3FBWA

Structure of rhodococcus rhodochrous haloalkane dehalogenase dhaa mutant c176y
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution studies of haloalkane dehalogenases DhaA04, DhaA14 and DhaA15 with engineered access tunnels.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 107
structure length 292
sequence length 292
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2008-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fbwA00
5HKBA 4UPDA 2QUBA 3IVMA 1MPXA 2FUKA 4IH4A 1VA4A 4S0XA 3G02A 2CB9A 4K6HA 1CV2A 1N5RA 2BCEA 4WFIA 5ALJA 2JGKA 4BRZA 2GBCA 4D9JA 2VQ6A 4DMFA 1KU0A 2HHAA 4JNCA 3EBLA 1WB5A 2P8SA 3DEAA 3IDAA 2ZJFA 1NU8A 5AKLA 4RPCA 4CG3A 4JUIA 1VOTA 4DNFA 2WG2A 1FFCA 2XUGA 3JYHA 4L3WA 5HQ3B 1DT3A 1JU3A 4FLEA 1OCEA 4WJLA 3G0BA 4PW0A 2PM8A 5LZ5A 2C5GA 4UFPA 1AUOA 2ACEA 4PSCA 3WK8A 4P08A 1ZGBA 1UKBA 4QA9A 3EQ7A 5CRIA 3O4HA 1MNQA 3G0IA 3UUFA 4OYLA 2RONA 5CT4A 1MX5A 2XUQA 5EFZA 3M3DA 3EQ8A 5AKXA 4AZ0A 4FBMA 3DNMA 2HA5A 2VA9A 5AK5A 4BVJA 5DNWA 3BE8A 1W1IA 5T4EA 2WUDA 5HF5A 5DNVA 1CUJA 2PSDA 4Y2QA 3WWDA 3PUHA 3IA2A 1JFRA 4BE4A 5FRDA 3H2JA 2CMFA 4ZWNA 5K5EA 3CCCA 4X6YA 2I03A 3N0TA 3I6MA 5FLKA 5JAPA 2BGNA 3BDVA 2YASA 3DYIA 1Y7HA 4B0PA 1DWPA 2E3JA 5JD5A 5EGNA 5BOVA 3WMRA 2Z8ZA 2WFLA 2O7RA 4KACA 4F21A 1F8UA 3H2GA 2HRQA 1HL7A 4PNZA 3TRDA 2Z5GA 4BZWA 4F0JA 1TCAA 3RKSA 4X97A 3QPAA 1ACJA 2Z8XA 3IIIA 1JMYA 2WU3A 3QPDA 1D07A 3F96A 4BC0A 5AI9A 1DWQA 3O9MA 2BAGA 4H7FA 3AIKA 3VJKA 4UBNA 3W05A 4DTCA 3I2JA 4J0DA 4B6GA 5ALQA 3V48A 2XQFA 4QLAA 3EF3A 3WIOA 4WY5A 3TJMA 3FSGA 5E4YA 4J03A 1LNSA 1USWA 4PF1A 4PSDA 4BAZA 3FYUC 2QMQA 2WFLB 3LCRA 5E4JA 4DNOA 1VLQA 1P0MA 3CN9A 3I2GA 3RARA 4C4XA 1OXMA 1J2EA 4HS9A 5LZ8A 3C70A 5HQ3A 3HJUA 1HBJA 3QVMA 5CT9A 4BB0A 2H7XA 3Q0TA 3E0XA 4GDMA 1Q0RA 4W63A 3WK7A 4TGLA 4G8DA 1EDDA 2XUJA 3WK6A 1C7IA 1UZAA 3WK9A 1CEXA 4KR0A 1CLEA 5AKEA 5A7FA 5ALOA 1CQWA 1ZI9A 2XUAA 1VZ3A 3NUZA 1R3DA 2EDAA 5I8PA 5AM5A 2NW6A 5HZGA 1ZI6A 3OOSA 5AI4A 4RGYA 1TKRA 5LZ7A 3MUOA 5AP9A 1N5MA 1XROA 5KWIA 2WUEA 1H2YA 2AJCA 3O95A 4LYEA 3W06A 2GBFA 5FOQA 3HABA 1F0NA 3EIOA 3V9AA 2QJWA 2HIHA 1ZGCA 1AZWA 2XUKA 3C8DA 1CUWA 1UT6A 3I1YA 3ILSA 3VVMA 2GYWA 1K63A 3M82A 5H3HA 2ONCA 1UFOA 2VJCA 3WKDA 4QDOA 5ALMA 5AOBA 4X6UA 2D5LA 4U2GA 2WM2A 1ZIXA 5DTIA 4JYMA 3FSGD 3R3YA 3B5EA 3EQ9A 1VJ5A 4WFJA 1XZBA 4GW3A 5BWBA 3VISA 1ZJ4A 3H2HA 3I28A 4IH9A 1KEZA 4FWBA 1J07A 2IX9A 4HXGA 2JF0A 3SWWA 2RIPA 5AOCA 2HL6A 4YASA 1VA5A 4PQEA 2OAGA 1XQYA 2I3DA 3TEJA 1EX9A 2QTBA 1C7JA 2VATA 5EHZA 4QEKA 3BXPA 3WL5A 4C4ZA 5CW2A 5K3AA 4E11A 5AOAA 4J0GA 1QIIA 2PSHA 2PL5A 1EVEA 1ZOIA 1X2EA 5EHQA 5FUMA 4B0OA 4X85A 2WUFA 2OLEA 5FP0A 2XQGA 5AM1A 3DL7A 4UHFA 2J3DA 5LKRA 2QR5A 2B9VA 2VAVA 3OM8A 2LIPA 4J0IA 1CUZA 1NX9A 3E3AA 3C8HA 1KU6A 4J0KA 4KAAA 4AO6A 1BN7A 1LBTA 5JANA 3R3UA 3RLIA 4BCBA 2G5PA 1R1DA 4N8EA 1TAHA 1AGYA 1OILA 1XLUA 2XUOA 5AKJA 4B9EA 3WKAA 1JMKC 1ISPA 2EDCA 1RYYA 4Y7DA 5IVHA 2BUCA 3GZJA 2DHCA 2RHTA 4FBLA 3A70A 3WK4A 1HLGA 4FOLA 1L7AA 3AZQA 1UKAA 2DCMA 2AJBA 3IUMA 4DMHA 1CR6A 2Z3ZA 3H18A 4NVRA 4EUSA 2O2HA 2OGZA 3DD5A 5AK4A 2C4HA 4UHCA 2ZYIA 1CQZA 3QPCA 2J4CA 5AKHA 4EZIA 5FDFA 4OU5A 3SX4A 3S8YA 4LIPD 1DWOA 5YASA 2OAEA 3AZOA 2X76A 5DJ5A 4OB7A 3NOXA 3ZWQA 4JYPA 4N8SA 3AINA 1UK8A 1B6GA 3G9UA 3IUNA 2ZVDA 3HC7A 4YPVA 1WB4A 1XZHA 5A2GA 1QTRA 4MYDA 1IUNA 4EY8A 2BGRA 2PUJA 3I6YA 3L1HA 4W9RA 4B80A 4AB1A 1H22A 2QUAA 2XQKA 1YSCA 4LYDA 1R9NA 1QIFA 2G5TA 2VSQA 2DQZA 5SYNA 5DYTA 3BJRA 3WKCA 3R0VA 5ALZA 3FYUB 4U2DA 4X91A 5FPPA 4HRYA 1ETHA 4TVKA 2H1IA 4U2EA 1IVYA 1G66A 4X90A 4IO0A 4UHHA 4Y2PA 3CN7A 1JU4A 2DHDA 2HA2A 2HADA 4P93A 4FFVA 4OPMA 1G5FA 1R4ZA 3B12A 3QBJA 5C7YA 3WL7A 5SYMA 2BJHA 5K3CA 4M0EA 2VT7A 2I3ZA 5ALWA 1XLVA 2HU7A 4N5HX 1IZ8A 2QS9A 2PKYX 1YA4A 4Y2XA 5A7GA 1TQHA 2HFJA 5A6VA 4GXNA 5DWDA 1XZEA 5AI8A 3ZLUA 1XZLA 5J3JA 4UBKA 4LXHA 3G0CA 1AURA 1AMNA 5DYWA 1THGA 3DKKA 2Y2VA 1QIHA 1Q0ZA 1XFDA 3BJMA 1ZI8A 2ZJ7A 2WIFA 4RE5A 2VAXA 2OG1A 3FYTA 2OQVA 5BV7A 4WCVA 1XZFA 4OSEA 4O08A 5ALXA 2ACKA 3LP5A 4ETWA 1JKMA 4EY5A 3W2TA 1R9MA 2R11A 5AICA 3STXA 5LKAA 2XLBA 4X00A 1CRLA 3AZPA 3WIBA 5I9IA 3A6ZA 4C01A 4Q1VA 2WQZA 4DNQA 1UK6A 5D3KA 1EI9A 1EHYA 2ZYSA 4GHWA 3GA7A 3IUJA 2ZYHA 3HRHA 1BEZA 4C4YA 2V98A 4B9AA 3H19A 1TCBA 3T52A 1AX9A 3WKBA 4OCZA 1ODSA 2XMDA 2K2QB 3S2ZA 1QFSA 2IIVA 1J06A 4MYSA 1WOMA 4BDTA 1F0PA 4G8BA 4UBIA 3R3VA 4CFSA 5FV4A 3I2FA 5F4ZA 2ZJ6A 2JBWA 5ALNA 3HACA 3TGLA 1K6EA 4UHBA 3B3QA 1T4MA 5I7UA 3QH4A 4G8CA 4K5QA 1YS2X 3OC0A 4KRXA 4X95A 5JATA 4CCYA 1I6WA 2HA6A 4GI1A 3WWPA 1BE0A 2DQYA 3WL8A 3DQZA 2DR0A 1C4XA 3C6BA 4OUKX 4KJXA 5A7HA 4BYMA 1H2ZA 5C8VA 3DCNA 2C7BA 2OGTA 1JI3A 1QJ4A 4HVTA 1WM1A 3SK0A 4AN0A 2GZSA 1IMJA 4IH1A 1DX6A 4XJVA 5LP1A 2ZYRA 2HA3A 3D59A 1QONA 5FXMA 2VJDA 3IURA 4KAFA 4H7IA 1CUYA 2V97A 1W76A 2X8BA 4AMZA 4BCCA 4Y2UA 2OCIA 4FDMA 3F98A 1MTZA 1FFAA 4N8DA 4LKOA 5HCUA 1XZJA 3ZI7A 3VXKA 1XZIA 1FFBA 1LPMA 2WIKA 1UWCA 4HZGA 2XUPA 3K9BA 3QMVA 4CG1A 1E3QA 3QMMA 6YASA 3H1AA 7YASA 3W9BA 4GBGA 4INZA 2DFPA 2WJ3A 1B41A 4Y9SA 3WWEA 2XMZA 3O4GA 1ACLA 3QITA 4XIIA 4ZREA 3VJMA 2HDWA 4QDXA 4LXIA 1ODCA 2OCKA 2AXEA 4QLOA 1QE3A 2Y2UA 4QWWA 4IQ4A 2YH2A 3GFFA 1M33A 4UHEA 5AHXA 1W52X 4WDRA 4AMYA 3IULA 1LPNA 3FCXA 4BTLA 2JGIA 3NGMA 3H1BA 1SC9A 5LZ4A 3M83A 3ESCA 1IUPA 1EDEA 3N2ZB 1CUAA 2XUFA 3RK4A 4BVLA 5CT8A 3STVA 3OPMA 4ARBA 5CH5A 4W1QA 4BDSA 3I6ZA 2ZSIA 5JAHA 4QWMA 2JEZA 2BKLA 2I78A 2XUIA 2JGMA 1GKKA 4OYYA 1SFRA 1BRTA 3ICWA 5IVKA 3C5VA 4Z49A 5ALGA 3R3XA 1A7UA 2WHPA 3X3HA 4EA6A 5T4HA 1EA5A 4WDQA 3E4DA 4GEGA 4Y2YA 3AJAA 3U1TA 2H7YA 4U2FA 4OU4A 5AIBA 1DQYA 2YYSA 1ZD3A 5EIHA 5AKKA 1EB8A 1ODTC 2XMGA 2V9ZA 4L0CA 2QT9A 2JIDA 1LLFA 3HSSA 2XMBA 3W04A 1XRLA 2HA4A 5D7BA 4DLNA 4CI9A 3H2KA 3D5EA 5AM0A 3O4JA 4HAIA 1S8OA 4AQDA 4QZVA 4PSUA 4Q3LA 3UUEA 5AKIA 1HPLA 3ED1A 3R41A 4A5SA 1MNAA 2C0QA 3A2LA 2H7CA 4Q3OA 5AK3A 2PSEA 4QDUA 4W1PA 4BBZA 4AXBA 4PV7A 1ZJ5A 4FLMA 1VE6A 1BU8A 3O4IA 4J0CA 2RAUA 4KE8A 4I4CA 1CUXA 3GBSA 5AKGA 2WFZA 3IUQA 3WJ2A 4EBBA 4WY8A 2CEKA 3L1JA 4ZV9A 5BWCA 4XVCA 3R40A 5LIPA 4EY7A 1ZD5A 2G63A 4LXGA 1TCCA 4FKBA 3WI7A 3PI6A 4ZV7A 4C87A 1A8UA 5HK9A 3IBTA 4GWLA 1WPRA 3ZPXA 2WUGA 4OB8A 2WIJA 3WQHA 1GGVA 3F97A 4MWTA 2RHWA 2DSNA 1YB6A 5DYYA 2JGLA 4EHBA 1JJBA 1MU0A 1QIMA 3ANTA 1A88A 4MQLA 2QVBA 3V1KA 3DOHA 3FWHA 5D6OA 1BCRA 1XQWA 1LBSA 4G9GA 2Y1KA 4NZZA 4QDZA 1YCDA 3D2AA 3WYDA 2WSLA 3C87A 4XWGA 3C5WP 4IHAA 1LPBB 4XX1A 3HXKA 4Y2SA 5CXXA 3VVLA 1VE7A 5AIAA 2GZRA 3FLEA 3FNBA 4BE9A 3HI4A 1GZ7A 4BZZA 3HZOA 4Q34A 1MJ5A 1CUDA 3PF9A 2J4FA 3L1IA 2HFKA 1JJFA 3LIPA 4Q82A 4A16A 4QE3A 5JD6A 3ESBA 5ALVA 4MEBA 4J7AA 1H23A 4HXFB 4F60A 2DHEA 3O0DA 5ALIA 3KOOA 3QYJA 2HU8A 2O2GA 3FVRA 3BWXA 3HEAA 5JZ9A 2FJ0A 1MN6A 1XRRA 5EI5A 3BF8A 4PO3X 1YA8A 1BN6A 3DL4A 1RP1A 2PU5A 2WHPB 4DMKA 3D3NA 4KRYA 2GYUA 5HFAA 2XI4A 1W6RA 5T4FA 1QIGA 4X3CA 2H9YA 3BDIA 4ZGBA 1A8SA 4X6XA 4AO7A 4M0FA 1QLWA 4NMWA 1HQDA 4U2CA 3WYNA 2FJPA 4G1FA 1TK3A 1UK9A 5ALSA 3LIIA 4H7EA 5ALDA 1EK1A 1QIEA 4C6HA 3F67A 4I3FA 4V2IA 1JT2A 3AIMA 5EHNA 3PFCA 4E15A 2WJ6A 1XRMA 1X70A 2PUHA 4CG2A 3CXUA 4Y2JA 4UHDA 4P92A 1XZKA 3A2MA 1XZAA 3G7NA 3ZV7A 1NU6A 4FNMA 2XUHA 4H7HA 4H18A 3G9XA 3GELA 4N5IX 1E8DA 5AM2A 4KEAA 1GPNA 2WIGA 2GBIA 4BCDA 4UBLA 1BROA 5FPQA 3BL8A 5CT5A 1O6FA 2W22A 5ISMA 2PVSA 2B20A 4UBJA 4J0HA 2Q0XA 5E4TA 1K4YA 3MGAA 3F8SA 2RGUA 1N8SA 3ICVA 3U0VA 1ZIYA 4M0MA 1EH5A 3C45A 1XRNA 5JARA 3C6YA 2WG1A 3SC2A 5DTJA 2J3QA 1LPPA 5LYYA 5K3EA 3WJ1A 1EDBA 4G9EA 2Z3WA 1E66A 1CVLA 2BFNA 3D2CA 2UZ0A 5CBKA 1L7QA 5AKYA 3PFBA 1YS1X 2BUAA 1WHTA 4HTAA 5HFNA 3WZMA 3AILA 2JGEA 2CZQA 5AI5A 5ALUA 4QDTA 2XDWA 4QNNA 5JIBA 3IB3A 4ZI5A 4G5XA 2C0PA 4G4IA 4BRSA 3I2KA 1UK7A 3KSRA 1CUVA 4MQMA 1E8NA 3ESAA 1EINA 4YX9A 3DKRA 4G4GA 3D4LA 3V1MA 2VTVA 2QXUA 2WG0A 1THTA 3ESDA 1AQLA 2ES4A 5ALLA 3FAKA 2XMSA 4UFOA 3G9ZA 1XZCA 2CJPA 5FKJA 3G8YA 4HRXA 1E89A 1RWQA 1U8EA 1MT3A 1F6WA 5LLSA 3WLAA 1Y7IA 4BAGA 5C8ZA 3PDCA 3C6ZA 4ROTA 5T4BA 4X71A 1LPOA 1E5TA 5ALTA 5HF6A 3OTQA 5ESRA 3KDAA 3STWA 3WZLA 2W6CX 1CUFA 1VXRA 4CCYB 1BEEA 3O9VA 4A23A 1G4HA 3AFIA 1DQZA 3G0GA 5HF8A 5E2IA 3KXPA 1SOMA 1IZ7A 2O2IA 3HYSA 5LZ9A 3STUA 4FFWA 3NWOA 3VJLA 1EXWA 2WLSA 5JAOA 5JD4A 2B61A 2CUTA 5K3FB 1EVQA 4LHEA 3V1LA 3KD2A 5AKZA 4BP8A 1QO7A 3I2HA 2HA7A 4RE6A 3FLBA 3WA6A 4F5ZA 3QMWA 1VXOA 3DS8A 4EY4A 1YR2A 2OPHA 3FVTA 1GKLA 4H35A 2WHRA 1L7RA 4AZ3A 5CH8A 1GXSA 1XQVA 1AC5A 1PV1A 1Y37A 1SCQA 4J0JA 1YASA 1CFJA 2IITA 4UUQA 1QIJA 4H7JA 4Q3KA 5KWJA 1J1IA 2OCGA 2WU4A 3WL6A 1LPAB 2WKWA 4B81A 1R88A 2G4LA 3DDUA 1R50A 4DSZA 3P2MA 1GQRA 1WB6A 3WK5A 4H0CA 1FSSA 4FLFA 2AJLI 1P0IA 2AJDA 4KAJA 1EK2A 3D0KA 1U65A 4X94A 4B85A 3WKEA 3ANSA 4CIBA 3BIWA 2Y6UA 2Y6VA 5CMLA 3BF7A 1MAHA 3K2IA 1CUEA 1XKLA 3LLCA 2WFMA 2HU5A 3PE6A 3BIXA 3H0CA 4JEIA 1U4NA 3DOIA 2VJAA 5JZBA 1K8QA 5IKXA 4YK7A 1LGYA 4DMCA 2AJ8A 1P0PA 4U2BA 5AM3A 3VDXA 3G9TA 3C43A 3GROA 3FYUA 2WILA 2PPLA 1QTIA 2GBGA 1XQXA 5IVIA 1YAHA 5KBYA 1DT5A 1N1MA 4MJ3A 4EY6A 2C58A 2QXTA 5JALA 3AIOA 4DYHA 2VF2A 2JGJA 4AX4A 3R3ZA 2QZPA 3UMJA 2XQIA 1X2BA 2XMCA 3STYA 4KE9A 5CXUA 1QFMA 3Q8WA 2CBGA 2R8BA 1HKHA 1ORWA 2PU7A 1U2EA 5ALFA 4K6GA 4ITVA 1Q83A 3JW8A 4UFNA 1WPXA 4GLBA 2JEYA 3K6KA 4DIUA 1T2NA 1G42A 4KE6A 3M81A 2HRRA 3W9UA 4FTWA 5AK6A 2XB6A 2FX5A 4C88A 5EIEA 4FHZA 4Y2VA 4Y2TA 2QKYA 1XZMA 3FCYA 1P0QA 2V96A 1XZGA 4MWSA 2XT0A 1DU4A 2QRUA 2XUDA 4CIAA 3FOBA 3OURA 2OQIA 1CUSA 5CURA 1IUOA 5JASA 4BAUA 5CTAA 4JH0A 1XRQA 2XQJA 4BC1A 3H2IA 1Z68A 2WTMA 2ZSHA 5CH3A 2PSJA 3LS2A 5HK8A 4H77A 5HKAA 5K3BA 5KREA 4Q05A 1GPLA 3G0DA 4L72A 1FFEA 1CIJA 5ALEA 3WWOA 2WTNA 3RM3A 5JYCA 2XMQA 1YAJA 3AUKA 5ALKA 4FMPA 4UBMA 2GYVA 3PICA 1AKNA 1VZ2A 4Y2RA 5ALRA 3MUNA 2HM7A 4FNGA 1MX9A 3ZLVA 5A62A 5JZSA 2ORYA 4L9AA 1PFQA 1VKHA 1YB7A 1CUBA 2ECFA 4E14A 2WIDA 1UOPA 1EB9A 1PJAA 4C89A 3H17A 1JJIA 4BTVA 1XZDA 5AJHA 5D3ZA 5IH7A 2QM0A 1QZ3A 3R3WA 4OB6A 4B83A 1W75A 3VKFA 4UBOA 5ALYA 4H7KA 3D2BA 2QOEA 3FLAA 4ZXFA 1CUCA 4WFKA 2VT6A 5AI0A 2EEPA 1W4LA 4DGQA 5EIAA 2OXEA 4OD0A 2PSFA 1XRPA 1MAAA 3F9CA 1WCYA 5K3FA 1DTEA 4K6KA 2PX6A 1QOZA 1XLWA 1MX1A 1DINA 4NS4A 3C6XA 3PUIA 3MVEA 1ORVA 3E1GA 2D0DA 3ZLTA 2WHQA 1E8MA 3KWJA 1CUHA 1CUGA 5AH0A 1DX4A 4B84A 4EB0A 3KWFA 1H2XA 3DYVA 5IVDA 4ZRDA 3PF8A 1QIKA 1QGED 4K2AA 3D7RA 1UOQA 5AO9A 4DM7A 4TPKA 3V1NA 5DLPA 3CCBA 2HA0A 2CKMA 4B82A 5C81A 1WHSA 1FFDA 4X93A 2VEOA 4X92A 1MO2A 1H2WA 1TRHA 2ROQA 4HXEB 2RI6A 4G4JA 4KE7A 1UOOA 5ALHA 3WWCA 4H7DA 4P9NA 5JADA 2VJBA 3HLKA 1GQSA 1BS9A 4BP9A 1ZD2P 1CUIA 2BUBA 3I2IA 1TIBA 5ALPA 4J3JA 4BATA 1QO9A 4B7ZA 2OGSA 3FBWA 1ZICA 4DSAA 5JAUA 1GPKA 2WJ4A 4MXDA 1HDEA 2JGFA 4KYVA 3I1IA 3H04A 2XLCA 4RNCA 4W1SA 4CCWA 3T4UA 1UKCA 4ARAA 5A71A 1LZLA 1LZKA 4GECA 2B4KA 2O7VA 5K3DA 3QZUA 3OG9A 2PBLA 1CUUA 1XKTA 1CPYA 4W1RA 5LZ2A 5C8XA 1FJ2A 4X7BA 4I19A 2C5FA 2YXPX 2QJRA 1BCSA 2OCLA 4AO8A 4MEAA 3STTA 5CT6A 5DNUA 3DLTA 1Q84A 1O6GA 1QIDA 4BVKA 3QM1A 2XMRA 1K5PA 1ZD4A 4AN1A 3JWEA 3YASA 5HF9A 2XE4A 3WA7A 1GT6A 1UXOA 3A2NA 4DNPA 2X5XA 5EHXA 5AM4A 1LPSA 3GUUA 1A8QA 3DJYA 1SCKA 4E46A 5AI6A 1SCIA
chains in the Genus database with same CATH superfamily
4L3OA 3GJ8A 1G1MA 1THZA 2BI4A 3RUCA 1QMGA 2RC6A 5HKBA 1FNMA 3CE6A 1X1QA 3IJRA 2P4SA 5HJ7A 5MFZA 3SI7A 3WMXA 2FUKA 1C4KA 1M0SA 2G1JA 2JHFA 1V39A 2Q49A 4PO9A 3MB8A 5J9FA 3EPJA 4GVPA 3L8EA 2EGUA 3I5AA 4RK4A 3B1WA 3P8ZA 3C2QA 4QTYA 1S3SA 4HG2A 4LMRA 3NYRA 2GPWA 3V4ZA 2E1RA 5JQGB 1TEXA 2RGDA 3IC5A 3E1SA 3OE1A 4MEJA 3CVWA 2ZI7A 3RO7A 1JHUA 5B1EA 5DLQC 3CUKA 1S0UA 1M1NA 2X9VA 3C3JA 3NBXX 5CEEA 1WG8A 4WWHA 3IP9A 1IWPB 1SUIA 1RNLA 2FOIA 3HADA 4HDQB 1G3QA 4JJGA 4QBHA 4KYUA 3O38A 3DFFA 3DTNA 1Y1KE 5G41A 4E09A 1OTXA 1HQYE 1OYYA 1U4SA 4JNCA 1MH9A 3O9ZA 1LDEA 2GPNA 5LJLA 2I91A 3IRUA 5KKCA 4QQKA 2BSXA 3SEAA 1UQUA 3AONB 5JSQA 2FEKA 2XRFA 5KYUB 4CG3A 4J16A 1VHQA 1VOTA 3CWCA 3PT5A 1XDUA 3I5XA 4XKJA 2EBUA 1Z17A 4EPTA 2XUGA 2MINB 3NOOA 5IG2A 5K0NA 1NR1A 1JU3A 1U7OA 2AOUB 2D2IA 4LW8A 4UUAA 2OO5A 3ADBA 2DR2A 4FLEA 1F1BA 4D02A 3KC2A 3JQ8A 1WCIB 1ZMRA 2OBFA 3WB9A 1ZFNA 4NU8X 4PW0A 2AMJA 2PM8A 1U98A 4X1OA 3AHJA 1W5EA 2PZLA 3UK6A 1KC3A 2ZE7A 1ULUA 3BWVA 4D99A 2NZUG 4QATA 4RULA 3N0VA 2YIMA 4RMNA 3DVAA 4OGFA 4NOJA 3INYA 5CRIA 1VFNA 6LDHA 1MNQA 3UUFA 2YJZA 4GGOA 1Z6YA 4AZSA 2PJRA 2RONA 3RGWS 3OFKA 4C3OB 2WPNA 4YMVA 1SXJD 4HYQA 2FUNB 3UATA 2H2DA 5HM6A 4OXYA 2QEQA 5BO5A 3B8EA 3DNMA 3K1TA 4CHTA 3U5ZB 1WUKS 1LS6A 4L28A 2GR9A 1YE3A 3HUTA 1RR6A 3OMWA 4RDCA 1SUEA 1VL0A 2AEFA 5DNEA 3QUQA 3PDWA 1NAIA 4FDVA 2IUTA 3TPZA 4B5LA 2Z4TA 2AEMA 1ADYA 2AB0A 3MWYW 3NIWA 2V8BA 1UT8A 3NBFA 1UXGA 5T4EA 2J3JA 4LNHA 3ZZTA 2XXAB 1U8ZA 4KK3A 2R1TA 1TJNA 3OWXA 1PWEA 3R5SA 4ZO7A 4P3XA 5FJJA 3TRKA 4FJ2A 2LKDA 3PEFA 2IP2A 2Y66A 4PRZA 1PZHA 5I47A 1MAWA 1V6SA 3PGLA 1ZUIA 4UQOA 5IKEA 3IA2A 4RA9A 1JEQA 2BGTA 2CXXA 3KUUA 3K8YA 1MORA 1Q44A 2WWRA 1NF8A 4R2LA 1XDSA 4GSKA 4O4HB 2JCXA 4RM2A 1S2NA 4HH3C 1QYIA 4F1KA 3H2JA 5BYAA 2C03A 1GXSB 5JBIA 3THXA 4KUGA 2CMFA 4L7VA 3GY0A 1OGJA 3Q2IA 3K0AA 2R5WA 1XB2A 3LUHA 3A9WA 3N2GA 1NJGA 5JAPA 2BGNA 1MO4A 4MW9A 4Q6WA 5LD2B 2YMQA 1RJWA 2MTBA 2XZOA 1FYFA 2AVNA 4Q24A 1E7MA 3GHYA 2PXCA 1V0JA 1H2BA 4PLWA 1R0KA 3OOEA 1PV4A 1N6RA 4UDNA 4B0PA 5TLSA 4NENB 1DWPA 4EGCB 3FBGA 3KZOA 4BLWA 2E3JA 2VDVE 1WQ1R 2BDEA 5EGNA 1UXHA 3I37X 2O3QA 5KYVA 2Z8ZA 3T35A 3JQCA 3UUWA 4J1TA 1FIUA 3MJSA 4B34A 4TTTS 4RJKA 3ZE1B 4F21A 4XX0B 2YJ6A 3H2GA 4LDPA 3KTDA 4O29A 1P9OA 2HJVA 3LVQE 2FQWA 3IKVA 1M76A 1TZJA 3T5DA 3EFHA 3JQDA 3OCVA 1JUDA 3ILHA 4JXJA 3ELBA 5BPFA 2EC5A 8LDHA 4GKVA 1U2PA 1XHEA 3DR3A 4O02B 3IERA 4B74A 1HX7A 3QX3A 2A5DA 4MKRA 5K0CA 3DEYX 3PU6A 1ACJA 2Z8XA 3IIIA 4FX2A 2HCTA 4KR3A 3JYNA 1H3EA 4YS6A 1D07A 3F96A 1FL9A 1R8QA 4WXYB 1JLLB 1G8MA 1AM4D 1FOEB 1HEUA 1UKEA 3ENVA 3TSAA 3ZU2A 3BDAA 5J2UB 2EW8A 3JAKA 3P2EA 2ZKIA 1ZC3A 3BMCA 1JDBB 1B1AA 2Z95A 3NWEA 3OY2A 1R4AA 3C3CA 1B93A 4QFCA 4UBNA 1UDBA 2B4AA 2HRZA 1FSFA 3L1UA 4CM3A 3I2JA 2YOHA 2C5AA 2V6BA 2E7ZA 1SC4A 3WBJA 5ALQA 1DKLA 3RREA 4D3ZA 5BQFA 1Y98A 1J70A 3HYCA 3R5KA 1ODIA 1JQEA 3ZE2B 4P38A 3FVQA 1IN4A 1E2DA 1W87A 2A0UA 2E5WA 2H2IA 2VVTA 3IMEA 3NHBA 1RM4A 3GGPA 4MINA 4OHFA 1G3RA 4WY5A 5B3JC 3NPAA 5DHRA 3P9SA 3L0BA 3S99A 3ELWA 5BV0A 1N9ZA 5FQNA 1U8FO 3Q9LA 4F3CA 1QYXA 4AIRA 3H84A 1USWA 1RPJA 4PYNA 4XX0A 2D13A 3S2IA 3WRWA 3SEZA 4JITA 3CLSC 3N7AA 4E32A 2QMQA 2RK3A 2F64A 1E3IA 1T5LA 3TG2A 3GJ0A 5GY7A 1TVCA 1GTJ1 3PD7A 4Y9RA 3TAUA 1P0MA 3RHSA 1CZOA 3RARA 5AD1A 3HYTA 5MGNA 1A5TA 3FRJA 2WKPA 1D4ZA 4HEQA 3IFSA 3PYLA 3PUYA 5DGXA 4CODB 2BHSA 1FSGA 5C8DA 3KYDB 3K09C 3BFJA 4MV6A 4URZR 5CIWA 3W77A 2UUCB 3GJZA 4B2PA 4EY6A 4J7UA 1N3LA 1CJTC 2J9XB 1XU9A 1OLSB 5CFMA 3HJUA 3V42A 4UTOA 1OLXA 1QLJA 1RDFA 1QSGA 2P11A 3QVMA 2H7XA 5C1PA 4B7AA 2Z9CA 2B35A 2RGCA 3SX2A 5AYVA 3OQNA 4MQUA 4PGFA 4GDMA 1H93A 3OM0A 2Z9DA 4ZQBA 2A94A 2W2LA 5TMEA 3P9NA 2XYHA 4RA9B 4DPMA 1ARZA 2ATXA 1NP7A 1XO1A 2WWTA 3RYFA 2O7SA 1G63A 3FCSB 3G9QA 1OPRA 2XUJA 3RR2A 1UZAA 4P4SA 3T1VA 3UXHA 3WK9A 3KQLA 5CDFE 1NN3A 2KBEA 4M1EA 1PR6A 4K8RB 4F4DA 3T1TA 1FP4A 1D1SA 1L1EA 4DB4A 2GK6A 1CQWA 1ZI9A 3KFLA 4OIFA 5ALOA 5KSYA 2OCAA 2QTVB 3QTBA 1R3DA 3N8GA 3HWSA 3GJRA 4KWTA 5ETJA 4EEXA 1D4OA 4RUKA 2NW6A 2GCOB 1KO5A 2WJGA 3OOSA 2BFFB 1W96A 2R44A 2XHZA 4G0MA 4MVJI 4CTMA 4EF6A 1CY1A 2W2TA 3OSUA 2CD9A 4RGYA 3D4PA 5K0ZA 2IL1A 5LZ7A 3KB2A 5AP9A 5SZIA 1JZQA 3IMGA 5KWIA 4RHFA 2WUEA 4NBTA 4UTRA 4AYTA 1EBUA 2AG6A 3O95A 2N46A 4UUNA 3D2LA 3H5NA 2BC9A 3DQQA 3BICA 4W99A 3HABA 5E95A 1F0NA 4ENUA 1YBMA 2BEVB 2XTJA 2PR2A 4AJHA 3EFBA 2OBYA 1KKMA 5KX5B 1MGOA 2R6JA 4KHPB 1UAYA 3LUFA 4TRJA 1HZJA 2C2OA 4JGIA 2Y1WA 4MMZB 3LBNA 2XTZA 4RHXA 3QK7A 2MSEB 4AG5A 1N9KA 1MPTA 1RTKA 1U7PA 2X4LA 3ANNA 4K40A 4LC1A 4KXFB 2UV8A 1C3JA 1KIMA 5P21A 3F7MA 1G4AE 4U02A 1UFOA 2BEUA 2DBYA 2VJCA 4MIYA 3AEKB 5F12A 1I14A 5KNCA 2XR1A 4KTVE 4I9GA 1QCCA 2AIRA 1DG1G 2ZUEA 1E2BA 2H4WA 4TTAA 5KC9A 1Y6FA 3GLGE 2H1CA 2H51A 2WMDA 3CMCO 4U2GA 3GRAA 2WM2A 2GH1A 1RXUA 3FVVA 1XL0A 1RWBA 4HQ6A 5FAXA 2Y1OA 1FVOA 3JRNA 1JAYA 3R3YA 3UT5B 3B5EA 4F56A 4N76A 2X8LA 3EQ9A 3Q2OA 4K9KA 3BZBA 1PD1A 5TGTA 3H9BA 4YAIA 1ODFA 3I9NA 3ZGZA 1C80A 1S9DA 3C97A 1LSOA 1YRYE 3EN0A 1A5AB 1ST3A 3MWLA 1LRLA 2VTKA 2X41A 3I04A 4FT4A 4FWBA 2IX9A 2ZWMA 4G4SO 5FX2A 4OOFA 4HMQA 2LVBA 4NBRA 4GZ5A 4BNHA 4RPIA 3EAFA 2PGAA 4X61A 3CRZA 3C3EA 3RSHA 3I8XA 4C0HA 5B5SA 3J7AC 2IS6A 2HLPA 4IRXA 1JEEA 1H6DA 3B3FA 5MDHA 1FLVA 3UZUA 2OAGA 3OLZA 3BE5A 4MHSA 1IAVA 3ZEAA 3WLIA 1FUUA 5CX1B 4AXXA 3I92A 1BWSA 3JYLA 1VKRA 3LP6A 4D96A 2JD2A 3KP1A 3ZK7A 1E7YA 1SKYE 2EKLA 3N8IA 4F71A 1ZNYA 2EP5A 5EJ6A 5IS2A 2HH9A 5JFTA 3UA3A 4EJ2A 2VATA 1X0VA 1MJFA 4QEKA 1E63A 2X9NA 3KR0A 4URFA 3UMVA 5JWOA 3L7JA 3MSXA 1G6HA 4P5EA 4Y30A 2ZT7A 4GMFA 1SIUA 1IM8A 5F76A 5EWJB 5F73A 3K0KA 1WMAA 4R2JA 2BGKA 2H0QA 3GYGA 2ZQYA 3V8MA 3PQFA 4MAMA 2Q2NA 2XE7A 1QIIA 2PSHA 2D8AA 2FR1A 1LTQA 2X2FA 3HWWA 3KQOA 4XDZA 3TUJC 3KFXA 3TVYA 3P7MA 3AXTA 3DMDA 1ZU5A 2F2TA 2PH7A 1NBME 2BDUA 4GKAA 4BC0A 3E27A 1ECBA 1RWKA 4GYJA 5LYJB 1OU0A 4B0OA 4JC4A 3DMFA 3L04A 3PXDA 3TNLA 3ABSB 1MEOA 2OLEA 5FP0A 4ZVPA 4QPCA 2R1UA 4U9HS 2XQGA 3CUSA 4UHFA 2XUZA 1ZJYA 2Q4TA 4RSRA 1G5HA 3QG5A 2O57A 2XGGA 4A03A 5CYOA 3RUDA 1Y4DE 1KTIA 4WOPA 3E9ZA 2ZSUA 4BVGA 1V2GA 1P9WA 3HYNA 1UJCA 3QBEA 1CUZA 1PLJA 3E5RA 4MUGA 3L92A 4IDBA 3T38A 5HDQA 1UIRA 1EP3B 3E3AA 1KU6A 4LEIA 1RWVA 4B6OA 3OZEA 1NNEA 2VYND 4IGFA 1J56A 4NQRA 4HNAA 4AO6A 5JCXA 5JANA 4LF4B 3Q1KA 2EV9A 3C6MA 3HFJA 3RLIA 5JVDA 5H70A 2G5PA 4OA5A 5DW3A 3VGJA 1IHPA 3DMTC 2ZXUA 2OECA 4PQRA 1N2SA 1ZMBA 2ISCA 3BRWA 3FDZA 3MZ0A 3OD5A 5AKJA 4JI7B 3AUJB 1U0NA 2ZPTX 3I01M 3RS2A 1JMKC 1HURA 1PR3A 4KFCA 1KVTA 2ERCA 1G2IA 2EDCA 1YZNA 2B78A 2FP4B 3AO0B 5G1PA 4FGJA 4J0QA 3V1YA 5C1OA 5JVDF 2VN8A 4MKFA 5K1ZA 2NUTA 5CITA 3GRKA 3OFSA 3AUUA 4ND5A 4Z53A 4WE3A 2J31A 3H65A 3OCZA 3RIHA 1XP8A 4ZANA 5FEUA 4TV9B 1KI8A 2W6JD 5LQKA 5B4VA 4RKRA 2WNSA 4W5HA 3B38A 2DCMA 2AJBA 1JF8A 3IUMA 5AJTA 4HDMA 2VNKA 1B8UA 1YZKA 1XZNA 4EUSA 5KTYA 4D98A 2GCNA 4RTKA 2O2HA 3G5MA 3EF0A 2OHJA 5IXYA 3ULKA 4MUNA 5E3HA 2GD0A 4R05A 1GAQA 3DD5A 4FCWA 3V4LA 3VTAA 2YS6A 4UHCA 4IAOA 1P3JA 4WLUA 1JSZA 1X7GA 1RJ9A 1XDDA 1BQEA 3ASUA 1CQZA 4BIMA 3QPCA 3OM9A 3GLRA 3PT9A 4G86A 4IEIA 5FDFA 3JQ9C 2C5SA 4NDNE 2YZ2A 1BYUA 1P31A 3SJUA 5ERGB 5B58C 2B8WA 3V9PA 3P32A 1W36B 4LIPD 2ECPA 4Q4HA 4P84A 1M7HA 1Y1TA 1YR3A 5YASA 2OAEA 3L8ZA 1SA0B 5DJ5A 4DR7B 1JIVA 2XE8A 4QVGA 1KK2A 1P2VA 1VE9A 2ZBEA 4JYPA 4N8SA 5TF0A 3ZWQA 2J6IA 4G0OA 4D4MA 4CKCA 4QGAA 1YBVA 2ZM6B 4IF4A 2QU7A 3K5WA 4PQFA 4RESA 1QH8A 1RHRA 1Y4UA 4YWJA 1Z0KA 3IP3A 2ZVDA 4Z7QB 3GRFA 4CT5A 1HOXA 2W48A 3F5QA 2P3OA 3KPYA 1XZHA 3VU3A 4QLBA 5A2GA 1WPQA 1PO7A 2I6XA 5PGMA 3CT6A 4MYDA 1IUNA 1RI3A 4F46A 1XOIA 2F8SA 4LTMA 1EK5A 2E4XA 3BS4A 3L1HA 4W9RA 5G3ZA 4ARZA 1CRWG 5HYVA 4L5BA 3DP7A 3SJZA 3WOHA 4AB1A 5FI0B 5IN4A 5T5QA 2QUAA 3EXG1 2GXAA 3O92A 1I3CA 2QVXX 5GP1A 3PRJA 3ZVKA 4NJMA 3RRNA 1R9NA 2CJFA 3RKRA 1XPUA 2P9HA 3K32A 2VSQA 1K97A 3A9CA 1SXPA 5SYNA 5F1YA 1WU8A 4OI4A 2FNAA 1UZLA 4OQQA 1SZJG 3BJRA 3OECA 2WTAA 3R0VA 3WKCA 4DQVA 5I9LA 2HWKA 4HDCA 3FYUB 4LMBA 3I4CA 2I7CA 2RGEA 5FPPA 3EDMA 1ETHA 4TVKA 4CCSA 4YXWD 2ZTLA 4YLEA 2ZRFA 5A3QA 3CVXA 4JOQA 4YYZA 1IVYA 3JU3A 1JR6A 3W8FA 1J0CA 1IN5A 1QC5A 1RE0A 3LUGA 4X90A 3HCBA 1DFIA 4PYKA 3NDPA 1KDZA 3TR6A 4ENQA 3UMMA 2WJPA 3MQ2A 3DVLA 1CIVA 1ZD9A 3QOFA 2ZJ8A 2NTVA 3LBYA 4Y2PA 4BHTA 1JU4A 3RANA 1K66A 3OT1B 1V9SA 4P93A 3PUWA 3BRWD 1R4ZA 1QU2A 1NPYA 3A6FA 2BN4A 5C7YA 3D3WB 3L84A 4N49A 4P4LA 3DM9B 4BLVA 5BSFA 3WL7A 1LUAA 1Q92A 3DUWA 4MV3A 3KB1A 5K3CA 4RZIA 3B7PA 1ENPA 2A30A 3GVPA 2YIVX 1A69A 2VJQA 2ZJ3A 4NV1A 4DBZA 4KWEA 2EERA 1X14A 4P7GA 5IBPA 1TQHA 3L0SA 4LTDA 4J9VA 4E1BA 4GXNA 4UTNA 1MABB 2I62A 4C03A 4EMUA 3PKZA 3K8OE 3LCJA 4GC9A 3GNQA 2NUAB 2I34A 5J3JA 6ADHA 1G2PA 3NAZA 2I1QA 1C9MA 3AGPA 4QXOA 5DYWA 3EVTA 3I73A 1YXMA 4X71A 4CKYA 1GITA 5EIBC 2X3YA 1YDMA 2Z1MA 4ZT7A 1JZTA 4RENA 4F3NA 1Q0ZA 2BM1A 1XFDA 2CMDA 1NJ5A 2OHIA 2VCEA 2WIAA 4HDSA 1DCMA 4WN3A 3W5HA 4AKTA 2C4UA 4LGVA 2CFCA 3H2SA 4EG3A 4R0VA 3MTBA 1RHUA 1JIXA 3V7FA 4ATNA 3M34A 3UK1A 3HY6A 4UEWA 5BV2P 4Y7CA 3W2IA 2OG1A 1PCXA 5CM2Z 2FSVA 3BCSA 1JAZA 3MGCA 4RSMA 1U6JA 4UPEA 4L85A 2X9LA 2C42A 5CGZA 3CVYA 1ZOPA 2I4NA 1LQUA 4L8VA 4QQNA 1ZG3A 3GDGA 3IHWA 4NI5A 4UCWA 3U09A 4IJQA 4WSOA 3E35A 1XCLA 4FDTA 2DMRA 3RFCA 3DOEA 2X15A 1B14A 4W9MC 3U4DA 4B6RA 3KTAB 1LLDA 1R9MA 2R11A 5AICA 1YGPA 4HF7A 2O0HA 1YH3A 2XKJE 4URVR 1XR3A 1RKVA 4GE3A 1VJRA 4KZPA 4V3BA 1VSUA 3ISTA 4NCBA 3U7IA 4C6TB 2YICA 2KM1A 3QJYA 3AZPA 1XMQB 5LNK6 4JMPA 5E4FA 3WIBA 2GZAA 5I9IA 1WW2A 3NGLA 2X7HA 1Z36A 4H60A 1M1ZA 2WQZA 4JUFA 2QUIA 1XQ6A 4KX3A 2WBLC 3C14C 2JG3A 5EKXA 1RLUA 4ZQIA 4A0HA 5D5HA 2G72A 1T4CA 2BYTA 2A9JA 4KVAA 3MLEA 3OQIA 3R3JA 4RCVA 2ZYSA 5B1HA 3LPDA 4GHWA 5AHRA 2ZYHA 1NUSA 3HRHA 4B8ZA 1GG2A 1BVHA 3OHSX 4WCFB 2OL4A 1KORA 4R0NA 2PUTA 2W2KA 4B9AA 3HKCB 4TOIA 4DCGA 5K0EA 3H19A 1TCBA 2YR0A 1AX9A 1B16A 3MTDA 5IAJA 5IEBA 3R44A 4W8HA 3T52A 3WKBA 3CJRA 4IVQA 5ER6A 1Z4QA 3ORHA 3L7KA 4EG5A 1EFPA 1ZXBA 5F52A 2HF8A 1EVZA 1F8GA 2P9FA 4XSVA 3N59A 4CMJA 2MSNA 4MYSA 2UUAB 2VJOA 2AC2A 2O54A 4RU1A 3PSHA 3KL2A 4ABYA 2GHRA 1FDSA 2V7TA 5ICSA 4FMBB 4L2IA 5TRTA 3R3VA 1K9SA 1HNNA 3I9JA 4FHFA 4UASA 2PQMA 4JB0A 3I2FA 3MMSA 4QHTA 3DFMA 4C1NA 1RXSA 4BMCA 2DFNA 4OJYA 2ZJ6A 3EOAI 5JNWA 2FPRA 2ID9A 1G16A 2JBWA 1OXTA 1GDDA 2ZTHA 3DXXA 3GIDA 3IPRA 4ILKA 4YQZA 1ZVKA 2RCNA 4UHBA 3TGLA 2J87A 3TZLA 1XWIA 2QW0X 3X1WA 4C2AA 2ZUSA 1FMFA 1EE9A 1N2BA 4R0MA 1SVMA 1PFGA 1NVUQ 1F4PA 3VI4B 4M1TA 4OGWA 4LZAA 4G8CA 5JO9A 3PUKA 4K5QA 5IYZA 1OKKD 2WINI 1G38A 3RUAA 4P7BA 5EUMA 4X95A 4PZ0A 3P71T 2I6SA 3KTFA 2BGGA 1PFVA 1E1QA 4PINA 2ZCVA 2WF7A 1YI1A 4GI1A 3S55A 1QB7A 1Z22A 2V65A 1W8IA 2GWRA 4IFEA 3R3SA 2B4TO 1EFVB 3SS8A 3C16C 1BE1A 1NDHA 4WCFA 4M6WA 3ZHBA 1U94A 4BWVA 3DQZA 4L4YA 4R5HA 5IM4F 2PUEA 1T3LA 1V5EA 4OUKX 5AUOB 4XPZA 5A7HA 4BX0A 1H2ZA 1YMQA 2J7KA 4HN4B 1G20E 2GHQA 2C7BA 3OZFA 1ZUNA 5E9QA 1JI3A 1UFRA 4BNUA 2W00A 4TYQA 4QXQA 3LFHA 2CF5A 4JJZA 1XTVA 2P9EA 4WAUA 5IEJA 1EWQA 4NYMQ 4AP5A 3MT7A 4D4IA 4LISA 5JJBA 1JT9A 4JZYA 1V9LA 5K0GA 2JARA 2VK2A 3CPHA 3TINA 3HA5A 4C6TA 5ANRB 4JOCA 4Z9BA 4YAKA 3ZQKA 3ETEA 4XRGA 2V3CC 1UPTA 2ZYRA 3AUXA 2AUNA 2HA3A 1VPEA 4XFJA 2ZWOA 2H2WA 1HDGO 3HB0A 2CNNA 1I7PA 2WP0A 3IBCA 2ISQA 2OOSA 3QQ5A 4RVGA 3R7AA 1L5WA 5IXSA 1K7XB 1M3SA 2VJDA 1MOPA 3H5IA 4WKOA 1HYQA 1JBQA 4QXAA 5CFRA 1FVHA 2W6OA 5LFAA 2V97A 4WZBE 4GH5A 4O2BA 4JU9A 1K98A 4ZIRB 4QREA 2QYSA 1AK2A 2P0EA 4NFHA 2ZI4A 5FFFA 3UTDA 1NIPA 4FDMA 4CQJA 2FFRA 1SZPA 2GN0A 1O6ZA 3ZHVA 1BDHA 4OX9B 1SN7A 4RGBA 1RIFA 4F5EA 3KYBA 1VC2A 1XX6A 1GPMA 1V5IA 1FFAA 4LOKA 3ZGLA 3A4LA 2C7RA 2JRLA 3S5JA 1RAHA 1ZCBA 3ZI7A 4PHTA 2GAJA 1R10A 4RXMA 5I7WA 4W9NA 1GU7A 2YXNA 3S70A 3CZRA 1DEHA 4E30A 3OJXA 1P7PA 2P69A 2W6IA 4QOJA 2ZU0C 2XUPA 2GD2A 3K9BA 3L40A 4XYBA 3QMVA 1VPTA 2A1TR 1X1AA 2ZJ0A 4B43A 2EW2A 3W34A 1E3QA 4C6RA 6YASA 2GZ1A 2MYNA 1UR5A 5L3VA 3RUHA 2H1RA 2DFPA 1UAGA 1GYPA 1DKMA 1XMSA 5CM8B 3ZZNA 4G85A 4IZ6A 1MABA 3DAOA 4I50B 2LD4A 2FPUA 4QXMA 5HS6A 4CCAA 3W5DA 3U44B 4OATA 3M4JA 1LI4A 2XMZA 5K03A 3D4OA 5DNAA 1C9EA 1KZGB 3WLEA 4JL8A 5ICGA 4OA8A 1OWLA 3FCUB 3AP2A 4ZREA 3VJMA 4EITA 4TTIA 1P1CA 3FNQA 3TTYA 4NEGA 2P4QA 1JILA 3KV3O 4EQ6A 5KNBA 3RJTA 3CLSD 3B6IA 3BORA 1E2PA 1PRYA 3A3OA 3RI3A 3L8YA 4E7OA 3BTSA 3TM5A 2PX0A 4KK4A 2ANBA 3B1YA 2VOEA 1NQAO 2P9YA 4Q4AA 5FL7A 3RYTC 1SPXA 1PDWA 2OCKA 3LDUA 3PXEA 4O5AA 2AXEA 1TLLA 2QP3A 5JEEA 2AVDA 1JALA 1JHQA 4QLOA 1U3FA 3O83A 5D01A 4YRZA 2Y2UA 4KHZA 1PT6A 3OQHA 1JR3D 2V3VA 3K05A 4QWWA 1NP3A 4IQ4A 4YCJA 3VZPA 4M36A 3T9BA 4I4TB 3FHCB 4UHEA 4X62B 1E9AA 3HO1A 1XG5A 4D79A 4EDFA 4EI9A 3IULA 3CH5A 3WNVA 1E2IA 1I4TD 2DEUA 4MA5A 3QMPA 5TEVA 3IILA 1L5SA 3Q0EA 4ZA2A 4EHFA 3AMVA 4OM7A 4Y1GA 3SVTA 1TT5B 4QOFA 4P3KA 1U2DC 2HT6A 2CLHB 1U0OC 3PEYA 3ESCA 1Y4SA 1LRJA 1Z7WA 1IEVA 3AQ4A 1CQXA 3PKJA 4P4UA 3EGCA 3HHEA 1EDEA 3OIVA 2J9FA 2QX6A 2NU9A 3N2ZB 1MA0A 2ZI6A 4P4NA 4EECA 3FMGA 3I01A 5EEHA 4ARSA 2QSUA 3DZHA 4BVLA 1DUSA 3LDAA 4BPBA 2XT6A 4EW6A 3NWJA 5CG2A 2V0NA 4JFAA 1XD2B 4NBUA 3STVA 4BBJA 1RQ7A 2R7NA 4DN6A 2FMTA 4Z86A 3KZVA 4IIYA 4W1QA 4NONA 2DE0X 2ZSIA 2IXEA 3DLPX 3PS9A 3QNMA 4DIEA 1TA4A 3RWOA 3LC7O 3AOEA 1QF6A 4LZJA 3MTAA 2JEZA 2PJZA 5KTNA 1WPGA 2BKLA 4QPNA 4TXNA 5KNBH 2I78A 4QT4A 1X1EA 1R4MB 2MT9A 2XODA 4IXMA 2O5EA 4QQ8A 1I51A 3USES 3G2JA 4O4JB 4LBZA 3WWYA 1RI4A 2DFLA 4XD7A 2OQRA 4EB8A 4ASUD 1BRTA 3ICWA 2JAOA 4J29A 2ZUTA 5BVGB 2J7PD 3WMWA 3MT9A 5ALGA 1RBMA 5AMXA 1Q6ZA 1J23A 1NF3A 4HH4A 3EUEA 2VG8A 3OQ6A 1EVYA 1PGOA 4MKHA 2VEDA 2YJNA 3DTVD 3L4EA 5T4HA 1DWUA 1QLHA 4U9IS 1PTJA 3B1VA 4Y2YA 1RLTA 4XOIA 4KQXA 2OD7A 1B8NA 5ECWA 1TLFA 2BELA 4EP1A 2J0EA 2PMBA 4CV0A 3S8EA 1IEWA 5C3MA 1PK9A 2XDQA 3BMNB 4MWCA 3ETJA 1Z88A 3TLYA 1RJ9B 2OAQ1 4HJRA 1EB8A 1VL1A 2Q27A 4GX1A 1DDIA 2VYNA 2XMGA 2FVXA 4QIHA 4EBFA 2VTBB 1KRXA 4FFBB 2CCGA 3K72B 1TA9A 2QT9A 4R51A 2DH5A 2YC2C 1LLFA 3M5DA 3RRBA 3DA8A 3QFTA 2YW9A 3RIGA 1QPZA 4GMGA 2OCYC 1XN1A 4TV9F 3RVNA 3X1KA 1Z0AA 4FE7A 4D3SA 2EKPA 1T8WA 1XRLA 2GLTA 1JG1A 3GEPA 4XLZA 4R1LA 4ZU3A 3GRCA 2XJ9A 5D7BA 3WYAA 2UYCA 1U04A 2P35A 3MMNA 1JFLA 4BY9E 4PYJA 5FBWB 2ZIVB 5FPSA 2CK3D 1N2CE 5MF6A 4DDWA 3D5EA 1SHJA 5TGZA 4TV9A 1DZ3A 3GQBA 1NYQA 2A3NA 2FR8A 3BULA 3DONA 4DJJA 1A8IA 2E9SA 2UXDB 5EMMA 4BKMA 2BGIA 4X8HA 1Z4IA 4NC9A 4QZVA 3IE0A 1M2OA 4GLJA 3B6ZA 3OAAD 3KHTA 1HPLA 3ED1A 4ND7A 3JY6A 3BA1A 3R8XA 1QG0A 2C0QA 3G8DA 3O03A 4Z4GA 1GGNA 4DXHA 1DTWA 3PB3A 1E2GA 3AK4A 1DJMA 2PSEA 2VKQA 4W1PA 4BZQA 5A5EA 3MWEA 2YVUA 3N2YA 1KGSA 1E7RA 4DLPA 1YZLA 1TL7C 3HCEA 5BT9A 1N7HA 1N5LA 4J75A 3SC2B 3E7DA 2M6KA 1BU8A 3NIFB 3HRIA 2JFWA 3JX9A 3CH6A 1L5VA 4MDHA 3GQVA 4YI3A 5I4IA 4KE8A 3B70A 5EJFA 3NHUA 2X4IA 1Z12A 1S89A 1WZNA 3WDMA 2ADOA 1VIAA 4DHWA 5JH7F 1CUXA 3S29A 1DPGA 1NQTA 5AKGA 1EUQA 4I1RA 3E15A 4EBBA 5KJFA 3K9FC 4Z7OB 5LMNB 3OX1A 4DEYA 2CDRA 2CEKA 3G2KA 4R8LA 2JGDB 4B3RB 3R7NA 3WIVA 4FYPA 4ZV9A 3W9SA 2IKQA 1RFLA 2M1ZA 4EFMA 5FOSA 5C5CA 5DCWA 4KQ1A 2EAUA 5KQGA 1ITZA 2QZJA 4EELA 4BX8A 3VYSB 1LCIA 2ZYAA 3DHVA 5B55A 1AF7A 4B3SB 1TCCA 3KT0A 3PJGA 1PR5A 4NZOA 5EZ5A 1BGWA 3T7AA 1NFFA 2BTQA 3NHRA 4OLBA 4IMRA 1M5TA 4U7TB 3JQ7B 1TK2A 4C87A 1A8UA 3CCFA 2QSZA 1E6MA 3QLTA 4DR4B 3IBTA 1Z7EA 1Q15A 4GWLA 1JEOA 1Q7EA 4WADA 1WDMA 3DBVO 3M6FA 3VAAA 2IS1A 1JSCA 2XA1A 2J33A 4OB8A 3N75A 1NUUA 4MWTA 1X6VA 4G0WA 2ZT6A 1OFVA 4HB0A 4RNDB 4CQNA 3KJGA 1YB6A 2EIXA 2Z2KA 1UBMS 1KPGA 4FXOA 4O8ZA 5DYYA 2O2SA 2YVLA 1RYFA 4DJEC 4YREA 4EHBA 4FR5A 5B58T 4ZYVA 2EX1A 4MQ4A 4Q47A 4RMHA 1R6TA 2VQSA 4NCHA 1RYZA 2J9ZB 4N12A 5FF9A 5IUKC 1FFXA 4ZAVA 4A2WA 4BNWA 3KPWA 4LRQA 4GSLA 2WB2A 2GA9A 2FOXA 5JRJA 3FMFA 5TJ9A 3TNJA 3C3AA 4CDGA 5CPFA 3P0IA 1BMQA 1JG3A 5BMVB 3IMKA 1WP9A 3UWPA 3DH0A 3WMFA 4A82A 1QVZA 2B5WA 4BNFA 3LBAA 5FBKA 5HE9A 1Q7CA 3V1KA 4BNNA 1QWOA 2IQ5A 1GM5A 2YMPA 1N2CB 1V1MB 1I3KA 2F3RA 3DEJA 1BCRA 3TBFA 1G8YA 1XQWA 1SHZA 3FE2A 3K2BA 4XW2A 3WHIA 4PHHA 2IVZA 4R81A 2I2XB 1ZD8A 4BVEA 3R7DA 1PDVA 1L4UA 3SSMA 4TWBA 2CXHA 2TMGA 1DRVA 1SWVA 2WK1A 2WSLA 4MLCA 3ROTA 3W4IA 2PA3A 1QV7A 3W5UA 4U8HA 1DAOA 1U1DA 2VPXA 3C5WP 3GMTA 4AWBA 3COJA 2GTIA 2M1XA 1U3UA 3RW9A 1LPBB 3BAFA 2A9QA 2WWXA 5DDIP 2ZBPA 4WK6A 4FYJA 4JL6A 4L95C 1J2TA 2P40A 3HXKA 3GOQA 3WLTA 4NARA 5BXYA 3VX3A 1G19A 3B1FA 4C4AA 2YV1A 1SBNE 2BMEA 2C3YA 1VE7A 4Q1BA 5I5EA 3T06B 1NUHA 4Q6BA 1E60A 3KVVA 4RPJA 1G8HA 2I55A 1INLA 4DTIA 4JX8A 1AKWA 5CVUA 4GIBA 3MCZA 4JCOA 1DO0A 1ENOA 1JPUA 4Y6OA 2OO7A 4AU1A 1L5NA 3UH0A 5A9RA 1GZ7A 3DKVA 3KEQA 3EMDA 4D3XA 4EVSA 4K9PA 2YL2A 4M8SA 4WXRA 5DX0A 4IO1A 4YV1A 4ZK2A 2P68A 1FQWA 4YDSA 1EWTA 3SMQA 4M0PA 5AJYA 5AJZA 5BNZA 2FEOA 1QP4A 1WCV1 4LRUA 1ZZGA 4D0NA 1D9XA 1KBZA 1Z73A 4LF5B 4RANA 2FETA 2DUUA 3CA8A 3GWZA 3HEMA 4UAGA 2VP0A 4C0SA 3SBEA 2EJTA 1C0PA 2W5UA 1SWWA 3KQKA 1NNI1 4A16A 2R3SA 2O8EB 2JAPA 3UK7A 4UE6A 5FNVF 3RFXA 1EUCB 3EC7A 5TMBA 3MTJA 1A77A 1GUYA 1VG1A 2OC9A 3PFNA 3Q7IA 3VHLB 4CDRA 4YUZA 4US2R 5ILOA 5ALVA 1W5SA 4J7AA 1XGKA 4PAOA 5FO1A 4AJLA 3LVRE 3KLPX 3NAQA 1XD8A 4PS0A 4Z99A 4JWTA 3KOOA 3QYJA 4P4SB 4F60A 5HRCA 1IXKA 5U4XA 4S1TA 4FKMA 3W6PA 4KYIB 2B4QA 3HEAA 3BWXA 4HS4A 3CF0A 5BWOA 3CKYA 2FJ0A 3WGGA 1A5ZA 3PC4A 4KQJA 1J0DA 3JVIA 5EI5A 1TEHA 3T41A 1RKUA 2QTWB 4KNWA 3IIJA 3A0RB 1JG6A 2P65A 2WRZA 5ICEA 4RC9A 2JCBA 5EMLA 3HNRA 2FFQA 5KYYA 4JP3A 4IDDA 3SHFA 2WHPB 2H2FA 1RPTA 2DPMA 1OLSA 4DBVO 3ITEA 5E7IA 2GYUA 3LC2O 2QTFA 1JA9A 1N25A 5JDIC 4UNPA 4PZDA 5IC5A 4BXOB 2QTAA 3T0GA 2GRJA 2ORED 4HAZA 2X7JA 2YQZA 2X13A 1V4VA 1T6XA 4BVBA 1QVVA 3GLIA 1XA3A 4J3NA 2XI4A 4II2A 3ZQ6A 4GM0A 2UZ1A 4OMUA 1QVWA 2H1OA 3NC4A 1TE2A 4NYJR 4YRDA 2XGSA 3NORA 5KS2A 2FFJA 5ARDA 2WYUA 2ZU6A 4CQMD 4CN8A 3FZGA 2C5BA 2HQRA 4LOAA 5FWXA 5AW2A 1O0SA 4X3CA 4PLGA 3KE8A 4PRLA 1GZUA 4DABA 3FI0A 3RBVA 1AK9A 4KR9A 1MB3A 3RC1A 3IAFA 1P33A 1XCOA 2V7UA 3QG1A 2QU8A 2QX9A 2IGBA 3H5WA 3BTUA 1KI1A 4ZOCA 3AU9A 5D3QA 2VNIA 4MYRA 4C4TA 4JOBA 2ZREA 2R5FA 1A2QA 5BUCA 2PZBA 3RSCA 2BH2A 3JZFA 2JVJA 3ICCA 3WYBA 1WD7A 2R8RA 3M6VA 1L5HA 1W5BA 4NESA 1E1QD 5JYEA 1BD3A 3G5TA 4YP5A 4PICA 3T3DA 3ZDXB 3BYZA 3G3EA 4OMDA 1V48A 1V16A 3F2IA 4TX1A 3EMVA 2PYZA 1M2FA 3DE5X 1SVSA 5BV8A 4GAEA 4V2IA 4I3FA 2C9ZA 1JT2A 2BZSA 3DUFA 3FMOB 1QVRA 1E1LA 3VZCA 4EYQA 4F8EA 3WLFA 3GVHA 1L5KA 2TMKA 2TMDA 4GICA 4L8LA 4M8LA 3HKEB 2ZLBA 4M9XA 4BO3A 1EUDA 2WJHA 2P9BA 4IDEA 4CG2A 2FGKA 3B9RA 3HS3A 5IT9A 4P92A 1GNPA 1SCAA 1TQ8A 5J5AA 3ZLJA 1GSHA 2XDQB 3BMNA 1HF3A 5J1TB 1XZAA 3D7KA 1P2FA 1XPOA 4O2RA 1BO6A 4C06A 2IYSA 3F9IA 4NMXB 1H0KA 5BQPA 1T5HX 3W2HA 4HBGA 2OMKA 3QHPA 5JCPA 4H18A 3QXCA 5KPJA 2JA2A 3G9XA 4BMNA 4DUYB 2ZRMA 2IOQA 5JWRA 1E8DA 3ZU3A 2MDTA 1D2RA 1I01A 5K6TA 2RE8A 4OP3A 1GPNA 1Q14A 3RIYA 3TQFA 4BCDA 1TYEB 3U9SA 2GDJA 3Q87B 1SVLA 4Q3NA 4DR2B 1GAWA 4MP3A 4C30A 1NX6A 5CDSA 1J1ZA 2BFWA 1PT9A 2O2EA 1RBZA 1T6YA 3PQ6A 3WBBA 1JRLA 5KKAA 1QGUB 3EY4A 2AK3A 4MYHA 1KZ6A 4PY2A 1TEVA 4DCTA 1P1KA 3GMDA 2IIBA 1SCJA 4J0HA 4MICA 3DXZA 4JU8A 2R1ZA 4YPOA 2CWWA 4MV0A 1YVRA 2ZSJA 3PSAA 2OV8A 1G5TA 3A14A 4NRDA 4V0MA 3DFZA 3HZRA 3F8SA 5JDCA 1ML3A 2RAFA 2BSAA 3ICVA 1ZJWA 1UQRA 2BM8A 1IXZA 3N39C 4PAGA 2OCPA 1XEXA 1MVOA 3A1SA 2GVZC 8ADHA 3V8EA 2NG1A 1EH5A 3NO4A 1SHTX 1E3SA 5TVGA 4H6XA 3I61A 3DFUA 2D7DA 2X58A 1AO0A 2CXTA 3K0CA 3MIZA 1IPFA 4MS1A 2C8KA 4AK9A 3OO1A 1XRNA 1I1QB 4TL7A 4I8XA 4U7FA 3O2JA 3RC9A 1QTNA 5KUTA 2ZDQA 2OZPA 3GZNA 2HMTA 4GYWA 4PCUA 2BGWA 1Y82A 2G9ZA 4BEWA 3PV0A 4S3MA 5UKDA 5IP5A 3VC7A 4I4TA 1K3FA 5FJIA 4L8FA 2QMYA 5HBRA 3OE5A 4UNNA 4IS2A 1FK8A 4F1WA 1YJAA 3DV0B 3ASVA 3EXAA 3F8TA 4PG8A 3ZHXA 5HKLA 3RS7A 1EPUA 3TCXB 1CZHA 2E4AA 3F6PA 1EDBA 4UZSA 1QQBA 3SDSA 4WZBA 4UOEA 1BKYA 5G0UA 4INAA 3TIFA 5BR4A 4DV5B 1PHRA 1O57A 2EFEB 1GOTA 2ZSAA 2OZLB 5CA1F 3E9YA 3ILYA 1CVLA 1HQCA 3LQ4A 3IV7A 4QU8A 3VSCA 1OX4A 2R60A 2AYYA 2P3QA 4Y0AA 5AKYA 4I9NA 1YS1X 4YRNA 4A6EA 4ZAWA 1AGPA 4HTAA 3LOQA 2EKDA 1X74A 3JASB 3QXXA 3AILA 5AI5A 1S1MA 5KCZA 2V7VA 4HGNA 5KYNA 3O84A 4MHOA 4TWAA 1PEAA 1JX6A 1SPBS 4QDTA 3QVGA 3WLHA 3S4YA 1JLSA 3R9XA 5KJ1A 3AVVA 2C20A 2C0PA 2RG7A 5HCIA 3MWDB 2GF9A 5SY4A 3ENKA 2IY9A 3E9QA 3MFYA 4MK4A 1H4SA 2JHGA 1EQAA 2H4XA 2P62A 2YN0A 3LJKA 3A4NA 4OYRA 4R68A 3DDSA 1E8NA 1EVLA 3OU2A 3PFGA 1EINA 4UM9D 1SK8A 2OORA 3DKRA 2WF9A 4MVYA 3N2KA 4N7JA 1F8XA 4ZO6A 3V1MA 5B4UA 3S1AB 2VTVA 1ZDMA 4R84A 2QMEA 1JS1X 2WHYA 1IULA 3HPRA 3ILXA 5IK2D 1OLUA 3EIFA 1JVBA 3MBOA 3A2KA 1FTYA 3E03A 3FCOA 4MKGA 1T29A 3E7FA 3GEDA 3C1AA 2JLRA 4RTOA 1O95C 2XADA 3W4KA 3CKMA 4D0LB 5ALLA 5DIZA 2XMSA 4UFOA 1XZCA 2YXDA 3IQZA 2CJPA 4CLHA 3QX8A 2OD9A 4I9UA 4KOAA 2G5GX 3BE4A 1G6KA 1QQ5A 2KS6A 3N5CA 4R9SA 4HRXA 1KEEA 1E1MA 1E89A 3T3HA 4OMFG 5CYFA 3VU8A 1U8EA 2HRCA 1XQ9A 1MT3A 3I3OA 2Y67A 1UWKA 2J85A 4NLLA 4MI9A 2Y71A 4NXMB 3NDJA 1JHVA 2B8TA 5A2QA 3DLBA 3I9MA 1VIDA 3BB3A 3IAAA 4P31A 1OZ0A 2B8JA 4MRMA 1AXEA 2Q29A 3A1VA 1KZHA 3SBXA 1VQ1A 3D81A 1VKZA 1JXMA 3DSRA 3G2IA 4P3PA 4TV8F 4US1R 3EIUA 2GSWA 1JLKA 2OWEA 2GEKA 2YBDA 3CO5A 1TKCA 4R83A 4AF6A 2Q2QA 1RSZA 5IN5A 5DHUA 4U7JA 5ALTA 4F4JA 2CBZA 2X0EA 3M6XA 4CIYA 4A0FA 1CSEE 1TD1A 3D3KA 2HBZA 5ESRA 1OT3A 4DOMA 5TT0A 3RSSA 1TYBE 1JHDA 3OP1A 3STWA 3NVMB 4CEHA 1X7ZB 1VYHA 2IEZA 2PCJA 3HL4A 3B9BA 3SSOA 3VDQA 1VXRA 3V8PA 4NAVA 2OGWA 3M3HA 2I4LA 1T9HA 2QWXA 3NTQA 3KOUA 3O9VA 2WUWE 1X8JA 4FE4A 2RHMA 3ILVA 4MDEA 3AFNA 3SE0A 3UHFA 1YMUA 4BO2A 2Q1YA 1QG2A 1DQZA 1YJ5A 2H9AA 2IZZA 2Q8PA 1FS4A 3I4FA 4B6SA 3KU1A 3MCAA 4I55F 5DYIA 1BNCA 1UINA 4ZVSA 1EHIA 1QCDA 1ZHFA 2BPOA 4OHZA 4HPWA 1KQFA 4IJWA 2GUWA 1IY8A 1IZ7A 2O2IA 5CK5A 1SEVA 4BFUA 5LZ9A 2A0KA 3ISJA 3K4QA 3STUA 2BSQA 1Y5RA 4UCFA 1G9TA 4BNIA 1GA6A 1DJQA 3NMUF 3P2IA 4O4IB 4D9FA 4C3UA 2IIQA 5ESDA 2RGYA 3OE4A 3Q3CA 2CUTA 3R9IA 2EHDA 4TWRA 2AQHA 3RKUA 4FD2A 3EMKA 1N7GA 4MRNA 3LTNC 1NUTA 5BR8B 2H11A 2CXNA 3AEQA 4F7DA 1COWD 1GLVA 2ODEA 5AKZA 1RKXA 3SVZA 1AQ6A 2D1YA 2PN1A 2VP2A 1QO7A 1GPH1 3QVSA 1CZRA 1E59A 4NE9A 4DC9A 4ETNA 2FW9A 1DI0A 4ZP1A 1N6LA 2Y0DA 1K5DA 1OZHA 3ICPA 4E33A 5HX7A 3PTZA 3B1KA 2HA7A 1CK4A 3FLBA 4RE6A 5IJAA 4AECA 4F5ZA 1O5OA 3LPLA 3KUCA 3CU5A 4A1OA 1E9CA 3QJ5A 4WI1A 2BI7A 4NYIQ 3DS8A 1PI3A 4RH0A 4HLUC 3D4IA 4Z8YA 3PC7A 1G21E 4M9RA 1JVSA 1QRTA 1SCBA 1YTLA 3EXEB 4H35A 3O21A 3B2EA 4KPYA 5CH8A 1JKXA 2J5RA 2GKOA 4AIIA 4I6JA 2R6CA 3T0FA 3BGWA 3M2PA 3DO6A 5AXBA 2GBLA 1Z4NA 3FVWA 4GOKA 1XTUA 4QXPA 2C1ZA 5EPOA 1AC5A 4FN4A 4U3JA 3ZGOA 2C1XA 4DQUA 2G9RA 1JNXX 3L43A 4LZWA 4Y1RB 1NJ2A 4LBVA 4XVUA 4NZNA 3DMYA 4OUDA 4G5HA 1NW4A 3OPYB 1Z0FA 3LVBA 1U9JA 3NEJA 2PLWA 4YDRA 5A02A 3OLCX 2ID8A 4G01B 2Q3EA 2BI8A 2J5XA 3MCWA 4L51A 3CS3A 4X7MA 1HO3A 5ICFA 1U7DA 3W90A 3PHCA 1JPJA 4CR6A 4Y18A 4HAXA 3VRHA 4HSGA 3WL6A 4I5DA 2OY0A 1CJUC 3GZTB 4RTLA 1T5IA 2Q5IA 3HVIA 4BFYA 2ZCJA 1ZWLA 3DDUA 4MQEB 3AKEA 4CIVA 4EKIA 3TQRA 4Z4EA 4EUNA 1BOOA 3PHGA 1PV2A 1X8KA 3CZ5A 3JATB 3NCHA 4JLOA 4OVKA 1YRQA 4CFYA 1A9RA 2ASVA 3PNSA 4JC8A 3CPSA 1GQRA 1U0LA 3OKPA 5BSTA 3ETHA 1FLAA 4H0CA 4N3CA 5BSVA 1ILWA 1EFTA 4FLFA 1EP1B 2AJLI 2IX3A 3GDOA 1FTGA 4K9MA 4ZI7B 1W30A 2F3TA 2NYUA 4DRZA 1ZQ9A 2NWQA 1CS0A 1AE1A 1U65A 4B2YA 4EY3A 1HT1E 3BJEA 4WBSA 4ENRA 4REOA 1GPBA 4DLAA 3TE6A 1KGDA 1KAHA 3FJOA 3PEEA 3FYSA 2BCJQ 1LB1B 2RHLA 3U49A 3IX7A 2ADFA 2ZSDA 3BIWA 3ERCA 1DKPA 2XSZD 4Y1FA 2VPYA 4QPJC 3K2IA 4WNYA 1CUEA 4HDAA 5GVSA 3DV9A 5H7XA 5I7FA 3PDUA 1NXTA 2DWUA 1SVNA 2Z08A 4HQFA 1W2GA 3I0ZA 3PE6A 4QYIA 3MTIA 1UP4A 2YWRA 4RFSA 1L8AA 2KMLA 2SECE 9GPBA 3BIXA 1UC8A 3CZMA 4WKBA 3L93A 5BMVA 2DBRA 3DE3X 2GRAA 5IX8A 2VSFA 4CMIB 2QG6A 2ZXEA 5ELLA 3I83A 3NIGB 4LDJA 4PSVA 5IKXA 1R0XA 2POQX 4ZTBA 5DB4A 2AJ8A 3O8QA 5EHGA 1NP6A 2W98A 2ZTVA 3FNRA 4LXTA 1KVSA 5FCDA 3NS7A 2YV2A 3MD9A 3W1WA 1SXQA 1WULS 1UT5A 3GJQA 5LLDA 3KZCA 5C37A 4IYRA 5LVAA 1DCTA 1DG3A 3DZGA 4IDPA 3VDXA 4BQIA 5LMZA 5C34B 1DAEA 1Q0QA 3CR8A 2FWPA 3G9TA 3VR6A 4C0LA 1HFEL 5BRJA 1AGXA 4HK4A 2QN3A 4IXTA 2HREA 1DIOB 3HU2A 3C43A 2FPIB 3FYUA 2WILA 3NKVA 3PDIB 2CHUA 3QE2A 3RPEA 1YNSA 2V6MA 3AHCA 1OOEA 2VZEA 3O3MB 1UZUA 2GBGA 5IULC 1N6OA 5D86A 2HSDA 1P72A 1XQXA 5IFKA 4S05A 1I9CA 1K88A 4Y0NA 4YUWA 3F3YA 2YHBA 3JQ7A 3INNA 2WYHA 5DWVA 3ZDDA 2O5RA 5A4AA 3F5DA 3QLJA 3KHSA 3ER9A 3HI6A 1AVTA 1GTSA 4G0YA 1PUXA 4QC2A 1MW9X 2FRXA 4EUEA 4QGSA 2XRYA 2ATEA 4LCJA 4ZEMA 4CMBA 1ORIA 3HA7A 4DDUA 2V4ZA 3CNOA 4GVLA 2H9IA 1ZH8A 1Z07A 3SIPA 3T9EA 4MTCA 3NEAA 2EWWA 3H83A 4JK3A 4EA9A 2Y76A 5BYKA 1KR2A 1XTPA 4NY1A 4X66B 3WNDA 2YBEA 4MPJA 1UP6A 2PKWA 2IYQA 2F3PA 5B7PA 4MI1A 1R74A 3EZ7A 3PWSA 4UC0A 5TQ2A 4CTOA 2XF2A 3MS7A 3ZYZA 4B3MB 2Q6KA 4I2VA 2R00A 4CM9A 3JRXA 5DTEA 1U2EA 2EBWA 2FF5A 4P81A 1O1YA 4ZOAA 5ALFA 1FFYA 2ATVA 1JEDA 2Q3DA 4K6GA 1NONA 5EZYF 4PBRA 4ITVA 2D59A 3LXXA 1JDPA 2VYQA 4X41A 3L7LA 3L6BA 1WPXA 3LHKA 3T61A 2H2HA 4DV6B 4RK6A 5IARA 4PRYA 1FP2A 1T2NA 1G42A 2A0YA 2C84A 3CH7A 1C9JA 2NSLA 2RK6A 2ZRIA 3GRUA 3ITNA 4TKUA 1J90A 1DRJA 3PLRA 2ZIZA 3DVRX 3TW8A 1KDRA 3W9UA 2HNKA 3WLOA 1WTAA 2YKGA 3PXAA 2C3OA 4II3A 5AK6A 1LW6E 2FX5A 5ILGA 3ZJ4A 5JQGF 4IDNA 2O3SA 4RQBA 4C88A 2OBBA 4BFXA 2CFTA 2N1MA 2XXJA 3JQ9A 4JJIA 4OP1A 4QUHA 3T3PB 1AJEA 1XZMA 1N3IA 3TF5A 3EZXA 3GQBB 4H0FA 1YHYA 4NFSA 2GEFA 2C5EA 2FPPA 4QOSA 4DARA 3ETLA 3LC0A 3QUCA 3G6KA 3AL0C 2V96A 2XDYA 1G8PA 2FA9A 4YAOA 4CYMA 1JHAA 1JFFB 1W25A 4Z8XA 3GJSA 2O2CA 2XYVA 1CDOA 1PYDA 2CDAA 4FYWA 1JA0A 2O05A 2ZJ5A 3UV6A 1JE0A 5J4VA 4BNLA 5JNSA 3LF1A 5IXJA 2JRCA 3UAVA 2COUA 3EA5A 4N0QA 1TZCA 2V5UA 4JH0A 2QR3A 3TZ6A 1Z5WA 1E1NA 2VTBA 5FUVA 5A5VA 3ZKWA 1EKXA 2IPMA 4CL8A 3GFGA 2B92A 4EUHA 5LDHA 1CC1S 1XMPA 3QKUA 4EAAA 1C7QA 1FJHA 1T1IA 1B8PA 1T9DA 2E48A 1AUPA 3JQGA 3OBBA 1KFKB 5HK8A 1YCFA 1YKGA 1OJ7A 1NY5A 2Q1UA 1FUEA 3SNKA 4E3WA 2PMDA 1IXYA 4IDOA 3BD8A 3IDSA 3GUHA 4KMOA 1A1VA 1PW7A 1W1WA 5HSGA 3FMPB 2G8NA 2HIGA 1JTEA 3HSKA 3W5VA 5BVGA 1YDFA 1H2AS 3A7EA 3MMPA 5KNDA 1RRPA 1MTOA 2VDPB 5K2MA 1RC1A 4ZO4A 1TTHA 4CTJA 1SC1A 1OYOA 3U3DA 3KCNA 4CKEB 1UANA 2D5IA 3LOUA 4HL6A 4QGFA 3ZIUA 3FD8A 4JP2A 4AJ9A 1AV7A 2BBOA 2PRJA 4FMPA 4UBMA 2R5NA 3L49A 1AKNA 4Y2RA 1WSAA 3RWBA 5K8IA 5AW1A 4RPGA 3GJ4A 2XZDA 2HM7A 3NZEA 5B1SA 4ZYWA 4RADA 2FPGB 1DIAA 3KCQA 4ES6A 3WDLA 1CQIA 4EW1A 4K6OA 4KLCA 3LRTA 3LX4A 3AKZA 3FF1A 5JZSA 3JWJA 2PL1A 4F7WA 3ZWVA 2V74B 3V32A 2AL7A 8ABPA 4WZAE 3L4SO 4PGMA 2R4QA 1YB7A 2KLHA 3LYHA 4F5WA 4ZEOA 4MAAA 1LBQA 3R7FA 4DEVA 1UOPA 1OFUX 1MEEA 1NFQA 2YOFA 3E58A 1JR3E 1E79A 2XTNA 3EIWA 3NP7A 5HEKA 3H17A 4XJXA 2PUBA 1IPEA 4IIJA 4FYKA 1KKLA 3G7UA 1QNLA 1PFYA 3D1JA 2WOOA 5C4GB 1R6XA 3KAJA 3KETA 1O0BA 4IJVA 1F3OA 1HYBA 1P8AA 4M1YA 4OSPA 5DGHA 3FAZA 4CLDA 6NULA 2IRWA 4OB6A 5EJ9A 1W75A 3PRKE 1V9CA 5FADA 1HSZA 2F4NA 3O26A 3DW3X 2XCOA 4NJEB 3VH1A 4FFMA 4NCAA 3LFUA 3IR7A 2JJ2D 3L06A 1CW2B 4E4RA 3FHJA 1I10A 1Y1PA 1Y6ZA 1RBYA 3FLAA 4QAJA 2WD8A 4Q4AB 1CUCA 1Z47A 2RAVA 1EFHA 3CNNA 4WFKA 2EZ9A 4XFDA 2R86A 3TLZA 4B4DA 3P45A 1TJPB 4PZCA 4K1XA 2VOJA 1NUAA 3CLHA 2OG2A 1J9GA 2EEPA 5GONB 2BRUA 4JY7A 2EYUA 1U3CA 3SM9A 2QL6A 2QP4A 3DDOA 2E2WA 2COKA 2QSJA 2XWQA 1MAAA 1THMA 4ON9A 2QDKA 3F9CA 3WIDA 2RJOA 3QF4A 2HWWA 5LP6A 1AT1A 2Q4OA 3OAAA 4K6KA 4UU8A 1U1FA 1O9HA 1H1LB 4LFAB 1GQQA 2G17A 3G8AA 3T3OA 2C2YA 3GW8A 3PD1A 4NS4A 1O5IA 3DO8A 1M6YA 3K30A 2FN4A 4YONB 1KKUA 5E2AA 3F6BX 4HMPA 3W6UA 2D0DA 4G26A 1NVVQ 2OUIA 4C9BA 4P4GA 2G70A 2BONA 1CUGA 4BQPA 3D8UA 1GSIA 1XCMA 3CTMA 3L8HA 3KJXA 1RYDA 2RD2A 4KODA 2BL4A 1DX4A 2FZKA 2QE6A 3PGJA 5GJCA 4KQ9A 2ACWA 3R7BA 3ZWNA 1MO3A 4P3OA 1IY0A 4ZRDA 3PF8A 1XCGB 3HGQA 4MRRA 4MS3A 5EIOA 5IDXA 5HRUA 1FXWF 3AR9A 1E96A 3ZW9A 3KOMA 1QP0A 4JHLA 4YROA 4QUAA 3ZHOA 2QG4A 3WLPA 2YZ7A 5LQNA 1MCZA 2NO5A 3OX2A 4D3YA 2ZI5A 4Y1RA 1NBMA 2AQIA 1B74A 2WJJA 3A26A 1R6UA 4K03A 4U3JB 3PJEA 3FZEA 4IJ6A 4NIMA 2HA0A 2UUOA 1I2AA 1O0CA 2O4UX 2QW1A 4IOMA 4YCDA 4B82A 3LL4A 2HPZA 3UA4A 5TX7A 5ECYA 2VPIA 5JYDA 1T5OA 2FGJA 1H6AA 3EGEA 3KOXA 1OREA 1ZEJA 2M32A 1LKZA 1O58A 2OM6A 4YHHB 3AESB 2G77B 1M6VB 1ZA2A 2BFDB 3E2MA 5K8JB 1FUKA 5JMWA 2BOVA 3Q3IA 2OV2A 1H2WA 1HV8A 3ZHTA 1M73E 2A9PA 3HMKA 3PWZA 4G4JA 1SZCA 4KE7A 5ALHA 1B00A 1ISSA 2O7NA 3KQWA 4JJEA 3UJPA 1U8XX 1UBJS 4H08A 5KOJB 3T5PA 5GMOA 5JADA 2ZIEA 3P0HA 3UGKA 4R7ZA 3A1FA 3QA3E 5SZKB 1ESCA 1YRWA 2IW1A 3OFNA 4DS3A 1MZPA 1AKQA 1EX1A 2ILVA 4Q3CA 3WC4A 3WISA 4P1ZA 4KOEC 4RIEA 3G2OA 4J49A 4PC6A 2PFKA 3BH7A 4H6PA 1OA1A 3IAS1 5FTJA 4GI5A 3V7WA 1MW8X 2BUBA 3AEQB 3QU9A 3I2IA 4M8KA 3DULA 4M1WA 4C2UA 2JH3A 3JAWA 3JVVA 1QO9A 5EIWA 4GI3A 1ISMA 4GXTA 3AP3A 1KO8A 2BJVA 4NNOA 4ZYYA 5HZMA 1GPKA 1HORA 2IDMA 2CLFB 2W9XA 4TLCA 1R8JA 1UZNA 1I2BA 2CHQA 2QTTA 4K28A 4QVIA 2FH5B 2CE2X 2NZJA 2X2PA 3H04A 3NVDA 1FB5A 1L9XA 1GG9A 4LYYA 3T1HB 4W1SA 1NMSA 3AFGA 3EAQA 4MVJG 2LXNA 5TF4A 4JLPA 1U9YA 3BL5A 2V45A 3GT4A 3PJDA 4HXYA 2OXFA 5FTKA 5A71A 3WSVA 1KWGA 1T1GA 1D1PA 2PMFA 1G21A 1E2KA 2PMCA 2O1WA 2R79A 3KHUA 4GM1A 1LZKA 3AJ8A 3CEHA 2O7VA 1BMFA 1TI7A 1B2RA 2Z6VA 4LHZA 1V2HE 3O8CA 1I2DA 3EB9A 1T3ZA 5H02A 4MJLA 2GN2A 5BSUA 1CZUA 1L4NA 2PBLA 3RYIB 4N03A 1HNWB 1WY7A 2Q62A 4CEHB 4KO3S 2EQAA 3D3JA 3ICEA 3S28A 4MWOA 3VH4A 4G1MB 3I6BA 4GNKA 2WKQA 3TLEA 1Z6GA 1VHLA 5C4MA 1NASA 1IHYA 2VLBA 1UOEA 2Z98A 3D8RA 2Y9PB 3NIBA 1KFCB 5FPQA 4DSUA 3IKLA 4OHPA 3BHMA 3VUFA 2YOGA 3KKQA 2QIPA 2A14A 2FK7A 2M6LA 1KIAA 4RETA 1IMOA 1RXWA 3JASA 3QOYA 3G7SA 2JS7A 2OO3A 2O9JA 4TLEA 2ECKA 3OTWA 5CT6A 2D62A 5FPHA 4CKXA 3BCRA 4PFJA 5E6SA 4CHGA 5KTSA 3A1NA 3HNOA 4N54A 5EXXA 5EWMB 3CG0A 3EGDB 2W2MA 3B9QA 3QM1A 3GUZA 3PUXA 4G5YA 4N47A 3VYWA 4ACAA 4CQMB 2QQEA 3YASA 2WJVA 3V33A 1UXOA 3T3GA 3ND9A 4TQ9A 3TLXA 2PX5A 3VNSA 4YRSA 1AS2A 2IS2A 1EMDA 3CLUC 1ZLXA 1K9VF 3CW9A 4LYJA 4UQPA 4DIDA 5EHXA 4DDKA 3UO8B 2C3PA 4CETA 3F9RA 3QXHA 4KPFC 5MGBA 1DEOA 3LWZA 4Z7NB 3WOVA 1P19A 1MJGM 1A8QA 2Q7DA 1NMEA 2PZ8A 1BXZA 1ADJA 5CLHA 3CC8A 3BH6A 2IHUA 2FX2A 1P91A 3OPVA 5J58A 2YUTA 3AM4A 3O8NA 3MXOA 1A04A 3KSDO 2Y0BA 1I8TA 5ENVA 4D0SA 3IVMA 1NSYA 1MPXA 1WVIA 2PO5A 1I6LA 3SAJA 1KY4A 2QI9C 3GLHB 4J1TC 1VA4A 4LCBA 3U4AA 4BJ1A 4MHTA 1CR1A 3G02A 5HTOA 3N3A<