLCA 4IOLA 4LE1A 4NQZA 1ULSA 4TLMB 5LMNB 2WT9A 4NNJA 3P45A 2Z6AA 1LDEA 1UBNA 4MS1A 3RNLA 3WYAA 4GNRA 1QH1B 3OCVA 3AUJB 3PI6A 5BSFA 5KHLB 4JI1B 1RI5A 1THZA 4PGMA 3TRJA 3O8LA 4G0UA 1VE9A 2GESA 2HLHA 3LNTA 5MGBA 8ADHA 4H7PA 4WH0A 5DGXA 5U1PA 3RHTA 5D6OA 3JWIA 5EPEA 4J3NA 2WZDA 3GOHA 1VIYA 4EHDA 2K5UA 5JTUA 1U0TA 1U8TA 2JDIA 3RIGA 2Y6UA 3GFBA 1J25A 2OZPA 4IGIA 4E7PA 3O3NB 1X1CA 3CH6A 4J7AA 4PC2A 5IDWA 3C1TA 1JU3A 3FGNA 2IUSA 4EA8A 1E3DA 4N5IX 1MTOA 1P0CA 3GIDA 3RFFA 4BVAA 2PV0A 2Q5QA 3LDGA 4EATA 5E6UB 1S2DA 2JRLA 2IIBA 3A7DA 3ER6A 1SC6A 1ENOA 3AVTA 4WBNF 4CV3A 1Y8ZA 1IVYA 1Z8HA 2HK7A 2P27A 3BUSA 4YQEA 121PA 1PZHA 2AOXA 2B6NA 2XQVA 3N39C 3Q1LA 4O2BA 4UBKA 4YP5A 5A9RA 3G5TA 3KQQA 4JROA 4CKCB 4K9DA 4LGYA 2Z0MA 3M81A 2B36A 5A3SA 2RBEA 3E5RA 5IG2A 1ZOSA 3AEKA 2HWUA 3LSTA 3PCRB 4L50A 3SN6A 1XEFA 2NU6B 2UZ1A 3QFCA 2Y0EA 3RTCA 1MAUA 3K31A 3S99A 1N6NA 1QHGA 4F60A 4NV3A 3B3QA 1YSCA 4BVJA 1FFWA 4KR2A 3HK2A 1T4CA 4QAQA 3KT0A 4AB1A 4QM6A 1Y63A 2R0QC 3KYCB 4ARIA 3EH2A 1SD2A 4GKAA 4YAWA 2ESRA 4X95A 1KK0A 5FV7A 2QX6A 1AHNA 1ST3A 4P31A 3QENA 4UJ5A 4CVNA 4BX3A 1Z5ZA 5LA6F 4E5KA 3UOWA 4ZQCB 2BR5A 3K8YA 1QMGA 1RYFA 3BORA 1XEXA 3EB9A 3M7IA 3U4AA 2ZJ5A 3G7UA 4Z99A 4OQNA 3LFHA 2IYWA 2RGGA 5GONB 1SEVA 1C2TA 2B69A 3AVOA 3NBMA 4ATNA 5I3CA 1JE1A 1GZUA 1IXKA 2IHJA 2PV7A 3GYBA 3O8BA 1J56A 3PFNA 4UEWA 2R5WA 2MDTA 3MOIA 3K2QA 3NHRA 2W00A 4QUKA 2R8EA 3OVMA 4UTOA 3L0DA 1ZESA 2QS9A 1OFHA 3G9XA 3KALA 4L5CA 1T2NA 4OLFA 3RJMA 2V7QD 1O5TA 2AZ4A 1L5WA 3BA1A 1XAJA 3FYUA 1Z4MA 2CMHA 2F3QA 4IQGA 2XF2A 2D1FA 1CF9A 4TWIA 1UBOS 1XJ5A 4N3GA 2ZROA 1F0PA 2AYYA 2QD2A 4UMEA 3V34A 1A77A 1Z26A 2FSFA 2ZGVA 1VYVA 3C6QA 3O9MA 4IW3B 4QDTA 2BH9A 1QR6A 1VMDA 2JF0A 2P67A 4LZOA 4IDGA 3V1UA 4UEOA 3D8NA 4X1KB 1M76A 5BT9A 4EGCB 3VO8A 3ZW8A 1RWVA 4I14A 5D5QA 2AX4A 2HU5A 2AB0A 1DU4A 3EDRA 1M1YE 2B8JA 3G2PA 3AFIA 1ZHFA 1ZJWA 1NUTA 4BQQA 1NVKA 2YWRA 1JKXA 4R4JA 3EHEA 4FT2A 1W30A 1ATZA 4RPIA 4LFCB 5JW6A 3Q8MA 1M1ZA 3CLUD 2DWQA 2VP5A 5ANRB 3RUIA 3TECE 2DECA 1IZZA 2IEYA 3BMXA 5CAEB 5CX4A 2ECKA 4R7GA 4AKEA 2G71A 1TTQB 1QZXA 4Z53A 2TRSB 2ET6A 5L53A 4I6JA 3M0EA 1VKHA 1W5TA 3PB3A 4M0LA 1EFRA 5PNTA 4JT9A 1QU3A 4HPWA 4F2DA 2CMDA 5ALMA 3HYRA 4F06A 1P2TA 4DG9A 1W93A 4LJLA 3DXYA 4RPGA 4B4KA 2WSYB 1C7EA 3DMFA 2YCLA 3KJGA 5IVIA 3L77A 3SZMA 1A8QA 2J3JA 3A8TA 3OTWA 4CJXA 5GTDA 1O0BA 3EXEB 4DKJA 4NCBA 1QOZA 4KQKA 5FBRB 4IH1A 5TNXA 2C2BA 2JKVA 2WFLB 4WBSA 4IX1A 4UFOA 4IL5A 3EEBA 4E2XA 4LWQA 3AG6A 2A3RA 1P0FA 3Q8XB 1BS9A 1IEQA 1L8OA 2CXPA 3UM9A 3O0DA 3G0GA 4Z2AA 1NONA 1Q0QA 2M6LA 3A6PC 1R6TA 1QONA 2D1RA 2EOAA 3FKSA 1L5KA 2VK4A 4K46A 1UJ5A 4Z1MD 4XJXA 4BC0A 1R0SA 3H2HA 1P7YA 5TF4A 2NNLD 5CLQA 1Z0JA 2CJPA 3MAJA 1DTSA 3ABOB 5BSHA 5BR1A 1UFQA 3RARA 3AEUA 5BUQA 4QGBA 2OV3A 2HCTA 1RC1A 2QPAA 4ZICA 4BQIA 3EXFA 1H4SA 1J2EA 4XR9A 3REQB 2GR9A 3Q98A 4QXPA 4YAOA 2NXWA 2Z56A 4E11A 1G7SA 4RMGA 1LDBA 5FUQA 3OBBA 2IDMA 4BY9E 1XZBA 3OO0A 3DPSA 5B37A 4GWGA 2PL1A 1X7WB 1KMCA 1UQRA 3NBAA 1RYNA 4FBMA 4RVCA 1SIOA 2X1HA 5FBQB 3W7AA 4DZRA 1FNCA 2VWPA 1DNPA 2YXNA 1WVMA 2M6KA 1HH4A 2FLVA 3BSWA 4A8TA 1O03A 4NG5A 4MR7B 4Q1BA 3WNBA 4CMCA 1W8DA 4K2HA 4UHDA 4Z0PA 4A82A 4BVKA 4D43A 1GPUA 2DEUA 3I5AA 3PHCA 3ICOA 4PPGA 1U3CA 1S02A 2GA9A 1N92A 4JL6A 3A3NA 2Y1FA 1KJQA 1W0KD 4N0MA 1P9NA 4QOIA 2HJHA 4WDRA 1PZNA 2IEIA 1UUFA 1X38A 2HC9A 2VJOA 3ORHA 4ND3A 2AXPA 1G41A 4Q39A 4WZBA 1C9EA 1VLMA 1BH6A 1OT5A 4ALLA 4UHEA 3AILA 3F6CA 1TZ2A 4P83A 2NSYA 4CQMA 4WIAA 3CA8A 3E35A 3T1HB 1AV7A 2AG8A 1IZ9A 2Q5CA 1VIDA 3FPFA 2BE7A 1QH9A 3T41A 1CJKC 2HJ9A 4P4GA 3WGGA 4CCYB 3Q2OA 2KBFA 4RPKA 2GZAA 2QVZX 3DLHA 1RZUA 1YHZA 3ESAA 4WMLA 3EYAA 1N5RA 3PEEA 3GV0A 1M2FA 3BQMB 1XMVA 2PSSA 4G5SA 4RF5A 1U0EA 1AK2A 3T5DA 3BFJA 5A06A 1ADGA 3I72A 4DCUA 4KR7A 5HKAA 3IP7A 2EBWA 3JWPA 3L8EA 3EGVA 1GG9A 2LXNA 2EV9A 3AR4A 3NXKA 5BORA 2P79A 1DX9A 3IR7A 3NI2A 4KR3A 3K09C 4LY6A 1Y6GA 4R1OA 2VJQA 2X1VA 3D7LA 3QXJA 5JTTA 5JJIA 1Q1NA 1DL5A 1ZD4A 3CLHA 4V2UA 1Z45A 5E6RA 1UR5A 1A9OA 1Y82A 3E05A 4A7PA 5JHHB 5M34A 1X7XA 3QPVA 4PXAA 3UMFA 2Q5JA 4TXJA 4N7MA 1GTL1 3PLNA 4PHFA 4OHFA 4NCAA 4URUR 4YVFA 4QUBA 1GTZA 1NVVR 2QUZA 3LX5A 1R9NA 1KK2A 3LT5A 4FYHA 4DUGA 3KTAB 1RHQA 1XKTA 1Y42X 3DM5A 4PU0A 2DG2A 5E1OA 2H2FA 2QUBA 3B3GA 3P96A 4BNDB 1FX1A 3E7FA 4OQPA 3OP1A 3I6ZA 1RAGA 3DD1A 3BTSA 4G1MB 2Q0QA 1N5MA 2PX8A 2QW0X 3DTTA 3WYNA 5JAIA 3QPBA 2OB1A 3EBLA 5CD1A 3MTDA 4TN5A 1P1FA 3GAMA 5MN5A 2JLZA 3HNRA 1KEEA 3D6HA 1MB4A 1ZNWA 2AN5A 2RH4A 4DIDA 3ZWNA 4I6EA 2VJYA 3I64A 5LDGA 4D8TA 1OX5A 1GDHA 3TLJA 3PF9A 4KACA 4DM3A 1JU9A 2O3RA 2JLQA 1DP4A 5G0SA 4CF7A 1S2NA 3P9ZA 4LX0A 4UD6A 2I66A 4LDQA 4EDFA 5BWBA 3IFSA 2BGIA 2EVWX 2BM8A 2Y1WA 1VXRA 3K09A 4NBNA 3VZQA 4Z7QB 4MPDA 5ULLA 1AJEA 4IEFB 3W4KA 1FPMA 3HY3A 2CXSA 2X58A 2YZMA 3H6GA 2H2DA 4YXWA 5JMWA 2J0SA 1D2EA 1UDRA 4G1EB 3ELBA 1M5TA 2EW8A 1H1LB 1ML3A 2VWHA 3HN7A 5J4YA 4EA9A 1DXYA 1K9VF 2JHGA 3R5KA 3O4JA 2QB5A 5BYKA 2I2AA 3AR2A 1CY4A 3DL0A 4O2BF 4DMCA 1TO1E 2GD1O 5ICEA 1DE0A 3PE3A 4DCPA 3ONFA 2ZG6A 4NJEA 2QZ4A 5JJCA 4DDKA 2CLDX 1KZHA 4DJFC 1DARA 1M7HA 2R97A 3KT6A 3Q8WA 1LK5A 3AOEC 3T7RA 4YT2A 2O8DA 4K1XA 2BTQA 4TKVA 5AXAA 1JJAA 3B6EA 3GFPA 4MQ4A 2HXSA 4FIDA 2DLCX 3ED5A 1C9MA 2VI5A 2Y0BA 3AXSA 3KOYA 4F3NA 2IPLA 3BSSA 2X3YA 1TL7C 3MILA 2QT0A 1D4ZA 2WPDD 1XQXA 2QJWA 3NVAA 3PGLA 4Y2PA 4FHZA 1L5YA 1V6AA 1CIPA 3LP5A 1PV4A 5EEHA 2F8TA 1NUSA 5CTJA 3VYUB 1ZGBA 1KY4A 3I01A 1ZD8A 4B3HA 3ZHUA 4NWIA 4BFLA 1R0XA 2IUTA 2DHCA 5CDSA 3HABA 4FGKA 4ZAWA 1GTJ1 1XU9A 4BNHA 5AHWA 2VUSA 3DL4A 3PUWA 2ZAMA 1K3FA 4GBMA 1TF2A 1UZLA 4UHJA 4EI2A 3KR1A 4KDEA 4RACA 2C7QA 1MABA 1RKVA 2Z8YM 4M53A 3W4IA 4E5PA 3D3KA 3EGDA 4G23A 4GOMD 1NLYA 4RXMA 4Q16A 4JBXA 4B44A 3FFAA 4U7DA 4YUYA 4M0PA 4KXFB 2WHRA 5LBIA 1KOFA 3L8DA 5EKUA 4Q1VA 5BUCA 2FPRA 4KE6A 1UOPA 3T95A 5JSZB 1G63A 2PTGA 3HCWA 2JAXA 4TQAA 4D4HA 1XPUA 3L3BA 5TQJA 3AEYA 4L5AA 3C45A 4EHJA 1U0SY 2I4OA 2K2WA 5EN4A 2BFBB 5HS6A 3PCTA 3HXLA 1O89A 1MAHA 3BH6A 4HAYA 3RJ9A 3THWB 3EVAA 1LCIA 3CUKA 2HJRA 1IJKA 3MMNA 4JXJA 4TGLA 3DLCA 1WLSA 1Z29A 3D3WA 5KNCA 4N40A 5JECA 3GLIA 2AJTA 4PFJA 4D8VA 3EX7C 1KMNA 5H9WA 2ZYUX 3HDYA 2QP3A 5MGNA 1E4EB 1PL6A 3C24A 2X3FA 1ORTA 2WYOA 3CUWA 1QHHA 1NP3A 1VBNA 2LPMA 3JTMA 2WHXA 5U9CA 3G5MA 3CTPA 3UT5A 2FPIA 2QPLA 3HSYA 5KKCA 5IN4A 1B00A 1JLHA 4GZ5A 5CK5A 5KWEA 2GKGA 4CM7A 5GP1A 3RADC 2JGDB 2QUAA 5HF8A 2C4WA 1CRWG 1V7PC 3B82A 2GO7A 1KZ1A 4OM7A 3IBCA 1Y3BE 2EBHX 3R24A 1QRAA 3LLVA 3W9SA 4Q4JB 1KDPA 3BGSA 4MVWA 3S40A 5I7SA 2EERA 3EQ2A 2O8FA 4P93A 3NDPA 2D7DA 2NZ8A 2X2FA 1YZNA 2H18A 4XYEA 4DGSA 7ABPA 1QPZA 2IEZA 1JEYB 16PKA 4YJHA 1ZJ4A 3FFTA 4QBTA 2Q3FA 2GH1A 1VJRA 1SXPA 4UXIA 1SZJG 1DWOA 4XPZA 3BQ9A 3PC4A 2QD3A 1UMDB 3LHSA 3ER8A 5IC4A 4EHLA 5ALSA 3P9CA 2FGKA 2HCJB 1CF2O 2BGKA 4AG6A 3R8XA 3HA7A 2I6XA 1IN4A 1PT9A 4CQLB 2HJSA 3ZPXA 4EX6A 4EKGA 2QBYB 1GTSA 1G8FA 2GJ9A 3EIWA 3NIFB 4D4KA 2PSHA 4TYPA 4US2R 4NS1A 1M8PA 3AO0B 4JL8A 1FBNA 5LLSA 4DA7A 1VA5A 3ADPA 3W5JA 3IKLA 1NJ8A 3MG9A 4Q02A 2Z1NA 4W6QA 5THXA 3O8NA 1Q6ZA 3ECAA 1T29A 1ZM4A 2OXEA 1QGYA 1PJZA 1YQ9A 4A16A 1F0KA 3HGQA 2HK6A 1G21A 3OA2A 1RRGA 1XO1A 2OXTA 4OF4A 5BSEA 5FUMA 2PJRA 4LZWA 2ZM5A 2F17A 2QI9F 2I4MA 2VDVE 3L1KA 4MXDA 5FA8A 2PSDA 1RWQA 2RONA 4KMOA 2C2HA 2VYND 5C35A 1GFSA 2GPAA 2FUG1 1RM4A 4MUKA 1J49A 1ZG3A 2BHRA 2H1SA 2VN8A 2D7JA 2LUOA 3F4LA 2GWRA 4X9XA 1W4RA 3TZQA 3FUWA 2WUWE 4IO1A 4Y6OA 4XD7D 2FDXA 1NWCA 1YUNA 2H1CA 1FDWA 1WMFA 3KFLA 4L22A 2OYRA 3WK4A 2BH2A 3DF7A 5F21A 4IXMA 4PZLA 1AXRA 3NKVA 1DVRA 1QO0D 3OQPA 3GDWA 4R9VA 2RHMA 3L82B 5DTJA 3Q5EA 4ZVVA 1NX6A 1C80A 4C30A 5I3ZA 3U44A 3QUAA 4UBMA 4IBOA 3QY9A 1EFPB 1QGUA 1NVMB 2GSDA 4ZYLA 5BT8A 5IPFA 3VA7A 4U5QA 1M75A 2Z8ZA 1D2GA 3AW8A 3GU3A 5FBLB 1LSSA 1U2TA 1U9JA 3ER9A 4OQYA 4MUYA 1K98A 1Y3IA 5G02A 3WJ2A 2AEEA 5CJPA 5TS3A 1U1EA 2PLFA 2QUKA 4JOSA 4V1CA 2UYHA 1QQAA 1E5QA 2CNWA 2OQRA 3A2LA 3HU5A 3L0CA 4IV0A 4QOGA 3UB3A 5REQA 4BZZA 1G20E 3DO5A 1M1YB 4UTRA 3ZY2A 3Q41A 1SCAA 3IUBA 4CETA 1GITA 1GWNA 4JC8A 5KOJB 1JI0A 1L2TA 1WO8A 2OV1A 1TUBA 3E82A 4JDUA 5JUWA 1L4KA 3TW8A 5LJIA 2H9YA 1V3TA 2BV3A 1WPRA 2Q4EA 2ZTUA 1O77A 2ONKA 3MCUA 3CY6A 4FJ2A 4XW2A 4IZHA 4NFSA 2FEAA 3SEZA 4L76A 3L7AA 3UPDA 2RMKA 4TM8A 2VWQA 2F48A 4L8GA 3T3GA 3R0ZA 5JH7F 4NSNA 2CHQA 4UULA 3C97A 3Q7PA 3TLMA 2QU7A 4AN0A 5AUPB 4J75A 2OHFA 2PMKA 2Y27A 4E70A 4H3HB 1MQSA 2WD7B 2HBZA 2Y1EA 3WL6A 1GQSA 1Z37A 4S0ZA 2FW8A 3DDCA 5DEIA 3HZHA 4NZYA 5AUNB 3KHKA 3H9CA 3C7CB 1XF9A 2WWHA 2YRXA 4NQRA 1JBEA 4OFZA 1SHKA 4MI3A 2PH5A 3HFJA 4Z9AA 5I47A 1U2RA 4KTTE 2R5FA 3DAHA 2AW5A 3QBJA 4TKMA 3ONWA 5G0UA 1R0YA 1RI1A 3TO5A 5KJCA 2V58A 4F8EA 4LXUA 2QPOA 3ADCA 3RRNA 2HTFA 2X77A 1HYHA 2B83A 4B3JA 5AW6A 5B4UA 3SBDA 1IB0A 4LGVA 3VX3A 5EIEA 2PX3A 3U3DA 3WDMA 3M6UA 5DXFA 2F8LA 4YJ2A 1T13A 2XWPA 1BCSA 3QBEA 3ND9A 3MUOA 3B7PA 1YQEA 2OV6A 3EMBA 3GLSA 3WL5A 3DL7A 5JAZA 1PJCA 3AUUA 3F47A 3EE6A 4EUHA 2EGHA 2QRQA 2YHBA 4GRIA 4A8HA 4C4AA 4AC9A 5JNVA 5AVUA 4B1FA 4JLWA 3N2GB 1EVYA 5F35A 2P30A 4ML3A 4TSFD 2QL6A 5DI3B 1WW3A 3FVWA 2AE2A 5J63A 4BMYA 2ONCA 1BDJA 4OQMA 4ZTUB 4DUPA 3RYCA 2H0RA 5G1PA 1TZBA 1GUYA 2GASA 2XQKA 2ZIXB 4UCWA 1UDXA 3S6JA 4DA9A 1GU7A 3GN2A 4JI5B 4K6KA 2QW1A 1ZI9A 2PKYX 5J4HA 3SOPA 4O2RA 5I9BA 3W1VA 3ZZ0A 2WTUA 5C3UA 3QKRA 4FJ0A 1MJGM 4HADA 5FWDA 1ANKA 3ZW7A 1OAKA 3GB9A 1KO5A 1VKJA 2YWGA 2A9JA 4NONA 2P77A 3BHIA 1DJLA 4YJFA 3BX1A 3H17A 3BCHA 3S2IA 3WWCA 2OMEA 2WP0A 3KE8A 1CVLA 3JZFA 3NUQA 5LUBA 1DEXA 1EFHA 5C51B 5GIPE 2P9JA 3JATA 4K86A 3PUIA 4JU8A 1YQWA 3MD0A 3FMFA 2IU4A 2C61A 4G4IA 1OTHA 3LT1A 5TGDA 3ZDRA 3THYA 5JPCA 4RF2A 4GOOD 3CEMA 3IUEA 2BBOA 5IP5A 1P45A 4S0XA 2ID8A 4YO8A 3IBGA 4UREA 1WD7A 3G1TA 3RUDA 4CUKA 3OEHD 3WAJA 1L3CA 1E2PA 4LV8B 4RH3A 4UU0A 2PLWA 3W04A 4UM9B 2SHKA 5AW7A 4FFWA 3R6GA 4XSHA 4RH0A 1EDEA 1IN7A 3O21A 3LUJA 4JH0A 4R8MA 4ZQHA 4F4CA 2DHQA 2VTBB 4D4JA 2PQ0A 1IM5A 3EISA 3LPDA 3PZRA 4GECA 4H27A 4IUDS 3WG9A 2CLOB 4ZAVA 1AGXA 2E49A 2Y4NA 2Z3VA 3P0EA 3EEYA 4JX9A 1CB7A 2QTLA 3DXFA 4E5VA 2XNSA 3NIGB 4K87A 4U0KA 4UNRA 1T8WA 1ZO8A 2PD3A 4MUIA 1HQDA 3HGMA 4LECA 4AMBA 5AVSA 5B2EA 3GLHA 2A9FA 3OU2A 4NBTA 4ZAYA 5GGYA 4EP1A 4UC0A 2KM1A 3KD3A 3SYLA 2I4IA 5KPDA 3TDMA 3ZWQA 1OXVA 1L7OA 2BLNA 3P2EA 4RNCA 2J9ZB 2X15A 2GCGA 2XCUA 4MJ7A 2CT8A 1FZTA 2IXAA 1T2CA 1RXYA 1L7XA 1YBVA 2ZP1A 3ZWDA 3HEAA 4F9GA 4DXDA 1MU0A 2JVJA 1GU0A 5CH8A 2NUTA 3UMRA 4WGFA 3AM1A 3L7JA 2W43A 4OH7A 4KLCA 2IUYA 3QIAA 1M9NA 1IXSB 1QFXA 1M2KA 1JA1A 1NUPA 2QTWB 5LNK1 2P3LA 1JDUA 1XQWA 3DVRX 4JJ8A 4KQXA 1GR1A 3MWEB 5I7FA 3ZU4A 4FZVA 4UUOA 4FR0A 4L1KA 3OD5A 5EE0A 1LZLA 1N2ZA 3EGCA 2A1UA 3GUUA 3L0SA 1V8DA 3C74A 5FBHA 2I80A 3NHJA 2BGRA 3IHKA 3QQ5A 3ZLTA 5IT0A 4EX7A 3QEAZ 2EP8A 3Q11A 4E22A 7ADHA 4BKOA 1UBRS 2IIVA 3BH0A 4ZO8A 1EGQA 3OQMA 4G1BA 3D6MA 2FR1A 4CG0A 1CYDA 1X13A 1JV2B 3RHZA 1VB3A 4DLYA 4EFDA 2ZBDA 1X14A 4K9KA 4KSCA 3RGWS 2YKGA 3LFUA 1TLLA 4B4WA 3EFOA 2CW5A 4CWAA 5MFPA 2CJXA 4PZPA 1BEEA 2WAMA 4LQ4A 4B3XA 4Q4HB 1M6VA 1NA5A 1MUUA 3AONB 1ZINA 1E9AA 1KY2A 3NTUA 1YC5A 2AJDA 5LP6C 3X1DA 4ARCA 4JI2B 1ECPA 1OREA 4UNNA 5D7BA 4B0OA 1PS0A 1F12A 4RY9A 3R5SA 2NXNA 1L5OA 2CNDA 4AY4A 4F3CA 4HDRB 2AF4C 1GAJA 1T9KA 4Q4CA 1D4AA 1U6IA 1ZN8A 3L8YA 5ES3A 2P5SA 3RVJA 1IY9A 5E7IA 1JMYA 1H5QA 4HAWA 1BQ4A 4QOJA 4CXMA 1NT4A 5DYTA 3T5MA 4O63O 4B80A 3CEAA 4L28A 2C5LA 4ZPJA 4DMFA 1H9AA 1XRNA 1ZW1A 1KQGA 3KWMA 4I2NA 1PVOA 4HDSA 2VZ9A 5LMZA 4GRAA 4MV9A 4P5EA 4WN3A 3WJ7A 3CVJA 2Y4OA 2WTMA 1TIBA 1FDUA 4PVCA 4NCIA 1YGYA 4JOQA 1J2TA 1WDKA 3RF6A 3RK0A 1IONA 4N5HX 1XCOA 1DFIA 3UAYA 2C2KA 2ZSHA 4PR3A 5CFPA 5FWAA 3C5EA 4I4CA 2IH2A 2F43A 3TNYA 1VCNA 3I2IA 4GSLA 1E1QA 3AVQA 4W5NA 4DF3A 1RHKA 1ZK3A 4LDZA 1JG7A 4DIOA 1JX6A 4ZOAA 1KHTA 4CDMA 3ZWXA 4LJ9A 2EFYA 1PFKA 1E0JA 3C5CA 1VJ5A 3OTQA 4MVJH 4RLSA 5DXAA 4D97A 4KITB 3HO1A 2J3LA 1Z3IX 4G2NA 1H0KA 2W93A 1Q1AA 5DCLA 3WP1B 5DM60 4OEHA 1NQ5A 2I6UA 1DBSA 4I5GA 5LP6A 2QTGA 1MAWA 2M32A 4IGAA 1FP6A 2YRFA 5A7HA 5HR5A 1R00A 5ALOA 2HD4A 3AVXA 4W99A 4AS2A 4ND1A 3V4VB 4G8CA 4WINA 3ET4A 1MH1A 3K70B 5K8LA 4D57A 4OIFA 1VMKA 4Y9DA 1L4GA 1PR6A 4R16A 2B3DA 3C98A 3TBFA 4V3BA 3BULA 4OYRA 1OYOA 3ZHZA 2ZAGA 2C9OA 1CDDA 3OE7A 3PF8A 3ZY5A 3FGZA 3WICA 1WDLA 1CDOA 2FN9A 3NEJA 2J5RA 4F3YA 4UPEA 1QE5A 4OI4A 2PEZA 4UDOA 1FY2A 1GGEA 3OZFA 4JR1A 4L15A 2OCAA 1KBOA 1MT3A <