3FBWA

Structure of rhodococcus rhodochrous haloalkane dehalogenase dhaa mutant c176y
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Atomic resolution studies of haloalkane dehalogenases DhaA04, DhaA14 and DhaA15 with engineered access tunnels.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
total genus 107
structure length 292
sequence length 292
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2008-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fbwA00
5ALYA 1YB7A 4WFIA 4BTVA 4KJXA 3WK7A 2QS9A 4H7DA 4BYMA 4GLBA 3R0VA 3FYUB 3K9BA 4CG2A 2XMBA 4MEAA 3ZLTA 4Y2YA 1VLQA 3QMVA 2QKYA 2EDAA 5E4JA 3I2KA 5LZ4A 3H2KA 4HAIA 4X95A 3WWEA 1ODTC 3IUMA 4DIUA 4Y9SA 3D2CA 5IVDA 5CT4A 3IUQA 1EVEA 4UHBA 1EA5A 3L1JA 3HABA 1ODSA 1YB6A 1TCBA 3C87A 3C6XA 1KU6A 5C8ZA 2D0DA 1LBSA 1HQDA 1QIMA 3WKBA 5ALFA 2Y2VA 1E3QA 2WIFA 1T4MA 3WYNA 1XROA 4ZGBA 4X92A 1L7RA 3W9BA 2H1IA 5CXUA 3OC0A 1ZOIA 2WG2A 1XRLA 2FJ0A 2ZJFA 1EVQA 1OILA 1H2WA 1EINA 3O4GA 3OM8A 4KEAA 1TRHA 3ILSA 2VTVA 3ESDA 4LHEA 1THTA 4QWWA 1TKRA 5ALDA 1AQLA 4RPCA 4N5HX 5AK5A 3JWEA 1MNAA 1ACLA 2RHTA 3IURA 4MEBA 4PF1A 2RONA 2O7RA 1IMJA 1E5TA 4H7JA 3BF7A 2QUAA 5EGNA 1CRLA 4NMWA 5JD6A 4E14A 1N5RA 3H2GA 4P92A 2JGKA 2WUGA 2IX9A 4WY5A 1THGA 4PV7A 5AI5A 1E8DA 4I19A 1QIKA 5AK4A 1XQWA 4B9AA 4GI1A 3F8SA 2WHRA 1XRPA 4INZA 4G9GA 1GPNA 1Q0ZA 2PKYX 3OOSA 3O4IA 5FLKA 1GPLA 3PUHA 3RM3A 1EH5A 3D2AA 1CUEA 1CUUA 3QVMA 4X3CA 4HXEB 1ZJ4A 2CB9A 5AIBA 1R9NA 1OXMA 4P08A 5IVHA 4EA6A 1X2BA 1UK9A 3WKDA 3DKRA 4DNQA 5C81A 3G02A 4EY8A 5ALIA 1JFRA 2XT0A 1GXSA 2WIKA 4H7FA 2Y1KA 1TIBA 1WHSA 5CT9A 2VJDA 3D3NA 3ICWA 1JMYA 2R11A 4GHWA 2VA9A 5CW2A 1EB9A 5AKZA 1U8EA 5A6VA 3MUNA 1Y37A 2HHAA 4FNMA 4PW0A 3FNBA 1QFSA 3OPMA 4QLOA 2ACKA 3WIBA 3BJMA 4BCCA 3HSSA 5ALZA 3KDAA 4WCVA 1HL7A 2XUOA 1LGYA 4UHEA 2CEKA 4U2EA 3H0CA 4FTWA 1WM1A 1XZDA 2FUKA 4J3JA 4WDQA 1JJIA 5CTAA 2GBIA 1A7UA 5EHXA 2JGMA 3STVA 1U2EA 3WJ1A 5CT8A 4Y2VA 2PSJA 3R3YA 3DLTA 3QITA 4OB6A 4UFPA 2JEYA 3TJMA 1R9MA 5JZBA 4GXNA 1N5MA 4FNGA 1G66A 4WFJA 1EDDA 1F6WA 7YASA 3G9TA 3D0KA 1A8QA 4AQDA 1XRQA 3B5EA 4Y2QA 3R3VA 1CVLA 1MAHA 2XQFA 4X6YA 2JGIA 3QM1A 3FBWA 1LLFA 4A23A 2Z3ZA 3R3UA 4C4YA 2DHEA 4UBLA 1XZIA 2HU5A 5AKIA 2XMGA 2XMZA 2JGLA 5KBYA 3PI6A 4YK7A 4DNPA 5DNUA 3RARA 4HS9A 1AUOA 2GZRA 3AZQA 3STUA 2PX6A 5IVKA 3MGAA 3BXPA 1FFAA 5K3BA 1BCSA 4N8SA 4B81A 1EI9A 1E8MA 1VA4A 2OQIA 4EUSA 2YH2A 2PVSA 3HEAA 3N2ZB 4F5ZA 5ALKA 2VJBA 2H7XA 2Y6UA 2WUEA 3WK4A 4XVCA 1BU8A 5EFZA 1F8UA 4FWBA 1NU8A 1YCDA 1LPMA 3WK8A 1QJ4A 3I2GA 5IH7A 4BB0A 1BS9A 2HRRA 4KYVA 4FLMA 4B0OA 5HCUA 5HZGA 1O6GA 3D59A 4UBKA 2AJDA 4ROTA 1UT6A 4PSUA 5BOVA 1E8NA 4OB7A 1XLVA 3NGMA 3JYHA 3T52A 1CUHA 4P93A 1AMNA 5HK8A 4QDZA 3WWCA 1WCYA 2G5PA 2K2QB 2YASA 3F97A 4BVKA 2VATA 5AM2A 5KWJA 5K3EA 4Y2PA 3FVRA 4NZZA 2I78A 3G7NA 4XWGA 1W1IA 2Y6VA 2WHQA 3EQ9A 4ZWNA 1KEZA 3G9XA 5HQ3B 2VT7A 3H18A 1CUFA 3STWA 3FWHA 4UBJA 3I28A 3STYA 3LP5A 4NVRA 2XUKA 1MT3A 1EK2A 4WJLA 3C8DA 2OPHA 1VZ3A 4Q3KA 1GZ7A 3FYUA 1ZI6A 5AKJA 4UHCA 2C0QA 1QTIA 1ZD5A 3W05A 1GKLA 4ZXFA 3C43A 1QIHA 1U4NA 3IUJA 2BJHA 4PSCA 2ES4A 2WG0A 1X2EA 3H17A 5AICA 1K6EA 3ZPXA 1UKAA 4G8DA 5LZ8A 5AKYA 3DNMA 4EY7A 2GZSA 3O95A 4L72A 4ZRDA 3WWPA 3I6YA 2BAGA 3VVMA 1TK3A 2JBWA 2WILA 3RLIA 5FUMA 4BTLA 3M81A 4CI9A 2CUTA 4HXGA 3IB3A 4J0JA 3G0GA 3VJKA 1PFQA 5LKRA 1XKLA 5AI8A 5ALGA 3DCNA 4YASA 5DNVA 4X90A 3X3HA 4WDRA 2WFLB 5FXMA 4BDSA 1QO9A 3CN7A 2PPLA 2GYUA 2XQGA 2WU4A 1CUWA 4JYPA 1B41A 5K5EA 3R3ZA 2HL6A 3BL8A 4FFVA 5JANA 1P0QA 2VJAA 3AINA 3OTQA 3H1AA 4E11A 3WKCA 1FFBA 1YAHA 2XMQA 3FVTA 2JF0A 2RAUA 3G0DA 1LZKA 2XI4A 3C6YA 3ED1A 4XIIA 2XUHA 1FSSA 4AZ3A 5AOBA 3H2IA 1ZI8A 4Y2JA 5AM0A 1MX5A 3DOIA 2DFPA 3WI7A 4Q05A 3WMRA 4KACA 3M83A 4JH0A 1EDBA 3PF9A 4K2AA 1TAHA 1CUIA 4IO0A 4BDTA 2QR5A 3DL7A 2DR0A 5KREA 3WJ2A 1LZLA 1QLWA 1ZICA 2AJ8A 2QMQA 1PV1A 1ZD4A 2WU3A 4LXHA 1USWA 4BAUA 5AOAA 2XUGA 1R4ZA 2JGJA 2VAVA 1XKTA 4EBBA 4S0XA 4DTCA 2XUFA 4OUKX 1CQWA 3BIXA 4O08A 5CRIA 2XUJA 4FHZA 4J0HA 3KOOA 4RNCA 4DGQA 3GA7A 3C6BA 2O2IA 4KAJA 1IUPA 1XRMA 3FLEA 3NOXA 1WB5A 2Z5GA 4PQEA 3QMWA 4CIAA 2QZPA 1H2ZA 3SK0A 4AMZA 4KE6A 3L1IA 2I3DA 2H7CA 2QTBA 5JYCA 2C5GA 2QT9A 1ODCA 1TQHA 3HRHA 4QWMA 2Z8XA 2YXPX 3PF8A 4BAGA 4MJ3A 5AIAA 5T4BA 1U65A 5ALSA 4X71A 1IUOA 4X91A 4X85A 3FSGD 4Y7DA 1BEZA 3SC2A 5LZ2A 1X70A 3ESBA 1LPSA 1DINA 5ISMA 3QH4A 3D7RA 4ZV9A 3E0XA 3AJAA 1YA8A 2WQZA 3LCRA 5K3CA 5ALXA 3C5VA 4B7ZA 4NS4A 3N0TA 3T4UA 1YASA 2QJRA 1C4XA 4AN1A 3GUUA 2EEPA 3AUKA 4DNFA 2JGFA 4DNOA 1B6GA 4UHHA 3DEAA 5JADA 4OYYA 2X5XA 1DTEA 1HLGA 1QIIA 4UBNA 5AHXA 2DHCA 3H2HA 2OG1A 5FV4A 2AJBA 2PM8A 4RE6A 4C88A 1XZKA 2ZYSA 2Y2UA 4GBGA 2J3QA 4BC1A 3KD2A 3V9AA 4EY5A 1A88A 3A70A 5CH8A 5A7FA 1SOMA 4U2BA 1HBJA 5JD5A 4IH4A 4DSAA 3WL6A 5AI4A 4U2FA 2OAEA 3M3DA 1MX1A 5CURA 1GPKA 3MVEA 4LIPD 3W2TA 5HF5A 3V1MA 2JIDA 3I2FA 4LXGA 3WL7A 2H7YA 3U0VA 3BDIA 3IBTA 4OCZA 3BDVA 1QIGA 1XZGA 4FDMA 5JAOA 2BUBA 1JI3A 2X76A 1DQYA 1F0PA 2C0PA 3FYUC 4UPDA 5ALWA 4J0GA 3LIPA 1G5FA 5I9IA 2BFNA 4B6GA 3ZLVA 1ORVA 1EK1A 1Z68A 3WIOA 4MWTA 1W75A 3SWWA 3HJUA 1AKNA 4H77A 3R3XA 5ALOA 3C70A 1ISPA 3IDAA 3AIMA 1CUAA 1L7AA 3EF3A 1KU0A 4G1FA 4KE7A 4J0CA 3G0CA 1WPRA 3VDXA 3C45A 4MYDA 4QDUA 5DYTA 1JU4A 1VOTA 3DOHA 5ALJA 3YASA 1TCCA 5FPQA 2O2GA 2PU7A 4CIBA 2XUDA 4UBIA 4B85A 5ALHA 4HVTA 1H23A 4W1RA 3F9CA 4H35A 3CCCA 1XRRA 1HDEA 5AKHA 1GGVA 4CFSA 5A7GA 2QXTA 1ZJ5A 1LPOA 1DT5A 3GROA 1LNSA 5ALUA 5FPPA 4MQMA 1ZIXA 2ZYRA 4K5QA 5AM3A 1UK8A 4DMKA 1MTZA 1C7IA 4MWSA 3FCXA 2O7VA 4F60A 4Q3LA 3KWJA 5ALVA 1T2NA 1EX9A 1GT6A 1LPAB 3HACA 1ZGCA 2XE4A 2C4HA 2G63A 1AGYA 5E4YA 1WPXA 1XZCA 3I1IA 4W63A 2WLSA 2XQIA 5AM4A 5AKGA 4CG1A 4BC0A 1BN7A 4BCBA 1N1MA 4EY6A 3UUFA 2UZ0A 2XMCA 2DQYA 3D5EA 1WB4A 5LKAA 4C6HA 3PFBA 4ARBA 3DYVA 5DYWA 4P9NA 4HRYA 4QLAA 1AURA 2DQZA 3O4JA 4KR0A 3HZOA 3I1YA 2ZJ6A 1QIEA 5DJ5A 3M82A 5HKBA 3I2JA 2WJ4A 1XZFA 1XZMA 3UUEA 5LZ5A 1ACJA 2HDWA 5E2IA 3V1NA 5JAPA 4DM7A 1MPXA 2PSEA 3GBSA 2HA6A 3FLBA 3LS2A 1CUGA 3E4DA 2VAXA 2GYVA 1R1DA 2RHWA 1CLEA 1YA4A 3HYSA 1R3DA 4X94A 3TRDA 5DYYA 1UK7A 4BATA 3K6KA 2WFLA 5FRDA 4EY4A 1Q83A 3O4HA 4WY8A 1E89A 1N8SA 2PL5A 3ZI7A 2J3DA 3G0BA 1UOOA 4IH9A 3WL8A 4CCYB 3I2HA 5IVIA 4M0FA 4X00A 5JZSA 3AILA 4H7HA 5LZ7A 2V96A 5JASA 3BF8A 5KWIA 3C6ZA 1UFOA 2IITA 4HRXA 2ZYHA 6YASA 1DWQA 1Y7HA 1MAAA 2PU5A 1L7QA 3WA6A 5LLSA 3KXPA 4ZREA 1UZAA 1WHTA 2RI6A 4J0KA 5ESRA 5A62A 5ALLA 3HC7A 2Z8ZA 2OGZA 4QDTA 2B61A 1CPYA 4J7AA 4Q1VA 2HA7A 3G9ZA 5LZ9A 1ZIYA 2CZQA 2W22A 5HFNA 2IIVA 5AH0A 3AZOA 3EIOA 1QOZA 2CKMA 1XZEA 4QE3A 1QIDA 1GKKA 4UBMA 2BKLA 3G8YA 1JT2A 4B82A 1IUNA 1IVYA 1YS2X 5ALTA 4HZGA 4I4CA 3TGLA 5E4TA 3NWOA 4KAFA 2Z3WA 1K5PA 2ROQA 4V2IA 2LIPA 1UWCA 3Q8WA 1EHYA 3QMMA 1J1IA 1CEXA 5H3HA 1VJ5A 4B0PA 4ZI5A 4DMCA 2WIJA 2OGTA 2EDCA 2VT6A 1NU6A 1J2EA 4B84A 5K3FB 3BE8A 2V9ZA 2HU7A 4BVJA 3ZWQA 1XLWA 3FAKA 4MQLA 1W6RA 5IKXA 4OB8A 4QZVA 4X6UA 2ZYIA 3WK6A 1LPBB 4AO8A 2VF2A 1UOPA 2AJLI 4PNZA 3G9UA 3ICVA 4BVLA 2PBLA 1ETHA 3DS8A 3G0IA 3IUNA 4KE8A 1XZJA 5AOCA 2D5LA 2J4FA 2QRUA 4I3FA 2ZSHA 2E3JA 4A16A 1HKHA 3A2NA 2WIGA 3U1TA 4HTAA 1XLUA 3GELA 3K2IA 5AKLA 5BV7A 5CH3A 1J07A 5EHQA 3I2IA 1JMKC 4KRYA 4Y2UA 1EDEA 4EB0A 4H7IA 5AJHA 1CFJA 3OURA 4IQ4A 1Q84A 1CUSA 5HFAA 3LLCA 5A2GA 1K8QA 1QIFA 1EXWA 2WJ3A 2HU8A 4BAZA 2YYSA 4UFNA 4B80A 5AI6A 1G42A 3PICA 3BJRA 1E66A 3E1GA 1YR2A 2XQJA 2OCIA 3ESAA 1VKHA 2OCKA 2VSQA 3VISA 1XFDA 1NX9A 1DT3A 3DL4A 1CUZA 2GBCA 3F96A 4PSDA 3WLAA 1M33A 1G4HA 1DX6A 4N8EA 5EIEA 4BZWA 2HA2A 4AX4A 2XLBA 4OU4A 4Y2TA 1J06A 1VXRA 4G9EA 3PDCA 1JU3A 2OXEA 2C5FA 3JW8A 5AI0A 3E3AA 1CUCA 3W04A 2G4LA 5C7YA 2PSHA 1K4YA 1BRTA 4AZ0A 5JATA 2XUIA 2OLEA 2O2HA 1VZ2A 2BGRA 3H04A 4U2GA 1XRNA 2OQVA 1MNQA 4WFKA 2OAGA 1UXOA 5CT5A 1IZ8A 5D6OA 3FSGA 4DLNA 3LIIA 1CUDA 3H1BA 4X97A 5EIHA 3O0DA 3VJMA 1CIJA 1CQZA 3WYDA 3VJLA 1CUXA 5ALEA 2ACEA 4UFOA 4UBOA 5CXXA 2PUJA 4FLEA 2WHPB 2X8BA 4L0CA 3F67A 4JEIA 3C8HA 2HA0A 2HM7A 4C4ZA 1JJBA 2RIPA 4UUQA 2CMFA 1ORWA 1ZGBA 3DQZA 4G4JA 1QZ3A 1XQVA 3IULA 3BIWA 3W9UA 4BRSA 5JALA 3AIKA 4XX1A 1K63A 3EBLA 1S8OA 2GBFA 1XQXA 1R88A 3ESCA 4K6KA 4JYMA 4OPMA 4U2CA 5AK3A 5DLPA 4CG3A 1W4LA 3QPCA 4F0JA 1DWOA 5CBKA 5AM5A 4GECA 3QYJA 1QGED 2B20A 2BUAA 4G4IA 2XMSA 4DMHA 4BZZA 1MU0A 2NW6A 4OSEA 4E15A 5DNWA 4X7BA 2H9YA 5HF6A 5D3ZA 2R8BA 3B12A 2XDWA 1DQZA 1C7JA 1BEEA 4QDXA 2WTNA 4W1SA 4HXFB 4BRZA 4C89A 4AB1A 2VQ6A 3DKKA 3V1KA 5K3DA 5FKJA 3I6ZA 4G8CA 2WTMA 4QEKA 1XZBA 3QPAA 5JZ9A 2I3ZA 2ORYA 1XZLA 4FBMA 4L3WA 3R40A 1FFCA 2WKWA 2VJCA 2HIHA 1BROA 3PFCA 2JEZA 2PUHA 1W52X 4G5XA 4B9EA 2C7BA 4ZV7A 1AZWA 2ECFA 3DJYA 2V97A 5D3KA 3AIOA 2GBGA 1UKBA 1YAJA 1BE0A 2C58A 5EHZA 3WA7A 5T4FA 4AMYA 5T4HA 4H7EA 2CJPA 1FJ2A 3L1HA 1UK6A 1W76A 4CCYA 5CT6A 5LIPA 4W9RA 1OCEA 2ZVDA 5JARA 2QM0A 4OYLA 4ITVA 1DX4A 4GEGA 3FLAA 4UHFA 3WQHA 1XZAA 5EIAA 2WUFA 5C8VA 3PE6A 1CR6A 4GW3A 1F0NA 3HXKA 2OCGA 3W06A 1QTRA 4C01A 4DMFA 5AI9A 1IZ7A 2B9VA 3VKFA 2HA3A 3IIIA 2FX5A 4RE5A 4KAAA 4DSZA 5I8PA 4YPVA 5C8XA 4MYSA 4Y2XA 1I6WA 4AXBA 3UMJA 5HQ3A 4EHBA 1CUYA 5AKXA 3EQ8A 3PUIA 5J3JA 1AX9A 1YSCA 3STTA 5I7UA 4TVKA 1RYYA 1QONA 5D7BA 1SCQA 4QDOA 3S2ZA 1ZD2P 1A8UA 2ZSIA 1FFEA 5BWBA 5AO9A 1DWPA 1Y7IA 5JIBA 5ALMA 5F4ZA 4W1PA 3WWDA 4IH1A 4G8BA 2I03A 5LYYA 2VEOA 3AZPA 2FJPA 2Q0XA 4J0DA 3ZLUA 1LPNA 4JUIA 4BP8A 4FOLA 2XMRA 4RGYA 5K3FA 3VXKA 2PSDA 1CUBA 1TCAA 4LYDA 3ZV7A 2XUQA 3D4LA 2HRQA 5A7HA 1H22A 3CN9A 1WB6A 2DHDA 3WWOA 4FLFA 4IHAA 2XUAA 2XQKA 2J4CA 4BP9A 2QXUA 2WFMA 4FMPA 2BUCA 2QUBA 1MO2A 4KE9A 4AN0A 1MX9A 4MXDA 1VA5A 4H18A 1H2YA 3F98A 4FKBA 1VE6A 5AM1A 4CCWA 2B4KA 3EQ7A 1DU4A 2HFKA 2WG1A 3C5WP 3ANSA 2WFZA 4F21A 1BCRA 3FCYA 5DTIA 4YX9A 2HADA 2QVBA 1HPLA 2W6CX 3WK9A 2ONCA 1LPPA 4Y2RA 4ETWA 3RK4A 3QPDA 4Z49A 4BE9A 2HFJA 3HI4A 3HLKA 4A5SA 3Q0TA 1QIJA 4U2DA 4BCDA 4ARAA 5DTJA 2XUPA 3V48A 4L9AA 2XLCA 4FFWA 3KWFA 3DYIA 2QJWA 1VXOA 3SX4A 5ALRA 3QBJA 3WL5A 3DD5A 1GQSA 4N8DA 2ZJ7A 1RP1A 5CH5A 3CXUA 4M0EA 3CCBA 1SCKA 1SFRA 1MN6A 5YASA 3WKAA 1AC5A 1SCIA 4K6HA 5AK6A 3IVMA 4M0MA 3BWXA 2PSFA 3AFIA 3WKEA 3OG9A 5FP0A 2AJCA 1PJAA 2G5TA 4AO6A 5A71A 3WK5A 1BN6A 3FOBA 4C87A 5FOQA 3H19A 1EB8A 5AKKA 1QE3A 5EI5A 4H7KA 1MJ5A 4K6GA 5ALQA 5BWCA 2V98A 3O9VA 3B3QA 4D9JA 1JJFA 2HA5A 3NUZA 4OD0A 1ZI9A 2GYWA 2DSNA 4OU5A 5AP9A 3KSRA 3P2MA 4EZIA 3S8YA 5LP1A 1CV2A 4LXIA 2WSLA 3DDUA 4Q3OA 2WUDA 2XMDA 5ALNA 4H0CA 4KRXA 4Q34A 5JD4A 1UOQA 4FBLA 2JGEA 1CUJA 4PO3X 5JAUA 2P8SA 4X6XA 4XJVA 2WHPA 1YS1X 5K3AA 4GDMA 3GZJA 1FFDA 5AKEA 2DCMA 4AO7A 3V1LA 4UHDA 5HK9A 1SC9A 5HF9A 1QO7A 3R41A 1D07A 4E46A 1JKMA 3O9MA 4BBZA 4J0IA 4C4XA 1P0PA 2WM2A 4Y2SA 3ANTA 4DYHA 3QZUA 4GWLA 1CUVA 5SYNA 4QA9A 1XZHA 3RKSA 3WZMA 1R50A 4BE4A 4LKOA 5HF8A 4LYEA 1H2XA 2CBGA 4B83A 4G4GA 2RGUA 2BCEA 2AXEA 1LBTA 1VE7A 3GFFA 4QNNA 5EHNA 3TEJA 1RWQA 5HKAA 5DWDA 2WIDA 4J03A 1P0MA 5JAHA 1WOMA 3H2JA 5SYMA 4X93A 1P0IA 2BGNA 2OGSA 1Q0RA 2QOEA 1ZD3A 4TGLA 1QFMA 3I6MA 2WJ6A 5CMLA 1GQRA 5FDFA 2OCLA 3D2BA 3WZLA 4N5IX 4JNCA 2XB6A 3A6ZA 3MUOA 3R3WA 1A8SA 3STXA 1XQYA 5T4EA 2HA4A 1UKCA 3A2LA 3VVLA 3FYTA 4TPKA 3A2MA 1O6FA 5ALPA 3IA2A 4Q82A 4W1QA
chains in the Genus database with same CATH superfamily
3UZUA 5DI3A 3EJWA 4V0NA 5U4QA 3W1VA 1FDOA 2P69A 4E3ZA 1K9SA 2IRWA 1P81A 3NP9A 1EFVA 4KJXA 1J90A 2BFCA 2H4JA 3LCUA 1F1BA 2QS9A 2OYCA 3L92A 1P91A 3WK7A 4C08A 1OBOA 5CFQA 5FR2A 1ML3A 4NZYA 3U7IA 3EY9A 4LXQA 5KSPA 1QO0D 3B8HA 1ZL0A 3N8HA 5GONB 1GZ6A 2WJVA 3JALA 3R0VA 3KTOA 3B8EA 4I7EA 4ZYLA 4N40A 2C4WA 2VBIA 1C7ZA 1VPEA 2HMVA 5EYPB 4NZPA 1WU8A 1NC1A 3DZKA 1KEWA 2F9LA 4TWJA 3DONA 3DW3X 5D3MA 1U7OA 5EJAA 4BNLA 1RPNA 3KKNA 4CG0A 5JT1A 3BQNB 3I2KA 2AEFA 3H2KA 4P34A 2IPAB 5MGBA 1V6CA 1UM9A 3IUMA 3MOGA 2GUWA 2XSZA 5BW6B 2B3TA 3KQVA 1NDHA 4YIKA 2HHHB 4MMZB 2FU5C 1BDJA 1DEXA 1NL3A 3A6GA 4IHKA 4K7JA 5IVDA 2QVZX 2BTQB 1J2TA 3LC0A 1RWPA 4RK0A 4M1YA 1YZKA 1EVEA 3GFBA 3DOUA 4DLPA 2GM5A 2JLAA 1LB1B 2YJ4A 1WDTA 2QE7A 1YB6A 5FJIA 3WY9A 1KRWA 4YA6A 3C87A 1I3NA 1QDUA 4HWGA 5MFZA 2Z57A 5FTNA 1E6LA 2EFCB 2OA0A 3MCTA 4PS1A 4UE2A 3C6XA 3GRPA 2LZ0A 3RS8A 2R62A 3ANMA 4RKQA 2V7BA 4N0QA 1PQ4A 2HJRA 3CKYA 3QU4A 1O89A 4KQ6A 2GHTA 1IG3A 1HNXB 1HQDA 5F52A 4EMBA 4PXAA 2QYHA 2Y8EA 3BWVA 3WMFA 5BV8A 3OQIA 1E77A 1Q2UA 1IEVA 2JANA 4N7BA 3WKBA 1AQUA 3IXMA 3VZBA 1OFUX 5JS8A 2IYFA 1F3LA 2BV3A 3HLYA 1JSXA 3JWJA 4L7QA 3F6YA 2G77B 4C2BA 4X92A 3MT7A 1L7RA 5M29A 3HN7A 1JE0A 4FMDB 4J90A 2FOXA 1W8DA 4OLFA 1Z4OA 4ZYZA 2JKYA 4JIMA 2EX0A 5CXUA 4HQOA 1X39A 3KWLA 1GKIA 1UC8A 2FJ0A 4P0TA 1PGPA 2PX4A 3HWX1 3NWPA 2I6UA 1OIXA 4U2KA 2IHUA 1H2WA 1R6AA 1CDZA 2Q9CA 1W4ZA 2XGMA 4HDQB 1JSRA 3R5FA 4J2TA 4A6EA 3OTOB 3QE9Y 5B3KA 1CG6A 4DDMA 3M34A 3O4GA 4Z99A 3OT4A 1PFGA 5E6SB 3UB3A 3FLMA 1SY7A 3PTLA 1PK8A 5CX1B 1PT7A 2IEGA 2H08A 1ZHOA 2BOVA 3D5TA 2RBKA 2PPVA 4Q93A 2H2DA 2PXHA 2R1UA 3ESDA 3MM4A 4LHEA 4C78A 1EGAA 1THTA 1GN9A 1JV2B 1YRWA 1A9ZA 2C29D 2KS6A 1Y1QA 3L6UA 3OCZA 3CX6A 4FFBB 5ALDA 3SKXA 5JVDA 1AQLA 4RH1A 4RPCA 4XB2A 4ZZ3A 4B6EA 3S81A 1JG1A 1I30A 1NE7A 2ZRLA 3ES9A 2JW5A 3SMVA 4AU1A 1FYEA 2F17A 1ACLA 2RHTA 3BREA 3HB9A 4IG9A 4J1NA 1G4AE 2VSFA 2XZLA 3DR3A 4E1AA 4M0CA 2LNDA 2O7RA 1O8CA 5BW5A 2O05A 1GLNA 1A2KC 1PJ8A 2R00C 3TMYA 3WGNA 3ZCQA 1IMJA 4H7JA 3BF7A 3I01M 5I3ZA 2QUAA 3RABA 1ORIA 3WFZA 4DDVA 3PLRA 1YONA 3EEBA 1ZN8A 4OFZA 4W7SA 5GOTA 2ZBDA 5JD6A 1SUEA 4ATNA 3V97A 1N5RA 1A98A 5LXTF 2DBQA 2JGKA 3GG2A 1VE9A 3UAXA 2IX9A 3DAHA 3ZK7A 1M2OA 4D8TA 4DCGA 4RULA 4P4LA 3E22A 1V41E 1CLUA 4LRUA 4JYCA 3DFIA 3OE5A 1LV8A 2ZP1A 3L0BA 2FSSA 1PD1A 1ZFNA 2IIQA 2X58A 1MO3A 3DUWA 3GZNA 4UNIA 3SZLA 2G72A 3FHCB 4I19A 1KA9H 1EWRA 2VUSA 2X3YA 3W4KA 2F4VB 1J0EA 1C1YA 1OAOA 2IDKA 3CR7A 2O2SA 2MMGA 1XTPA 2FFJA 3F0TA 1QKKA 1VKNA 1SIBE 1PNQA 5DGTA 1GY8A 3VTZA 3K32A 3WNQA 4UM5A 2TSYB 3SE7A 3R0QA 3O7MA 3VNQA 2Z83A 3VC3A 4INZA 1P2BA 4TLAA 4B3BA 3ECSA 3S2YA 3CZCA 1SRQA 1GPWB 4Q3EA 3AOEC 2XCLA 3L8DA 3ODGA 2V6BA 3PEFA 4RJJA 2VNKA 3BJEA 1Q0ZA 3R9IA 1DPGA 3TLZA 2B82A 1UMDB 2O7NA 4CMHA 4HATA 2AUNA 3DDCA 5AFSA 1HT2E 2QTCA 2YJNA 4KN6A 3OOSA 4OVKA 4BQPA 3L1UA 2NQTA 5IM4A 1CETA 3NH6A 3VDNB 4TLMB 3A1SA 3EVDA 3PCXA 4RVNA 4BWGA 3SHOA 4CXMA 3P4XA 3KTAB 1UPFA 2GJ4A 2JJ2D 2XIQA 4HO1X 4BQFA 5AVRA 5K6TA 1PV4A 3IUEA 1CUUA 3QVMA 4TKUA 4ETIA 4N0MA 1RC0A 4CVNA 3CT6A 2EJCA 2IFTA 2WD8A 3UVEA 3GRVA 4MS3A 4EGJA 3TI7A 5AIBA 1CP2A 3LUGA 1RZ3A 3NEYA 5J2TF 3QBDA 2W0SA 3O2SB 5JSZA 1OXMA 4IBOA 2GF0A 4FHFA 5DWQA 4YT2A 2QMYA 2IOFA 5E3IA 2JIZA 3GJ3A 2J85A 2J3MA 5HZGA 1SC1A 2L2QA 1PR9A 1IJFA 2QRGA 4MI3A 3QELB 1I4LD 1EEXB 1UK9A 2BHNA 4MICA 3TOVA 4TT3A 3O4FA 1Q0HA 4KO2S 3PGVA 2ZSFA 7AT1A 3A3NA 3G02A 2D4HA 3T4EA 4CLEA 1WXWA 3QXJA 3TKLA 1DX9A 2XF8A 2XT0A 2WAAA 3KU1A 1D5CA 1GPUA 1RWKA 3P9RA 5E6RB 3TG8A 1Y3AA 2Y1KA 2IU3A 5LQJA 2QD3A 4BEVA 5K6AC 3QX3A 1GTMA 1WHSA 4FFDA 3DEJA 1YDMA 3UV7A 2VJDA 3HB7A 1W49A 2C31A 4I4NA 2PXAA 1IRXA 5DGCA 3ZIAD 3WAKA 5LVAA 1FIUA 1U0SY 3T12A 1IBKB 4M53A 5J4KA 1OUMA 5H83A 1Y1SA 2WICA 3EG9A 5JBIA 3OCJA 1EB9A 2A59A 2R84A 3INRA 3MJDA 4FGLA 4O2AB 4TV8F 1IBLB 3BGSA 1O4WA 1JKJB 1T9HA 3KDPA 3SHFA 3U4GA 1R0SA 2I99A 3NEJA 2CYCA 1A77A 2HHAA 3BHIA 1XC7A 4L02A 4ND5A 3FNBA 1CVIA 4PW0A 2ZBPA 1QFSA 3QLEA 5ELMA 4CWAA 2BKVA 3EN0A 1DB3A 1WUTA 2O3UA 4QLOA 5BN5B 3UF0A 1EX6A 4YUWA 4XA8A 3BJMA 4ILKA 4BCCA 3KQHA 4RA6A 3Q2KA 5HEKA 3AVVA 1G2PA 4LBZA 4B09A 5ETJA 1TIKA 4HB2A 3SJBA 1IHDA 1HL7A 4OLAA 1ZK4A 1AO0A 4PG5A 4UMFA 3VR6D 3VU9A 3AR7A 4HZUA 1E9FA 3BB1A 4UHEA 4M36A 1V16A 3H0CA 4CLHA 5JJKA 5I4CA 1UBKS 1XZDA 2P2SA 2QTAA 3NDRA 4J3JA 4BNMA 3ZGVA 1W44A 3E18A 3EQ6A 4PZ0A 4WZBA 2FA9A 1OXBB 1NN3A 4MUXA 4DG9A 5CTAA 2YL2A 3MMPA 2FRVA 3N8IA 4V2UA 5EHXA 1F14A 1NLYA 1Q6YA 1F48A 3STVA 1YZVA 1XMQB 4Y2VA 3M5CA 3PUKA 2PSJA 1VG1A 3K35A 3D3WB 4AWBA 2DH6A 3NVKI 2HMAA 3BRSA 3ET5A 3VI4B 1HXHA 2GBPA 4OB6A 1P4JA 3OQNA 2JEYA 1PR5A 4A27A 3LM8A 3ZD9A 4MWOA 3OZIA 1Q95A 4AJOA 2GILA 1ECLA 1LW7A 3K0AB 3L0ZA 4F8YA 2FZLA 4OXRA 5CA0A 1BOOA 1N0UA 3X1JA 1G16A 2ID4A 4C1BA 1QHGA 4FGUA 1ZJYA 3KT3A 2ZBEA 3C3YA 3L7LA 4FSHA 1WSDA 4UMEA 4BB5A 1U0BB 1CRPA 2IU4A 1O0CA 4GS5A 1KK0A 5AVVA 1EDDA 1DAKA 2MTBA 2C9DA 3AKEA 3KZCA 1ULSA 4CFZA 3UT6A 1A69A 7YASA 1OB2A 2VNJA 3DO6A 3DVAB 4XDHA 4NKRA 2D7CA 3LOPA 4EW6A 2ZYTX 5C2JB 1L5NA 3OBIA 1V6SA 3E1KA 3ZNPA 3G9TA 4GZ5A 3D0KA 1A8QA 1L5ZA 4D4KA 4IIJF 4AQDA 4LVOA 4AKEA 4QUJA 1ZRMA 1JP7A 3EC1A 1Z8NA 3IP1A 1G41A 3NT2A 4WVFA 2BHTA 2GZ2A 2BFDA 2VF8A 2JGIA 3QM1A 1E32A 4HD8A 4DUZB 1GZ3A 4PINA 1MEJA 1ZVJA 3FBWA 2Y67A 1LLFA 4L5CA 3S2SA 4A23A 1XMPA 3RS4A 5FYDA 4R05A 4BNJA 4V0KA 1Z6PA 4C4YA 2FN3A 2RGBA 2CXPA 3L04A 4HAUA 4ER5A 2QMZA 5JEDA 4F1JA 4XD7A 4L5AA 3QVKA 4REMA 1P8AA 1G64A 2RG1A 1NLUA 2OG2A 4EPXA 3BC1A 3H5NA 1BDHA 2WU0A 4TYQA 1ZU5A 2XMGA 5AKIA 1LDMA 2JGLA 1KMCA 4GP6A 3OQPA 3CKLA 2HMWA 4A82A 1Z08A 2X0DA 2C5EA 1MHPA 4N54A 4DV2B 3EZGA 4XSGA 3ZE7A 2Q7OE 4B31A 2I2CA 5IAOA 1N5IA 3DXZA 2VJYA 1ZSVA 2X13A 3RAFC 1AUOA 1EWKA 2GZRA 2YRXA 4XIJA 1OR8A 1ADBA 3QU2A 3SQDA 3STUA 4D1YA 3I76A 5CM8B 4B6PA 4BUJA 1UQRA 4C2UA 1KSFX 1FFAA 4DAEA 1JBEA 1CR1A 4RXUA 10MHA 1QQBA 2JCBA 2GXQA 1ZXBA 4QXMA 2P7IA 4RD1A 3ZV4A 5KNBA 3PEYA 2YCBA 2IUEA 4G1MB 1USGA 4POOA 2Q5CA 3UIEA 3QXSA 3Q72A 2GZ1A 4NV1A 5DSXA 3CRQA 1X7YA 2PD6A 4B81A 4KPUA 2W71A 1EI9A 4GPD1 3RADC 4ND8A 3RVPA 3C48A 1KI2A 1E8MA 1L6RA 4EUSA 1ZUWA 2YH2A 1X7WB 2ZJZA 2QHXA 2Y1EA 3HKEB 2H4WA 3IQIX 4KUEA 4M6WA 4YR7A 4DT1A 1DZIA 1G98A 1QH0A 2VJBA 1XELA 3OQOA 1YXMA 3AM1A 2REOA 2G3YA 5FL7A 4JT4A 1NXTA 2FFQA 2Y6UA 3WK4A 3AR5A 3IQHX 5GP1A 2WZCA 2HIMA 1FLDA 3BE5A 1OWPA 3OE7D 2JI8A 1YB5A 3BCUA 4G0NA 5EFZA 4EYGA 3UPUA 4PLZA 4JU9A 3O92A 4XRGA 3VR5H 1CR0A 2QL9A 3ANLA 1NU8A 3LWZA 5K6RA 5BQPA 1YCDA 1KHHA 1Y1KE 4KQ1A 5HRCA 1JXOA 4F9GA 1P80A 1EUYA 1XEWX 4JQOA 4PQYA 4PX2A 4NOJA 1Q3TA 1T3ZA 3O3OB 2JBAB 4LK2A 2QX9A 2CMGA 4RHFA 5F51A 4RLQA 1V8FA 2VPWA 3EF1A 6PFKA 1C14A 1Y1PA 2C57A 4C4OA 3Q8LA 5JZOA 3KBOA 4D9BA 4KR7A 2J67A 3ZY4A 1ZNZA 1YRQA 3HZHA 1KYXA 1O6GA 3JV7A 3DAYA 2F43A 4KSYA 4CLOB 4B4KA 2AJDA 4ROTA 5DMXA 2YWJA 4DJTA 1L0BA 1EFKA 3BBPA 4KOEC 2IYTA 2E4ZA 3JRWA 4RH0A 5B4UA 4EI7A 1N2GA 1WXDA 1KQ3A 5LD2B 4UPVA 2EVWX 5K3OA 3UAWA 1O2DA 1CP3A 5EJ5A 3TG2A 1OT5A 4YRPA 3T52A 4UDYX 5BPHA 3Q88A 2AI3A 3C3MA 3OPXA 1AMNA 5KYYA 3U09A 3WWCA 4TS4A 2CNLA 1WMAA 3A1VA 2ABWA 4I2VA 5KWJA 5IVPA 2JKZA 4P83A 1NJ2A 5BNWA 5K3EA 3H3JA 3MTQA 2C2BA 2R1VB 3T0IA 1P7PA 5IF9A 1HNZB 1VL0A 4NE7A 1C3XA 4RDHA 3U31A 3DCIA 4ZC8A 4BMXA 3G7NA 4TN5A 1PI3A 1P61B 1W1IA 2YQZA 2O2ZA 1E6CA 2FKAA 3LKBA 3UK1A 4YUAA 2Z1DA 4Q9AA 4JI8B 3AEQA 4BWYA 3RUFA 5HQ3B 4Q7QA 3KVYA 3OZFA 3Q5DA 1W85B 2P2CA 3FM9A 5JMTA 1KFEB 2I3AA 3P0EA 4YDHB 4CM6A 1M0WA 4IKEA 3ZWMA 2FEPA 1ZD9A 2OHIA 2FTKE 3FWHA 1UFRA 4E5VA 5JMPA 1OBHA 4NH4A 5B7PA 1QP8A 3KE9A 2Q1TA 3I62A 4E08A 1DV2A 1GUYA 2EC5A 3H9EO 2Y1DA 1P74A 2WHXA 1I7SB 1XRSB 1PSDA 1QVAA 2KBFA 3QIAA 5ER6A 3LP5A 1JPUA 3HCOA 3LFTA 2ZIEA 3P0JA 3AKCA 1X8XA 1D09A 5LUAA 3IOBA 4BKUA 4EPRA 1P1IA 3T35A 2IYWA 1EE2A 2BGIA 3SC3A 3U0BA 3AC0A 2V7VA 2B25A 4G0VA 3NBAA 4R8LA 5GONA 1VZ3A 1HYHA 1H0HA 2BM0A 2OOSA 1GZ7A 3I64A 4Q3KA 1ZI6A 4KXFB 2UUBB 3EMDA 5DX1A 5EYPA 1KZHA 1EM8B 2ZI4A 1EFRD 2DVMA 2W6ID 5LQKA 4KPGA 5FF9A 1GKLA 2FQXA 2NXEA 1R4AA 1QVWA 1J49A 3K31A 3LQYA 3MOIA 2UYYA 1SK8A 2YWEA 3BXHA 2BY4A 3IMFA 3MOSA 4XGRA 1A1SA 1Z0UA 2P9BA 5B36A 1QIHA 1U4NA 1D0VA 2O1WA 1XYVA 2XHZA 3BZUA 5EERA 4B2LA 3ECAA 4MQUA 2P9ZA 1Q77A 1SQSA 4J1QA 3FF1A 1QYXA 3IAHA 2FFAA 4X1KB 4EGSA 4M54A 2BTQA 2XE8A 3NNNA 4MWDA 1D6MA 3RTGA 3EMBA 4RQTA 1C41A 1GPAA 1K6EA 3ZTYA 2QTZA 3CU5A 4II2A 3ADDA 3L7JA 3BICA 4G01B 4G8DA 4NIMA 3EPHA 2PD3A 2EAUA 5DGDA 2H18A 3HS3A 4EY7A 3U7JA 3NATA 1J20A 2OHFA 4N5MA 2ZM6B 2N1MA 1Z9BA 5IT9A 1BNCA 3IKMB 4QGSA 4KFSA 4YP9A 1XQ6A 3NZEA 2ST1A 2DH5A 4I14A 2PL9A 4TVOA 3ZHXA 1B15A 3E9QA 3R5JA 5MDHA 1SBCA 5FA5A 1FF9A 2WZBA 1T4BA 1T5HX 1R37A 1Z16A 3FUXA 3G89A 3J7TA 5AW0A 5A9SB 2AX3A 3TRIA 4QOHA 4WIAA 5H59A 3H5OA 2JCVA 4ENRA 3C5HA 4BTLA 3VKGA 3NC0C 1EDOA 2QP4A 3M81A 1XMXA 3SBDA 4MI9A 5JBQA 4L4ZA 4EFLA 3EA4A 2O7SA 2MIIA 2V4ZA 3HJBA 1RHMA 2MSNA 5DM60 2PS3A 1V1JA 3G5MA 5AI8A 4DIDA 2VQFB 3L4BC 1DDIA 4XUGB 2GZHA 3OFNA 1G7CA 4QQKA 3WGQA 1CZOA 5J2UF 3BFJA 1BS2A 4WDRA 2WFLB 1HFJA 2BKUA 5E6SA 4ND3A 4UU7A 1VJCA 1P1BA 3WWYA 3PYLA 1A50B 1QO9A 2ZTSA 3AOGA 3Q3VA 4LECA 1JB9A 1DKMA 2PPLA 2QG9A 3KIPA 5CX1A 1H6BA 1ZGAA 2EZTA 2UZAA 3T7TA 4BX2A 2J9XB 2C9BA 2ETVA 2XQGA 3H9BA 4MGKR 1CUWA 2PZFA 2IBTA 4UVIA 1S7GA 3AJ8A 5K5EA 4XYLA 1MB0A 4FFBA 1Q1QA 4YRBA 4YT5A 4FEGA 1P33A 5DT2A 3CF4A 3P1JA 1MFZA 4LMBA 4L1KA 4I36A 2VYND 4LJSA 3OTQA 1SCJA 4M0DA 2YVAA 1USIA 2X6TA 4KLAA 4QECA 5TJHA 1VCHA 3FFBA 1NXPA 3GLIE 1SC4A 3DMHA 1Y9AA 3CLSC 1JDUA 2CUZA 1SKBA 1LZKA 2XI4A 3C6YA 4LRYA 4DIMA 3S99A 4XIIA 2FWRA 4PX3A 4CMKA 2YVQA 5KSZA 2RGNC 3KR1A 4JXJA 4K9MA 5COQA 3UKOA 3ZOKA 5AOBA 3RV4A 2YMMA 2QROA 3PT9A 1ZI8A 3BB3A 4Y2JA 3L0OA 3U3KA 1N0HA 1ZM7A 5AM0A 3EISA 2WAXA 4G0YA 5ITWA 5H80A 5G2OA 3K8ZA 3DOIA 3BD6A 2FG5A 2GCOB 1OGYA 4NXNB 4I55F 2X77A 4KU4A 4KACA 3TDKA 4KXLA 1PG2A 1KAQA 3KKPA 4K2AA 5KZMB 1TVMA 1IJKA 1TAHA 3CWCA 3P2EA 3LQQA 1YS4A 1WHTB 3GJSA 1EIZA 2JB9A 1Z0KA 4IQ0A 4UD2A 5K51A 3TE7A 4BDTA 4CM1A 3EMVA 4JLBA 2CFIA 3B3FA 3DL7A 3ZVKA 4O4LB 3JZAA 3OQMA 1LZLA 1VHJA 2AJ8A 4EL0A 3BWEA 4UVDA 2NZVG 2V0GA 4U7JA 4B3HA 2WT4A 3G1WA 4QT4A 5TT0A 3BEOA 4DV6B 2JHFA 2DWPA 2H51A 4KFRA 3H2ZA 2VF4X 4KW7A 3RROA 1UMDA 2BGKA 4WCFC 1ZHFA 4PWZA 4YPOA 3Q3CA 1TEXA 1P72A 2W2KB 5LU9A 3AV3A 3FTPA 5DHPA 1R4ZA 2VAVA 1KZ9A 3A1DA 1IN5A 1NW4A 2MR5A 2VP0A 3AUTA 3KTAA 4YAOA 1D3AA 5FUQA 4B2IA 1Y7TA 1VYHA 2G1UA 3BGIA 4QUGA 4CQLB 4CUKA 1RI5A 1CQWA 2QSYA 4AMUA 3TFOA 3BIXA 4D79A 5AJVB 1E5XA 1RTKA 3NW9A 4I1SA 4LJRA 4AKIA 1QAOA 1C0LA 1YC5A 3PNBA 4Z4QA 1J9ZA 2OCXA 1XLTC 2R8ZA 3OIYA 3WYBA 1Y80A 2DKOA 5FTJA 3PR1A 2QYSA 4YAIA 2YIVX 2WDZA 4DR7B 2QX4A 4I5EA 2XJ9A 3QELA 4KAJA 1ADGA 1IUPA 4B35A 1XWFA 1XK7A 1XRMA 4JMLA 3KQQA 3FLEA 3UW3A 4F2GA 5H82A 2QTWB 5I8ZA 5K8VA 1WG8A 2GQ0A 3IUYA 1WB5A 1GV1A 1XPJA 3FKJA 4KX3A 2FGKA 2HOQA 2X14A 3RSSA 3QMWA 3RUEA 1VFPA 1MJHA 3QJYA 2B7BA 2QZPA 3RRFA 1BGXT 1S0UA 1JLLB 3DUFB 1EG2A 1KH2A 2CHUA 3MYYA 4EYSA 1QAQA 1A96A 1BMQA 2PRKA 3KT0A 3LNTA 5E6RA 1Y8QB 4GR9A 3SK0A 4CLXA 1LY1A 2HU2A 1FFWA 3RASA 2XOKA 3E8XA 1N78A 4MDYA 1QHFA 3CIFA 4DW8A 1C9JA 3D43A 1RM3A 4KKVA 3KEOA 1QG6A 3FTCA 4BBAA 1IU9A 5TEWA 5H16A 3C3AA 2PKWA 2ZEJA 3PHJA 4ZK2A 5EMJA 3QEAZ 4L0DA 2XA1A 4HR7A 4LE0A 1Y8AA 1AS3A 1CJBA 1T1EA 4O2AA 1TQHA 3DBHA 1JKJA 1UADA 4PEVA 4G5HA 1IONA 3OETA 3PX3A 5B55A 1WVGA 5MFPA 1V1RB 4JT9A 3ZLBA 4PN3A 2VHZA 4YALA 1CVRA 3ULKA 4DLUA 1W48A 2J30A 3DJFA 4YP5A 1PGJA 4E2WA 2WSBA 3HB0A 1PF7E 5ECYA 3GEIA 4MJ3A 2PX8A 5AIAA 1MC4A 4B5KA 5DM4A 2E5LB 4MUJA 3EOBI 3UTCA 4JSRA 4R1TA 2J9RA 5DH9A 1BEZA 2G80A 4PG4A 1QGUB 3UWOA 3GJ0A 5MN5A 1G7SA 3CVJA 4KZPA 3WLTA 1FNDA 2HRBA 5J43A 1YDHA 1MO6A 4IZOA 5A02A 3IMCA 1VQ1A 3N2EA 4P7GA 2IV2X 2V7TA 4ZICA 3ZHYA 2JEOA 4Y1FA 4UD6A 3GLFE 3L1VA 2FI1A 2IUSA 1ONSA 3RC7A 3T5AA 3TF5A 1FJXA 4WESB 2VPIA 3D7RA 3FPSA 3D3WA 3K30A 4PC7A 4RQUA 1ZQ1A 1DNPA 2QQ0A 1UBSB 4OBWA 1SOUA 3ESYA 1UR5A 3WOVA 3AO0B 1YS7A 3CKKA 3C7KA 5K3CA 1DAEA 4B8ZA 1A9TA 4EQ6B 1WZ2A 4NICA 4GC9A 1I3MA 3OU2A 1EJ0A 2J7PD 3AP1A 2DPGA 1GT91 2M2IA 1Z39A 3GHHA 3K0AA 3NRBA 4D9HA 3RYCB 2QTFA 5M04A 2FZKA 4QYMA 3GUUA 1LA2A 3L0IB 4DXAA 1O6ZA 1PFVA 4AKHA 4NEQA 3DMTA 1SVNA 2QLLA 1EFDN 2XWSA 3DE2X 4DNFA 4OQMA 3H86A 5KC8A 5JSHA 3K4QA 4IWYA 2Q5JA 3DVAA 3FHLA 5LN1A 3NANA 4DLAA 4JEHA 2Q1YA 1JTVA 2HQOA 2IVFA 1EQ2A 3BQ9A 4R8VA 2P9QA 2G09A 4UBNA 4I1VA 4JASB 1I51A 4BFTA 2A9QA 1KMQA 2CVFA 2WHEA 3QFHA 1IMOA 4LYGA 4YHHB 4C88A 1XZKA 2C95A 5FA8A 3KOMA 2QX7A 5CLGA 3QWAA 3HY3A 2OESA 4GBGA 3EVTA 4TMFA 5DRTA 4ALIA 4DHWA 1SQ5A 5EESA 3HDYA 4HQFA 5I9SA 4S12A 2ZS9A 3K2BA 1DL5A 4BC1A 4RGVA 4WLVA 3BX1A 2R8EA 1RQLA 1NVUQ 2I91A 1PZHA 3CX4A 3H3XA 3PJFA 2DETA 3E03A 4IW3B 3D3QA 4L28A 4OIFA 3PE4A 2QM8A 5EY5B 1L2TA 2QORA 4BWFB 7GPBA 4F3RA 3UICA 2BF4A 1HBJA 1HRDA 2PJDA 2QAGC 3HSYA 5EIBD 4H3HB 4NR0A 2F55A 2X7XA 1M5UA 2EGUA 1OVMA 2IP4A 2OAEA 3M9WA 4U00A 4XVHA 4HX2A 4D98A 4DWWA 1O1YA 2AOTB 2CLKB 3UJNA 1H3FA 3N2IA 3LY9A 4GX2A 4WN3A 3K9NA 5HUJA 3VA7A 1GR0A 2JLXA 4GYJA 1GGKA 3W2TA 3CLTD 1E2FA 3UAOA 1QMPA 1ENZA 4K9RA 4KQ2A 3W77A 3X43A 1TYDE 1GGJA 2JIDA 1J7JA 1EWTA 4LXGA 5D7NA 3WL7A 1U7PA 2PIAA 4A2WA 4EEZA 1RFLA 1UIMA 4BJHB 3SQOA 1YJ8A 3JTEA 3AVTA 3QEMB 2EFEB 4B33A 1T34A 4FDMA 4RACA 1JVBA 4KUHA 1JI3A 3E5MA 5FLEX 4DXHA 2DUWA 5LLDA 1H2RS 1ARZA 1DQYA 2X9QA 3MGKA 5DHUA 4BQOA 2C0PA 4YRDA 3R7WB 4L22A 2H5LA 2CNOA 2C1ZA 4UPDA 2JK0A 1X7WA 5ALWA 1GUBA 4J0GA 5EUBA 3HFJA 5FI3A 4GSKA 3HKEA 3A6KA 4IY1A 1G5FA 3LOQA 1NUHA 2A57A 4K9LA 4RVGA 3UJPA 4BP1A 5G1PA 5JROA 4HLCA 4AURA 1IXRC 1GNQA 4XR4A 2V4MA 4FUTA 5KX5B 1H1LB 1OVGA 4XJXA 3VTFA 4E4TA 1Z68A 4R0VA 1JILA 2F7SA 2RFLA 1PHPA 1W75A 4FFOA 3HO1A 3AB7A 1E3SA 5FD8A 1FRFS 4IJ6A 2O5RA 3PHBE 1UC5B 5IKMA 1WULS 2CLEB 3OLZA 3HN2A 1ONPA 3JD3A 1FNCA 2JBAA 3OZBA 2B30A 3X2FA 3ST7A 3UJDA 1T5DX 1LLCA 2EARA 2P3LA 2FEKA 4KE7A 1TT5B 2FGJA 2GVZC 1Z8DA 2GO1A 4P5EA 1GUZA 1Z83A 3VRHA 2BYTA 1DARA 3JXEA 3RFVA 4HVCA 1JU4A 3IAM1 1KXZA 3DOHA 4CLOA 1NFRA 1SKMA 4M9XA 2A5LA 2P2ZA 3E70C 4U0JA 1TCCA 4MGEA 2VDJA 1DMRA 5FEMA 4LOHA 2PU7A 4EDFA 3RS7A 1VJRA 2O0LA 4DE5A 2I4RA 3KJIA 3PC3A 5K3SA 1WR8A 2XUDA 2GASA 3AF2A 3QA9A 1C50A 2AWNA 4W1RA 2PWBA 1BMFA 5LNK6 4WJZA 3RIGA 2G6BA 4H35A 3CCCA 2NWQA 3RSCA 2G7ZA 3GLHE 3LO8A 1QGDA 3FMVA 1G5QA 3EC2A 1CJMA 3ABRB 3EXFB 1LDBA 3WDLA 3DDHA 4P33A 1QDLB 4RLFA 3L49A 1D8AA 3I4FA 1P4RA 1LPOA 3OAAA 3U37A 1JJ7A 1NY5A 1RFGE 3OEEA 2O0MA 5CVDA 1NVWQ 1QOPB 1ZIXA 2R1VA 2ZYRA 4NCJA 5AXBA 1RZRA 2WYWA 5AM3A 1VG0B 4OK6A 3AP2A 1H6DA 3CRVA 1GG2A 1P17A 2AN9A 2IK8A 4MVYA 5JS2A 4OXYA 4S1NA 3J7AC 3WRYA 4DMKA 3PIDA 1JU9A 3ZY6A 5A03A 1MTZA 5CFMA 3WJAA 5F7ZA 3FCXA 4F60A 4ND1A 3O26A 1VL8A 3P9ZA 1W85A 4JC8A 2YMQA 3KSUA 1O9BA 3MAAC 1RXIA 1BQEA 2ZRDA 1VE1A 5ALVA 1J0AA 3LUBA 1T2NA 1F12A 4R2XA 1LPAB 1JIKA 4L75A 4RIGA 3HACA 3H87A 1VIMA 3PDJA 4UKDA 3NTLA 4X7RA 4M4SA 1L5VA 1FFYA 2G63A 1AGYA 2R3SA 4RGQA 5ESXA 1UZNA 1XZCA 2FETA 2QZJA 3HL0A 4BFYA 3EXG2 4C14A 1O58A 3KUUA 3EZNA 4RJTA 1GPBA 1N6HA 1ORTA 1ZCJA 2BJVA 3QLJA 3RFUA 2Q27A 2DY0A 3ZJ4A 1QQTA 2ODNA 2FPGB 5ICSA 1UJ4A 2QIPA 1GP2A 2RHOA 1FUYB 4QQNA 1WVMA 1JEDA 1XNGA 5BSGA 1S8AA 4UZEA 3RBXA 2AXQA 1HMPA 3AM5A 5CIQA 1OH5A 3MPOA 1SXJD 4FDUA 5KKNB 4BCBA 1JIUA 2P6PA 3I61A 4EY6A 1Y8CA 1KXJA 4F5WA 3BRQA 3UUFA 1EM8A 1ZGJA 1JLMA 4KBFA 3IMKA 4FW9A 2XMCA 5DGXA 2V74B 4P7KA 5GOZA 1DQPA 1AHNA 4V1CI 4YJ2B 3DEIA 2IHYA 3MSXA 4D9FA 1RSZA 2VSOA 4L78A 1WMSA 1OFUA 1KJQA 2YS6A 3OZCA 4C7JA 5LKAA 5GV8A 1JI0A 1CF9A 1A7JA 1TW3A 1NHGA 2ILVA 2XUZA 4BMCA 3DYVA 3FNIA 4X1KA 5DYWA 4EGQA 2YWHA 4P9NA 4MIYA 2GEJA 1IBRA 4MIEA 1XTKA 5JJBA 1RMTA 2DQZA 3O4JA 4N65A 4AKSA 3BMOA 1T26A 2ODEA 1GFZA 1BEUB 2HJSA 2Q7DA 2PWAA 5DJ5A 4YJ3B 4YACA 3M82A 1YGPA 4QGAA 5DKFA 2ZE8A 1FP2A 1NZDA 4K8OA 4RD0A 2VHXA 4TMYA 3I2JA 4XYGA 3E3NA 4FZJA 2C42A 3GUHA 4EITA 4OHCA 3HKBB 1IN8A 2N46A 3V7UA 2CV1A 2DWOA 5LLTA 3SF0A 1ACJA 3VR0A 4AUMA 4EHHA 2VDLB 4F6CA 4PZEA 3JAKB 2AN1A 1VYTA 3NTRA 5A9SA 4L6IA 5JWRA 2DWUA 5CLHA 3GJTA 4HJXA 5DNYB 1WAMA 2AUMA 1MPXA 2IUYA 2R87A 3SXPA 5BXQC 2CL6X 2IIBA 2PKRA 3TKAA 121PA 1E1LA 3M6FA 3OJWA 4A6DA 2Q5FA 4W4TA 3CLUC 4EEKA 1HWYA 1CUGA 5AYVA 3L93A 1AUVA 1R1DA 1UC9A 4K40A 1XMOB 1M1YE 1CLEA 2P41A 4NU5A 3PQ5A 3HYSA 4X94A 4EUEA 1T3HA 3WQQA 2XVYA 4G9BA 3ORFA 1VL5A 1M76A 2D2IA 1H2FA 4XYMA 1QS0B 3L43A 4J4TA 5HCNA 2WFLA 4DLXA 1WW8A 3SZUA 5LQNA 1WO8A 1EGQA 3TCKA 1U6JA 3O4HA 3JZIA 3GJ7A 1E89A 1QB8A 1JEAA 2KPOA 4U7FA 3E4CA 1M7BA 2PT7A 4OGGA 3ZE8A 3RFTA 5FWNA 1I36A 1PGOA 3K1TA 1HT1E 2H06A 2ATCA 4H0NA 1GQFA 3Q6IA 2P79A 1DQRA 1TIPA 3GRCA 4MW0A 1RQ2A 1CNFA 3T0GA 4C2TA 1FFXB 3MTJA 3EDRA 4CIVA 1Q3KA 2OORA 1Z0SA 1T0PA 4F7WA 3N7AA 2CE7A 4Z4GA 1D2NA 3AILA 5HM6A 3ER8A 3VR4H 4B8YA 3BF8A 3IEIA 5FPTA 1JHOA 1M7HA 3C6ZA 4PIVA 1GLVA 3IPRA 2G36A 3QLUC 4QTXA 4JI6B 2PKXA 2BLNA 2JFYA 3NWJA 4XYBA 4J6EA 2JD1A 5GVRA 6YASA 2JL1A 1JW9B 1DWQA 3PA6A 2NGRA 1WABA 4MPJA 1TM3E 3L7OA 1CJUC 3GL9A 1L7QA 3MCZA 2WF7A 5DNCA 3F7NA 3KVRA 3VDRA 5GJWC 2GCOA 4DCJA 4G56A 5BRJA 2DB3A 2P5YA 4ASUD 1NVFA 1GO2A 1NVKA 4ZQEA 5DTQA 5HPYB 2TYSB 4ZREA 2J9ZB 3C3PA 3M4JA 1RRCA 2GYYA 1WHTA 4GOND 1IZZA 1CF2O 2OHXA 2RI6A 4RF5A 1E2HA 2ZB7A 2F3QA 2JIBA 1P1FA 4O4LA 2JA1A 2P77A 3PRJA 5B2EA 3LX5A 2CF5A 5KB3A 3PHCA 3W5DA 4DV5B 1SUCA 3KPWA 1WBJB 4OQDA 4QDTA 1XDDA 2C1XA 1CPYA 2A8YA 2CXSA 2CMKA 2FUG1 3ITEA 3G9ZA 5CVJA 2BDUA 5GM2A 5IFKA 1E18A 5CPFA 2AZ4A 5HG0A 4CEHB 2XY4A 4OX9Y 4ID3A 2F00A 4IJKA 5DN6A 4I1OA 5CHYA 3UKDA 1T9BA 3MHTA 2ZULA 1HC7A 2IEZA 4UTRA 1G8MA 4CT5A 2W2KA 4BO5A 1TD1A 1GL9B 1KO1A 4QE3A 1YBMA 2QTNA 4UBMA 4BQSA 2BKLA 4EELA 1O03A 3TZ6A 1P7YA 3JYQA 3L8YA 2X40A 3NYIA 2Y4NA 5E8JA 3ODPA 5KYVA 3VNSA 5ALTA 4XWYA 4CQLA 2EKPA 4ZOLF 2YYYA 1UWVA 4IGEA 2GHQA 3IV7A 3LC7O 2VT2A 2H92A 4LZNA 1AQJA 2UUCB 2Z3WA 2ZATA 4R6WA 4RMHA 3ZZUA 4QFMA 1M83A 4V2IA 4GP7A 5BR7A 1ZK1A 2ZE5A 4JLUA 1H8ED 3CNEA 1RJWA 3OLWA 4GG1A 1O7JA 3AUYA 4HDAA 1P73A 3THYB 3JZFA 1X87A 4WX2B 2GLUA 3S2EA 3A1NA 4B0PA 4LGYA 3ZQKA 5IF3A 3A4TA 3MCVA 4TTVA 4EHAA 2YDYA 3A6HA 3AFOA 3OCUA 1BFUA 1PR3A 1CSEE 1WOYA 4FYVA 2WIJA 3BSYA 4LNUB 4LYJA 4UTZA 3A14A 2VT6A 4ZAZA 4B84A 4B4WA 1A4RA 1NUUA 2YN2A 3GCZA 5K3FB 5IHPA 1WF3A 1T24A 3BE8A 4BVGA 1MXFA 1OYVA 1X8KA 2C9YA 4RY0A 4YMGA 5KS2A 1NWHA 1JLLA 2HU7A 3DUFA 1G38A 4YCCA 2JARA 2Q8NA 1Y8QA 5CCBA 4E12A 2D2XA 3DE4X 2VZ9A 4TS1A 2Q50A 3RB8A 2D0PB 1XNHA 3D8UA 2PGOA 3HUUA 4UTXA 4EG6A 5I47A 3C4VA 1K75A 1U3CA 1AMOA 2YC2C 5IKXA 4H4DA 2G70A 1C0EA 2GNOA 2RDMA 4YRTA 3WA6A 3UHPA 1EUDB 4RVSA 1F51E 4Q18A 1QAMA 4DCOA 4F5YA 3ZY2A 4X6UA 3RAPR 3GZTB 1AKYA 3NVMB 1NW6A 4C6SA 2VWQA 1GVNB 4OMUA 3P5BA 3RSLA 1OX4B 1V1RA 4TV9F 1Z56C 4ZA2A 1L5KA 1Q0QA 1E94E 1D5WA 1NRJB 2AJLI 3LFHA 1CNEA 4QTTB 2JJ1D 4BVLA 1ECGA 1G21E 1CHDA 1U0LA 4OJTA 5PNTA 1Y3CE 1W4RA 1G19A 2O2DA 1DAIA 1R0BA 1IK4A 3AI7A 4A8JC 1DADA 2WTBA 5D8DA 2VC2B 5BN4B 2I54A 2VP4A 1WMBA 2FQQA 4ZTBA 3WO1A 1QGUA 4P4NA 4DBVO 4PC6A 2XNDA 5E1BA 5AOCA 5G1NA 1E69A 1NVMB 1SNYA 2NO7A 2PZAA 1VGVA 3GH3A 5EE9A 3RRJA 1L7MA 2ONZA 3A9CA 4A16A 1LTHR 4MWBA 3JQ9A 3LX8A 4CF4A 2FF7A 3L06A 4HTAA 1BHO1 2IYOA 4ZMBA 3AR3A 3CVXA 5AJYA 5BV7A 3DAFA 3EVBA 5FQOA 5I45A 2O59A 4WXPA 2H1SA 4ZALA 2AN5A 5CH3A 4WESA 4GNKA 3HA7A 1JIQA 1N6IA 4X44A 4PYRA 1BCRB 2GRJA 4Y2UA 4AF8A 1Y4ZA 1TKCA 1IY2A 1JECA 1P7WA 2DMRA 3BULA 3HADA 4H7IA 4UNPA 3T5GA 3OQHA 2WSIA 2X4GA 4EQ6A 2NQ8A 4KTVE 1L5MA 1QU2A 5I7EA 1IOWA 4I2NA 4NAVA 4JT2A 4WV3A 7ABPA 1KVUA 4IQ4A 2Q6LA 5SY6A 3RYCA 1PR6A 1AXRA 2Z8YM 2VAWA 3PWTA 4RV4A 1PDWA 1RYEA 3EA0A 4OJNA 3W6ZA 5BVHB 4QBTA 1ZIDA 4Q7MB 1K8QA 1CR4A 3NORA 1L4HA 4JBLA 2WJ3A 1BJRE 4PSAA 4G63A 3R8XA 1J56A 3O2NA 4KODA 2OV8A 3OSZA 1UH5A 3H8JA 4AMVA 3K05A 2Y66A 1XV5A 2J8ZA 1U4SA 1Y3DE 1JHQA 2ZRPA 3KALA 4M1SA 3ENWA 1UPXA 2HBZA 4F7DA 4MVJA 1Z6YA 2AZXA 1IBCA 4TLDA 3FZNA 1G42A 2R6AA 1E20A 2WA2A 5D84A 3ZJTA 2EJUA 4RA9B 4D3XA 1ENPA 2UAGA 1M1XB 2B78A 3JASA 1Z0DA 3D81A 3M5DA 5IPFA 1DG1G 5JEEA 1ILEA 5HP4A 4OHPA 2XQJA 4IIFA 1NI4A 4GQIA 2IY8A 2OCKA 3OMLA 3UJ8A 2QJOA 1F3OA 1NX9A 1NT4A 1Y4UA 1PLKA 3LUHA 1JQLB 1DC6A 3DL4A 3L8ZA 4P32A 4PSVA 3NVAA 1Y1LA 4AVYA 1XZPA 1ADYA 5GAJA 3ROXA 5TXGA 3A3YA 1I32A 3HP1A 1NW7A 2BTOA 3RV3A 1PP4A 3DE0X 3WLAA 3WYFA 5EE0A 4DC9A 2O3TA 4LN1A 1Y6ZA 5KVAA 2AOTA 4Q66C 1JZTA 3EVAA 1YCFA 4LGCA 5JAZA 2VJLA 2LW7A 3BORA 3GT4A 4ZGGA 4L5IA 1JIJA 2QYTA 4JX8A 3U26A 1RAFA 1RYNA 1V35A 3AL3A 2XLBA 2Q8PA 4GGOA 2FP4B 2JHAA 3LT1A 1ZS9A 1MAWA 1BX1A 3WRXA 4G8JA 2HLDA 3BH0A 3PNLA 4TXMA 1HE4A 3N0XA 2VPPA 4YI3A 3SDSA 5HE8A 3SHQA 3U2QA 1HT0A 3QEMA 4CPDA 3HB1A 1S6YA 2F3SA 3ZE6A 2FHPA 2IYNA 4QYXA 2QP3A 1KTVA 4YC7A 4FNAA 1WUIS 1CU1A 2ZYAA 1P3JA 4FSXA 1Q5PA 3R7WA 4BKMA 1GLGA 1OW3B 1CIVA 3ACBA 4LZWA 1DEAA 2PNJA 2QZ9A 2IS4A 3QXCA 2PSHA 2GPSA 1ZJZA 4NCIA 1I80A 1K4YA 5IDXA 5KX5A 1H1LA 2F3RA 4EUNA 1LJUA 2XUIA 2M32A 1T2AA 2D1RA 4HNUA 1N5KA 2ZYDA 2X9LA 1E3EA 2I9PA 2O2HA 2PUAA 1VZ2A 4D5EA 5BSMA 1AH2A 5EIXA 2BI4A 5B3JC 5IN4A 1ZMRA 4EW3A 1G1AA 3HV0A 4MQBA 5CJPA 1IM2A 1MNQA 4EK9A 4IINA 1JGTA 2OP1A 3GV0A 2Y0EA 1DBWA 4EWLA 4W5RA 3K1YA 1Y63A 1RS0A 4QJ3A 3DOFA 3I32A 3W5AA 1TT5A 3LDHA 2KI5A 4X61A 2DSTA 1YBVA 3LIIA 2AR7A 4RPGA 3H1BA 3P4YA 3PDUA 2ET6A 4H4CA 5EIHA 3CJRA 2F3TA 2B4QA 2GHRA 4CTJA 2JLWA 1IK6A 4ZTUB 3VJLA 5I01A 4FI3F 4TL6A 1QHIA 1VP3A 3HPRA 3CF4G 4CLRB 1JKFA 5CFZA 2ZI3A 3NHWA 1QR2A 1R15A 1H65A 4LVUA 4RZQA 2VPQA 1RQGA 2OB2A 5FORA 1G55A 2A5FA 2IQIA 5JCXA 4D8UA 2HCTA 2WHPB 4IJ5A 4KRFA 6CHYA 3OJOA 3LQ1A 5HJEA 5CXQA 3T9CA 3K2EA 3EXFA 3WGHA 1RQRA 2WU8A 4MRRA 4NOKA 3B1KA 3PD1A 2WJPA 4ZU1X 1JR3A 3NIWA 3RTCA 4JEIA 2C7QA 2P5UA 2YZGA 4ER3A 3LHDA 3TH5A 3VHQA 4CYMA 1T9GR 4QOEA 2VZ8A 4MV3A 1SVOA 2P1RA 3CS3A 4XGQA 5AHOA 2P9TA 2SKCA 2HA0A 3GLIB 3PFNA 2XEDA 3UCEA 4EHLA 2OBMA 1O9GA 2QJFA 3PTAA 4HHEA 5FTMA 3U7QB 2GETA 2V6GA 4MKGA 4MCHA 3LBFA 4W6ZA 4TX1A 3WMGA 2CXOA 4QO7A 1ORWA 3CNNA 4IXDA 1DEHA 1F17A 3DQZA 3HHEA 3GJXC 3WYCA 1Q14A 5BMOA 3FWZA 2VDUE 1NKTA 3T6KA 2XKAA 5IFLA 3QBVA 4LFBB 2BZ1A 1RQ7A 2F62A 1MOZA 2BM8A 2I3BA 2V0CA 2RSLA 3FETA 3LE8A 1H4VB 1OF1A 3R8CA 2FPIB 4WOPA 4CDGA 3F90A 4OQQA 1WIWA 4UXHA 3H1PA 4MVJP 4W5JA 5FLYA 1BDIA 4K8RB 1MO5A 2RBGA 2MOKA 3RG2A 3BAFA 2PVCA 2JI4A 3CSDA 2FPGA 1K63A 2ZJYA 1VB5A 3EBLA 1S8OA 4PLYA 1GG5A 1XQXA 3ESCA 3QV1A 4GMFA 3UMVA 1TM5E 4AFNA 1LVUA 2ILTA 5FIUA 1Q7BA 1OLUB 1SIUA 5DOZA 3RYHB 5IASA 4AF7A 2H9IA 4U2CA 1KOJA 4IV8A 4QASA 4R7TA 3UC5A 4BLUA 1TPZA 2QYOA 1SKYE 3KB8A 3IP6A 4HXYA 3WSTA 4AYXA 4YJ2A 4MSUA 2OY0A 1NQVA 4AN4A 4RK4A 1YBFA 2VKTA 3FYCA 4EPVA 4F85A 1BOFA 1DWOA 1TM2A 3CB4A 3I0MA 3PC8A 4F0JA 4GECA 1RPZA 3FB4A 4TSFD 1HOXA 3GN2A 3HQ4O 2R5FA 4BFWA 2BUAA 2I8AA 3B3GA 3LUCA 3OLYA 4G4IA 3VC2A 4W5NA 2C83A 5CNJA 4TRMA 4DMHA 4L6AA 3PX2A 2RH9B 2Q5IA 2BCJQ 3Q1LA 4JWTA 2GCPA 4OSEA 5ELLA 3LQKA 2A5GA 4Q4JB 4E15A 4X7BA 1FMFA 4FT4A 4YJ3A 1ULAA 3V55A 2V5AA 4QU0A 3FGNA 3PHLA 3B12A 4BOYA 3SE0A 4X63A 4BQNA 4AJ2A 4C0KA 1KJNA 3VH4A 4HCJA 1WMFA 1N5JA 2PMDA 4Z0PA 4W1SA 2YKGA 4GM0A 3BS4A 5FWXB 1NKVA 2NO5A 4C89A 3O4RA 1ZSYA 4BIIA 5L6LB 4TROA 2XXAB 4JJFA 1A72A 2J87A 2ZR7A 4G1UC 1QF6A 2LVBA 3C8UA 1L8XA 1I0LA 2WWXA 3CB2A 3NIBA 3OIVA 1IHXA 1VJ0A 2CUKA 2Y68A 2ZR0A 4MYCA 3V1KA 3MTDA 4PCUA 3RVSA 3NHRA 1DRUA 1R8JA 2P3OA 1X8LA 4QEKA 4OEHA 2HJVA 2PA3A 2QRVB 2OZEA 2PRYA 4PG7A 1EUCB 2E1PA 2HIGA 2JFOA 4M2LA 1YL6A 1F4LA 2WJZB 3KFLA 5TVGA 1PV2A 4V0RA 1SVKA 4BX0A 1QANA 1SBIA 4Y8VA 5IYZF 1GTG1 3WICA 2HIHA 4BX3A 3UJBA 1BROA 3PFCA 2PUHA 4G5XA 1W52X 1C9MA 2LTAA 5CIWA 3AUJB 4R3WA 1JYSA 4UAUA 4INPA 4DBLC 1L4LA 5GQSA 2H3EA 2RARA 1GL6A 4F45A 1XTBA 1QS0A 1RM0A 2J9FB 3L4JA 1O6BA 2IZ6A 3QXGA 5HIIA 1TE2A 1CS0B 2I6TA 2EBUA 5D3KA 3B6IA 3GJ6A 1OH6A 1HTWA 2XWPA 1UKBA 2FSGA 2C58A 1V8DA 1QH1B 1YE3A 2YV5A 2FPLA 3HV2A 1XL0A 4MH0R 1O57A 5T4FA 5BVGB 1S02A 3BUSA 3RWMB 1FNNA 1YUNA 2AOVA 1ST2A 1V2HE 4HRVA 3FJ1A 5ECWA 2VF7A 5EE3A 3J81A 2CJPA 2WZQA 2GTIA 3WIUA 4B73A 3QKWA 3QNWA 4R1QA 4ICIA 3FZQA 5C7LO 3LHFA 1HZZC 1FFXA 4G84A 5CX4A 4W9RA 2ZVDA 5JARA 2H5IA 3FJOA 4BZQA 1TQ4A 3K73O 2QM0A 5H8WA 4ITVA 1OLXB 3WQHA 1ZN9A 2FUEA 2OEPA 1KNXA 1XZAA 5EIAA 3LGSA 1KL7A 3ZW9A 2JFGA 4BNNA 5M7EA 1IHOA 3H7AA 4LZAA 3UMCA 5CA1F 3PE6A 1CR6A 4MMXB 2DRIA 2ZRHA 1W5BA 3PDWA 3WO0A 4D44A 5D2CA 5DDIP 1IQRA 2X0IA 2SICE 4DPLA 3H16A 2GXAA 1G0OA 1QTRA 4UARA 3S2IA 1RHRA 3UC9A 2GLTA 2WQ6A 4NPCA 5CGZA 1QYVA 2B5WA 3DXYA 5CK4A 2H07A 4GZMA 3GBPA 2D13A 1XJ5A 2XDQB 3VKFA 3IIIA 4N03A 4QJ5A 3ACDA 3GCGA 1QFYA 4YRQA 5D5HA 1C3LA 4R81A 2XYGA 4KAAA 4GR5A 5EWMB 5I8PA 5EJ8A 1OI3A 3PA8A 4MYSA 4QUDA 2LWIA 4Y2XA 3SEQA 3HDVA 4AXBA 1YUBA 2F8LA 4EHBA 1F5SA 1NFQA 5AKXA 1N3BA 2GTPA 1NPYA 3PXXA 4MOWA 4FINA 3RIMA 4EUHA 1AX9A 3VX3A 4KBGA 2TMKA 5HKLA 4C9BA 2ZE6A 3UPTA 4CEHA 5I7UA 4UM9B 2IE8A 4UM7A 1CR2A 1RJGA 1P44A 1TMOA 4Q9DA 2YZMA 4Q6WA 3FOFC 1P9NA 5AQ1A 2ZRAA 3IRUA 1WPQA 5C0OE 4U7TB 1A8UA 1RXUA 2WRZA 1EFUA 1OU4A 5C7IO 2OFFA 4DEYA 4OG2A 1WZUA 2A3NA 5HMMA 3N2GB 3GF4A 4ZZ0A 4FYHA 4WL0A 3CH4B 1AUXA 4I66A 1SC6A 5F4ZA 1P31A 4IGKA 4OSPA 3I42A 3RJZA 1M2JA 2I7DA 3NYQA 4ISCA 4J75A 5AW5A 4IDDA 4KQJA 4E88A 1Z5PA 2GO7A 3KUCA 3NDPA 4WZ6A 5HS6A 2DR3A 5CYPA 4G8BA 3C16C 4ZI3A 1CQXA 3AXSA 1RAAA 1CS4C 4TMZA 4YV2A 1K3TA 1VMEA 3THYA 4G81A 3NBZC 3W7BA 4F4FA 3EGDB 3B1WA 3NTXA 1HFKA 1P3DA 2HQRA 5KNCH 1ZSNA 4NFHA 1ZBQA 3C4QA 3FKQA 4IEIA 1T4CB 4LVNA 5C8YB 4AM8A 5HX7A 1N9GB 3ZD6A 1AMUA 3T7JA 2GRAA 2JFQA 5LYYA 5FBWB 4LNUA 3AZPA 4DR5B 4J0DA 1EWQA 1NVDA 1LPNA 1ELOA 1YRBA 3DBRB 4JUIA 2A9RA 3UPDA 4AJLA 3VXKA 5K3FA 4QARA 3MJ4A 1L5LA 2PSDA 5INTA 2Z30A 3WMWA 1TAGA 4ZDJA 3RS2A 3A6PC 3E5HA 1EE1A 5ITZB 3R5SA 3ZV7A 5JJLA 3D7KA 1E3WB 4PBSA 4BNTA 2E5WA 2P0AA 4Q7EA 1WY5A 1GUFA 2I4NA 3IAAA 3ZX4A 3RJMA 5G0TA 4MRNA 4PHTA 4DJAA 4E2FA 3MB8A 4BMDA 221PA 2LCFA 1EUDA 4KWHA 2HMTA 2HRCA 1M6HA 4FHDA 4F93B 1H22A 4MW5A 1HEYA 4OHYA 2JC3A 4EGFA 4DF3A 1S2DA 5TQVA 4ON9A 2FH5B 4JL8A 1G5IA 1WB6A 4B2PA 5C51B 4FLFA 4CMIB 2BDEA 4BX9A 2XUAA 2XQKA 4QREA 4RPJA 5CYFA 1LRJA 1U0NA 4MDEA 3DMPA 2D59A 3QFCA 3UTDA 2XRFA 3IQZA 1PU2A 5JQGB 1KVTA 3GFGA 4CODB 4O8ZA 1JEYB 1J0CA 4FMPA 2IW1A 2ZXFA 5EZ5A 5HCUA 4CIDA 3AVXA 3VTAA 2YJ5A 2I33A 4BGVA 1IN7A 3E5NA 3OMXA 3ONNA 4HNAB 5IKPA 3HI6A 5BN4A 2G9UA 4HX9A 4KE9A 4LOAA 3WDSA 4QFCA 2QRLA 2A4KA 2BISA 1S89A 5ILGA 4AWXA 1T8PA 1MX9A 1SELA 1ULZA 1RU3A 3A58B 3RWBA 3HH8A 1MA3A 1TO6A 2P3QA 3BB4A 4D4LA 5B4VA 1GQQA 2P8JA 5BQOA 4JJAA 5CCEA 3COJA 1MQAA 1O0BA 1KDRA 3SJCA 2JI9A 3ZCSA 2I4LA 4OK5A 5L7YA 2A2ZA 2WG1A 4RLSA 1Q17A 4K0RA 4MR7B 3VVCA 4F21A 1BCRA 1YMVA 3IAS6 1GSHA 2BSAA 8LDHA 1DDGA 1YCHA 3GLHB 1FTYA 2VUUA 2DFLA 4ZOCA 1DS6A 2N9UA 1GXSB 2FE1A 1XDGA 4L50A 1JTFA 4YJHB 1GTL1 1WB9A 4C6RA 1EXDA 3WLIA 1Y5RA 3QA3E 3ZJ5A 2P65A 1NYRA 1VPTA 1TFUA 1ZC3A 2MWMA 3HFGA 4MZDA 4BE9A 4Z49A 5BVHA 3GXBA 4W5TA 1BXGB 1XCBA 3U4IA 3UMGA 3VGPA 3AY3A 4PRLA 1XU9A 4P54A 3UA4A 1FSZA 1G4UR 3DT8A 4MULA 1RLOA 4RKEA 1ZEJA 1Y9JA 2AZDA 2HMUA 2QZ4A 3WFIA 4B2YA 4BVEA 1EXVA 4YRZA 2R00A 5KKAA 1I4EB 1RWNA 4DDKA 2IC5A 1U28C 1RRKA 4YNBA 3P2KA 5DTJA 3TZCA 2YBDA 3V48A 2EF0A 1BIFA 1D4FA 3P5SA 4H9GA 4EMSA 2IYQA 3WGGA 1K5GA 3R1IA 4MUAA 1P2SA 4AG5A 1J2YA 4RA9A 2R7AA 3SX4A 4DDHA 3ETEA 4HP8A 4MKFA 1L7BA 1REQB 3BMQB 1H0KA 3QBJA 1C0IA 4LQLA 3ON5A 4P3OA 3WL5A 5IDYA 4DSUA 5BR8B 3DDWA 2ZRIA 1WKVA 4UULA 3P0IA 4ZO9A 5JFTA 1W5FA 4LV6A 4FEEA 5KAMA 2WVAA 4G89A 3TZHA 3VPAA 1G8GA 3VYUB 4A2PA 1Z63A 1XYYA 2ZJ7A 1RP1A 1FMCA 2POCA 2OC4A 4DY6A 2UYQA 3TZBA 2HBRA 2FCRA 3ONDA 2BKXA 4CEIB 2VCHA 3Q5EA 4TS9A 5LL6P 2Q1XA 1X1TA 4M0EA 5JPIA 3BGWA 4DA9A 3DE7X 2FSIA 3O90A 2OYSA 3H8VA 3TK1A 2IT1A 1MN6A 3ND5A 4OLHA 2RHBA 2W2XA 3Q6MA 5YASA 1HOTA 2VIIA 421PA 3AOEA 2H63A 1JPNA 1UIRA 3FCAA 1XEXB 4D4HA 2COUA 1AC5A 3MGCA 4X8HA 5I3CA 4N1AA 5ELXA 5C5CA 2BMDA 3WHIA 3BWMA 4WCFB 4BNDB 2B21A 2FP4A 1SCIA 2P90A 2XGOA 4WKOA 4XSVA 3ZE9A 2DWQA 2V1XA 3IVMA 3N39C 2B1IA 4I0WB 1Z6XA 1EBUA 2GN6A 1MUUA 2VFAA 1EK6A 5FYQA 3H2YA 4Q24A 5CP8A 4YONB 3WKEA 3A4VA 2EZUA 3O1LA 1PJAA 3KKZA 4HDMB 5GJVC 4X66B 3V4VB 3DOJA 3BRCA 5BV1A 1FP1D 2LRHA 2ZUSA 4JJIA 5A71A 1D2GA 4CRWB 4CW7A 4E5SA 1BVHA 2PGAA 2EYUA 3OHMA 1Y48E 3TIVA 5FCDA 3TVDA 2R8XA 2Q4RA 1XQ1A 5GTDA 4DSOA 4CTMA 3QSYA 3I04M 1EB8A 4D45A 5AKKA 1KHTA 3TOXA 3B1JA 5EI5A 1BYUA 2V7WA 2M6SA 4PYLA 1ADJA 4YWJA 4DUYB 5C4GB 3FDIA 3TUIC 5ALQA 3GCDA 2ZSDA 621PA 1PS8A 3O9VA 4ZN6A 5LMUB 1EK5A 2HT1A 1L5RA 3ZBTA 2SECE 2ZDGA 2D5IA 4QNMA 3ITKA 4I50B 4D9JA 2WZDA 1SUWA 2O2CA 2PH1A 3IS3A 1JJFA 4XVQA 5DV9A 5IWAB 4DB4A 3SZMA 1MENA 1ZI9A 3DLPX 2YMPA 5G0UA 3RSGA 4B7CA 2NVBA 3CURA 1PD0A 1I6MA 4RS4A 3KSRA 3KZMA 3M9XA 3P2MA 5AP9A 4BLWA 4EZIA 4RDXA 3S8YA 5JRDS 3MJHA 2GEBA 4WXHA 3GBVA 1OASA 2OUIA 5K6AA 3NT5A 3ZGXA 3DDUA 3ADBA 4NBUA 3ILYA 5ALNA 4DBLE 2B69A 3JRXA 5HSGA 1WE2A 2OD7A 4Q34A 5I4BA 4CLRA 3JZDA 5J4LA 2JGEA 4IJUA 1LI7A 1N6KA 1QLHA 4PO3X 4YRLA 4B3IA 2P8SA 5JAUA 4G1CA 4NBKA 1COWD 3R09A 3DHEA 4LSZA 2GA8A 3O9ZA 4BV3A 2WSSA 3ZI0A 2WHPA 2ARKA 5B3LA 1RPTA 1YS1X 4KR9A 3QWFA 2H1OA 4TL7A 2EGGA 4Q12A 3MG9A 4UNNA 4C04A 3ASUA 1FFDA 4A0QA 1DIRA 1E92A 2DCMA 2R97A 3JSAA 4IIYA 2WUVA 3IOYA 3LP8A 4TZKA 4AO7A 2ADMA 1JMVA 1YJQA 1US8B 3NH9A 1NBMD 1GKUB 2O57A 3PQ7A 5HF9A 2H1WA 3GLIA 3MTGA 1JKMA 1ZCFA 5K99A 4LK3A 3IJ5A 2IUUA 3U7QA 4LC0A 5F21A 4J0IA 2SKEA 4GVPA 1U9CA 4Y2SA 4QSMA 5F77A 1XTVA 1HYBA 1N0IA 1L4GA 1UBNA 3DWIA 4DYHA 4JKYA 4KYUA 5JXGA 4GWLA 5BR1A 4IF4A 1IL0A 1E0DA 1WZCA 4A1FA 5SYNA 2YWGA 3B85A 3E8SA 2FN9A 3ZBUA 4JGBA 3SHTA 3W3AH 5JCOC 3SNKA 3M2PA 1P4AA 2G76A 4G5SA 4LQ4A 4AG6A 1AQNA 3FZGA 2FPIA 2BFPA 1TJPB 3DDZX 3EX7C 2EQBA 2XOXA 4LKOA 3DMRA 1TZMA 3EG5A 4GO1A 1VE5A 1CULC 2E85A 4HQNA 3IKTA 1WUKS 1PJQA 1XTIA 2VYVA 4DANA 5CG2A 1BW9B 1H2XA 1I6LA 3V8VA 2ZKIA 3WGZA 3GAMA 2W2LD 4U39A 4O0MA 4G4GA 4ALLA 2AXEA 3OLXA 4YAUA 2B8JA 1VE7A 3UWPA 2H1VA 4ZEMA 1UL1X 3NGLA 4JKIA 4LW8A 2W48A 1UXKA 3RYHA 1OLUA 1B23P 5B2FA 2I7VA 1WEHA 1ZP6A 3R2JA 1FPMA 4RL6A 1RWQA 2EATA 5HKAA 4OSOA 1LX7A 4KVZA 2DOKA 2FMKA 2P91A 2YWDA 3PC4A 5SYMA 3UMSA 4HUTA 1PJBA 1S2NA 2DT8A 2HF7A 2OGSA