3FBWA

Structure of rhodococcus rhodochrous haloalkane dehalogenase dhaa mutant c176y
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution studies of haloalkane dehalogenases DhaA04, DhaA14 and DhaA15 with engineered access tunnels.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 107
structure length 292
sequence length 292
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2008-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fbwA00
2WU4A 5AOBA 2ZVDA 5AI9A 5DTJA 2PU7A 2Y2VA 1QIMA 2JEZA 1X2EA 4IH4A 2WG0A 3HZOA 1ORVA 1QIHA 4L0CA 3C8HA 4EZIA 1UXOA 1X2BA 3VVLA 1SC9A 2WU3A 3NOXA 1XLVA 1C4XA 2B4KA 2Z3ZA 1CUJA 4UHBA 3GELA 1XKTA 4RE5A 2PU5A 3GA7A 2R11A 4OD0A 1VE6A 4P9NA 4G9EA 4P08A 2VJCA 4JNCA 3D2CA 3OURA 3K6KA 5LZ5A 2XLCA 1W75A 2HRQA 4G1FA 3G0CA 1AGYA 1LZKA 4DMKA 2BAGA 2GYVA 3WWOA 3WIBA 3WK9A 4OB6A 3WWDA 4DNFA 4CI9A 1ISPA 4QEKA 1BU8A 5T4EA 5A7HA 3GBSA 1JT2A 4I4CA 4I19A 4CG3A 1HL7A 5EGNA 1MJ5A 1W76A 3AFIA 3DKRA 5AJHA 4AO6A 1H2ZA 3LCRA 5CBKA 3ZLUA 3IB3A 4FLFA 2IX9A 4J0HA 1IVYA 1D07A 1LBSA 4J0JA 3EF3A 2CKMA 2WLSA 1TCBA 3HI4A 1AZWA 4W1SA 2WKWA 1VA5A 5CMLA 3PF9A 3OTQA 4Q82A 1LPPA 5JASA 1VE7A 2JF0A 4AB1A 5LZ9A 4S0XA 4B81A 4BBZA 3H2HA 3H19A 3DYVA 5FPQA 4AO7A 1WHSA 3HSSA 4BCBA 2WIDA 4G4IA 3DOHA 2ZSIA 4OSEA 4H7FA 1AMNA 5ALHA 2XUOA 4X85A 2XUGA 3R3XA 1MNQA 4YK7A 4C4YA 4HAIA 3RM3A 3N2ZB 1BS9A 2B20A 3VKFA 4X90A 2WUGA 3ANSA 3H04A 3KOOA 1CUBA 3Q0TA 3WZMA 4JEIA 1CUUA 4DIUA 3KWFA 3H18A 5C7YA 2J3DA 1GPNA 2XUPA 5AH0A 3IA2A 1UZAA 3CCBA 1CVLA 2ZYSA 2ZSHA 1ZICA 2JGKA 4GECA 1CUYA 1L7QA 4C87A 5AM1A 5HF9A 5A2GA 4BC0A 2VATA 1UKAA 5ALTA 2PKYX 1WHTA 3B5EA 4WY5A 5AI4A 3PUHA 4HZGA 3PDCA 3H0CA 4MXDA 5JALA 3ICVA 1ACLA 1HKHA 3N0TA 4OU4A 5CT5A 2BUBA 2GZRA 3WIOA 5HF5A 4E15A 5KWJA 4EY5A 3R41A 4G4JA 3M3DA 1ODCA 4HRXA 3W06A 1CLEA 4BTLA 5AM3A 1N8SA 1H2WA 3DEAA 4KACA 3FSGA 5AK3A 4UHFA 1XKLA 5HQ3A 3ILSA 2G4LA 2RAUA 4YX9A 4MWTA 3QMVA 4TVKA 1IZ7A 5DJ5A 2K2QB 3HLKA 2XUDA 1DX6A 1VZ3A 1XLWA 2RHWA 3EIOA 2HIHA 3G0BA 2H7YA 2IIVA 3VISA 1XZKA 3OM8A 3G02A 3GROA 2I3DA 1XQWA 1Q0RA 4MWSA 1O6FA 4JUIA 2XUKA 1ZD2P 3WKBA 3VVMA 2OAGA 4PNZA 1KEZA 4HRYA 5LZ7A 2FX5A 4Y2YA 4EB0A 2ORYA 1XRMA 4N8EA 2XUHA 5AOAA 5CT8A 4G8BA 2I3ZA 1K63A 3B12A 5DLPA 3WK8A 4QLOA 4C4XA 3R3VA 4KAJA 4DNQA 1ZI8A 1I6WA 1G42A 1LGYA 5A6VA 3W04A 1BEZA 3FWHA 3C6BA 1LPSA 3R3YA 3WL8A 3O9MA 5AK6A 1XRRA 4F60A 1CEXA 2DHCA 4V2IA 3R0VA 1MN6A 1R4ZA 5ALPA 1K5PA 3V1LA 2VEOA 1LPBB 3FYUB 1CUIA 3I28A 1VXOA 5F4ZA 4RGYA 4GWLA 1YSCA 4EHBA 1EB9A 4UFOA 4UBJA 1G4HA 3E4DA 5JZSA 2C4HA 1MAAA 3G0DA 4K5QA 2WG1A 1QFMA 1ZI6A 1EVQA 2XMZA 2ONCA 5JD4A 2XMSA 4H7EA 4AZ0A 4ARBA 4FLEA 5AI6A 2CBGA 2VAXA 1PFQA 4G4GA 4UPDA 2AJLI 4FLMA 3BE8A 3A6ZA 5ALNA 5AOCA 3SK0A 4AXBA 2HA0A 4AN1A 2VSQA 3QH4A 3CN9A 4Y2QA 1F8UA 5HKAA 5BV7A 1IUPA 3T52A 4X7BA 1AX9A 4F21A 3I2IA 5AI5A 4HXGA 5HCUA 1E66A 5T4BA 5FDFA 5ALXA 3UUEA 2QRUA 5JYCA 5AKGA 1QTIA 1OXMA 2VJBA 1P0MA 2WJ4A 1VXRA 2EDCA 5ALOA 4KEAA 3STUA 1XZLA 4L72A 4IQ4A 2PVSA 3SWWA 3V1MA 2E3JA 5HF6A 3IUMA 3VJKA 1ZD5A 2XT0A 4C4ZA 4EUSA 1UKBA 2WIGA 4LHEA 1NX9A 1HLGA 4WJLA 2OAEA 3BWXA 3WKCA 5HZGA 5ALLA 4KE7A 1SCQA 4G5XA 3FVRA 2PPLA 1W1IA 5DYYA 2WUEA 3DDUA 1LLFA 2JGLA 2XQGA 3WQHA 2PX6A 2O2HA 1HBJA 1LPNA 1XZBA 4AMZA 3D59A 1AURA 4C89A 1IUNA 1LPMA 4X6UA 1ETHA 3FCYA 4BZWA 3AZPA 4DGQA 1W4LA 2Z3WA 3G0IA 1USWA 3H2KA 5EHZA 1XZFA 4QWWA 4BTVA 3MVEA 4F5ZA 1BCSA 3M81A 3D0KA 2G63A 4L3WA 1XZMA 5I9IA 5IH7A 3AZQA 4ZI5A 1JKMA 2C0QA 4GDMA 3QYJA 3FNBA 4H7DA 2WHQA 4B6GA 1GT6A 4X00A 3WLAA 2XUFA 1N1MA 3BJMA 1B6GA 4KE8A 3YASA 4XVCA 2JGJA 1MT3A 2W22A 2XMRA 1UT6A 3TJMA 4DMHA 4EA6A 4QA9A 4INZA 1KU6A 4BCDA 1BN7A 1FFDA 3STXA 2XMCA 3T4UA 1E3QA 1XZDA 4Q3KA 3WWEA 2HM7A 4CCWA 3MUNA 4N8DA 5HKBA 4C01A 3F97A 2ZYRA 4W1PA 3O4GA 4QDOA 2HFJA 2QJWA 2O2GA 2XQKA 3PE6A 4J7AA 1MNAA 3EQ7A 3HABA 1EI9A 5BWBA 1CIJA 4H18A 1JI3A 1ZOIA 5LKRA 2PSJA 1DQZA 3KD2A 4QE3A 5HFAA 4B85A 3A2MA 5JANA 1XZAA 2ZJFA 3OG9A 4QWMA 4X91A 3KDAA 4IHAA 2OQVA 1QIKA 3BIWA 3C8DA 4Q1VA 3I2HA 3BDIA 4CG2A 2X76A 1WM1A 2CUTA 5D3ZA 1XLUA 1VKHA 1EB8A 5DNVA 3F9CA 1GQRA 1QZ3A 1THGA 3HYSA 1QIGA 1QIJA 3WMRA 3ANTA 3WWCA 4Y9SA 3BL8A 3C70A 2VAVA 4U2FA 4P92A 3BIXA 2Y2UA 4BAZA 3D2AA 3X3HA 5EI5A 1ZI9A 2XUAA 1FJ2A 1Q0ZA 1RWQA 1YAJA 4X71A 4DSZA 5E4JA 4FFWA 3AIMA 4MJ3A 1UOQA 2BCEA 4H35A 5I7UA 1CUFA 5SYMA 2W6CX 4X92A 3STYA 4J0KA 1GQSA 3LIPA 5K3EA 3GZJA 3H1AA 1DWOA 1MU0A 4GHWA 3V1NA 1RP1A 1TQHA 1JJFA 1ZIXA 1A8QA 1EK2A 2VJAA 3V48A 1A8SA 4H7KA 2QXTA 1CUVA 2JGEA 3FBWA 2J4FA 5JD5A 4B0PA 1AKNA 5D6OA 5C8XA 4BCCA 2GBGA 1XZJA 2PL5A 3SC2A 4U2CA 1DU4A 2QM0A 4HS9A 3IUQA 2GBIA 1R3DA 5EFZA 4RPCA 4F0JA 3SX4A 1H2YA 1YCDA 4PSDA 3WKEA 3TRDA 4H0CA 1GGVA 5ALFA 3STWA 3U1TA 4GLBA 3AJAA 2XUQA 1AUOA 1HQDA 5LZ8A 2NW6A 2C7BA 2JGIA 4UUQA 4B80A 5K3FA 4N5IX 3H2JA 3QVMA 1ZIYA 2JIDA 1CRLA 1K8QA 4B84A 1TCAA 5FKJA 5K3BA 1XZEA 4J0GA 5ALSA 5IVIA 3H2GA 2QOEA 3DL7A 4PQEA 2DSNA 1OCEA 2GYWA 3HJUA 4A5SA 2JGFA 4E14A 2OXEA 4UBMA 4J0CA 3D2BA 4BATA 3FYUC 1UFOA 5HFNA 1LPOA 4UBKA 5AIAA 4FMPA 4FKBA 2AXEA 1YAHA 5EHQA 2XMQA 2QVBA 3WK6A 2CZQA 1DINA 1MO2A 2PSEA 2RGUA 2UZ0A 5AI8A 1J07A 3C43A 3FYUA 1K4YA 3DD5A 4WDQA 5DNWA 3F67A 4BDSA 4DMFA 5H3HA 5FOQA 5HK9A 2DHDA 1IUOA 3G9UA 3C5WP 4LYDA 4IO0A 5D7BA 5J3JA 2PSFA 3KXPA 4QNNA 4E46A 5LIPA 2BUCA 2WSLA 4FNGA 2OG1A 4PW0A 2WFLA 1IZ8A 5ALWA 4NZZA 1CUCA 2HADA 4M0MA 1BEEA 3STVA 2P8SA 4LYEA 5DYWA 1CUSA 5JAPA 3D4LA 2QXUA 3W9BA 4B82A 2ACKA 5ALJA 4LIPD 3LLCA 2HU5A 1XZCA 4MYSA 4YPVA 1BE0A 1CFJA 1E8MA 1MX1A 1XRLA 2GZSA 1WPRA 4GW3A 1YB6A 3ESAA 3S8YA 1BRTA 1MX9A 3RK4A 2WM2A 4CCYA 3IVMA 5AKEA 3WL6A 4J0DA 2C58A 5ALMA 4ROTA 3HC7A 4W9RA 2ZJ6A 4UFPA 1EX9A 5C81A 2AJCA 4UHHA 5AM0A 1JJIA 4P93A 3P2MA 1WCYA 2VA9A 2XQJA 2Z8XA 4I3FA 2X5XA 4KRXA 3PUIA 4K2AA 1LZLA 4Z49A 5JATA 3PI6A 4WDRA 1JJBA 4DTCA 3Q8WA 1E5TA 1N5MA 1XQXA 1ZJ4A 2CEKA 5ALUA 3DL4A 4AMYA 4DM7A 3QM1A 4J03A 5AKZA 2QTBA 3RARA 3NWOA 1ZD4A 2QZPA 4MEAA 1BROA 4XX1A 4Y2RA 2J3QA 3EQ9A 4OB8A 2QS9A 5KREA 3FAKA 1E8DA 4QDUA 5AM5A 2XB6A 5K3FB 2BGRA 3ZLVA 1GXSA 5E4YA 4JYPA 2XI4A 1XZGA 1YS2X 5CTAA 2PBLA 1VJ5A 4XWGA 3TEJA 2RHTA 1EDBA 3D7RA 1JU4A 5T4FA 4BAGA 2HA6A 1XZHA 5AHXA 3PFCA 3QBJA 4ZREA 4UBIA 1Z68A 4OCZA 1P0PA 1S8OA 3JW8A 5ALZA 1AQLA 5FXMA 4LKOA 2GYUA 4PSUA 1XRQA 1CUZA 4K6HA 2HDWA 4ZV7A 1SFRA 3FVTA 5CH3A 2RI6A 1CUAA 3DLTA 4AX4A 4Y2TA 1TAHA 4OYYA 1L7RA 1QLWA 3HEAA 4J0IA 5FUMA 1C7IA 5ALVA 4UFNA 1C7JA 1UK9A 3GUUA 5AKJA 2H7CA 4Y2VA 5E2IA 3WWPA 5YASA 1JFRA 4B9EA 2X8BA 4Y2XA 5DNUA 2H7XA 3V9AA 2QR5A 2VT6A 3FCXA 1WB4A 3W05A 3AUKA 1A88A 4U2DA 3BF7A 1H23A 5I8PA 3M83A 1B41A 3QMWA 1MPXA 2I78A 4MQLA 1QTRA 4WFKA 3KSRA 4B83A 3BF8A 3PF8A 2ZJ7A 1JU3A 2Z8ZA 2OCGA 1QONA 1QIDA 2WHPA 4JYMA 1VA4A 5BOVA 3WYDA 1QFSA 1XQVA 1YA4A 1IMJA 4LXHA 1DT3A 4QDZA 5A62A 1RYYA 2HFKA 2HA7A 2VJDA 5CRIA 1XZIA 4KAFA 2DFPA 4FWBA 3A2LA 2ECFA 4BE4A 1H22A 4UBNA 5CH5A 4J3JA 3M82A 1R50A 3D5EA 5K5EA 1BN6A 3AILA 5ISMA 4GI1A 5HF8A 2V96A 4DMCA 3EQ8A 2WUFA 2BJHA 3QPAA 5K3DA 4Q3OA 4MQMA 2HA3A 3G7NA 5SYNA 1HDEA 1J2EA 4QDXA 2WIJA 3ICWA 4HXFB 4Q05A 2OQIA 5AIBA 5DWDA 1Q84A 5LYYA 3D3NA 4X94A 5FPPA 4U2BA 2JGMA 4TPKA 2QMQA 4AQDA 1GKKA 2XQFA 1DWPA 3F96A 3PICA 3ZPXA 4U2GA 2XLBA 3LIIA 4OYLA 1CV2A 2J4CA 5IVDA 1UWCA 3DQZA 4QLAA 3JYHA 2EDAA 1WB5A 5ALEA 1J1IA 1CUXA 2VF2A 3EBLA 4KRYA 1LBTA 1EHYA 4A23A 1A7UA 3H17A 1EINA 1R9MA 1SCKA 4XIIA 1UOPA 2D0DA 6YASA 3O4HA 3WK5A 3MUOA 4CIAA 1F0NA 5CW2A 3DJYA 4GXNA 2WFZA 1QIEA 3RLIA 2IITA 1EK1A 3R40A 3K9BA 2ROQA 3CN7A 3O4IA 4N8SA 3OPMA 3C87A 4ETWA 1WOMA 4KE9A 2B61A 1MTZA 2GBFA 1T4MA 5C8VA 1KU0A 2WTNA 1YR2A 1K6EA 5IVHA 4OU5A 1U65A 3OOSA 1TIBA 1FSSA 3R3UA 2R8BA 3AIKA 3E0XA 4W1QA 5JIBA 4FFVA 1ORWA 3FLEA 2XUJA 3O0DA 5AKXA 3WI7A 2ZYHA 2BKLA 4HTAA 1UK6A 2G5TA 3F8SA 1THTA 1XRPA 3BDVA 4Y2UA 4H7JA 4Q34A 5ALQA 1WPXA 1U4NA 3C6ZA 4TGLA 2DCMA 5JARA 4WFJA 2QJRA 3WL7A 5AM4A 2Y1KA 3DOIA 3FLAA 3ESBA 1JMKC 1EDEA 2XUIA 5HQ3B 1F0PA 3CCCA 2BFNA 3L1JA 1P0IA 2XMDA 3B3QA 3C6YA 3WK7A 4BC1A 1QOZA 2WG2A 1F6WA 3C5VA 4Y2SA 2QKYA 1P0QA 3LP5A 4AO8A 5E4TA 4CFSA 4DNPA 4ZWNA 2C0PA 3I1IA 4EY6A 4FBMA 4PO3X 4E11A 1VOTA 4DNOA 3IIIA 5JD6A 5DTIA 1UK7A 3H2IA 3ZWQA 5LLSA 2BUAA 1R1DA 3AIOA 1J06A 5CXUA 4CIBA 3OC0A 1VZ2A 2PSDA 3I6ZA 3UUFA 3ESCA 3WYNA 3C45A 5A71A 1CUEA 5FLKA 1R9NA 2XQIA 3R3ZA 3A2NA 2RONA 1YB7A 2Z5GA 4MEBA 2WFMA 1EA5A 1NU8A 1OILA 4QDTA 2H1IA 3IDAA 3FLBA 3PFBA 2OGSA 3WA7A 2I03A 5JAHA 1WB6A 2ACEA 2DQZA 2OGTA 2OCKA 2G5PA 1XFDA 5AKHA 5JADA 2YH2A 3E1GA 5BWCA 1W6RA 3STTA 1Q83A 3DNMA 1VLQA 1SOMA 4X6XA 1MAHA 5T4HA 1TKRA 3QMMA 4UHEA 1QO7A 5CT9A 3QPDA 4X3CA 1T2NA 2OPHA 4JH0A 5ESRA 4OB7A 4WY8A 4KAAA 2WJ3A 3QPCA 1E8NA 5FV4A 3I2FA 2WFLB 3WJ1A 2QUAA 2HA5A 1ODTC 4QZVA 2Y6UA 5AK4A 5KBYA 2GBCA 1Y37A 4GBGA 3CXUA 5EHXA 4BB0A 4BVLA 3DKKA 3F98A 1QE3A 1EXWA 4H7HA 4W1RA 5LZ4A 4X95A 1ACJA 2V98A 3V1KA 5LKAA 3NGMA 2CJPA 2CMFA 4A16A 2Q0XA 3W2TA 1U2EA 3W9UA 1ODSA 3I6YA 4NVRA 3NUZA 5DYTA 3ZLTA 3WL5A 1CR6A 1DQYA 3UMJA 1QO9A 2YXPX 4FNMA 3O4JA 5FRDA 4UHCA 1UKCA 4BAUA 2D5LA 3H1BA 5ALRA 1H2XA 4Y2PA 1QJ4A 2AJDA 3G9ZA 2WUDA 4K6GA 1EH5A 1TRHA 1CQWA 3VJMA 3I6MA 3I1YA 5IVKA 4B9AA 1TCCA 4X6YA 1FFBA 3BJRA 2ZYIA 3C6XA 3G9XA 2QT9A 4H7IA 2AJBA 2WILA 1L7AA 2WIFA 2EEPA 4CCYB 1TK3A 3DYIA 4YASA 4BP8A 1FFCA 3G9TA 4ZGBA 1AC5A 4IH1A 4IH9A 4FBLA 1O6GA 1UOOA 1CPYA 3WKDA 3E3AA 3A70A 1CUDA 4O08A 3LS2A 2HU7A 4KJXA 3K2IA 3HXKA 3VJLA 4KE6A 2C5GA 5JZ9A 4Y2JA 1NU6A 3ED1A 5CT4A 2XMBA 4Y7DA 2JEYA 5AP9A 2WJ6A 3MGAA 1GZ7A 1FFAA 4M0FA 4DYHA 1PJAA 2YYSA 4PSCA 2VQ6A 3HRHA 3HACA 4G8CA 3I2JA 1W52X 1ZGBA 5A7FA 4K6KA 3IURA 2Y6VA 1GKLA 1ZJ5A 4N5HX 5IKXA 4B0OA 3WKAA 1N5RA 4NMWA 3VDXA 5A7GA 4FOLA 4BRZA 5AKLA 2JBWA 1XRNA 2O7RA 4WFIA 1XQYA 3DS8A 5EHNA 4ITVA 7YASA 2OCLA 4C88A 4M0EA 4BP9A 4MYDA 2WHPB 1DX4A 3FYTA 3O95A 1ZGCA 1CQZA 2OCIA 3WJ2A 3ZV7A 4L9AA 2WIKA 4W63A 2HHAA 3DCNA 3G8YA 5CXXA 2HRRA 2PUJA 1PV1A 1CUGA 1HPLA 2V9ZA 2VTVA 3JWEA 3IUJA 4ZV9A 1UK8A 4BRSA 1X70A 1Y7HA 1XROA 1GPLA 2QUBA 5AICA 5AO9A 5LZ2A 5ALDA 3FOBA 2WQZA 4H77A 4BVKA 3QITA 4GEGA 4OPMA 4RE6A 4KYVA 4RNCA 3GFFA 1CUWA 3L1HA 3S2ZA 2O7VA 4AN0A 1CUHA 5EIAA 2PM8A 2XE4A 5JAUA 4NS4A 5AM2A 1SCIA 5AKKA 4D9JA 2O2IA 5ALKA 1DTEA 5AKIA 1G66A 3G0GA 4LXIA 2PUHA 2OGZA 2BGNA 2WTMA 4DLNA 2HA2A 5FP0A 2XDWA 2CB9A 4UHDA 4G8DA 4FHZA 3TGLA 1QIIA 4AZ3A 3ZI7A 2HU8A 4ARAA 5ALYA 4KR0A 1GPKA 3QZUA 2YASA 3FSGD 2FJPA 2DQYA 1G5FA 5JZBA 4FTWA 1U8EA 4PF1A 4BE9A 5EIEA 5LP1A 2DR0A 4G9GA 2B9VA 4EY7A 2V97A 2AJ8A 3AINA 5AI0A 4UBOA 4HVTA 2VT7A 4Q3LA 3WA6A 2DHEA 4EBBA 5JAOA 3IUNA 1M33A 3IBTA 4PV7A 2PSHA 3U0VA 3ESDA 4CG1A 4C6HA 4BVJA 4BZZA 2OLEA 3VXKA 5C8ZA 2H9YA 2HA4A 5K3AA 1Y7IA 4FDMA 4LXGA 1E89A 4BYMA 1R88A 4ZRDA 4X93A 3KWJA 1MX5A 1DT5A 2HL6A 4X97A 2XMGA 5CH8A 3IULA 5K3CA 1QGED 2LIPA 4UBLA 1YA8A 2C5FA 1BCRA 1QIFA 3I2KA 1JMYA 1FFEA 5HK8A 3RKSA 3BXPA 4OUKX 4XJVA 1A8UA 5CURA 4WCVA 1EVEA 3R3WA 5AK5A 5ALGA 2WHRA 1LNSA 4EY8A 5CT6A 4EY4A 2FJ0A 2FUKA 4U2EA 4DSAA 4BDTA 3AZOA 4B7ZA 3WK4A 2RIPA 2ES4A 5EIHA 1YS1X 1DWQA 5KWIA 1LPAB 3WZLA 1EDDA 4HXEB 4ZXFA 3O9VA 5ALIA 3I2GA 5D3KA 1ZD3A 3L1IA 5AKYA 1YASA
chains in the Genus database with same CATH superfamily
3VUFA 2ZVDA 4CKZA 5IBPA 1L4YA 1NW5A 3UJHA 2C9YA 5DTJA 5HDQA 2R7MA 2IEGA 2VDRB 2Y2VA 4YALA 1I4OA 3MWDB 2OSBA 3HB5X 1TIPA 3C1AA 1XXHB 3B36A 1OXKB 2QRVA 3HXOA 4U8GA 3U48A 4DYDA 2YHSA 2H2AA 4DUGD 3C8MA 1H0KA 1N2OA 2BE9A 3OOWA 3OZUA 4Z0PA 1SELA 1PR1A 3EZFA 4KW7A 1HY3A 4GI7A 1BXZA 1SC1A 2X9VA 2WU3A 1L5MA 2ZCUA 3DW1X 4D4IA 4L0DA 4C0KA 2O50A 1XLVA 2PA0A 2XJ4A 3K0FB 4GKVA 2DUJA 3MJVA 5JXIA 1KEKA 1M72A 4XFKA 2D59A 2OXIA 4UHBA 4LV8B 1E7SA 3GELA 1SRQA 2FEXA 4YUAA 1XKTA 2HYDA 2ISCA 3MRTA 1R6DA 2YOGA 2AR0A 2R11A 3FTEA 3L0CA 1VE6A 4P9NA 4S0ZA 4DLWA 3PXGA 2TSYB 1N2JA 2P78A 3SAJA 3GRZA 1NVBA 3M2PA 4UXHA 2IUTA 4FD2A 1H3EA 4I55B 3K6KA 5E3IA 1U7XA 5DI3A 2EP7A 2HRQA 4RTPA 1G2IA 4CKCB 2QAGB 4C6SA 3G0CA 4E88A 1E2EA 2X5JO 2OHGA 2Z5FA 1L5LA 1XAIA 4IVNA 6AT1A 5FTKA 4OATA 1G21A 3RIHA 1AGYA 3VNQA 3FKJA 5K0TA 1G3IA 2OHIA 2ODTX 5J2TF 3NVMB 1TB4A 4MWDA 2VS1A 4N7RA 4CBVA 3AM1A 1EJ6A 1T8SA 4YRKA 2EARA 4MW9A 5K8IA 1G63A 1B0UA 4D4KA 3WGLA 3AH8A 3WK9A 1YJCA 3DQPA 2IDMA 3QLJA 1W47A 2BZ1A 4OQEA 3T7TA 2KBEA 5IG2A 1ISPA 1JZSA 1C7FA 1SB8A 2ZOSA 3ETGA 3GB9A 4J2OA 4LX0A 4ZPXA 1OMOA 2AZDA 3Q7EA 4Q1EA 3EGDB 4ITRC 5GP1A 3VU9B 1F60A 3ZGVA 2NV6A 2HC9A 1D6SA 2P1RA 1GFWA 2HWYA 1EDZA 2OFWA 3VKWA 3WZ2A 1JT2A 1ZHHA 4I4CA 4P3YA 5B1IA 1ECJA 1OGIA 3QE9Y 2C5HA 4MKRA 4I19A 4IYJA 2IS2A 1YFZA 2GT1A 3JTMA 1LWOA 4RF3A 4D8YA 5C7OO 3OLYA 5EGNA 3OE1A 3RUPA 3U3RA 2YY5A 3G85A 5WRFA 2FMUA 5BN5A 1PV4A 2X6TA 3TBKA 3RC9A 4NR0A 5C5IA 3IQGX 3Q87B 3RJ5A 3VR0A 2DPYA 4L8GA 4OSOA 1D9XA 2BV3A 2CL7X 3IPCA 3ZLUA 1GGKA 1V3TA 1T8YA 4L9RA 4RKRA 3F3YA 4WV3A 4MDHA 5HEKA 4D41A 2DTXA 2WF5A 5F12A 5C8YB 3H4TA 2IX9A 5A05A 2J3HA 4CIYA 3A4VA 1IVYA 1LBSA 1ND5A 1R5OA 2J32A 3EF3A 3ORQA 5DEOA 3R3HA 1J1ZA 3ZV3A 3KAQA 1YNOA 4QC2A 1EFCA 1SY7A 2D7JA 1XP8A 1S2MA 4GZ5A 2Q6KA 1T3SA 3ROQA 2CFTA 3KUDA 3MGGA 1A50B 1UBTS 1NQXA 3AVQA 1GTVA 3N3AC 3TLKA 1R74A 1D1PA 1TZJA 4XGQA 4BQPA 2B1RA 2ZT8A 4FQ8A 1JFTA 5AJVB 2IGBA 1SQ0A 1SZCA 3PF9A 2PKRA 1NLZA 3MCTA 4MKIA 4Q02A 3KZCA 4QPDA 4P4LA 2BGIA 2UZIR 5EE0A 4EQZA 1HDYA 3A9VA 4L15A 3KFVA 5C5EA 4FXOA 1U7PA 4TXLA 2JG3A 3CF2A 2VAMA 2O48X 1PG5A 2P40A 3ELYA 1L3IA 2KHZA 3VH3A 4JLNA 1BX0A 4BBZA 1F2VA 4NZ9A 2X42A 4EJ6A 2CXUA 1ZUD1 2C9MA 4OUDB 4YC7A 4F5WA 5GIOE 5EJ7A 1WHSA 5I7OA 3HSSA 2XCOA 5KX5A 1DZ3A 1X86B 4BCBA 4UPVA 3CX7A 3KL4A 4F11A 2QI9C 4GX0A 1UFKA 1RZUA 3AL0C 3IHTA 3P1JA 4FC7A 4WZ6A 3TSOA 3T3DA 4PS0A 2H2DA 2VDWA 2ZULA 4QX6A 4E1VA 3GEEA 4ZFNA 3DOFA 2XUGA 1CP2A 1U28C 5B7PA 1UBJS 1PK7A 5BN5B 4HZIA 1DEXA 1G7CA 2ZB7A 4GKJB 2OC4A 3CHYA 5IHXA 5LMCA 3JATA 1T6YA 5FYQA 1BS9A 4OXXA 1WRBA 2G1KA 1HYQA 1FLAA 2GOYA 3EYAA 1WBJB 3PQ4A 3FKSD 4KPUA 3VKFA 5LLTA 2XRYA 2IW1A 1OLXB 3ANSA 3PSHA 4PPGA 4C0XA 1VCOA 4JFAA 3SJCA 1ZD1A 4GX1A 5E9QA 4MPRA 3KOOA 3Q0TA 2ZSUA 2XTMA 3BTVA 3WZMA 4EB3A 3UMFA 4TZ0A 2HBYA 1N9GA 3PHIA 4OHMA 4LEIA 3W2HA 4OP1A 1X7XA 2ZAOA 4AKGA 3ENNA 3H18A 1JT9A 4JBHA 3GFGA 4REQA 4DGSA 5K9ZA 4D45A 1GO2A 4EVIA 1XF9A 4FGZA 4PLFA 3QKSA 3TBFA 2O5CA 1YVRA 3RE1A 2J85A 3G2QA 1HZZC 2OSVA 1U2GA 3SE0A 2FR1A 3ZEAA 3IA2A 1UZAA 2X8LA 3SC2B 3CCBA 2YZ2A 2JFQA 3BXZA 4GBED 4WK6A 1QF6A 1LTKA 2OD7A 8MHTA 4JCCA 2CHQA 3B5JA 3EZ9A 3FMGA 1UBRS 3IUPA 1L7BA 1QQ6A 4M9RA 1L6RA 1DCTA 5DHRA 4M46A 1YDEA 3K5PA 5BSFA 5P21A 1F2TB 2ORWA 3P9KA 1ORDA 1L4FA 3OKPA 1OFHA 2ZJ2A 3B5EA 5ALTA 3RREA 2ZBEA 1ABBA 5HNKA 3H3XA 3HN6A 3UK1A 1G0NA 1U0EA 2AMYA 3BMXA 3LKDA 3QEOA 4H15A 3CYFA 4HUJA 2RH5A 4TTQA 2EKLA 2KBFA 1ZRNA 3F9IA 1GG8A 3FMFA 3PDCA 3HCDA 2XT6A 4C21A 1E4EA 5LBIA 3HBLA 3A28A 5FQNA 3AUYA 4B5LA 4PZAA 1GDTA 3FMOB 1NOIA 1M76A 1OWNA 3KPUA 3JVIA 3X2EA 3CIOA 4WL0A 4EJMA 3S2EA 2Y92A 5F1KA 4BO0A 3CNOA 4R51A 3VR5D 3NBXX 2VJMB 3R41A 5JBQA 1ODCA 1I4TD 4J16C 1IOWA 5B12A 3K1AB 3W06A 1JHDA 3T3PB 5CG1A 1XAHA 1XE3A 2QMYA 5AM3A 1GQYA 3SJBA 1P6QA 5J40A 1LU9A 1D2CA 1FJXA 3FUCA 1KZYC 1XPJA 3BMQA 4P35A 1N8SA 5GJBA 3D6AA 4KACA 2Z8YA 1AQIA 2VAWA 3TLMA 5L3QB 1QQTA 1PWHA 4ZXPA 3KYDB 4KSCA 2BOVA 4QYIA 1W35A 5ADUS 4DDTA 1ISSA 1FCJA 2J3KA 2UAGA 3DDHA 3E8SA 4TVKA 2QQ0A 4FJ0A 3VVBA 2NVBA 3THYA 1ZK2A 3IDZA 1CT9A 2CCJA 2HLDD 3ITEA 5DXFA 3PDIB 3ENWA 4XSGA 2QEQA 4BOYA 1QZUA 4OG2A 1KF0A 2XUDA 4TKUB 1VZ3A 1QH8A 4NTZA 3R9XA 2O8BB 5CDHA 4U02A 2IDZA 1K8XB 1ZIDA 2OZKA 2AX3A 3KZKA 3KZMA 3P9QA 2IIVA 2HSEA 2WWIA 3AQIA 4HSEA 5BRAA 3HDQA 2NXJA 1I3LA 1UC4B 2HHHB 4BB5A 2VNSA 2HI0A 2XNDA 4ZAWA 1KQ3A 1L4BA 2BF4A 1XKQA 1QRDA 2W2XA 2HTEA 1XELA 3GROA 4ND1A 4M1TA 3RTDA 4BEBA 1O58A 2VDLB 3D2LA 1Q0RA 1E3TA 3LUGA 2XUKA 3JQAD 3OSUA 4QLBA 3BSYA 3UQYS 3X2FA 4PGMA 5HXAA 5C53B 4PNZA 4ZKDA 1WA5A 1RQ7A 4PVCA 1H93A 3SJUA 2HIMA 3BJZA 2I2FA 4HRYA 3INNA 1Y8CA 4U1RA 3JZDA 3RC2A 2YCLA 5I6DA 1ZUIA 4Q66C 5HQTA 3H0EA 1MGOA 3LC7O 1IBRA 3PGKA 4E6PA 2FEMA 3P45A 5HMMA 4PQRA 4JL8A 4NJEA 1UL1X 4HYEA 3OPYB 1QB8A 2FOIA 1JLSA 3NBAA 1KERA 2CXTA 1WIWA 4M0UA 3N86A 5ESXA 1RACA 1ZD8A 1FW6A 4JJKA 3CRQA 2FWJA 2HMAA 3B12A 3FFAA 5DLPA 3R2JA 3WK8A 4IBOA 5KTKA 2P0AA 4C4XA 4JJ6A 4HB0A 4TSKA 5D1NA 3WS7A 5JQGB 2OBLA 1RYZA 1ZI8A 4KC0A 2AV6A 3ONVA 2FF5A 4LOKA 3CUUA 1K3TA 2O52A 5CYOA 3TAUA 3UWSA 3ZJUA 1IHDA 3C48A 2VPIA 5I4CA 5JSKA 3FWHA 5BVHA 1EZZA 1U0LA 1LPSA 1RWKA 2IPMA 3KJHA 3ND5A 5CA0F 3SQMA 4CYMA 3B3AA 1X3SA 5JASA 1P33A 2NNLD 3N2LA 3NYIA 2CDRA 4F7WA 1K4MA 1A4XA 2CXNA 4HATA 1U8AA 3WAKA 4OBWA 3OJ0A 2ZQYA 1OC4A 4LWQA 3LO5A 5EN4A 5TEVA 1CEXA 2DHCA 2VT3A 1V1JA 2G83A 2ZRBA 4PLWA 1GDDA 5ICGA 1U6JA 3R0VA 2GZ1A 1R4ZA 4R3WA 5TQ2B 5E3HA 1K5PA 3V1LA 3TLXA 2VEOA 5LA6A 1I3MA 3RQIA 2XADA 1CUIA 3R44A 4V39A 5CAEB 4L5AA 4OVKA 3VKHA 1ZJWA 5DCWA 3F7MA 3GNTA 4EHBA 1EB9A 3BHNA 4UFOA 3SEQA 3Q8LA 1XN1A 2C00A 2A84A 1PNRA 1G4HA 3L6BA 1UPUA 4XLLA 1L4LA 2ZUFA 4B7AA 2X0JA 3GRPA 2D62A 4LY0A 3W6NA 4JXXA 3T3OA 2IV7A 1N3IA 2DR3A 1I6LA 1KDTA 2ST1A 1BE1A 1B73A 1YD7A 3HVKA 2IODA 1AZLA 1GSOA 1C8KA 4GYYA 2ZK7A 1YDFA 2FYTA 5HIAA 3OQJA 2V7VA 2Q1TA 2A5JA 4BNYA 3MWEA 3LHIA 4WN9A 2JVIA 3A4YA 3B7WA 1OZAA 4FLEA 4V3CA 3OAAD 3AOEA 4CIXA 5FAKA 5K51A 3GIDA 1PFQA 4C5CA 3WFJA 3F4KA 1IAVA 3L4BA 3A6ZA 1M74A 4M9SA 3ETCA 4JMLA 3O8QA 4ZVMA 3HFRA 1MG0A 2W6JA 4PO8A 4ROSA 1D8TA 4UAUA 4AJPA 3GT7A 4FIDA 1TXGA 3GJRA 2HA0A 4IXMA 1Y4SA 2BCGY 3PUYA 4H31A 3RUCA 2BISA 1SIWA 1J8FA 3U44A 4ZDKA 1FE8A 2WB4A 5FF9A 4DV6B 1AK1A 4FX5A 3H5LA 5BN3B 3NBKA 1IY2A 5LNK1 4NK5A 1H3FA 3F71A 1SC3A 3VBEA 1Q7CA 4E7OA 3KS9A 1AX9A 1MJGM 5H16A 4F21A 1XNHA 3IMKA 4W5WA 1JG7A 3D8TA 5JECA 2CKDA 4MPJA 1E66A 3LT5A 2H1VA 3UJ7A 5CB4F 4TLLB 5ALXA 2AN5A 5JZOA 5C51B 3USES 2TRSB 3DUFB 5JYCA 5AKGA 1DDOA 1I36A 3NC1C 3MPOA 1B93A 4OOEA 2OB1A 3RK1A 1QCYA 1UBEA 2FQ1A 3PNLA 1IQUA 3UEOA 1F1JA 2JNWA 3H42B 4B3XA 2EDCA 3V3TA 5G1NA 2PEZA 1E9AA 3RFUA 3AJDA 2IYWA 3B1WA 5HZKA 2DWCA 3A25A 5CLHA 3VBCA 4IGIA 4JHLA 4CETA 3DDNA 5KTTA 2I91A 5J5VA 4I1PA 2Z56A 3SWWA 3V1MA 4E5UA 3RG2A 3OQBA 4EW3A 1N5KA 5I8WA 2E3JA 2QIOA 3A31A 8ATCA 4BFVA 1YC5A 3HZHA 5J58A 3IUMA 2EZ4A 4BO5A 3V7FA 2AR7A 2E37A 2ENWA 2JHCA 4DEYA 1ZD5A 3M1LA 1NJ1A 1W5FA 1C30B 3IEUA 4Q4CA 1EEXB 1JUDA 1GAJA 1ZAKA 4O0LA 4OY3A 3HKCB 1YNSA 1WUYA 4Y3UA 1JYSA 3FGZA 4QJ3A 4C05A 3TJRA 2AW3A 2IP4A 2R6DA 1COWA 2CMGA 5K0JA 1PEDA 3UFBA 4ND7A 3AP3A 3EMBA 4LHEA 4ZCMA 3VYWA 1RJFA 1QH8B 5IEBA 4O2BF 5BOSB 4DCGA 3FI0A 4RDIA 2RCNA 4NLLA 3VHXB 4A8HA 1KVSA 1Q14A 3UNXA 4Q12A 2J9FB 2IYYA 4DIFA 3WKCA 3GUHA 5FUWA 4Q4JB 4OK5A 4PYLA 4MQBA 1YFJA 4Q21A 2PRJA 3O4RA 4JBWA 1W581 4B6JA 5IC5A 4RTMA 4NXMB 1RU3A 4P4NA 2NYUA 2GCIA 3P0EA 1W9HA 2PMFA 4QXAA 5GIPE 4E21A 3L6RA 1YZYA 3GCGA 2RDMA 1LLFA 8ADHA 3WQHA 1UXIA 4DV0B 5IJZA 4JBLA 2LIVA 3RJZA 1XU9A 4Q5IA 3WGZA 3WYEA 4DEVA 1P74A 3N75A 3LYLA 1HBJA 4NCIA 2GXUA 1LPNA 2A1UA 1HE3A 1SD5A 1AUVA 2YZ7A 3GAZA 4TROA 2ZS7A 1PFVA 4AMZA 3NWEA 4QHSA 3EIFA 4FYYA 3RBZA 4C89A 2V6FA 1RMQA 1VPDA 3IEVA 4BGIA 3EOBI 1R4AA 2ZP1A 1IXKA 2OTCA 3EXIB 1CYEA 2MR6A 2C2YA 4OX9Y 2VK2A 4I9HA 5JRZA 2C5BA 1ETHA 2JAQA 3UV7A 3HJHA 2YVQA 4N76A 4YRFA 1WQ3A 3KEFA 3LOQA 2Z3WA 3CEJA 5CGQB 2ADOA 5E7MA 2IUFA 1J2TA 2DF8A 3QOXA 5EHZA 2CLLB 3U4MA 4QWWA 4MYUA 4M49A 4AJKA 4GM4A 2R6AA 3W8NA 4F5ZA 2DY1A 1X74A 2YMQA 5DOVA 5HUJA 5IN5A 3ZE0B 4AROA 2JFPA 1WD5A 5JY1A 4RK1A 4MV0A 1BHO1 4RJJA 4AUNA 4EJ0A 4L3WA 4L7VA 4DVJA 1XZMA 3KBBA 4N49A 4GXRA 5I9IA 5DASA 4M38A 2A57A 2H85A 1PFKA 4KFUA 3X1XA 5FPKA 3OA0A 3AZQA 5IAEA 3RUDA 1JKMA 1NQUA 3P4XA 4LF4B 5CXSA 2RHJA 1PZNA 4LE0A 5JCPA 1C41A 2CDBA 1JEQA 3L7IA 5B57C 2Q49A 2IZ5A 5C7IO 1XAJA 3I05A 2ZUTA 3VOAA 2EFYA 4RK7A 3FNBA 2G17A 4H7DA 5A5VA 3TUJC 5D3QA 4FWTA 1NF2A 2GJSA 4G25A 5E2AA 3AR9A 3HBAA 4PNHA 3ZI0A 1U2DA 4NMLA 1JFSA 4WOKA 2GSWA 3V2GA 1WDTA 4DSNA 5ELLA 2XUFA 4HVAA 4CLOA 1QS0A 4KZKA 4NNPA 1XQ1A 1SH7A 1NVEA 2AQHA 4LE2A 1N1MA 4OIFA 4R5HA 2QR2A 4KE8A 2YIVX 1E3SA 1GCOA 3YASA 4Z7OB 3CA8A 5FT9A 1R5JA 4XVCA 1KDYA 3TD9A 2VHYA 2OE2A 2Z1DA 2JGJA 4LWPA 1J6UA 4MB6A 4YRTA 2PUFA 5A5GA 1UT6A 3CX3A 4FOPA 4PG4A 5BRJA 2IHJA 4AW9A 3WICA 5DYNA 3GLVA 4JIMA 2FPWA 4INZA 3K53A 1AKMA 1KU6A 4F84A 4NJOA 5CU7A 3TWOA 1BN7A 3V7WA 4Z3KA 3STXA 3P96A 4G56A 2GK6A 2XMCA 4PZLA 1UJBA 3SJ7A 3GX1A 5KU7A 4I5IA 3H8WA 2HDHA 3D02A 1KQNA 3B1YA 2QJTA 2ZUBA 2OFFA 3UAOA 2PGOA 4Q3KA 3SXUB 4CRWB 3WWEA 2H1LA 1YZVA 2ZJ0A 2UZAA 4IXNA 4OQPA 3ZIUA 4B34A 5EZ6B 2DFNA 2JJYA 3BT7A 2AG6A 2WKRA 2F2TA 4W1PA 4HDRB 5MFPA 2FMKA 3O4GA 1EESA 4QDOA 1KDVA 2QUJA 2QJWA 1Y5LA 3PCXA 1YBVA 3PE6A 2YXBA 1OXBB 3BQMB 1YOVB 3C1OA 3EQ7A 1ZL0A 4XYMA 4DPLA 3U5ZB 4DMRA 1T1SA 3MG9A 5BWBA 5F7XA 4S1WA 4H18A 5EWJB 2DWQA 3DE2X 3NHUA 1C3OA 1W46A 2VOEA 2ZZMA 4ZIRB 3ELBA 1KYIA 2FEWB 4YXFA 1UKVY 2R5FA 3KLNA 2FEKA 4TRNA 3OFSA 1Z33A 1QSGA 4TQUS 3REFA 4BB9A 2LTAA 4H9GA 3U3KA 4MQEA 4C4OA 3ICEA 2CBZA 5F51A 3O0TA 1WVIA 3WVNA 5JANA 1XZAA 4YCNA 1PUXA 2ZJFA 1AU9A 1YBMA 3VSEA 1YIAA 1YI1A 1KGDA 1PR9A 3ZWKA 2Z5VA 4F97A 4HVCA 2B30A 3KDAA 1SC4A 3U7RA 4XOIA 1EVYA 5CK5A 1LK5A 2FMTA 4EBFA 2OQVA 5KUTA 4ZZ1A 5A4FS 1OI7A 2H4YA 5FORA 4ZMRA 1MC4A 2IYPA 2QVLA 5G40A 4UTOA 1L4GA 4HAWA 4CEHB 2G0TA 3C16C 1KFJB 4Q1VA 1BH2A 1D4FA 1XCGB 4BEVA 2X76A 1MR3F 2ZE6A 1QXSA 3WLKX 2CUTA 2OXRA 3ELUA 1KTIA 2GRAA 2IDJA 4PRLA 2Q50A 1P2DA 4PX3A 1P5RA 2W8BB 4DS3A 1W25A 3CVXA 1CYDA 3C3EA 5JVDB 1EB8A 1Q3TA 1QRSA 1KQOA 4BASA 1WQ4A 1JIKA 2DXIA 4AWAA 2CJWB 3UC5A 1R66A 1WW2A 3KAPA 3QKIA 2FSPA 4KQFA 1FZTA 2CHFA 3HYSA 3HPQA 3FR8A 1ISRA 4KJZA 5F5NA 5AOVA 5TPZD 1JVBA 2P2DA 4OAQA 3TXYA 3WMRA 5AW6A 5FEUA 3WE7A 2TMGA 3BL8A 4DQLA 4Y18A 4FN5A 1G38A 3D31A 2RHBA 3HNOA 3THWA 3T7DA 4U2FA 3VMFA 4P92A 4WESB 1MO4A 1YTLA 3NUQA 4AZSA 2Y2UA 2GXQA 1ZM3A 3D2AA 2QW1A 3I9OA 4MVXA 4HD8A 3PEVA 2XCLA 1T43A 1ZI9A 3NTXA 2GXAA 3CRW1 3OUUA 4UTXA 1C1DA 2AC2A 4EMSA 3GG2A 5B6JA 1Q7BA 3SVTA 3K16A 2WDZA 2Y99A 3OO0A 1QRTA 1TQ4A 2F48A 4RD2A 2IH5A 1IHXA 1KVTA 3FMVA 5JUWA 2PVPA 1YUBA 2X41A 3GEGA 3PRHA 4X61A 3SHWA 1RWQA 4NBVA 1FYWA 4MYRA 3VR6H 3IAEA 3P26A 3L8ZA 1WKVA 4FQ7A 5TGDA 4ZVSA 1TT5B 4BVEA 3TNLA 3R5XA 4EIWA 3PEWA 3FAZA 1G4UR 3IIMA 3MWGA 4UUMA 3X2SA 3SSNA 4AG3A 1FFYA 1UXHA 1Z0UA 3MT9A 1CUFA 2VHEA 3TR0A 4R9RA 5SYMA 1GL3A 4PZZA 5EQJB 1OWPA 2BGKA 1MZVA 1WV0A 3WB1A 2CXPA 3EBPA 4J0KA 4H17A 1K5GA 2V7QA 2WIAA 5TPWA 4IRMA 1SPBS 3KR0A 1QLHA 3JVEA 2DG2A 3VU1A 3GZJA 3U4QA 1R0ZA 4XCQA 1UQUA 4G0MA 4EAAA 2QDXA 1TQHA 4IMRA 3BERA 1FA9A 3MC1A 3L4KA 4TMVA 2BMVA 3GAFA 1HEUA 4TTSA 2ZATA 1LBQA 2YRFA 3V48A 821PA 1A8SA 4JBNA 4NZYA 5KTSA 3EDOA 2QXTA 3ZDDA 3EIUA 1UIRA 2GD2A 2JGEA 1PGJA 4D80A 3PQ2A 3FWNA 4I8DA 1Q92A 4ZIRA 1L8XA 3IUSA 2QNBA 4AJOA 2XOKA 4F6LA 1SB9A 1JJAA 1XV5A 4ZYWA 2NTNA 2DHQA 4N40A 5C8XA 4N3BA 4HR7A 2KLHA 2ZRAA 4J3FA 4BCCA 2GLXA 4AJJA 1FDSA 2GZ2A 4CZ2A 1KC3A 5DI9A 2GBGA 3G2OA 1ZA2A 1NASA 3CUYA 1XZJA 1ZITA 5KOIA 2AH5A 4UJ3A 1EBFA 3SC2A 2JFGA 3NBZC 5EESA 4D79A 2IU0A 3T4XA 5DGIA 2QM0A 4INOA 1C9KA 1VIYA 1K3FA 1W30A 2ASEA 2INGX 5AMXA 4OH1A 4JL6A 3IDFA 4HS9A 2B6NA 1I3NA 1JZQA 1VCMA 1WMFA 2BEJA 3BE4A 3IUQA 3LF1A 3NDRA 1ZSNA 3OQVA 2PX0A 4BNIA 1BQEA 4F0JA 3WGUA 2P9GA 4ZI3A 4JOBA 1EFHA 1G5PA 3HHEA 3MJTA 4HI0E 4Q7MB 1Z2NX 4WZZA 4RELA 5J1TB 3BEOA 2VTBB 1JLLB 1NLFA 3GJ4A 5LP6A 1L4NA 5JI2E 1T9ZA 1YL7A 3KR2A 2I6XA 1ULUA 4YDHB 2DPLA 2Y9PB 5TR9A 3ZY4A 3NWBA 4JJAA 3BXFA 4RMJA 3SSMA 1BDHA 3FGOA 4FT4A 4N3GA 4MDFA 4ZOBA 4Q1FA 2GPYA 1GGVA 2P4SA 3X1JA 2FR0A 5ALFA 1RBQA 3G7SA 3QFFA 4TMWA 2EKQA 3STWA 1YRLA 1GQOA 1U5AA 2VH1A 3ZU2A 4W82A 2F17A 3JQBC 2VP4A 4TV8A 4DR6B 5CVCA 1GUAA 1YE3A 2IXTA 4AP6A 3ZY6A 1JHPA 2XUQA 1GSIA 1B8PA 2QRGA 1AUOA 2FP4B 4MWCA 4PRYA 2EP5A 4M8SA 3NAZA 3W79A 3UUGA 2D8MA 2ZBPA 3DHYA 2IYAA 3HCBA 4UUQA 1H4QA 1GV0A 1HDXA 2MMGA 5IT5A 4B80A 2G1AA 4K6MA 3F49S 3QW4B 2P3OA 4U3JA 3AJ8A 3HDGA 4S2UA 2AXQA 2O0KA 1KMHA 2R6HA 4BFTA 4CLOB 2CLFB 3H2JA 3SKVA 2IXGA 3WYBA 3GH1A 3NC0C 3HXLA 1OQAA 1I0IA 4RVHA 1N5DA 2XKAA 3Q0EA 4GKBA 1QCZA 2CVFA 2JIDA 3AXTA 2Z2ZA 5H3CA 4B84A 3AKCA 2PR2A 1KYTA 3DKIA 2J7PD 3AF4A 3FSEA 1JFVA 3DAYA 1EK0A 3PX2A 4HWTA 1W34A 1W0KA 1K7EB 4ZHQF 5CA1B 4RY8A 3SEFA 4ASUA 2UXBB 5ALSA 3NMUF 2H4FA 5C0OE 1X80A 4D4LA 1XCMA 5AUQA 1RMTA 4PQEA 4KR2A 2CN1A 4EFMA 1OCEA 3K0CA 3LG2A 1TAGA 4HP8A 2GUWA 4HS4A 4HYTA 1X39A 5JWRA 4HUQA 4LQCA 2OC9A 3HJUA 4W5NA 1JR3E 1V35A 1HDGO 1PL6A 4MR7A 4H4CA 5ULLA 3MLAA 4TLEA 1JS1X 1OSNA 3ZVRA 2J5RA 3HKCA 3FYUC 1UFOA 2QDKA 3JAKB 3AOGA 2IIBA 3A1FA 1Q3HA 1O6ZA 3BX1A 3K1YA 1PP4A 3OEEA 4M53A 4UBKA 5EE1A 2QT0A 4FMPA 4B43A 4FKBA 3P5SA 2C4NA 1KDRA 1YAHA 1ZWLA 2BFFB 1X1CA 2R1VB 3B13B 2IE0A 3A27A 3WLRA 1PJ8A 1Y8RB 2G04A 1KO4A 4WECA 5BYAA 4IO1A 3EPLA 1H5NA 4DCVA 4L3OA 4M21A 1RRMA 2BKAA 2OB2A 4FUTA 4TKMA 1DINA 4LBWA 4ENPA 3C74A 3E2IA 5AI8A 2BIFA 1M1UA 3LC0A 5IWCA 1J07A 4FFNA 3LH5A 4ZAYA 1AA6A 3IXMA 1RYNA 5F5LA 4C6RA 1Z38A 3HVHA 1VKNA 4LSMA 3ZQ4A 1V2HE 2O14A 3DD5A 2BLNA 3GMSA 4QAJA 5TB5A 5I45A 2XOEA 1WCIA 4DMFA 2JCYA 3D8UA 1P1JA 1AN9A 5FUQA 1J97A 3O3NB 4LYHA 1TEXA 4RFSA 1Q21A 5TMDA 4CJXA 1FP2A 4U7DA 2WTBA 2DHDA 1XL0A 1J33A 4KFRA 4RMGA 4Z2YA 1IUOA 1UFVA 4ZAFA 1CEEA 3H4MA 4EGJA 2AQ8A 1A27A 3G9UA 1RPAA 5C8DA 4LYDA 3WQRA 3R23A 4R0VA 3ZHTA 4IO0A 4TZKA 5HUQA 2H0QA 2F1JA 3ZJ5A 3FETA 4CXMA 4EYGA 3KXPA 5TARA 2H59A 3FPJA 3JQ7B 5BSGA 3DP7A 3ZKWA 1POWA 3GK3A 2FETA 4QOIA 2O2DA 4HQOA 5A0VA 3I58A 4MW6A 5IK2A 5LIPA 4KVGA 4MPPA 2ZITA 5HJ7A 4Z53A 1P7WA 3KTFA 1JIJA 4FNGA 3CB2A 2I6FA 2CFCA 4K0KB 4MUAA 1S3FA 3ZX4A 2W6ID 4EFNA 1YS6A 1Z3IX 4YJHA 4PW0A 1B1CA 2PUWA 2WFLA 2XVYA 3OQIA 5ALWA 4KO4S 4L50A 2DLNA 2P77A 4NZZA 2QORA 2HADA 3A3KA 3E8XA 4PWZA 3ZZ1A 3S40A 4F3YA 4MR7B 1M1XB 3UWDA 5J4KA 1CDEA 1P72A 1UM8A 1QHXA 2AWOA 5D00A 3FPFA 4A91A 4N5MA 5KHLB 1X8XA 1VRCA 1KOGA 721PA 1NVGA 2BRUC 5DYWA 4DYVA 4DCTA 2DT5A 4ZYLA 4B74A 5JAZA 1TUBB 3K1JA 2D00A 1XEXA 4M7WA 1GWNA 2QXUA 3M49A 2BZSA 4G86A 3DMHA 2H5LA 1Y8RA 5L7YA 3ESRA 2QBYB 1I1QB 3MM4A 4PICA 1J5PA 1DJNA 3PWZA 2HGSA 3MTGA 1BW9B 2HU5A 2ZRKA 1XZCA 3QV1A 2ZPUA 4H7PA 5AUNB 4RY0A 1NJ2A 5L3QA 4OHRA 2O54A 3VKUA 1E8MA 1W4BA 5HM6A 2WZQA 2ZT5A 3OA2A 1CJTC 4DARA 3DDCA 3JYNA 4CV1A 1OPXA 4OXRA 2FSVA 3JD0A 4QOEA 1W7AA 3D3EA 1A77A 3CINA 3NLLA 1XZQA 2O0MA 3S29A 1NR7A 1KQFA 1ONOA 3S8YA 4JLBA 3ST7A 4KYUA 3OBIA 2GS9A 3VTFA 1YE8A 4AMVA 2HNBA 1QB7A 3IXLA 1VTKA 2E1PA 5CVDA 1NTOA 2QV0A 2YFYA 4AJLA 2WM2A 5CB0A 2DZDA 5J47A 1KKMA 4TQ9A 2JHFA 3IEMA 5FHQA 1EKXA 3NHWA 4M9UA 4CCYA 4EAQA 3QQPA 3WY9A 4AK9A 2ZJAA 3GJYA 3IVMA 3ZE2B 5HP4A 5FADA 3KQOA 2PZAA 3WL6A 4V0LA 4QUHA 1YQQA 5EWLB 1IQPA 1YR8A 5HDBB 1Y7PA 5A6SA 2C58A 5ALMA 4K05A 3Q7SA 3SYKA 1RYDA 3ETHA 3O2SB 4ZEVA 4M7PA 3RFFA 3HC7A 5A4DA 3QUTA 2GEUA 1XDUA 2JIRA 4RETA 5IJXA 5EEGA 3JYPA 3KSMA 1TUEA 3A10A 1Y5NA 1ZH8A 1HOXA 1PFWA 1Q0SA 1P2GA 4CMCA 3I9NA 4EZEA 2X7JA 4ACAA 2I66A 4BO2A 3AK4A 4OJYA 4AKEA 1X7GA 2Z0MA 3LL7A 3NHKA 2A1TR 2UVQA 3EG9B 3L4JA 1DVRA 4EW1A 4R2XA 4X8LA 3U60B 1A2QA 1LA2A 4K2AA 2GGSA 4OHUA 4L8FA 4MKZA 2CNWA 4X8OA 2F7SA 4RKQA 3X1MA 4DM3A 4BZPA 4XVUA 4Z49A 3PEYA 1QQ7A 3S28A 1SCBA 4WBNA 5U9CA 1T8TA 3QYAA 5A9SA 3EVDA 5M3BA 4ZCIA 1TK9A 2AHRA 4TTIA 2G09A 4DTCA 3N59A 2JKVA 4P2BA 2PQ2A 3JPWA 1GNVA 2BPOA 1E5TA 3AKYA 3GJTA 4BJ1A 1ZJ4A 1U8XX 4MMXB 4AYWA 3EIQA 4FMCB 4AP9A 4XRRA 2GAOA 3HS3A 5FFNA 1WXFA 3SC4A 1T6ZA 4U6QA 5ALUA 3I04A 2GCOA 3EUFA 4HDQB 4HQ6A 3AHIA 2WD7B 3QM1A 3JTEA 4QYTA 3PPVA 3R6GA 2BFBB 4J03A 2QTBA 3H2YA 1NVMB 2JJMA 2V7QD 4Z86A 1R64A 1U63A 3GR6A 3T4PA 3KB1A 1QHFA 2YZKA 1CY0A 4S3MA 2VF4X 4MEAA 1TEHA 1BROA 4V0ME 4YCDA 5ERYA 4I4NA 4D9EA 1NIPA 4N0EA 1U8YA 3AFNA 4KSBA 3KQPA 4ZOCA 3E48A 4H6XA 5ELMA 4EDFA 1I4WA 2CHUA 1G4AE 3Q7QA 4ITUA 4D81A 5KREA 2VP6A 4AJHA 4MR8A 1M2WA 1KK0A 3GFOA 3UICA 1BCSB 1E6UA 3PQDA 3RSFA 3KE8A 2XGJA 5IT0A 3GFPA 3FNRA 1MOQA 4I14A 2BDUA 3M4ZA 4MH0R 4UHKA 1GFZA 1AVTA 5CA0B 4EGFA 4MJ7A 3OZTA 3KYIB 2CK3D 3QTBA 5K8TA 5KYNA 1JAIA 3U7HB 2GWRA 3DVQX 2D7DA 2NO9A 4XGKA 4DSUA 1C1DB 1XZGA 3HP1A 1ESCA 4DG5A 3SGLA 1Y42X 4F2HA 3AGQA 3VPSA 5E8JA 2WPNA 4HFJA 4Z5XA 5LQAA 3SIPA 4X1OA 4DC1A 3CS3A 4XFDA 4XWGA 2QTZA 4ANFA 3GRFA 3LXXA 3N2NA 4OK3A 4P33A 1FLNA 4RJIA 1Y0BA 5BQ5A 3REQB 3D7RA 2AOUB 4PPNA 7ABPA 1IIBA 2HA6A 3C3DA 2H3HA 5AHXA 3PFCA 3HWSA 2KS6A 3LU1A 3RVQA 1WSWA 1JPUA 3MQ4A 4OCZA 4A0FA 1FXSA 2Q5LA 1SBCA 1S8OA 1Z83A 3GXOA 2XTJA 2GNOA 1BAPA 1AS2A 1HWYA 2WF7A 4G1CA 1X7YB 1WDKA 2GEBA 2GYUA 3NTLA 4K6CA 4LKOA 3V32A 1IHYA 1AKTA 3NHMA 4KL8S 3AUFA 4HDCA 1BCRB 3EARA 1F0YA 4CQMB 2WWFA 2HJHA 1Y1LA 5KB3A 2OLJA 3KQHA 3NASA 4DA9A 2PRYA 1Q1NA 3Q7RA 1TAHA 2Q3EA 2FZKA 2UZ3A 3G2LA 4C4RA 4QSHA 4AZWA 3JVVA 1L7RA 1A5AB 1QLWA 1ZXLA 1CF9A 3HEAA 5TIIA 1ZNXA 3CLTD 5D01A 5LD2C 3L06A 5FI3A 3O38A 3PD0A 3OZGA 3VI3B 4GPEA 1N2CE 5ALVA 1C7JA 3OUZA 1NDUA 2JJ2D 1NE7A 3ZHZA 4D9NA 4H1HA 5KYWA 5F7JA 5EUQB 1YJ5A 3TLZA 4BFCA 3T3EA 2HLHA 2I3BA 2I7XA 3LQ2A 4Y2VA 2IUYA 4ZOQI 1ZRSA 5E2IA 1G17A 2XDYA 1XU4A 2QMEA 3DZIA 3E9EA 3GJ8A 5U4QA 4DUPA 4O59O 3TRFA 3F6YA 1BX1A 3KOXA 4DZZA 1PWXA 1NLUA 1YJQA 1GAXA 2ZUUA 3A05A 3JQAB 1MKYA 2B4YA 4LZZA 1I7DA 4HNQA 4BNLA 3MELA 4WLFA 5K0ZA 5KQGA 2IEAA 4Y2XA 4AI6A 2H7XA 2HQBA 4K88A 4TX1A 2NO5A 4NY1A 1NRXA 1RZVA 2CZCA 1T3GA 3GRUA 5KDLA 4G5FA 3AHCA 1C3OB 2ZU6A 1ZBQA 5KTNA 3W05A 2R6CA 4HTFB 5JDIA 3PC8A 2FU5C 2LWIA 2Q4EA 4URZR 5F2OA 4JOQA 1A88A 3L0IB 3HJRA 4RLSA 3FJOA 4AS2A 3OJEA 3FOEC 4N3AA 4FC6A 1MFZA 3B5IA 4TV8F 2FZGA 1B41A 3D3WA 2YKGA 4DR1B 3IPAA 4J1QA 4L57A 3ZHUA 1YCFA 3EZGA 4DQUA 4XYEA 1NL3A 4JT8A 2OV3A 2BR4A 5CLQA 4ZI2A 2Q3DA 4NU6A 4WFKA 5EL0A 3OQ6A 5EJ8A 2NZYA 3V8NA 4BNNA 2JJ1D 2HMUA 3BF8A 3DT9A 4B83A 3JQ6A 4DCMA 5EIBC 1XEWY 3UVEA 5MN4A 3L4SO 2Z8ZA 3Q11A 2VP2A 1QLJA 4BKMA 1GNTA 2G9RA 2DFKB 4DV2B 1ODJA 1QIDA 1H0RA 4JKIA 3UJAA 3EHEA 4KR3A 1VIMA 1DC8A 4RZIA 1HE2A 5BOVA 4PC7A 1YOVA 2JK0A 1DI0A 4DLZA 1R2QA 1NMEA 3IOEA 1GPWB 3BB3A 2PCJA 3PDJA 4YPFA 4D9GA 3LCUA 1DP4A 1FP7A 5A62A 3QYPA 3Q6IA 4JI8B 4Y6OA 3VR3A 4RVGA 3AM3A 3WV4A 1KAEA 1MH9A 4JI0B 4LHZA 4LHSA 4KAFA 2F55A 5JROA 3W9YA 5ITSA 2NXWA 3WGNA 3THWB 1DC5A 5SYAA 3VU9A 2HJVA 4JQZA 2BBTA 3HCPA 2PBRA 4OAPA 1T2VA 4BX8A 1TJNA 1MW8X 1ZLXA 3O6VA 4UBNA 5FPYA 3BAZA 5F2NA 1E79D 1WUIS 4RH1A 5DHFA 5DEIA 3RFVA 1E3EA 2VYQA 3LX8A 4A0QA 2WNHA 4MMZB 3WIVA 2FKAA 3L77A 1DOZA 2WAMA 2PYDA 3L79A 5EA2A 2XAAA 4ZANA 4N6OA 1BN6A 4BKUA 5LJLA 2VO1A 5HF8A 2V96A 2Y1EA 1QYDA 4ZOAA 4ALIA 4HGQA 5J43A 1B16A 2C82A 1U0NA 2CVQA 4F4FA 2VVTA 3QPAA 1E2BA 1O89A 2Z09A 7REQB 1IXRC 4ZRMA 3VO8A 2HWUA 2YHIB 3HA5A 4HNAB 3HCOA 1FFXB 2MINA 5AJZA 1QBGA 2EYQA 4L5YA 4XR4A 4PO9A 4JQYA 5I4BA 3W5BA 4JU9A 2VHZA 2XXAA 2JAHA 1UBUS 1X9IA 5DBHX 4LY3A 1SVIA 2DT8A 3ULKA 5JLAA 1UZUA 1MIHA 4QDXA 2XF2A 2HO5A 3C15C 2OKGA 4HXFB 4Q05A 3ZY3A 1Q84A 1C3VA 4V0NA 3D3NA 4PXYA 5LYYA 3TCXB 2PZGA 4X94A 1ETUA 2BLLA 5FPPA 1UBSB 3QRWA 4UMDA 3EXHA 3LY8A 2JGMA 4L5CA 4NS1A 5JFOA 1F2UA 1RLMA 2ATVA 2RHRA 2XQFA 3HSYA 2FW7A 3P9SA 4RZ2A 4TXJA 4BLUA 3R5FA 4BQOA 1Z7BA 2BHTA 5CW1A 3ROZA 4CM9D 2WJHA 3GJ5A 1A8HA 3O75A 4RENA 1HL3A 5I47A 1EWVA 3VR1A 1T1EA 1K06A 3R6TA 1QYVA 2H1SA 2VDNB 3AF1A 2EKBA 1M6NA 1IB6A 2OO5A 4KFCA 1ZOSA 4JMPA 1VPEA 1DBVO 3KTAB 4DMGA 4C76A 1S4MA 2P2ZA 2EDAA 1WB5A 4CM7A 2QZ9A 3B7GA 3DZKA 1CUXA 4K9SA 4DA8A 1KMMA 2GSDA 1DTWB 1RQPA 2YJZA 1GPAA 2NUPA 4KRYA 5IZ4A 3LX6A 3DUWA 1EHYA 1MAUA 3CLSD 4IXTA 3ETEA 4ZVLA 1GGEA 4RJLA 3OQ1A 4TMTA 2OYCA 3HJBA 1TD1A 3O4VA 1UDWA 4GI3A 2RGDA 5IF3A 1A2BA 3IKMB 4XIIA 5IN4A 1RRKA 4JJ8A 1XXHA 1ATZA 1G5HA 4BZQA 2ZJZA 3EH1A 3SXPA 2C2ZA 3O4HA 5HIIA 6YASA 2Q5EA 3VTKA 1TA4A 3SXJA 2GN6A 2ONKA 4TYYA 3SFZA 4KN5A 7REQA 1Z8FA 1QCDA 2D1FA 2GASA 2X6QA 4Q48A 5IKOA 3KKEA 2HDNB 2WFZA 3DHVA 4PGGA 4DJAA 2GTIA 3NHYA 1GKUB 1QIEA 3IQXA 3AHHA 2O8DA 1HGXA 2O2ZA 2UDPA 1U7UA 3EPRA 4R8SA 4G89A 5TT0A 2FSGA 2NWQA 4RHEA 3SR4A 1CWUA 1W88B 4ENTA 1ZSVA 4FDTA 1U28A 5DOZA 2IRWA 2CL6X 3GJ0A 1EXNA 1EK1A 3R40A 4UMVA 4WKOA 3TRKA 5IKEA 5HTOA 2GN0A 4S1PA 3U3OA 3HZRA 4BNXA 1F20A 1GGNA 3O4IA 1XFAA 4I5EA 1Z4KA 3E3NA 4YGXB 4KE9A 4O2BA 2JAPA 5F4BA 4UNPA 5K0LA 4GYWA 1Y3AA 3UAVA 3WNQA 1W4RA 1MTZA 2OLKA 1W49A 3O94A 5GZ1A 1T4MA 5H02A 1L5KA 2PGDA 2VH2A 3EGEA 1NAHA 1Z5WA 4K9DA 1ZJ6A 3AB3A 3P32A 4GVLA 3JALB 2VHJA 4IM7A 3TIVA 2E49A 1A5SB 2FG6C 3AYZB 2ZE8A 3L84A 1IHOA 5IVHA 4EHIA 1U65A 2OHJA 3OOSA 4MUJA 1HQCA 2H52A 3GJ6A 1Q74A 4PPYA 5F3RA 4H3SA 1NMQA 3AIKA 3ZW8A 2FPGB 1P4HA 2GK4A 2Q3LA 2VPYA 3A6PC 4YAUA 1EWQA 3FYDA 3FLEA 3FI9A 4GI5A 5E7IA 1BYIA 2XUJA 3AG6A 3L8HA 4IG9A 2Q0SA 2WHXA 1KK2A 5I9TA 1F0KA 1IDOA 5FCDA 1Z5OA 3Q85A 5CVVA 2ZYHA 3QXJA 2BKLA 1Z73A 3O3OB 1Z6AA 3DMPA 1M6HA 5CITA 4YHHB 1QU3A 5FA8A 2UUOA 4LCBA 3AR4A 3F8SA 3T3IA 2QN8A 1G5TA 1ZXXA 1L7MA 1ECGA 3BDVA 3CF0A 4TTPA 1I10A 2Y0DA 3KOYA 4D0LB 4Q19A 3THXB 1XWWA 1VJTA 2QJFA 2I71A 3CLRD 4Q34A 5CA0A 1II0A 1IATA 5ALQA 3ZHVA 2A92A 3QU2A 5EOVA 3E0QA 3WIEA 4ZZ3A 4DBLE 4FGJA 2O19A 4LA4A 3C85A 4Q4LA 4EARA 4MK4A 5AM4A 4CL3A 2Y68A 1U2GC 5G1PA 4EG6A 8GPBA 3FLAA 2A0FA 4PNEA 4C07A 2K6GA 1M2EA 1PDWA 3GAAA 1BHSA 1IK4A 4W5HA 3MHTA 1V5IA 2GVNA 2W6JD 4YQZA 5EQFA 4Z9YA 5IEJA 5AVUA 1OB2A 1JWLA 2AHOA 1J9EA 5HQ3B 1S1MA 2ACWA 1WXIA 1IRIA 2XA2A 3F0TA 2MHCA 3NM4A 1H0HA 1DBQA 5FTMA 2WV7A 5LMUB 5A3QA 2JFVA 1E3LA 4LW8A 3TB4A 3O03A 1JFFB 1P0IA 2XMDA 3AEKB 3V33A 4G0YA 4JI5B 1AIPA 3OE5A 1I30A 3ZIAD 4A4DA 4GH5A 5JOQA 5K8UA 2HMSA 3JYQA 2JIMA 2X4IA 5GONB 3D7MA 2GN8A 3EFBA 3SZRA 4EJSA 2R1VA 4YPVA 1F6WA 2OECA 4ODIA 4Q9JA 1ZGZA 2WT9A 1UDRA 3PR1A 3W9SA 3A6FA 4DJDC 1EX6A 3ZXXA 4IF6A 3KCNA 2WPDA 1KO8A 4PEVA 4NECA 5B5SA 2PV7A 2V8BA 4IDGA 5G4KB 1GL9B 1H2FA 2WP8J 2HQ1A 3ONNA 1RYFA 2IHTA 2BZGA 3FB1A 3FCEA 2HF8A 2G4CA 4EG8A 1BU5A 4KQHA 2I2CA 4F4JA 1SCUA 1BVYF 3PGMA 5IYZB 2OHHA 5FNVF 2EJTA 4QL3A 3KSUA 2CVHA 4BJ6A 4CEJB 3RS4A 4QUAA 3D3QA 3B9QA 3H2IA 3M9WA 5IWAB 2PSSA 5LLSA 4HMPA 3B48A 4P7FA 3DAOA 4R40A 2WSSA 4WLEA 1DJLA 3JZFA 2QTCA 1IM2A 3ZC3A 3E9RA 2XGSA 4UQLA 5EE5B 2IW3A 3CRVA 5CXUA 1IBLB 2QTRA 1VRVA 3GLGB 1SXGA 1E79A 1O08A 2O1SA 3OC0A 1P9RA 2PSDA 3TE6A 2EJCA 3I6ZA 3JYLA 1KSJA 4LN1A 1NXTA 1ZDMA 4FIZA 1ZEMA 3UUFA 4C4TA 3DTTA 3OP4A 2FKNA 1MGPA 2QE6A 2VCHA 3JWHA 3A1VA 2OFPA 3H1TA 1LS6A 1C7EA 5B3LA 5JQGA 1J24A 3LJKA 5ES4B 4OHFA 1E1CB 1TF5A 2ID7A 4F3CA 1UPFA 5FLKA 1TKCA 5TQ0B 2QE7D 1R9NA 1X42A 2JGDA 3ADKA 3S27A 1YB7A 3IOCA 2P9QA 4P3KA 1TMKA 3II6X 4IHJF 5DHUA 2FFHA 1CJKC 2JHPA 3WRWA 1K8ZB 3WRYC 4AXXA 4TV9B 1EA5A 1NU8A 2FP4A 3OCXA 3LWNA 1OILA 1CBUA 4XX0B 1U80A 2ATEA 4US0R 4YIHA 3Q1LA 1E2IA 4DHEA 5CAEA 2LW7A 3T5GA 2CHEA 3RVOA 5HZHA 4ID9A 2VI5A 3FLBA 13PKA 2BP7B 2HSZA 3LD9A 3WA7A 1YZQA 2OT3B 2XDQB 1BFKA 1T24A 2R2GA 5EWJA 3LYHA 4CMBA 2WVHA 1UFRA 5KEIA 3R76A 3GGCA 3UHJA 1KH1A 3U7EB 4A8JC 2OGTA 4KKXB 3BSFA 2E82A 4A6DA 2W9XA 3QEBZ 1QHNA 5FWYB 4PM4A 2VBCA 3HM2A 1XFDA 2IA5A 5B37A 2H5IA 5JADA 1E1DA 4K8OA 2VZ0A 2J0VA 1YOBA 3SG0A 2AG8A 4G81A 2VKQA 1CB7A 1X1QA 2B5VA 2XY4A 3DPIA 4P8RA 5EPOA 1VI5A 5LC1A 3RDPA 3FJYA 2VZEA 4HYYA 4YMUA 1VLQA 4Q37A 1MHPA 4MS3A 1H4TA 2QGFA 3RK0A 4E32A 3B51X 4IJUA 3CEHA 4IIVA 3O82A 2QUKA 2AF3C 4G1EB 1KR2A 3QPDA 5AJWA 5BMVA 1KDPA 3V4PB 4RZSA 4D9CA 1T2NA 3GVHA 1J4AA 3Q7TA 4JH0A 4X0EA 3H2BA 2D5AA 1JE1A 3MWYW 1YL6A 3VKVA 3CLVA 3L1UA 3KB6A 5B53A 4DWVA 1UPTA 1XXLA 1XC7A 1PLLA 2VUUA 4KAAA 3LM8A 2WM9B 3QPCA 5FAXA 5G0VA 2JAXA 3OETA 5FV4A 1DG3A 1P4SA 4E07A 1O94D 2VAPA 2I8CA 3TX6A 1B00A 5KS2A 1XJQA 4Z0HO 3WJ1A 3T5PA 1VC2A 1FS4A 2HTFA 1U0TA 2RGYA 3LW7A 3E7WA 4QEZA 2GESA 4L85A 4NCNA 3ZW9A 3FPHA 1QYCA 1C80A 3ZHSA 2FE4A 1JILA 1XX6A 5REQA 1DQNA 2IZZA 1MEEA 5E6UB 1ICEA 4CF5A 1ADJA 2BGGA 4XW2A 1MB2A 1TF7A 3RRBA 5EHXA 4BMOB 1SZPA 3L8GA 1YRQA 4CKYA 4BVLA 5FL7A 5MN5A 1EXWA 1UMBA 1RRFA 2XVXA 4XJSA 3TLJA 3U6KA 3G59A 1M8JA 3ZE7A 1NVDA 2B98A 1JIXA 3U13A 5HOQA 3M1YA 3K0KA 1Q17A 5F1YA 2V55B 1ZONA 2OFXA 2Y1CA 1PD1A 4ATNA 2CJPA 4V0KA 1KK3A 3JALA 3AEZA 2OOSA 4L76A 5TY0A 3FDFA 5B3JA 3TQIA 4ENRA 5IFKA 1UMKA 3QOWA 5LN1A 4L4UA 4JKOA 2I4LA 2JCXA 1QAQA 5FWAA 1GARA 1SN7A 1JMVA 3FTPA 4TTVA 1JAXA 1DKOA 2CMHA 3NUZA 4IVRA 1R8XA 3RTBA 1S2DA 5ECWA 1YUMA 3EC2A 3K0FA 4HHEA 3VMMA 4KFTA 4II7A 2EBUA 3ZQUA 5CX4A 4EI7A 1CR6A 2AJTA 2QX8A 2BMDA 2C8KA 3G8CA 3L0OA 4OJNA 1T0PA 5BSHA 4FDAA 2NYAA 1QOQB 2X7HA 4MARA 4UUPA 1IBMB 2I9KA 1QHIA 3HJGA 3VZBA 1V3UA 3SPXA 4P84A 4F4IA 5L6MB 3HM9A 3MJEA 2R8PA 2D5LA 2WWWA 3TO5A 1F5SA 2H8GA 2RH8A 3ZDFA 1Y9DA 2VHQA 4XSVA 4RSMA 5K0EA 2MMCA 4KLCA 4LDAA 4M60A 1QJ4A 4LZJA 3G9ZA 1AMUA 4K6GA 3IERA 3P2YA 1EH5A 2JPDA 2BCJQ 4LZPA 2QRHA 5ERGB 1B4DA 2M6LA 4B3IA 2YC4C 4UU7A 5CIYA 5K8JB 3I6MA 3R7AA 3SYLA 3N87A 1BOFA 3INYA 3E22A 1DAKA 1MT0A 1RAAA 2ZZKA 3I5AA 4QRDA 4YI3A 4A8TA 2QQGA 5U1PA 1EXMA 1JQLB 2QT9A 2Z4RA 2IS1A 1JYFA 1OU4A 3HB0A 1EUCB 2AJBA 4A2PA 2OR3A 5A06A 4AFNA 4DSTA 1PFUA 1DTWA 2WIFA 3KPVA 1YS9A 1V71A 3FGNA 4ISCA 1CNMA 4KFSA 5L51A 3DYIA 1KJQA 4B2IA 2GNPA 1OH8A 2IPNA 1WXXA 4C2UA 1IY1A 1UZMA 2HU2A 1X92A 3H5RA 4BJ5A 1N8NA 3QHQA 5C4IA 1SVSA 5CFLA 2NU8B 3WLOA 4WN9B 1LK7A 1UOOA 3NW9A 4RZHA 1CPYA 4RV9A 1E0JA 3WKDA 5B7NA 4OHKA 4M1WA 5DBIA 2QRPA 4B3TB 2L69A 3M6LA 5BXQC 2RAVA 4HQ0A 5IBCA 3M6MD 3CF6R 4Z0TA 5B2FA 4XLTA 1Z36A 3OPQA 3IO3A 3VTZA 1T34A 3AVPA 4NULA 1ES9A 3MZ0A 4YMWA 4LX8A 2X40A 1K0FA 4B6EA 4B2LA 3TFQA 1VMEA 2IELA 1MQ8B 3ZHYA 3IKLA 4MW1A 5C5DA 5JZ9A 2FWPA 2ZWAA 4H4DA 5JHGB 2CXSA 2QZ4A 3DEIA 4W5OA 1UPCA 5KWVA 4TWBA 3UBTA 4ZQIA 2O8EB 3WDSA 2XMBA 4Y7DA 2JEYA 2VRCD 4QJ5A 3B3FA 1G1MA 2QG4A 3MGAA 2R9VA 1GZ7A 4ON9A 4CIWA 1FFAA 3OLVA 4BKOA 3ER6A 2RGNA 1GZ6A 4DYHA 5KSWB 1MOSA 1P7VA 3D43A 1DEKA 1FP1D 1PJAA 2VNJA 2X13A 2R1TB 2E4YA 4PSCA 3F3SA 1IZYA 3LWZA 3I3SR 2FQWA 3BKXA 2AOXA 3H8SA 3PFWO 4EJ2A 4JWTA 4MCHA 1B15A 4DREA 1QHSA 4LHWA 1RPTA 2AA3A 3JD2A 3NKFA 1TPYA 1U8CB 4G0WA 4HSGA 4MCJA 2WMYA 4JGGA 3VKGA 4HBZA 4K6KA 4V1CI 1INLA 3EAFA 3PJFA 1Z0AA 1ZJ5A 2R7LA 4J76A 1EBUA 1NHGA 1FXWA 1E2QA 1G3MA 1KY4A 1ZJJA 2XX3A 1UAGA 1I24A 3N2KB 3O8QB 4I8XA 4NMWA 3VDXA 4HH1A 1VE1A 3IUBA 1A82A 3BWYA 3ZV5A 4C0QC 3E7DA 4BRZA 2CE7A 2NAFA 4ZO7A 3E9NA 2P9BA 1XRNA 2I2DA 2O7RA 4QYWA 5AKLA 5AWFC 1QQBA 1XQYA 2GX6A 2W5UA 1GR0A 4YAJA 1DPGA 3V8BA 2DKFA 1WL8A 1Z3CA 4ZHQB 2B9EA 2OCLA 3DOEA 1L3CA 2CZGA 2FWRA 3B9RA 3QA3E 4HX9A 4M0EA 5CLGA 5DP2A 2ZUSA 4Q01A 5DTMA 4BP9A 3L41A 1RXVA 2A9QA 2H06A 3EIWA 4B7UA 3WJ2A 1CQZA 4I1SA 4CN8A 1RQRA 4M98A 2WV9A 4IIEA 1TVKA 3WLPA 4EVSA 2H17A 3DC7A 1J9ZA 1C7ZA 1VL2A 2YFQA 1Z88A 3ZDQA 4DCPA 3HKDA 3EWAA 1A0OA 3G8YA 4FYJA 4JA2A 4LDQA 3IUJA 4M54A 2J9GA 3UT6A 3FRJA 1HYEA 3ZWNA 2I22A 5IKMA 4M0PA 4BRSA 4OQQA 4D57A 1REQA 4A2CA 4D44A 3REOA 3T1NA 1LY1A 4WMLA 3UK2A 2PWAA 4DC0A 2W00A 2NTJA 4QQNA 4F6RA 4DV3B 5AICA 3GEIA 4RLHA 1BDJA 1X7DA 4JLDA 3PRYA 5IH3A 4MW4A 4RADA 2R1UA 5KYUA 5IMSA 1HLDA 4LFAB 3IT1A 3MUFA 3H2ZA 4RE6A 1FQOA 4QTZA 4L8WB 4YJ2F 2GEDA 1S9HA 2ODBA 1BJRE 2XWQA 3IMFA 5EP4A 3L1HA 5FTWA 2ABWA 3S2ZA 2P11A 4D96A 4F9EA 3RH0A 2GZHA 1WUJS 4BVHA 3PFKA 4K46A 2WBLC 3B6JA 3MWDA 4TM8A 4AN0A 1P5HA 2ZT6A 4FE7A 4L6IA 1WKBA 1ZGGA 3LHFA 4G65A 4EX6A 2C7QA 4NZMA 4QQRA 5DLYA 1T4CA 4DQ0A 3ADDA 3E2MA 4TYQA 1ZVKA 2FPLA 1MORA 2GAIA 2O2IA 2O23A 4R8RA 3JAWA 1QF9A 1YI8A 1G66A 5LUBA 1L5ZA 4CEHA 3UOAB 2Y8EA 3REGA 2PJUA 1L6IA 3UAWA 4BMSA 5B1SA 2WMNB 1P1IA 1A9SA 1U31A 3HO6A 2VBFA 3HWX1 3MLBA 3JARB 3ENQA 2BGNA 1Z4LA 4NBTA 1FW8A 4DLNA 3MERA 1LDGA 4ND4A 3H75A 3QWAA 5C4MA 4Y2GA 2CB9A 1XF1A 3DOCA 1T91A 3KEMA 1GAQA 4UHDA 3H9BA 4FHZA 3ZW7A 2ZUEA 5CVTA 2VLBA 1JEYB 4KDEA 4B6SA 4OJKA 2XAUA 3EN0A 4C22A 1Y6ZA 2W2OA 4KMSA 4AZ3A 3I0ZA 1A4RA 1OROA 2G9ZA 3GZ4A 3PNKA 2WMDA 4IJKA 2CF5A 1JBEA 2DSTA 4UOEA 1UMBB 3RIEA 3U4QB 2A4MA 2YASA 5KAMA 1J0CA 3AHJA 1U9IA 1S1CA 4F1WA 4F2WA 3QX3A 2UXDB 1YU6A 4PHHA 4DLUA 3HR7A 3IQFA 1H1TA 1LWNA 1O95C 2A1UB 3UA3A 4YCLA 5FUBA 3KKMA 4FTWA 1H4VB 1QDLB 1KZGB 4UAVA 3LSYA 3T7JA 3UJ8A 4BNGA 4A0RA 3LZDA 5JV5A 1K8RA 2DR0A 2PJDA 2PGXA 1C1XA 4N6GA 4XSHA 1YS4A 1J7KA 1TM5E 3FSJX 4EY7A 2I62A 1BMDA 4FFMA 2DQ4A 3EAQA 1G3UA 2RHMA 1YZKA 4I2NA 4YUVA 3T4EA 4C0JA 4CNQA 1KKUA 2AL7A 3DV9A 3EXEA 4ABYA 1PDOA 2J7KA 2V3VA 1BMQA 4MV7A 2FX2A 5FB3A 1N6KA 3PVZA 1D2HA 3ETNA 4MW0A 3FVVA 2GN4A 2AEEA 4JLJA 4R1TA 4LC9A 4YAIA 3TRIA 3IVCA 2P3QA 4GC9A 1SOUA 2C92A 2J6CA 3B70A 3KELA 1NA5A 1XKXA 2RB4A 1J09A 1IH8A 1KEWA 3IYLW 2IEDA 4DABA 1AS0A 3IBTA 3GUZA 4PV7A 1XT6A 1Y34E 1FTNA 1JG4A 4OKSA 3QPUA 3ZGLA 4F04A 4K03A 4V1CB 5ECGC 5IAJA 4C6HA 4G23A 2XKKA 3AHGA 3ID6C 1PBNA 5IVPA 4UNNA 4PZEA 5C8ZA 3QPWA 1JLMA 2LKDA 2R3SA 4DR2B 1J2RA 2Q4RA 5K3AA 5JXHA 1SULA 1Y7IA 5A9RA 3QUQA 4KI7A 3ENKA 1IN1A 2NTEA 4FDMA 3E27A 4HWGA 3VOBA 4LXGA 1GPJA 3NIFB 5HBRA 5FUYA 3RT1A 3BORA 1Y33E 1W5AA 2D1TA 4BYMA 1VSVA 3RYIB 1ZM7A 2GN1A 1Y63A 1Y80A 3BM5A 5B55A 4BN0A 2XYRA 3GI1A 4YQFA 5JCZA 3U61B 3RUHA 2Q8PA 2ZJOA 1R6VA 2HL6A 4FHEA 1JJVA 5A1TA 3CWCA 3S7ZA 2ZTMA 1HSZA 3ZCTA 5CH8A 2GM3A 3WLQA 2BT4A 2I1LA 1PUJA 2QIPA 3CRRA 3FWZA 2R44A 3IULA 1VJ1A 2CJYA 4PFKA 5DTRA 4W4TA 3EEBA 5KSPA 3K8OE 1QGED 3SP1A 3TZKA 2LIPA 2WF9A 2XWSA 3I37X 4BX9A 4UBLA 2QLNA 1BNCA 3HDVA 1EAYA 3IODA 3KUXA 4EGSA 1EWTA 3H5NA 3L46A 3R4VA 4CI0B 1T5DX 4KHZA 1NQVA 3VO9A 3M6WA 4LBZA 4GR4A 2I4MA 2WLTA 3PXBA 4CTKA 1Q57A 1V9SA 1QOPB 1Y3HA 1NZDA 1QIFA 2E4ZA 1JMYA 1FFEA 2ZTHA 3QWIA 4IDCA 1Y1SA 4MP8A 5I4IA 1AHNA 1S3SA 3RTCA 1Y8AA 1TIKA 1PNQA 4XJVA 5CURA 4WCVA 3IOBA 1KPHA 3UAZ<