3FC3A

Crystal structure of the beta-beta-alpha-me type ii restriction endonuclease hpy99i
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
189
structure length
189
Chain Sequence
MLKNDDFVIAKNQLGNIVPNSVGVIRAVNGKSAMVLFIGLNELKRVDFSELEAIDIYRTGKGYDKKICNICHILKNTDGFEINQTDAKGRKTTRPSCRECRKNIDGVKLSSTEKKKMDEIAPPKGSVFTCPICEKRSIVGVTANLVHDHNHDTGWGREWICDSCNTGLGRFKDNPKFLEKVIEYLKKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the beta beta alpha-Me type II restriction endonuclease Hpy99I with target DNA.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/dna
molecule keywords Restriction endonuclease Hpy99I
total genus 48
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02945 Endonuclease_7 Recombination endonuclease VII
A PF18350 SH3_17 Restriction endonuclease SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fc3A01
3.30.60.130 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3fc3A02
3.40.1800.10 Alpha Beta 3-Layer(aba) Sandwich His-Me finger endonuclease fold His-Me finger endonucleases 3fc3A03
2DAQA 3F70A 2QNFA 3META 4E7HA 4ZTJA 3UWNA 2NLUA 5J26A 1E7DA 2HQXA 5KCHA 4II1A 4QVZA 2HQEA 5IAYA 3L2VA 3MP8A 2RHYA 2K3XA 2K3YA 2G3RA 2RI5A 3OS2A 3S3MA 4E7LA 5FRNA 3NTIA 1G5VA 2QNCA 1SSFA 2QQSA 1WGSA 2GF7A 3E9FA 3MEWA 3OS1A 2RJEA 2P0KA 3LYIA 3FLGA 3OS0A 3L2UA 2JTFA 2M0OA 2X35A 4B9XA 2BUDA 4OVAA 2R5AA 3OYDA 4BE1A 2GFAA 2XK0A 4IUVA 4Z02A 4CRIA 3OYEA 4ZTFA 2RHZA 3PFSA 5C6SA 5KCOA 3QKJA 2DIGA 4PLLA 3OYLA 1N27A 3QJ6A 3UT1A 4A4HA 3H8ZA 4BE2A 3DB3A 3OA6A 3L2QA 3NTHA 1OZ3A 3OY9A 2RHUA 5KE2A 3LGFA 4IUTA 3FC3A 2EQJA 5D6WA 4BE0A 4L59A 4N4HA 3MP6A 3P8HA 2LDMA 2RJDA 3MEUA 3SD4A 3OYIA 2RJCA 3ASKA 3LX7A 4QQDA 4LD6A 2RHXA 4BACA 2GFUA 2IG0A 2LRQA 2PQWA 4N4GA 4E7IA 2DIQA 3QIIA 3L2RA 3PMIA 3ZEHA 4IURA 2LTOA 2L8DA 4BD3A 3BDLA 2EFIA 3OQ5A 2YRVA 3H6ZA 3LLRA 4E7KA 2L89A 2LCCA 2R5MA 4NS5A 2RI3A 3OYKA 1OI1A 4BDZA 2B8AA 2JZ2A 3QBYA 1OZ2A 4EDUA 4PL6A 3Q1JA 4E7JA 4PLIA 2EQUA 4UC4A 5J39A 3PNWC 3GOXA 3NTKA 3L2WA 2WACA 3DLMA 4QQGA 2EQKA 2MWOA 3OYGA 4BDYA 2R58A 4IKFA 4IUPA 2RI2A 4C5GA 3DB4A 3CEYA 3KUFA 3PMTA 4N4IA 5C0MA 1WJQA 4C5HA 3OYFA 2QQRA 5KE3A 2FHDA 1H3ZA 2R57A 1RI0A 1XNIA 2F5KA 2O4XB 3O8VA 4QQ6A 2M16A 3MP1A 4A4FA 3M9QA 4FU6A 3L42A 4A4GA 3S3NA 4GY5A 3OYBA 4IUQA 4C5IA 2E6NA 3EAEA 3FDRA 3MO8A 3OMCA 5FRMA 2O4XA 1EN7A 3LGLA 3C4SA 3OYHA 2LVMA 2X4WA 3ME9A 2RHIA 3MEAA 2XDPA 1MHNA 5CIUA 4B9WA 5M9OA 5FROA 2RO0A 3OYNA 5D6YA 2E5QA 4X34A 2X4XA 5KH6A 2BKDN 4QW2A 2EQMA 2L3RA 3OMGA 2RJFA 2D9TA 4FL6A 4HCZA 4RG2A 4A4EA 1E7LA 5D6XA 2CKKA 3P8DA 3S6WA 3FEOA 1WJSA 2BIVA 3MEVA 3S3OA 3OYJA 4IUUA 3OYCA 2MWPA 1KHCA 2X4YA 3E9GA 3OYAA 4Q5WA 1WJRA 2VYTA 5IN1A 4C5EA 2EKOA 3OYMA 1OYXA 3LH0A 2M1HA 3OB9A
chains in the Genus database with same CATH superfamily
1HXDA 4CC3A 5KYWB 4R56A 4LUEA 2LC4A 2F2WA 2DXBA 3G4SQ 2A0FB 2OX7A 2DB6A 1K0XA 1KFZA 3HH2C 1BBZA 2RK1A 3I35A 4PJNA 3D00A 3X28B 1PSFA 2OTJT 3EFOB 3OS1A 1VQ9A 1SGYI 3OS0A 2JVVA 4B9XA 4LN2A 2LUYA 5CCLA 3RESA 4ZNXA 3JV3A 4LXCA 1GBQA 2XK0A 5IH2A 4PFOA 1RLPC 5GAOr 2HZYA 4E47A 3H8ZA 4XU0A 2RF0A 3FC3A 3ULRB 1AOJA 4N4HA 2KR3A 4AFUC 3LX7A 3JB9J 2QASA 1H3HA 2PVOB 2P6AC 4N4GA 1O75A 2FNFX 3CCUT 3VS1A 5CVIA 3RR6A 2QEXT 1ZA1B 5CQYA 3CC4A 3M55A 4M7DA 1YJ9A 2R5MA 2XDDA 1IHVA 1M3CA 1NLOC 2RI3A 3EFSA 1SHFA 3I9QA 3JAME 2O31A 1OZ2A 1IGQA 2K5IA 1KIKA 1IHWA 4M78D 4PLIA 4HT9A 4E2FB 2DILA 4MMKA 2KCXA 4KT0E 5GMKh 3G71A 4FSSA 1TUSA 3O5ZA 3JCMc 2JM9A 2DF6A 2EYXA 2MWOA 1VQ7T 1G3YA 1KSWA 4EMKC 2CYZB 4OVOA 3NGPA 1XNIA 2O4XB 1PRLC 2XHCA 3VJPA 3S3NA 4AFZC 1W2BS 2DYIA 4RTTA 2D8JA 1I0CA 3OMCA 3JCMW 8ATCB 2LT4A 1BCOA 3LGLA 3TVTA 5M9OA 3FJ5A 1M3BA 1WNLA 2BKDN 5I21A 2L3RA 3HFNA 2QQDA 3S6WA 1PHTA 1XJWB 3JCMe 1VQLT 5CCMA 1UHFA 5GMKi 1Y8FA 2ELIA 2BTTA 4J7IA 1U1TA 2YQPA 3OYMA 1B3QA 1HEVA 1KQ2A 1YJ9Q 5GAMh 3MPUB 3VS6A 5GMKl 2HD0A 4J9BA 1VQPT 1LOJA 3G71Q 1K1ZA 1D3BA 4O5VA 5GAOn 3OS2A 2QNCA 1N8RR 1GL5A 5GAN5 1YHQT 2UZ3A 3ZL7C 4BI3A 1FYBA 3A98A 2KNBB 5GAN6 1SHGA 2CDTA 2COYA 4M75C 4LDXA 1W70A 2SGDI 2RQVA 5IXBA 4HA8A 4EPCA 3CXCA 1CSOI 1YWOA 2C06A 3QJ6A 3VUZA 4BB7A 1VQPA 1M8CA 1F1BB 1WHMA 4M75G 2QI2A 3UF4A 3L1AA 4IUTA 1WFWA 2GNCA 2RPNA 2RJCA 1ULKA 5GAMj 2CGHA 4HCCA 3TO7A 2GKTI 3CCQQ 3OQ5A 2DLPA 2YRVA 2E3HA 4GI3C 1VQKT 2PNIA 2RMOA 2LEOA 2IIMA 1R0BG 4EDUA 1Q86C 1X2QA 2AZSA 2EW3A 5J39A 3ER0A 1QCNA 1QWFA 2RQTA 3D7SB 1J3TA 2YWWA 4PFPA 4C5GA 4FYVB 1QVFP 1TBRR 4L9MA 4OMOA 5KE3A 3CPWS 2F2VA 4KH1B 5E3RA 3WXMB 2DZCA 1YJWT 2HBPA 3SEMA 4M77B 2EYQA 4RCBA 4M7AF 3VS2A 2K79A 3M58A 5CAIA 1QKWA 1K9AA 4K11A 3R5DA 3G4ST 2X4WA 1HJDA 5GMKj 3EG2A 1Z9ZA 3HRTA 2QA4T 5CKBA 2JUFA 1JU5C 5GAMd 2EYWA 2F5TX 1CSKA 3M56A 4BI8B 1X75C 1RL2A 4AG1C 4XTXA 3TSWA 2K5FA 3HFOA 3X26B 2X4YA 3JCMd 3CCQA 5GAMf 1ZUKA 2DRMA 4J5YA 2VUBA 5DAEA 1M2OA 4M78F 1V1CA 1E7DA 2J6FA 1OYVI 2HQEA 2MAMA 1SGNI 2YUNA 3QSUA 4C8QA 3TEEA 2JW6A 1VQ9Q 1K8AC 3H0FA 1ZSZA 1X01A 2M0OA 3TCJA 1YU6C 1O9SA 3HRUA 5GANg 1K76A 1TG0A 3E2UA 2E70A 3PFSA 1K73C 1KMAA 1NE8A 2V1CA 1UJ0A 3J7AF 2C0OA 5CQXA 1CT4I 2WSFE 1AWXA 3OA6A 4ZGDB 2YRCA 5LJ3j 2QQ9A 3R6OA 3OXGA 2ZPGB 1IY5A 3SD4A 4RMOA 4DBHA 4KBMB 1HK9A 2EJGA 2GBQA 3X24B 3GP8A 3PDNA 2DIQA 2O9SA 3CC4Q 1D1AA 1NPPA 5LJ3e 4DA4A 1IY6A 1XX6A 3CD6T 5FUWA 5LJ3g 1K0SA 1OI1A 2A37A 2L0AA 2AZVA 4M7AE 4PL6A 4DEYA 4PFZA 1Q82R 2HKNA 3I5SA 2D1XA 3M0RA 3CCMQ 5KYXA 1HDLA 1Q82C 2FHDA 4FIBA 3G6ET 4QQ6A 3L42A 1V76A 3UGDA 1XBTA 2VGNA 4ATOA 5A0DA 4B6DA 1VQ9T 3VDPA 1W2BA 2DJZA 1K4US 4RTVA 4F7UE 1WJSA 1JO8A 1D0ZA 1QP3A 2CWGA 2SGFI 1GFDA 3OYCA 1TUCA 3OBYA 4C5EA 1AZGB 2VV5A 1YITA 2ATCB 2VWFA 1M90R 3HHTB 4QVZA 1TOVA 4OGCA 3VKIA 2NUTB 2QPOA 1WQWA 3S3MA 3CCMA 2QQSA 4WP4A 2W0ZA 5A0LA 2JTFA 3OBWA 4KRTA 4GLMA 2R5AA 4P5NA 5HI7A 3VYHB 2CUDA 5GANf 1QVGS 4KGZB 4M7AA 2ZPBB 1X6GA 1K7VA 3OYLA 1N27A 1W1FA 1VQPQ 3UT1A 1U5SA 1JJ2P 1BI0A 1G3TA 3NTHA 3OY9A 2RB6A 5GAN3 4PJOC 5IT9E 3MP6A 1S1NA 1KD1R 2NUTA 1JBMA 2CJSC 2IVWA 4XAXB 1VQ6T 2QQ0A 5FU6B 1YITQ 1SGRI 2RC4A 1PZWA 2N1AB 3JCMb 1PCXA 3SWNB 2YUPA 4HCKA 1KC8C 1OQKA 1BI1A 4C92B 4JRKA 4M78A 1ZLMA 2B86A 1NYFA 5FWBA 2FRYA 2D6FA 2QTXA 4AG2C 3OYGA 5GMKm 1LR7A 4BUGA 4XU1A 4F04B 1W6XA 3BFMA 1G3WA 2E6ZA 4XK8E 5JHWC 2FG0A 1Q81R 1X4SA 1Y1BA 3MP1A 3UDCA 4JRIA 2DBMA 1WHLA 4OGEA 1VYUA 3OYBA 1QWEA 1RFHA 2N1UA 1UVGA 1WDXA 1Z7KB 2K9GA 1DJ7B 2D0QB 4C0DC 1TIHA 3FB9A 2DBKA 3X25B 1VYTA 1JQQA 4F14A 3OYNA 2CT3A 4XQ3A 2LCLA 4HVWA 1E7LA 4FM4B 3RU0A 1G8XA 2BIVA 1D0XA 1E6HA 3OYJA 1AZEA 1VDDA 1YJWQ 1ZBJA 4JRQA 3OW2A 3G7ZA 4M75A 1YCYA 1MJBA 1SGEI 3E19A 2JXDA 3UWNA 3VS0A 3M0SA 4EMKA 2L7XA 2Y0MA 2RHYA 3JSCA 2VC8A 1JXMA 4OMNA 1T0HA 1M8VA 4M7DF 2YLBA 2ZGWA 2GGRA 2WSEE 2X35A 4XTUA 4V2SA 3NMZC 1G2BA 3QWYA 2EQIA 3UA6A 1Y96A 2XMFA 1WHHA 4M78E 4M78B 1U8RA 3M0QA 1VUBA 2KRNA 1RAAB 1M1GA 5GAOl 5GANd 4A63B 4DQ2A 2EQJA 2DD4A 1K8AR 1OULA 3DLLA 3FIFA 5J3BA 3OXLA 3GIBA 1YJWA 1FX7A 2QEXQ 4JCVE 4FT2A 2L8DA 5FWCA 3RKYA 3CCLT 1MV3A 3EGXB 3UATA 4Y91A 4C8QD 2E41A 4N0AA 4JJCA 3RNJA 1SGQI 2KVQG 4OB0B 3JCMQ 1PTRA 2PVDB 3NTKA 4JPBW 1LJOA 2A08A 4YTLA 1XOVA 4PK4A 4CC2A 2EQKA 1UUEA 1E7OA 3CPFA 3CC2A 1WJQA 2DA9A 1TGSI 2AIRB 1PCEA 1Y1CA 3A8MB 1I5OB 2M16A 3M9QA 3CCLA 2L2PA 2XKOC 1NZ9A 2SEMA 4JLIA 2LZ6B 2CP5A 4C5IA 1IREB 2E6NA 3C12A 2KK4A 1N13A 2DZ9A 2E3IA 1EN7A 4J8OA 4XTWA 2JN0A 1KK7A 2RO0A 3JCMf 1UB4A 2KQWA 2X4XA 4QW2A 5LJ5e 4RG2A 3RMQA 1WIEA 5D6XA 3INZA 1M1KU 4M7DE 2NU4I 1ULMA 1OX8A 1BUSA 1WJRA 2VYTA 1UGPB 2YRDA 1FY7A 2QQBA 1JJ2A 5J26A 3EG0A 4LNPA 2KRSA 1HJAI 1Q95G 2OU2A 2XU8A 2V1RA 4E7LA 2HBWA 2FO0A 5EX3A 1CKAA 2DM1A 3CC2Q 1UFFA 2RJEA 4DBRA 1AD5A 2CP3A 2ZPIB 1DS2I 3CCLQ 2DTIA 2E65A 1VQ6Q 2J05A 1R79A 3OW2P 2MCNA 2EPDA 1C6VX 1M1KR 3VS4A 5LJ5f 4F17A 3RMSA 3HSBA 4A4HA 3L2QA 1Q86U 5GJWB 3LGFA 2D0NA 3H9NA 4ZN1A 3EH2A 2LT1A 4HVVA 3A8HB 1BK2A 3EG3A 3QAHA 4RUGA 2FZKB 2HSPA 2J6OA 4JJBA 4OB3B 1V1IA 1SKUB 2KGTA 4L5GA 2QYZA 1OPKA 2LCCA 4GBQA 1Y7XA 2DL5A 5LL6S 4JS5A 1FMVA 2DVEA 3PE0A 2OJ2A 2DTOA 2DXUA 3JB9G 1WXTA 4XTYA 1TBQR 1KG1A 2ROWA 2GCXA 3UA7A 1ZBXA 4IKFA 5DY9A 2QGFB 2SRCA 2FZGB 1PJUA 1K7TA 3KFVA 1H3ZA 1GXIE 4OB1B 4J7FA 2QQCA 4C92F 3PIOA 4UXHA 3QG1A 2L3SA 2FEIA 2RN8A 4PJJA 1A0NB 1FMKA 2LVMA 2MK5A 4AFSC 1N8RC 2RHIA 4RCCA 5CIUA 3E2IA 3A1PA 2EYYA 3CCRT 2N17A 1LPLA 3S3OA 3QDRB 3CCET 4IUUA 2KT1A 5E3QA 1U06A 1M30A 4ANJA 2LQKA 1YBYA 1VQMQ 3MKDA 2M1HA 1QVFA 4AFQC 2P84A 1T3SA 5KCHA 1Q81C 5GANe 1N8RU 1KC8R 3MP8A 2ED1A 2K3YA 1M8BA 1NEBA 3LH5A 1GFCA 3OW2S 1S20A 3NHNA 4AMCA 2KE9A 1YP5A 2GIVA 4E6RA 4IIMA 4C0GA 2BUDA 2X9HA 4BE1A 1JJ2S 4Z02A 2J87A 4RTUA 2EYZA 4OF1A 3SHWA 5C6SA 3TO6A 4J6XA 4DOVA 3NPFA 5LJ5g 1WPYA 3M0PA 3KY9A 1NYGA 2QK0A 2DXCA 1TSFA 1ZA2B 1P92A 1BIBA 3QZ5B 3ASKA 3H41A 4QQDA 5FW9A 2QEXA 5KYWA 2YDLA 4NOYA 2LNHB 1CHOI 2IG0A 2PQWA 1VQMA 1MJAA 3VRZA 3LWIA 5KYYB 1G3SA 3H6ZA 4E7KA 3BY7A 4M77E 1M3AA 1Q86R 3JCMX 3UOEA 2X3WD 4PJMA 4C8QF 2ZAEA 3EGDA 3EGXA 1GRIA 1Q7YU 1V29B 4QQGA 3H0IA 4HCBA 2DL8A 5GAOq 3TU4K 2EGAA 2HSEB 3HP9A 1PM3A 2XIDA 2DO3A 1KQ1A 1MNEA 2VXFA 4A4GA 2EGCA 4LDVA 5DM7R 1NLPC 1ZUYA 4PKCC 1UE9A 1VQ5Q 4MDWA 3MEAA 2OZUA 5ECAA 2XDPA 3PVLA 1Z9QA 2OAWA 5D6YA 2RA2A 3UFFA 3LW5E 2DIPA 1NXUA 3TO9A 2YUUA 4HKEA 3PTAA 2CKKA 3FEOA 2L3QA 3P8BB 1OMUA 3OYAA 1BKBA 1K73R 4FT4A 4JJNK 3F70A 4M75D 2JZMA 1B07A 2BUSA 4M7AG 2HQXA 4LD9K 2RI5A 4CC7A 4EMHA 3N5BB 1EZZB 3NTIA 3CCVT 1X27A 3EH1A 4M77D 2N52A 1VQ6A 4C92G 1AWOA 3REAB 1ACMB 2DIGA 2MI6A 4M7DG 4MDXA 1VQ5A 1LR8A 2QDLA 3FRNA 1OEBA 2DYBA 4QVDA 2D8HA 4J9HA 2DJQA 2KYBA 3SB2A 2SGQI 1AEYA 4GLKA 2A20A 4C0FA 3OYIA 1UVFA 1SRMA 7AT1B 2GTJA 4A53A 5I11A 2GFUA 3ZFJA 4E7IA 3R6NA 3QIIA 3THKA 1X6BA 3J81E 4KUIA 3BDLA 2QTVA 1H92A 1YN8A 4IIOA 3RKWA 5IHIA 3ZBDA 2O88A 3GF5A 1TU0B 2B8AA 2JZ2A 2AKKA 2K5LA 3L2WA 3MJXA 2HEQA 1P9GA 1UGRB 1H0ZA 2LQNA 2JTEA 5LJ5h 4J9EA 1I07A 2NUPA 3O8VA 2JOYA 2DL4A 1M90C 1X69A 1TUGB 4ZGJB 4R0KA 4MPIA 5HQ8A 2ODDA 3M4YA 3CCVQ 2CZ7B 2VXEA 4C92A 2F69A 2FVUA 3I56T 4KUDK 2OD1A 4QT7A 4C92D 2RJFA 1WHKA 2GTOA 3MEVA 5KYUA 1WXUA 2ZPEB 1FMWA 2K9HA 4HXJA 4OMLA 1VOMA 2CZ6B 1KQSP 1VQNT 1YTPA 3VE5A 2G3RA 4WF2A 3CCRQ 1RI9A 2XD0A 5GANh 4NL2A 1NEGA 4J9DA 4J6YA 3WVDB 2KDSA 3VV0A 1I1JA 3OYEA 3JCMP 1Q9BA 1ZX6A 2GQIA 2QXFA 3WVEB 3U23A 2ROLA 5KCOA 5KYUB 1AHJB 1PRMC 1PWTA 1MUZA 1FXXA 1OZ3A 4FYXB 4CC4B 3BE3A 2HCKA 1XA6A 4E1PA 2E73A 5EG2A 1R77A 2HKQB 4JRPA 2PUOB 2K7AA 4DEXA 4EMKB 3VU3C 5GAN4 1RAGB 2P0PA 1UGVA 4M7AC 2CP6A 4JJDA 2COZA 3I5RA 3PMIA 5KYXB 1IRXA 2JJ9A 4F7UA 3JB9D 4ZGEB 4BDZA 4A24A 5LJ5d 4C92E 2JNGA 1KQSA 1IB8A 2EQUA 3CCRA 1KHIA 5IXFA 1BMOA 4BDYA 4RTWA 2E64A 5KYYA 3A8OB 4N4IA 2BE9B 3OYFA 2K4YA 2QQAA 4M75B 2LX9A 1W4RA 3JB9H 4Z8AA 2KY9A 3A8GB 2YUOA 3RKXA 3CXCP 1D3BB 3CBPA 5I22A 1EX4A 2FB7A 2A7YA 5IHNA 3FDRA 4BI4A 1SGPI 1VQOT 1YNZA 5FU7B 4JLGA 2KROA 1TBOA 2ZCFB 2X3XD 1BB9A 5CKEA 1AWJA 5A0GA 5KH6A 3J80E 4C0ZA 2K3BA 3UPUA 1RADB 4J9GA 4E1RA 1JEGA 2AHJB 5IN1A 1CGII 4DOWA 1BU1A 1ZUUA 3OB9A 3CC4T 3M57A 2BZXA 2JMAA 1UEBA 3QWXX 2ECZA 6AT1B 2MYSA 4E7SA 1PD1A 1UJYA 1Q82U 2KI7A 1PPFI 2GF7A 1IXDA 3L2UA 5I2MA 1UHCA 1FARA 4F7UB 2F1LA 3GNFB 3MHXA 2ZPFB 1SGDI 3OL0A 2L8EA 1ZSGA 2F2XA 4PJLA 1VIEA 2KBTA 1SPKA 3TJQA 2ZPHB 9WGAA 4F7UF 4BE0A 3CXCS 3M54A 1TTHB 1QQJA 1TUDA 2CUBA 4BACA 2JMCA 3CCQT 4M77F 2PUKB 4IURA 1M8MA 1N9SA 1M2VA 3GBQA 3LLRA 1TOTA 3OSSC 4C8QB 3AHUA 1WTJA 2LCSA 3Q1JA 1H8KA 4Y92A 3SGBI 4PJOF 1I4K1 3X20B 3OSVA 1MMAA 3QYHB 2LJ0A 1WQ7A 3PT9A 4HT8A 4IUPA 2ESWA 3CQTA 4CI0C 2QQRA 3TOAA 2A36A 1WA7A 1AT1B 2OI3A 1M4ZA 3C94A 1SSHA 1WKXA 2DL3A 1RAHB 2DKGA 4JZ4A 5CCAA 3UGIA 5GMKe 3TSZA 2KMPA 3L2ZA 1TXQA 3CCVA 4PNOA 1OU8A 4X34A 9ATCB 1RABB 3TQ7P 1IO6A 1CT0I 3HL8A 2CZ1B 4J9CA 1OV3A 3E1SA 2VVKA 1RACB 3CC7A 4Q5WA 4FW2A 2BE7D 3LH0A 4M7AD 2QNFA 4E7HA 3URGA 2QDYB 1M2VB 3CBMA 2XRCA 2PZ1A 1WLPB 4D6WA 3FJPA 4RG8A 3RIRA 1TS9A 3E9FA 4MMLA 3QDFA 2HL3A 2YHTA 1SF9A 1D09B 2ENNA 4DNCA 4Y28E 3QZ9B 1U5KA 2KMQA 3QPHA 4NL3A 3CBOA 4M7AB 5KE2A 1AVZC 3V7RA 5DLOA 2NU3I 5GAOm 5FU6C 3LWHA 4PJOE 2E4HA 3CC7Q 2X51A 2VGMA 2LRQA 2E5RA 1ABQA 5DLQE 3L2RA 3ZEHA 1YJ9T 1P9ZA 2HNIA 1Q7YC 2FL7A 2RQUA 2W10A 4C8QG 3CXLA 1I81A 1WHJA 4M7DD 4MZMA 2L89A 1MV0B 5FUXA 5GAN7 2G6FX 2DXTA 1GCQA 1VQ4A 2AKLA 2SGPI 2WCYA 1YIJA 1Q7YR 4MZTA 1VQOQ 3M59A 2I0NA 3GOXA 4B6MA 3CCMT 1WZOA 4C8QC 4JUVA 2NWMA 3DLMA 3MCAB 2R58A 2KXCA 3EG9B 1X2KA 3EG1A 3DB4A 1KC8U 3M5AA 1AWWA 1YJNQ 2RH2A 4C5HA 3G6EQ 4M75E 1KQSS 2ZZDA 5J8FA 3EFRA 1RI0A 2F5KA 2MF2A 3FSYA 1ARKA 1XQHA 5LJ5j 2EBPA 3M0TA 5LJ3d 1QMCA 5GANj 2AT1B 3A5ZB 3EAEA 1T0JA 2NUPB 2XDBA 3FSXA 2O4XA 2H8HA 3HRSA 4JDSA 2C0TA 1LCKA 4FL6A 3EGDB 1Z2IA 2B0UC 4EIKA 1C1AA 1R0CB 4M77A 4ELZC 2MWPA 1SEMA 3I55T 3KXTA 2VB6A 3VYGA 1VQ4Q 2DAQA 3B4VC 1N9RA 1D1CA 2NLUA 1YIJQ 4PJOD 3GPLA 2H3JA 4PJOA 2VRWB 1OOTA 1YFNA 2Z0WA 4MZPA 3H0HA 3PIPA 1QVGA 2E12A 3MEKA 1YJNA 3SEKC 2V8JA 3NFCA 1JXOA 3I55A 2DX1A 3OYDA 4JS4A 2DRKA 2FPFA 2W0TA 1WI7A 1QKXA 4PLLA 2WSCE 4AT1B 4BE2A 2QA4Q 1UTIA 1GBRA 3DB3A 2KDPA 5FU7C 4A4KA 1OX9A 3JCMg 2LMJA 4J9FA 1LVKA 1ZQ1A 4L59A 1C0MA 3P8HA 2DNUA 2LDMA 5EX0A 2YT6A 4L6V5 2ORVA 2FPEA 1PC0A 2O9VA 3EFOA 4BD3A 5LJ3h 2EFIA 2J06A 4HVUA 3R5CA 4NS5A 3C95A 4KULA 3RERA 2RK2A 1B34A 5HY6A 2WGCA 4A54A 1FYNA 3UEJA 4ESRA 1MGQA 1OU9A 5HCKA 1TBNA 2J9RA 2CH4A 2DMOA 2NU1I 1RUWA 3CMAQ 1D0YA 1ZSZB 4D8KA 1K9MU 2V8KA 1Y07A 2PQ8A 3QJYA 2QA4A 4R55A 1PKSA 1ABOA 1UECA 1YI2T 2P0QA 2LB7A 1K8AU 3JB9I 3QUIA 1PTQA 4QVCA 1PSEA 4LUDA 3PVQA 4A4EA 3JRZA 4ORZA 2HDAA 1V1HA 2DVJA 1OVOA 1U3OA 1BYMA 1B7TA 2ED0A 1AN1I 1IW4A 4EMGA 4Z89A 4F7UG 1YI2A 3VDUA 3R5BA 2DPPB 2CT4A 2NUZA 2LP5A 5FRNA 1G5VA 1RAFB 1WGSA 7WGAA 3MEWA 2P0KA 3FLGA 3RDVA 1EFNA 4BY6B 3CMAA 1K73U 4LE9A 2LJ1A 1DS3I 5FUVA 3CCST 2MOXA 2JW4A 1KD1U 1IGUA 2V1QA 2EKHA 2KSSA 3CPWP 3OYYA 1PG5B 2CSQA 2X3TA 2RHUA 1QVFS 2DK3A 1S72T 3MEUA 2DKVA 2DD5A 2V53A 2DTHA 2LJ3A 4F16A 2RHXA 3SWNA 2K2VA 3M4GA 2GKVA 3CCJQ 1ULNA 2H3EB 5E3PA 2LTOA 1VQOA 3CD6A 1MNDA 2Y90A 2SGEI 2QG9B 1H641 1S72A 2KAFA 2PTKA 1W3SA 3CMEQ 2C0IA 3CEYA 3G6EA 1CGJI 3SFMA 3VS5A 2R57A 1QCOA 2HAXA 4PJOG 2JS2A 2YSQA 5CK9A 4GY5A 2GVIA 2MPXC 3M53A 3HTRA 1R0RI 5A2QE 1Y0MA 4KGXB 4QKUA 1NJIC 1NBEB 4B9WA 2CWFA 2ROTA 1W4SA 2J7IA 4BY6C 1FAQA 1VQ7A 2CREA 4UXJA 3OMGA 5FLXE 4D8DA 5D7UA 3CCJA 1BCMA 4Z88A 4OMMA 2K2MA 3VUBA 5J8CA 5GAMg 1OPLA 1RAIB 3OVOA 4LDWA 1TURA 2HQHA 2X52A 5L8RE 3CPWA 4M77C 1KBFA 2EGEA 1K9MC 3EG9A 1BIAA 3GLXA 1LR9A 4X1VA 2K3XA 1S72Q 4XTZA 3JCMV 1GCQC 1MMGA 4FYYB 1WYXA 4DBFA 1HSQA 2L3PA 3CCUQ 1VQLA 3I55Q 2X4JA 2PU9B 5KYNA 4FCYA 4OVAA 3BJIA 1VQ4T 4RTXA 1ZHIA 3JB9F 2MIOA 2RHZA 2Y4XA 3A8LB 2XG8D 3QKJA 1W2BP 1Y71A 4HGUA 1JB0E 1UDLA 1VQ5T 1VQ7Q 2CS7A 2DFUA 4E7ZA 2V8IA 2RM4A 1WHGA 2Y4YA 1VIFA 3CCEA 1QCFA 4WTOB 1UHAA 1VQ8Q 4XU3A 3RBBB 2CH4W 2OVOA 3RUXA 2CP0A 1PKTA 3UEYA 1K7UA 3VRYA 3QBYA 1VQNQ 4JZ3A 3PNWC 3TREA 3TOBA 4M75F 4FSXA 2KMTA 2EIFA 3QO3A 3PMTA 3R5AA 5L23A 5LJ3f 1RLQC 1D1BA 1EIFA 2FPDA 3CC7T 1PD0A 3OXFA 4RTYA 4DBQA 1I8FA 2BZ8A 1VQKA 3AT1B 3EHRA 3HPWA 2YUQA 1MHNA 1CE3A 2CWHA 1WGTA 4PJOB 2VKNA 4J83A 4M7DC 2DERA 3CCEQ 1TH7A 1VQ8A 3VS3A 1VQMT 2JYYA 2EKOA 1OYXA 2RIJA 5GJVB 1CKBA 1VQNA 2GQVA 4ZTJA 3QXEB 1YI2Q 2DEUA 3G4SA 2YLCA 4II1A 1MJ9A 5IAYA 2CSIA 1HD3A 3SGQI 2FRWA 5AT1B 2EVRA 2NU2I 4FKDA 2M51A 1BI2A 3V8JA 1NJIU 3GNGA 3LYIA 1X74A 1M90U 1VQ8T 2O2OA 2CZ0B 4WCIA 3QYGB 4ZTFA 3CCJT 2ABLA 4CRIA 2E1HA 1VQKQ 1T3LA 3DKMA 4KGVB 1ZSZC 2P4TA 3JCMJ 1MMDA 1UG1A 1YIJT 1I5LA 2J6KA 5D6WA 2OTJQ 1YWPA 4XU2A 1N5ZA 4M78C 2RJDA 4OMPA 4M77G 4LD6A 4M7DB 2CP2A 1WGCA 3CCSQ 5GAN8 1YHQA 1M27C 1X43A 2RQWA 1HYOA 2LQWA 5CR2A 1XTDA 4LDUA 1GCPA 4M78G 3OYKA 4J6WA 3CD6Q 1PNJA 2CP7A 2ENMA 2L5QA 3V7CA 2E10A 3PGGA 2NYSA 2P4RA 3CC2T 3BDUA 4N0AC 3CMEA 2GKRI 1YJNT 1Y96B 2EJ9A 2JXBA 2RI2A 3T9NA 1MMNA 3E59A 3KUFA 2V26A 4TVRA 1B34B 2DL7A 1VYVA 2XI9A 1KD1C 2HL5C 2PVGB 4RTZA 2EWNA 4FU6A 2JTMA 1NPRA 4J9IA 1M1FA 2NU0I 1QP2A 1IZ6A 4IUQA 2VASA 5GAOp 1MT1A 2A3LA 4UXIA 3C4SA 2ARPF 3ME9A 1WX6A 3REBB 2OTJA 5FROA 3CMET 1M1KC 1BI3A 1SRLA 1X6OA 2M02A 2JS0A 4HCZA 4C0DB 3P8DA 1NUBA 3VS7A 5GAN2 3CCSA 1YHQQ 2KMRA 1KHCA 3E9GA 2BZYA 2HMAA 2ORWA 1KBEA 4C8QE 2M9UA 1WXBA 1FWZA 1UGSB 2F3CI 4X9CA 2LX7A 4X9DA 3META 1NM7A 3JCMh 2RNAA 2YXYA 2M0YA 4SGBI 4ME7A 4C92C 3L2VA 5HK3A 2O01E 1NJIR 1LNXA 2K57A 2QGGA 5GAMe 2N71A 1SSFA 4LDYA 4OB2B 2OTLQ 2ERWA 2ENZA 3CCUA 2JM8A 1VQLQ 1RAEB 2KT8A 2JT4A 1QW1A 5EC7A 3EHQA 3M0UA 4FYWB 5CKFA 1Y57A 1N6AA 1JRIA 5CKDA 2KMOA 2GFAA 2OAUA 4IUVA 3SWNC 3V7SA 1YCSB 2FZCB 2UVOA 1U1SA 4AMLA 3G71T 4OMFB 2XICA 2WVJA 4XTVA 3V8LA 2QQEA 3IQLA 2LQ8A 1HPTA 4OP0A 3I56A 3SDZA 1K9MR 2EJFA 2MMPA 1VA7A 1TWBA 4FW1A 5AYFA 8AT1B 1CT2I 1G83A 2KYMA 4RKUE 1YITT 2JA1A 2B8TA 2RQRA 3UGLA 1QVGP 3KBGA 1UUCA 5CO7A 2QAZA 1QLYA 2COWA 4E7JA 4UC4A 2K6DA 3EGUA 2WACA 4OMQA 2OTLA 2M5XA 5CKHA 1M5Q1 3HKSA 1R8OB 2V1CC 5C0MA 3OS5A 3CMAT 2AK5A 1M9SA 3QHSA 4A4FA 2LNVA 2KXDA 1Q81U 5FUYA 5HK0A 2I2LA 3BW1A 5IHKA 1E6GA 2FYKA 2DE0X 4KH0B 4M4ZA 4VUBA 5FRMA 3MO8A 2RD1A 4O6JA 3G1JA 3OYHA 5HKCA 2DEQA 2E5KA 2IPOB 3C0CA 3QWPA 3I56Q 2OTLT 1OMTA 2E5QA 2KEAA 2A28A 2DETA 2EQMA 2D9TA 2EAYA 1KJWA 1SG5A 4ZN3A 5I2SA 3QTLD 1NG2A 4ELYC 3V8KA 2KRMA 1QVPA 1UGQB
chains in the Genus database with same CATH topology
1HXDA 4R56A 1SGEI 3E19A 2LC4A 2JXDA 4F7UG 2DXBA 3UWNA 4EMKA 1YI2A 1PTRA 2L7XA 3VDUA 2CZ6B 1VQNT 1YTPA 2DB6A 2RHYA 3VE5A 3JSCA 2DPPB 2VC8A 2G3RA 3HH2C 4WF2A 2RK1A 5FRNA 1G5VA 1M8VA 4M7DF 2XD0A 2YLBA 1WGSA 3X28B 3D00A 1PSFA 2ZGWA 3MEWA 2OTJT 3OS1A 1VQ9A 1SGYI 2P0KA 2WSEE 3FLGA 3OS0A 2JVVA 2X35A 5GANh 4B9XA 4NL2A 4XTUA 4BY6B 3CMAA 4V2SA 2LUYA 4J6YA 3WVDB 2KDSA 3RESA 3VV0A 5CCLA 1K73U 3J80E 1DS3I 5FUVA 2XK0A 1Y96A 3OYEA 3CCST 3JCMP 4M78E 2QXFA 4M78B 1U8RA 3WVEB 5KCOA 1KD1U 5GAOr 1VUBA 1AHJB 4E47A 1M1GA 3H8ZA 5GAOl 2KSSA 3OYYA 5GANd 4XU0A 1FXXA 1OZ3A 2RHUA 4DQ2A 1XA6A 4E1PA 2E73A 5EG2A 3FC3A 1QVFS 1OYVI 2EQJA 2DD4A 2DK3A 4JRPA 2PUOB 4EMKB 4N4HA 1S72T 3VU3C 5GAN4 3MEUA 2DD5A 2P0PA 2V53A 3LX7A 2DTHA 3DLLA 3JB9J 3FIFA 5J3BA 4M7AC 3OXLA 3GIBA 2RHXA 2PVOB 2K2VA 3SWNA 1FX7A 3M4GA 1YJWA 2P6AC 4N4GA 1O75A 2GKVA 2FNFX 4FT2A 4JCVE 3CCUT 3PMIA 5CVIA 2QEXT 2LTOA 2L8DA 3RKYA 5CQYA 3CCLT 3CC4A 1IY5A 4F7UA 3JB9D 3M55A 4M7DA 1YJ9A 2R5MA 4Y91A 2XDDA 2RI3A 4ZGEB 4C8QD 4BDZA 2E41A 3EFSA 4N0AA 4A24A 5LJ5d 3JAME 4C92E 1OZ2A 1VQOA 2JNGA 2K5IA 1SGQI 3CD6A 2Y90A 2KVQG 1KQSA 4OB0B 4M78D 2EQUA 4PLIA 3JCMQ 4HT9A 2PVDB 4MMKA 3CCRA 3NTKA 4KT0E 5GMKh 3G71A 1H641 1LJOA 1TUSA 4YTLA 1XOVA 1KHIA 1S72A 1BMOA 2KAFA 3JCMc 1VQ7T 2EQKA 2MWOA 4BDYA 3CPFA 1G3YA 1W3SA 2E64A 3G6EA 3CEYA 3A8OB 4N4IA 4EMKC 1WJQA 3OYFA 2CYZB 2K4YA 3CC2A 2QQAA 3SFMA 4M75B 1CGJI 1TGSI 4OVOA 1PCEA 2R57A 1Y1CA 1XNIA 2LX9A 1W4RA 2O4XB 2HAXA 3A8MB 2M16A 4PJOG 3JB9H 2XHCA 3M9QA 3CCLA 2XKOC 1NZ9A 2KY9A 3VJPA 3S3NA 3A8GB 1W2BS 4JLIA 5CK9A 3RKXA 4GY5A 2GVIA 1D3BB 3CBPA 3M53A 4C5IA 1IREB 2E6NA 2FB7A 2KK4A 2A7YA 3C12A 3FDRA 3OMCA 4BI4A 2DZ9A 5A2QE 3JCMW 1VQOT 1N13A 5FU7B 2LT4A 3LGLA 1EN7A 4J8OA 4JLGA 4UXJA 1NJIC 1TBOA 2ZCFB 4B9WA 4XTWA 2JN0A 1W4SA 4BY6C 2RO0A 5M9OA 1FAQA 3JCMf 5CKEA 1VQ7A 1WNLA 1UB4A 2KQWA 2X4XA 5A0GA 2BKDN 4QW2A 5I21A 5KH6A 5LJ5e 2L3RA 3OMGA 4RG2A 4C0ZA 3HFNA 5FLXE 3RMQA 3UPUA 2QQDA 5D6XA 3S6WA 3CCJA 3JCMe 3INZA 1M1KU 1VQLT 4M7DE 5CCMA 2NU4I 5GMKi 1Y8FA 2ELIA 4J7IA 3VUBA 4E1RA 1U1TA 1WJRA 2YQPA 2VYTA 1BUSA 1UGPB 2AHJB 5IN1A 4DOWA 3OYMA 1CGII 1KQ2A 2KCXA 5GAMg 3OB9A 3CC4T 3OVOA 3M57A 4LDWA 5GAMh 1TURA 2QQBA 5L8RE 3CPWA 1JJ2A 4M77C 1KBFA 5GMKl 1UEBA 5J26A 1K9MC 2HD0A 1BIAA 3GLXA 1LR9A 1VQPT 1LOJA 1HJAI 1D3BA 2K3XA 5HI7A 4O5VA 5GAOn 3OS2A 4XTZA 1Q82U 2XU8A 3JCMV 4E7LA 5EX3A 2QNCA 1PPFI 5GAN5 2GF7A 1YHQT 2UZ3A 2RJEA 3L2UA 5I2MA 4BI3A 1FYBA 1VQLA 2X4JA 2PU9B 5GAN6 1FARA 4F7UB 2ZPIB 4M75C 4OVAA 1DS2I 4LDXA 3BJIA 2SGDI 3GNFB 3MHXA 1VQ4T 1ZHIA 2DTIA 2E65A 3JB9F 2ZPFB 1R79A 1SGDI 2RHZA 2Y4XA 3A8LB 2XG8D 3QKJA 4HA8A 4EPCA 3CXCA 1CSOI 3OL0A 2L8EA 1Y71A 5LJ5f 2C06A 3RMSA 3QJ6A 3VUZA 3HSBA 4A4HA 1JB0E 4BB7A 1VIEA 4HGUA 1VQPA 3L2QA 1M8CA 1Q86U 1AN1I 4M75G 3TJQA 1VQ5T 2QI2A 2ZPHB 3L1AA 3LGFA 4IUTA 2CS7A 4ZN1A 4F7UF 4BE0A 2V8IA 2LT1A 3M54A 3CXCS 2RM4A 2RJCA 3A8HB 5GAMj 2CGHA 4HCCA 2Y4YA 4BACA 1VIFA 3CCEA 2GKTI 3CCQT 4M77F 4XU3A 4OB3B 2PUKB 4IURA 1V1IA 3OQ5A 1N9SA 2OVOA 2YRVA 4L5GA 3RUXA 3LLRA 4GI3C 1TOTA 3OSSC 1VQKT 4C8QB 2LCCA 3AHUA 1Y7XA 3UEYA 5LL6S 4JS5A 2DVEA 2LEOA 3QBYA 2DTOA 2DXUA 4EDUA 3JB9G 1Q86C 3Q1JA 4XTYA 3SGBI 1TBQR 4PJOF 5J39A 1I4K1 1KG1A 3ER0A 3PNWC 3TREA 3X20B 3OSVA 2ROWA 3G7ZA 4M75F 2GCXA 3QYHB 4FSXA 1WQ7A 3PT9A 1ZBXA 4HT8A 4IKFA 5DY9A 2KMTA 4IUPA 2EIFA 4C5GA 3QO3A 3PMTA 4CI0C 1PJUA 1TBRR 5LJ3f 2QQRA 1Q7YC 3CXLA 4L9MA 5KE3A 1H3ZA 1EIFA 3CPWS 3CC7T 1GXIE 1SGPI 3WXMB 4OB1B 4J7FA 2DZCA 1M4ZA 2HBPA 3C94A 4C92F 1YJWT 2QQCA 3PIOA 3OXFA 4UXHA 3QG1A 2EYQA 4M77B 1I8FA 4RCBA 1VQKA 4M7AF 2J87A 2DKGA 5CCAA 3M58A 3UGIA 5CAIA 5GMKe 3HPWA 3G4ST 2LVMA 2X4WA 2KMPA 3L2ZA 2RHIA 5GMKj 3HRTA 4RCCA 5CIUA 1MHNA 3CCVA 2QA4T 1N8RC 3E2IA 4PNOA 5CKBA 1CE3A 2JUFA 4X34A 5GAMd 4PJOB 2F5TX 3M56A 3CCRT 4J83A 4M7DC 1CT0I 2N17A 3HL8A 2CZ1B 4BI8B 1X75C 1RL2A 1TH7A 3E1SA 1VQ8A 3S3OA 4XTXA 3QDRB 2K5FA 3HFOA 4IUUA 1VQMT 3X26B 2X4YA 3JCMd 3CC7A 5GAMf 3CCQA 4Q5WA 2JYYA 2LQKA 1YBYA 2EKOA 1OYXA 3LH0A 4J5YA 2M1HA 4M7AD 2VUBA 1QVFA 5DAEA 2QNFA 4E7HA 2GQVA 1VQNA 4ZTJA 3QXEB 4M78F 1E7DA 3URGA 5KCHA 3G4SA 2QDYB 2YLCA 5GANe 1Q81C 4II1A 1N8RU 2HQEA 3CBMA 5IAYA 2MAMA 3MP8A 2XRCA 3SGQI 1SGNI 2K3YA 2NU2I 1M8BA 3QSUA 4C8QA 4D6WA 4FKDA 3TEEA 2JW6A 3OW2S 3FJPA 4RG8A 1BI2A 3RIRA 3V8JA 1NJIU 1K8AC 3E9FA 4MMLA 1X01A 3GNGA 3LYIA 1X74A 1M90U 2M0OA 1VQ8T 3TCJA 4C0GA 1YU6C 1O9SA 2BUDA 2CZ0B 2YHTA 3HRUA 5GANg 2ENNA 3QYGB 4BE1A 1JJ2S 4Z02A 4ZTFA 4Y28E 4CRIA 3QZ9B 2E1HA 2E70A 3CCJT 3DKMA 4OF1A 3PFSA 5C6SA 1U5KA 2P4TA 1K73C 1KMAA 2KMQA 1NE8A 1R0RI 3QPHA 4J6XA 4DOVA 3J7AF 5CQXA 1CT4I 3JCMJ 2V1CA 2WSFE 5LJ5g 1WPYA 4NL3A 4ZGDB 3OA6A 3CBOA 1YIJT 3KY9A 4M7AB 5KE2A 3V7RA 2QQ9A 5LJ3j 5DLOA 2DXCA 3R6OA 1I5LA 2NU3I 1IW4A 5D6WA 5GAOm 5FU6C 4XU2A 3OXGA 2ZPGB 1P92A 4M78C 1BIBA 2RJDA 3QZ5B 3SD4A 4RMOA 3LWHA 4PJOE 4M77G 3ASKA 1HK9A 2EJGA 4KBMB 4QQDA 3X24B 4LD6A 3GP8A 2QEXA 3PDNA 4NOYA 4M7DB 2VGMA 1CHOI 2IG0A 2LRQA 2PQWA 2E5RA 2DIQA 5DLQE 5GAN8 3L2RA 1VQMA 1YHQA 3ZEHA 1YJ9T 2HNIA 3LWIA 1G3SA 2FL7A 1XTDA 4C8QG 5CR2A 1I81A 1NPPA 5LJ3e 4DA4A 3H6ZA 4LDUA 4M7DD 4E7KA 1IY6A 4MZMA 2L89A 1XX6A 3BY7A 4M77E 4M78G 5LJ3g 3CD6T 5GAN7 1VQ4A 2DXTA 5FUWA 5FUXA 3OYKA 1OI1A 4J6WA 4M7AE 2SGPI 2WCYA 1YIJA 4PL6A 3JCMX 2L5QA 4MZTA 3V7CA 4C8QF 2E10A 3M59A 3PGGA 3GOXA 3CCMT 1Q7YU 1V29B 4C8QC 4JUVA 3CC2T 3DLMA 4QQGA 3BDUA 4N0AC 3MCAB 3CMEA 2GKRI 1YJNT 2R58A 1Y96B 2EJ9A 2RI2A 1KC8U 3T9NA 3DB4A 4HCBA 3M5AA 5GAOq 3KUFA 4TVRA 3E59A 1HDLA 2RH2A 4C5HA 3TU4K 1B34B 4M75E 1Q82C 1KQSS 2ZZDA 2XI9A 2FHDA 1KD1C 3EFRA 1RI0A 2F5KA 2PVGB 3HP9A 2EWNA 4FIBA 4QQ6A 2XIDA 2MF2A 3G6ET 2DO3A 1KQ1A 2VXFA 3L42A 4FU6A 2JTMA 1NPRA 1XQHA 4LDVA 4A4GA 1M1FA 5LJ5j 5DM7R 5LJ3d 5GANj 2NU0I 1QP2A 3A5ZB 3UGDA 1IZ6A 4IUQA 5GAOp 4PKCC 3EAEA 2XDBA 1XBTA 2O4XA 2VGNA 1MT1A 2A3LA 4ATOA 4UXIA 3C4SA 3HRSA 5A0DA 2ARPF 4MDWA 3ME9A 3MEAA 4B6DA 2XDPA 4JDSA 2OTJA 1VQ9T 5FROA 5D6YA 3VDPA 3CMET 1M1KC 2RA2A 1BI3A 3LW5E 2DIPA 1X6OA 1W2BA 3UFFA 2DJZA 4FL6A 4HCZA 2YUUA 4HKEA 4C0DB 2CKKA 3P8DA 3PTAA 3FEOA 1WJSA 4F7UE 5GAN2 1QP3A 3CCSA 4M77A 2SGFI 3P8BB 2KMRA 1OMUA 3OYCA 4ELZC 2MWPA 1KHCA 3OYAA 3E9GA 3I55T 2ORWA 1BKBA 3OBYA 3KXTA 4FT4A 4C5EA 3VYGA 4C8QE 4JJNK 1KBEA 2M9UA 2VV5A 1FWZA 1UGSB 1YITA 2DAQA 4X9CA 3F70A 1N9RA 2F3CI 3B4VC 4M75D 3META 4X9DA 1NUBA 2JZMA 2NLUA 3JCMh 4PJOD 3HHTB 3GPLA 4M7AG 2HQXA 2BUSA 2H3JA 4SGBI 4PJOA 2VRWB 4ME7A 4QVZA 4C92C 3L2VA 5HK3A 2O01E 4LD9K 4OGCA 3VKIA 2QPOA 1WQWA 1LNXA 2K57A 2RI5A 3S3MA 4EMHA 3N5BB 3CCMA 4MZPA 5GAMe 3NTIA 3PIPA 1QVGA 1SSFA 2QQSA 2E12A 4LDYA 2N71A 4OB2B 3CCVT 2ERWA 1YJNA 2ENZA 3CCUA 3MEKA 3SEKC 2V8JA 3NFCA 2JTFA 5A0LA 3OBWA 4M77D 1QW1A 2R5AA 3I55A 4P5NA 5CKFA 1VQ6A 3VYHB 4C92G 3OYDA 1N6AA 1JRIA 5CKDA 4JS4A 2KMOA 2GFAA 2OAUA 4IUVA 3SWNC 3V7SA 5GANf 1QVGS 4M7AA 2ZPBB 2W0TA 2DIGA 2MI6A 4PLLA 3OYLA 4M7DG 4MDXA 2SGEI 1N27A 2WSCE 1U1SA 1VQ5A 1LR8A 3UT1A 3G71T 3FRNA 4BE2A 1BI0A 4OMFB 2XICA 3DB3A 1G3TA 4QVDA 2WVJA 3NTHA 5FU7C 4XTVA 4A4KA 3V8LA 3OY9A 2RB6A 3JCMg 2QQEA 5GAN3 2LQ8A 3SB2A 1HPTA 2SGQI 4PJOC 4GLKA 5IT9E 1ZQ1A 4L59A 2A20A 3MP6A 4OP0A 3I56A 3P8HA 2LDMA 2B0UC 4C0FA 5EX0A 3OYIA 1UVFA 3SDZA 1JBMA 2CJSC 2EJFA 2MMPA 2IVWA 4A53A 4L6V5 2GFUA 4XAXB 3ZFJA 2ORVA 4E7IA 1VQ6T 3QIIA 2QQ0A 5FU6B 5AYFA 3J81E 4KUIA 4BD3A 3BDLA 2EFIA 5LJ3h 3JCMb 1CT2I 1SGRI 2N1AB 4RKUE 1YITT 2JA1A 3SWNB 2B8TA 3RKWA 3UGLA 3ZBDA 1KC8C 4NS5A 3GF5A 3KBGA 2B8AA 2JZ2A 1UUCA 1BI1A 3C95A 4KULA 5CO7A 4JRKA 4M78A 4C92B 3RERA 2RK2A 4E7JA 2K5LA 4UC4A 1B34A 5HY6A 2D6FA 4M75A 4A54A 2QTXA 3L2WA 2WACA 3UEJA 2OTLA 2M5XA 1MGQA 5CKHA 3OYGA 5GMKm 1LR7A 1TBNA 1M5Q1 3HKSA 4BUGA 1UGRB 1R8OB 4XU1A 2J9RA 1H0ZA 2V1CC 5C0MA 3OS5A 3BFMA 3CMAT 2NU1I 1G3WA 2E6ZA 4XK8E 5LJ5h 5JHWC 3O8VA 1X4SA 2JOYA 1M9SA 3QHSA 2N52A 1Y1BA 3MP1A 3UDCA 4A4FA 2LNVA 1M90C 4JRIA 1K9MU 1Q81U 5FUYA 4OGEA 5HK0A 2I2LA 3BW1A 2V8KA 4ZGJB 2FYKA 3OYBA 1Y07A 3QJYA 2QA4A 1RFHA 4VUBA 4R55A 3MO8A 5FRMA 2RD1A 4O6JA 1UVGA 1Z7KB 3OYHA 1DJ7B 2D0QB 2P0QA 5HKCA 4C0DC 2DEQA 3QUIA 3JB9I 1YI2T 1K8AU 1TIHA 3FB9A 1PTQA 3X25B 5HQ8A 3QWPA 2ODDA 4QVCA 1PSEA 3M4YA 3OYNA 2CZ7B 2OTLT 1OMTA 2E5QA 3CCET 2VXEA 4C92A 4XQ3A 2F69A 2FVUA 2LCLA 3I56T 4KUDK 2EQMA 4C92D 2OD1A 2RJFA 2D9TA 4A4EA 3JRZA 2EAYA 1E7LA 1V1HA 4FM4B 3RU0A 2BIVA 1OVOA 3MEVA 4ZN3A 3OYJA 1VDDA 5I2SA 2ZPEB 3QTLD 4ELYC 3V8KA 4JRQA 2K9HA 3OW2A 1BYMA 1QVPA 1UGQB 1YCYA 4EMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAQ A;  3F70 A;  2QNF A;  3MET A;  4E7H A;  4ZTJ A;  3UWN A;  2NLU A;  5J26 A;  1E7D A;  2HQX A;  5KCH A;  4II1 A;  4QVZ A;  2HQE A;  5IAY A;  3L2V A;  3MP8 A;  2RHY A;  2K3X A;  2K3Y A;  2G3R A;  2RI5 A;  3OS2 A;  3S3M A;  4E7L A;  5FRN A;  3NTI A;  1G5V A;  2QNC A;  1SSF A;  2QQS A;  1WGS A;  2GF7 A;  3E9F A;  3MEW A;  3OS1 A;  2RJE A;  2P0K A;  3LYI A;  3FLG A;  3OS0 A;  3L2U A;  2JTF A;  2M0O A;  2X35 A;  4B9X A;  2BUD A;  4OVA A;  2R5A A;  3OYD A;  4BE1 A;  2GFA A;  2XK0 A;  4IUV A;  4Z02 A;  4CRI A;  3OYE A;  4ZTF A;  2RHZ A;  3PFS A;  5C6S A;  5KCO A;  3QKJ A;  2DIG A;  4PLL A;  3OYL A;  1N27 A;  3QJ6 A;  3UT1 A;  4A4H A;  3H8Z A;  4BE2 A;  3DB3 A;  3OA6 A;  3L2Q A;  3NTH A;  1OZ3 A;  3OY9 A;  2RHU A;  5KE2 A;  3LGF A;  4IUT A;  3FC3 A;  2EQJ A;  5D6W A;  4BE0 A;  4L59 A;  4N4H A;  3MP6 A;  3P8H A;  2LDM A;  2RJD A;  3MEU A;  3SD4 A;  3OYI A;  2RJC A;  3ASK A;  3LX7 A;  4QQD A;  4LD6 A;  2RHX A;  4BAC A;  2GFU A;  2IG0 A;  2LRQ A;  2PQW A;  4N4G A;  4E7I A;  2DIQ A;  3QII A;  3L2R A;  3PMI A;  3ZEH A;  4IUR A;  2LTO A;  2L8D A;  4BD3 A;  3BDL A;  2EFI A;  3OQ5 A;  2YRV A;  3H6Z A;  3LLR A;  4E7K A;  2L89 A;  2LCC A;  2R5M A;  4NS5 A;  2RI3 A;  3OYK A;  1OI1 A;  4BDZ A;  2B8A A;  2JZ2 A;  3QBY A;  1OZ2 A;  4EDU A;  4PL6 A;  3Q1J A;  4E7J A;  4PLI A;  2EQU A;  4UC4 A;  5J39 A;  3PNW C;  3GOX A;  3NTK A;  3L2W A;  2WAC A;  3DLM A;  4QQG A;  2EQK A;  2MWO A;  3OYG A;  4BDY A;  2R58 A;  4IKF A;  4IUP A;  2RI2 A;  4C5G A;  3DB4 A;  3CEY A;  3KUF A;  3PMT A;  4N4I A;  5C0M A;  1WJQ A;  4C5H A;  3OYF A;  2QQR A;  5KE3 A;  2FHD A;  1H3Z A;  2R57 A;  1RI0 A;  1XNI A;  2F5K A;  2O4X B;  3O8V A;  4QQ6 A;  2M16 A;  3MP1 A;  4A4F A;  3M9Q A;  4FU6 A;  3L42 A;  4A4G A;  3S3N A;  4GY5 A;  3OYB A;  4IUQ A;  4C5I A;  2E6N A;  3EAE A;  3FDR A;  3MO8 A;  3OMC A;  5FRM A;  2O4X A;  1EN7 A;  3LGL A;  3C4S A;  3OYH A;  2LVM A;  2X4W A;  3ME9 A;  2RHI A;  3MEA A;  2XDP A;  1MHN A;  5CIU A;  4B9W A;  5M9O A;  5FRO A;  2RO0 A;  3OYN A;  5D6Y A;  2E5Q A;  4X34 A;  2X4X A;  5KH6 A;  2BKD N;  4QW2 A;  2EQM A;  2L3R A;  3OMG A;  2RJF A;  2D9T A;  4FL6 A;  4HCZ A;  4RG2 A;  4A4E A;  1E7L A;  5D6X A;  2CKK A;  3P8D A;  3S6W A;  3FEO A;  1WJS A;  2BIV A;  3MEV A;  3S3O A;  3OYJ A;  4IUU A;  3OYC A;  2MWP A;  1KHC A;  2X4Y A;  3E9G A;  3OYA A;  4Q5W A;  1WJR A;  2VYT A;  5IN1 A;  4C5E A;  2EKO A;  3OYM A;  1OYX A;  3LH0 A;  2M1H A;  3OB9 A; 
#chains in the Genus database with same CATH topology
 1HXD A;  4CC3 A;  5KYW B;  4R56 A;  4LUE A;  2LC4 A;  2F2W A;  2DXB A;  3G4S Q;  2A0F B;  2OX7 A;  2DB6 A;  1K0X A;  1KFZ A;  3HH2 C;  1BBZ A;  2RK1 A;  3I35 A;  4PJN A;  3D00 A;  3X28 B;  1PSF A;  2OTJ T;  3EFO B;  3OS1 A;  1VQ9 A;  1SGY I;  3OS0 A;  2JVV A;  4B9X A;  4LN2 A;  2LUY A;  5CCL A;  3RES A;  4ZNX A;  3JV3 A;  4LXC A;  1GBQ A;  2XK0 A;  5IH2 A;  4PFO A;  1RLP C;  5GAO r;  2HZY A;  4E47 A;  3H8Z A;  4XU0 A;  2RF0 A;  3FC3 A;  3ULR B;  1AOJ A;  4N4H A;  2KR3 A;  4AFU C;  3LX7 A;  3JB9 J;  2QAS A;  1H3H A;  2PVO B;  2P6A C;  4N4G A;  1O75 A;  2FNF X;  3CCU T;  3VS1 A;  5CVI A;  3RR6 A;  2QEX T;  1ZA1 B;  5CQY A;  3CC4 A;  3M55 A;  4M7D A;  1YJ9 A;  2R5M A;  2XDD A;  1IHV A;  1M3C A;  1NLO C;  2RI3 A;  3EFS A;  1SHF A;  3I9Q A;  3JAM E;  2O31 A;  1OZ2 A;  1IGQ A;  2K5I A;  1KIK A;  1IHW A;  4M78 D;  4PLI A;  4HT9 A;  4E2F B;  2DIL A;  4MMK A;  2KCX A;  4KT0 E;  5GMK h;  3G71 A;  4FSS A;  1TUS A;  3O5Z A;  3JCM c;  2JM9 A;  2DF6 A;  2EYX A;  2MWO A;  1VQ7 T;  1G3Y A;  1KSW A;  4EMK C;  2CYZ B;  4OVO A;  3NGP A;  1XNI A;  2O4X B;  1PRL C;  2XHC A;  3VJP A;  3S3N A;  4AFZ C;  1W2B S;  2DYI A;  4RTT A;  2D8J A;  1I0C A;  3OMC A;  3JCM W;  8ATC B;  2LT4 A;  1BCO A;  3LGL A;  3TVT A;  5M9O A;  3FJ5 A;  1M3B A;  1WNL A;  2BKD N;  5I21 A;  2L3R A;  3HFN A;  2QQD A;  3S6W A;  1PHT A;  1XJW B;  3JCM e;  1VQL T;  5CCM A;  1UHF A;  5GMK i;  1Y8F A;  2ELI A;  2BTT A;  4J7I A;  1U1T A;  2YQP A;  3OYM A;  1B3Q A;  1HEV A;  1KQ2 A;  1YJ9 Q;  5GAM h;  3MPU B;  3VS6 A;  5GMK l;  2HD0 A;  4J9B A;  1VQP T;  1LOJ A;  3G71 Q;  1K1Z A;  1D3B A;  4O5V A;  5GAO n;  3OS2 A;  2QNC A;  1N8R R;  1GL5 A;  5GAN 5;  1YHQ T;  2UZ3 A;  3ZL7 C;  4BI3 A;  1FYB A;  3A98 A;  2KNB B;  5GAN 6;  1SHG A;  2CDT A;  2COY A;  4M75 C;  4LDX A;  1W70 A;  2SGD I;  2RQV A;  5IXB A;  4HA8 A;  4EPC A;  3CXC A;  1CSO I;  1YWO A;  2C06 A;  3QJ6 A;  3VUZ A;  4BB7 A;  1VQP A;  1M8C A;  1F1B B;  1WHM A;  4M75 G;  2QI2 A;  3UF4 A;  3L1A A;  4IUT A;  1WFW A;  2GNC A;  2RPN A;  2RJC A;  1ULK A;  5GAM j;  2CGH A;  4HCC A;  3TO7 A;  2GKT I;  3CCQ Q;  3OQ5 A;  2DLP A;  2YRV A;  2E3H A;  4GI3 C;  1VQK T;  2PNI A;  2RMO A;  2LEO A;  2IIM A;  1R0B G;  4EDU A;  1Q86 C;  1X2Q A;  2AZS A;  2EW3 A;  5J39 A;  3ER0 A;  1QCN A;  1QWF A;  2RQT A;  3D7S B;  1J3T A;  2YWW A;  4PFP A;  4C5G A;  4FYV B;  1QVF P;  1TBR R;  4L9M A;  4OMO A;  5KE3 A;  3CPW S;  2F2V A;  4KH1 B;  5E3R A;  3WXM B;  2DZC A;  1YJW T;  2HBP A;  3SEM A;  4M77 B;  2EYQ A;  4RCB A;  4M7A F;  3VS2 A;  2K79 A;  3M58 A;  5CAI A;  1QKW A;  1K9A A;  4K11 A;  3R5D A;  3G4S T;  2X4W A;  1HJD A;  5GMK j;  3EG2 A;  1Z9Z A;  3HRT A;  2QA4 T;  5CKB A;  2JUF A;  1JU5 C;  5GAM d;  2EYW A;  2F5T X;  1CSK A;  3M56 A;  4BI8 B;  1X75 C;  1RL2 A;  4AG1 C;  4XTX A;  3TSW A;  2K5F A;  3HFO A;  3X26 B;  2X4Y A;  3JCM d;  3CCQ A;  5GAM f;  1ZUK A;  2DRM A;  4J5Y A;  2VUB A;  5DAE A;  1M2O A;  4M78 F;  1V1C A;  1E7D A;  2J6F A;  1OYV I;  2HQE A;  2MAM A;  1SGN I;  2YUN A;  3QSU A;  4C8Q A;  3TEE A;  2JW6 A;  1VQ9 Q;  1K8A C;  3H0F A;  1ZSZ A;  1X01 A;  2M0O A;  3TCJ A;  1YU6 C;  1O9S A;  3HRU A;  5GAN g;  1K76 A;  1TG0 A;  3E2U A;  2E70 A;  3PFS A;  1K73 C;  1KMA A;  1NE8 A;  2V1C A;  1UJ0 A;  3J7A F;  2C0O A;  5CQX A;  1CT4 I;  2WSF E;  1AWX A;  3OA6 A;  4ZGD B;  2YRC A;  5LJ3 j;  2QQ9 A;  3R6O A;  3OXG A;  2ZPG B;  1IY5 A;  3SD4 A;  4RMO A;  4DBH A;  4KBM B;  1HK9 A;  2EJG A;  2GBQ A;  3X24 B;  3GP8 A;  3PDN A;  2DIQ A;  2O9S A;  3CC4 Q;  1D1A A;  1NPP A;  5LJ3 e;  4DA4 A;  1IY6 A;  1XX6 A;  3CD6 T;  5FUW A;  5LJ3 g;  1K0S A;  1OI1 A;  2A37 A;  2L0A A;  2AZV A;  4M7A E;  4PL6 A;  4DEY A;  4PFZ A;  1Q82 R;  2HKN A;  3I5S A;  2D1X A;  3M0R A;  3CCM Q;  5KYX A;  1HDL A;  1Q82 C;  2FHD A;  4FIB A;  3G6E T;  4QQ6 A;  3L42 A;  1V76 A;  3UGD A;  1XBT A;  2VGN A;  4ATO A;  5A0D A;  4B6D A;  1VQ9 T;  3VDP A;  1W2B A;  2DJZ A;  1K4U S;  4RTV A;  4F7U E;  1WJS A;  1JO8 A;  1D0Z A;  1QP3 A;  2CWG A;  2SGF I;  1GFD A;  3OYC A;  1TUC A;  3OBY A;  4C5E A;  1AZG B;  2VV5 A;  1YIT A;  2ATC B;  2VWF A;  1M90 R;  3HHT B;  4QVZ A;  1TOV A;  4OGC A;  3VKI A;  2NUT B;  2QPO A;  1WQW A;  3S3M A;  3CCM A;  2QQS A;  4WP4 A;  2W0Z A;  5A0L A;  2JTF A;  3OBW A;  4KRT A;  4GLM A;  2R5A A;  4P5N A;  5HI7 A;  3VYH B;  2CUD A;  5GAN f;  1QVG S;  4KGZ B;  4M7A A;  2ZPB B;  1X6G A;  1K7V A;  3OYL A;  1N27 A;  1W1F A;  1VQP Q;  3UT1 A;  1U5S A;  1JJ2 P;  1BI0 A;  1G3T A;  3NTH A;  3OY9 A;  2RB6 A;  5GAN 3;  4PJO C;  5IT9 E;  3MP6 A;  1S1N A;  1KD1 R;  2NUT A;  1JBM A;  2CJS C;  2IVW A;  4XAX B;  1VQ6 T;  2QQ0 A;  5FU6 B;  1YIT Q;  1SGR I;  2RC4 A;  1PZW A;  2N1A B;  3JCM b;  1PCX A;  3SWN B;  2YUP A;  4HCK A;  1KC8 C;  1OQK A;  1BI1 A;  4C92 B;  4JRK A;  4M78 A;  1ZLM A;  2B86 A;  1NYF A;  5FWB A;  2FRY A;  2D6F A;  2QTX A;  4AG2 C;  3OYG A;  5GMK m;  1LR7 A;  4BUG A;  4XU1 A;  4F04 B;  1W6X A;  3BFM A;  1G3W A;  2E6Z A;  4XK8 E;  5JHW C;  2FG0 A;  1Q81 R;  1X4S A;  1Y1B A;  3MP1 A;  3UDC A;  4JRI A;  2DBM A;  1WHL A;  4OGE A;  1VYU A;  3OYB A;  1QWE A;  1RFH A;  2N1U A;  1UVG A;  1WDX A;  1Z7K B;  2K9G A;  1DJ7 B;  2D0Q B;  4C0D C;  1TIH A;  3FB9 A;  2DBK A;  3X25 B;  1VYT A;  1JQQ A;  4F14 A;  3OYN A;  2CT3 A;  4XQ3 A;  2LCL A;  4HVW A;  1E7L A;  4FM4 B;  3RU0 A;  1G8X A;  2BIV A;  1D0X A;  1E6H A;  3OYJ A;  1AZE A;  1VDD A;  1YJW Q;  1ZBJ A;  4JRQ A;  3OW2 A;  3G7Z A;  4M75 A;  1YCY A;  1MJB A;  1SGE I;  3E19 A;  2JXD A;  3UWN A;  3VS0 A;  3M0S A;  4EMK A;  2L7X A;  2Y0M A;  2RHY A;  3JSC A;  2VC8 A;  1JXM A;  4OMN A;  1T0H A;  1M8V A;  4M7D F;  2YLB A;  2ZGW A;  2GGR A;  2WSE E;  2X35 A;  4XTU A;  4V2S A;  3NMZ C;  1G2B A;  3QWY A;  2EQI A;  3UA6 A;  1Y96 A;  2XMF A;  1WHH A;  4M78 E;  4M78 B;  1U8R A;  3M0Q A;  1VUB A;  2KRN A;  1RAA B;  1M1G A;  5GAO l;  5GAN d;  4A63 B;  4DQ2 A;  2EQJ A;  2DD4 A;  1K8A R;  1OUL A;  3DLL A;  3FIF A;  5J3B A;  3OXL A;  3GIB A;  1YJW A;  1FX7 A;  2QEX Q;  4JCV E;  4FT2 A;  2L8D A;  5FWC A;  3RKY A;  3CCL T;  1MV3 A;  3EGX B;  3UAT A;  4Y91 A;  4C8Q D;  2E41 A;  4N0A A;  4JJC A;  3RNJ A;  1SGQ I;  2KVQ G;  4OB0 B;  3JCM Q;  1PTR A;  2PVD B;  3NTK A;  4JPB W;  1LJO A;  2A08 A;  4YTL A;  1XOV A;  4PK4 A;  4CC2 A;  2EQK A;  1UUE A;  1E7O A;  3CPF A;  3CC2 A;  1WJQ A;  2DA9 A;  1TGS I;  2AIR B;  1PCE A;  1Y1C A;  3A8M B;  1I5O B;  2M16 A;  3M9Q A;  3CCL A;  2L2P A;  2XKO C;  1NZ9 A;  2SEM A;  4JLI A;  2LZ6 B;  2CP5 A;  4C5I A;  1IRE B;  2E6N A;  3C12 A;  2KK4 A;  1N13 A;  2DZ9 A;  2E3I A;  1EN7 A;  4J8O A;  4XTW A;  2JN0 A;  1KK7 A;  2RO0 A;  3JCM f;  1UB4 A;  2KQW A;  2X4X A;  4QW2 A;  5LJ5 e;  4RG2 A;  3RMQ A;  1WIE A;  5D6X A;  3INZ A;  1M1K U;  4M7D E;  2NU4 I;  1ULM A;  1OX8 A;  1BUS A;  1WJR A;  2VYT A;  1UGP B;  2YRD A;  1FY7 A;  2QQB A;  1JJ2 A;  5J26 A;  3EG0 A;  4LNP A;  2KRS A;  1HJA I;  1Q95 G;  2OU2 A;  2XU8 A;  2V1R A;  4E7L A;  2HBW A;  2FO0 A;  5EX3 A;  1CKA A;  2DM1 A;  3CC2 Q;  1UFF A;  2RJE A;  4DBR A;  1AD5 A;  2CP3 A;  2ZPI B;  1DS2 I;  3CCL Q;  2DTI A;  2E65 A;  1VQ6 Q;  2J05 A;  1R79 A;  3OW2 P;  2MCN A;  2EPD A;  1C6V X;  1M1K R;  3VS4 A;  5LJ5 f;  4F17 A;  3RMS A;  3HSB A;  4A4H A;  3L2Q A;  1Q86 U;  5GJW B;  3LGF A;  2D0N A;  3H9N A;  4ZN1 A;  3EH2 A;  2LT1 A;  4HVV A;  3A8H B;  1BK2 A;  3EG3 A;  3QAH A;  4RUG A;  2FZK B;  2HSP A;  2J6O A;  4JJB A;  4OB3 B;  1V1I A;  1SKU B;  2KGT A;  4L5G A;  2QYZ A;  1OPK A;  2LCC A;  4GBQ A;  1Y7X A;  2DL5 A;  5LL6 S;  4JS5 A;  1FMV A;  2DVE A;  3PE0 A;  2OJ2 A;  2DTO A;  2DXU A;  3JB9 G;  1WXT A;  4XTY A;  1TBQ R;  1KG1 A;  2ROW A;  2GCX A;  3UA7 A;  1ZBX A;  4IKF A;  5DY9 A;  2QGF B;  2SRC A;  2FZG B;  1PJU A;  1K7T A;  3KFV A;  1H3Z A;  1GXI E;  4OB1 B;  4J7F A;  2QQC A;  4C92 F;  3PIO A;  4UXH A;  3QG1 A;  2L3S A;  2FEI A;  2RN8 A;  4PJJ A;  1A0N B;  1FMK A;  2LVM A;  2MK5 A;  4AFS C;  1N8R C;  2RHI A;  4RCC A;  5CIU A;  3E2I A;  3A1P A;  2EYY A;  3CCR T;  2N17 A;  1LPL A;  3S3O A;  3QDR B;  3CCE T;  4IUU A;  2KT1 A;  5E3Q A;  1U06 A;  1M30 A;  4ANJ A;  2LQK A;  1YBY A;  1VQM Q;  3MKD A;  2M1H A;  1QVF A;  4AFQ C;  2P84 A;  1T3S A;  5KCH A;  1Q81 C;  5GAN e;  1N8R U;  1KC8 R;  3MP8 A;  2ED1 A;  2K3Y A;  1M8B A;  1NEB A;  3LH5 A;  1GFC A;  3OW2 S;  1S20 A;  3NHN A;  4AMC A;  2KE9 A;  1YP5 A;  2GIV A;  4E6R A;  4IIM A;  4C0G A;  2BUD A;  2X9H A;  4BE1 A;  1JJ2 S;  4Z02 A;  2J87 A;  4RTU A;  2EYZ A;  4OF1 A;  3SHW A;  5C6S A;  3TO6 A;  4J6X A;  4DOV A;  3NPF A;  5LJ5 g;  1WPY A;  3M0P A;  3KY9 A;  1NYG A;  2QK0 A;  2DXC A;  1TSF A;  1ZA2 B;  1P92 A;  1BIB A;  3QZ5 B;  3ASK A;  3H41 A;  4QQD A;  5FW9 A;  2QEX A;  5KYW A;  2YDL A;  4NOY A;  2LNH B;  1CHO I;  2IG0 A;  2PQW A;  1VQM A;  1MJA A;  3VRZ A;  3LWI A;  5KYY B;  1G3S A;  3H6Z A;  4E7K A;  3BY7 A;  4M77 E;  1M3A A;  1Q86 R;  3JCM X;  3UOE A;  2X3W D;  4PJM A;  4C8Q F;  2ZAE A;  3EGD A;  3EGX A;  1GRI A;  1Q7Y U;  1V29 B;  4QQG A;  3H0I A;  4HCB A;  2DL8 A;  5GAO q;  3TU4 K;  2EGA A;  2HSE B;  3HP9 A;  1PM3 A;  2XID A;  2DO3 A;  1KQ1 A;  1MNE A;  2VXF A;  4A4G A;  2EGC A;  4LDV A;  5DM7 R;  1NLP C;  1ZUY A;  4PKC C;  1UE9 A;  1VQ5 Q;  4MDW A;  3MEA A;  2OZU A;  5ECA A;  2XDP A;  3PVL A;  1Z9Q A;  2OAW A;  5D6Y A;  2RA2 A;  3UFF A;  3LW5 E;  2DIP A;  1NXU A;  3TO9 A;  2YUU A;  4HKE A;  3PTA A;  2CKK A;  3FEO A;  2L3Q A;  3P8B B;  1OMU A;  3OYA A;  1BKB A;  1K73 R;  4FT4 A;  4JJN K;  3F70 A;  4M75 D;  2JZM A;  1B07 A;  2BUS A;  4M7A G;  2HQX A;  4LD9 K;  2RI5 A;  4CC7 A;  4EMH A;  3N5B B;  1EZZ B;  3NTI A;  3CCV T;  1X27 A;  3EH1 A;  4M77 D;  2N52 A;  1VQ6 A;  4C92 G;  1AWO A;  3REA B;  1ACM B;  2DIG A;  2MI6 A;  4M7D G;  4MDX A;  1VQ5 A;  1LR8 A;  2QDL A;  3FRN A;  1OEB A;  2DYB A;  4QVD A;  2D8H A;  4J9H A;  2DJQ A;  2KYB A;  3SB2 A;  2SGQ I;  1AEY A;  4GLK A;  2A20 A;  4C0F A;  3OYI A;  1UVF A;  1SRM A;  7AT1 B;  2GTJ A;  4A53 A;  5I11 A;  2GFU A;  3ZFJ A;  4E7I A;  3R6N A;  3QII A;  3THK A;  1X6B A;  3J81 E;  4KUI A;  3BDL A;  2QTV A;  1H92 A;  1YN8 A;  4IIO A;  3RKW A;  5IHI A;  3ZBD A;  2O88 A;  3GF5 A;  1TU0 B;  2B8A A;  2JZ2 A;  2AKK A;  2K5L A;  3L2W A;  3MJX A;  2HEQ A;  1P9G A;  1UGR B;  1H0Z A;  2LQN A;  2JTE A;  5LJ5 h;  4J9E A;  1I07 A;  2NUP A;  3O8V A;  2JOY A;  2DL4 A;  1M90 C;  1X69 A;  1TUG B;  4ZGJ B;  4R0K A;  4MPI A;  5HQ8 A;  2ODD A;  3M4Y A;  3CCV Q;  2CZ7 B;  2VXE A;  4C92 A;  2F69 A;  2FVU A;  3I56 T;  4KUD K;  2OD1 A;  4QT7 A;  4C92 D;  2RJF A;  1WHK A;  2GTO A;  3MEV A;  5KYU A;  1WXU A;  2ZPE B;  1FMW A;  2K9H A;  4HXJ A;  4OML A;  1VOM A;  2CZ6 B;  1KQS P;  1VQN T;  1YTP A;  3VE5 A;  2G3R A;  4WF2 A;  3CCR Q;  1RI9 A;  2XD0 A;  5GAN h;  4NL2 A;  1NEG A;  4J9D A;  4J6Y A;  3WVD B;  2KDS A;  3VV0 A;  1I1J A;  3OYE A;  3JCM P;  1Q9B A;  1ZX6 A;  2GQI A;  2QXF A;  3WVE B;  3U23 A;  2ROL A;  5KCO A;  5KYU B;  1AHJ B;  1PRM C;  1PWT A;  1MUZ A;  1FXX A;  1OZ3 A;  4FYX B;  4CC4 B;  3BE3 A;  2HCK A;  1XA6 A;  4E1P A;  2E73 A;  5EG2 A;  1R77 A;  2HKQ B;  4JRP A;  2PUO B;  2K7A A;  4DEX A;  4EMK B;  3VU3 C;  5GAN 4;  1RAG B;  2P0P A;  1UGV A;  4M7A C;  2CP6 A;  4JJD A;  2COZ A;  3I5R A;  3PMI A;  5KYX B;  1IRX A;  2JJ9 A;  4F7U A;  3JB9 D;  4ZGE B;  4BDZ A;  4A24 A;  5LJ5 d;  4C92 E;  2JNG A;  1KQS A;  1IB8 A;  2EQU A;  3CCR A;  1KHI A;  5IXF A;  1BMO A;  4BDY A;  4RTW A;  2E64 A;  5KYY A;  3A8O B;  4N4I A;  2BE9 B;  3OYF A;  2K4Y A;  2QQA A;  4M75 B;  2LX9 A;  1W4R A;  3JB9 H;  4Z8A A;  2KY9 A;  3A8G B;  2YUO A;  3RKX A;  3CXC P;  1D3B B;  3CBP A;  5I22 A;  1EX4 A;  2FB7 A;  2A7Y A;  5IHN A;  3FDR A;  4BI4 A;  1SGP I;  1VQO T;  1YNZ A;  5FU7 B;  4JLG A;  2KRO A;  1TBO A;  2ZCF B;  2X3X D;  1BB9 A;  5CKE A;  1AWJ A;  5A0G A;  5KH6 A;  3J80 E;  4C0Z A;  2K3B A;  3UPU A;  1RAD B;  4J9G A;  4E1R A;  1JEG A;  2AHJ B;  5IN1 A;  1CGI I;  4DOW A;  1BU1 A;  1ZUU A;  3OB9 A;  3CC4 T;  3M57 A;  2BZX A;  2JMA A;  1UEB A;  3QWX X;  2ECZ A;  6AT1 B;  2MYS A;  4E7S A;  1PD1 A;  1UJY A;  1Q82 U;  2KI7 A;  1PPF I;  2GF7 A;  1IXD A;  3L2U A;  5I2M A;  1UHC A;  1FAR A;  4F7U B;  2F1L A;  3GNF B;  3MHX A;  2ZPF B;  1SGD I;  3OL0 A;  2L8E A;  1ZSG A;  2F2X A;  4PJL A;  1VIE A;  2KBT A;  1SPK A;  3TJQ A;  2ZPH B;  9WGA A;  4F7U F;  4BE0 A;  3CXC S;  3M54 A;  1TTH B;  1QQJ A;  1TUD A;  2CUB A;  4BAC A;  2JMC A;  3CCQ T;  4M77 F;  2PUK B;  4IUR A;  1M8M A;  1N9S A;  1M2V A;  3GBQ A;  3LLR A;  1TOT A;  3OSS C;  4C8Q B;  3AHU A;  1WTJ A;  2LCS A;  3Q1J A;  1H8K A;  4Y92 A;  3SGB I;  4PJO F;  1I4K 1;  3X20 B;  3OSV A;  1MMA A;  3QYH B;  2LJ0 A;  1WQ7 A;  3PT9 A;  4HT8 A;  4IUP A;  2ESW A;  3CQT A;  4CI0 C;  2QQR A;  3TOA A;  2A36 A;  1WA7 A;  1AT1 B;  2OI3 A;  1M4Z A;  3C94 A;  1SSH A;  1WKX A;  2DL3 A;  1RAH B;  2DKG A;  4JZ4 A;  5CCA A;  3UGI A;  5GMK e;  3TSZ A;  2KMP A;  3L2Z A;  1TXQ A;  3CCV A;  4PNO A;  1OU8 A;  4X34 A;  9ATC B;  1RAB B;  3TQ7 P;  1IO6 A;  1CT0 I;  3HL8 A;  2CZ1 B;  4J9C A;  1OV3 A;  3E1S A;  2VVK A;  1RAC B;  3CC7 A;  4Q5W A;  4FW2 A;  2BE7 D;  3LH0 A;  4M7A D;  2QNF A;  4E7H A;  3URG A;  2QDY B;  1M2V B;  3CBM A;  2XRC A;  2PZ1 A;  1WLP B;  4D6W A;  3FJP A;  4RG8 A;  3RIR A;  1TS9 A;  3E9F A;  4MML A;  3QDF A;  2HL3 A;  2YHT A;  1SF9 A;  1D09 B;  2ENN A;  4DNC A;  4Y28 E;  3QZ9 B;  1U5K A;  2KMQ A;  3QPH A;  4NL3 A;  3CBO A;  4M7A B;  5KE2 A;  1AVZ C;  3V7R A;  5DLO A;  2NU3 I;  5GAO m;  5FU6 C;  3LWH A;  4PJO E;  2E4H A;  3CC7 Q;  2X51 A;  2VGM A;  2LRQ A;  2E5R A;  1ABQ A;  5DLQ E;  3L2R A;  3ZEH A;  1YJ9 T;  1P9Z A;  2HNI A;  1Q7Y C;  2FL7 A;  2RQU A;  2W10 A;  4C8Q G;  3CXL A;  1I81 A;  1WHJ A;  4M7D D;  4MZM A;  2L89 A;  1MV0 B;  5FUX A;  5GAN 7;  2G6F X;  2DXT A;  1GCQ A;  1VQ4 A;  2AKL A;  2SGP I;  2WCY A;  1YIJ A;  1Q7Y R;  4MZT A;  1VQO Q;  3M59 A;  2I0N A;  3GOX A;  4B6M A;  3CCM T;  1WZO A;  4C8Q C;  4JUV A;  2NWM A;  3DLM A;  3MCA B;  2R58 A;  2KXC A;  3EG9 B;  1X2K A;  3EG1 A;  3DB4 A;  1KC8 U;  3M5A A;  1AWW A;  1YJN Q;  2RH2 A;  4C5H A;  3G6E Q;  4M75 E;  1KQS S;  2ZZD A;  5J8F A;  3EFR A;  1RI0 A;  2F5K A;  2MF2 A;  3FSY A;  1ARK A;  1XQH A;  5LJ5 j;  2EBP A;  3M0T A;  5LJ3 d;  1QMC A;  5GAN j;  2AT1 B;  3A5Z B;  3EAE A;  1T0J A;  2NUP B;  2XDB A;  3FSX A;  2O4X A;  2H8H A;  3HRS A;  4JDS A;  2C0T A;  1LCK A;  4FL6 A;  3EGD B;  1Z2I A;  2B0U C;  4EIK A;  1C1A A;  1R0C B;  4M77 A;  4ELZ C;  2MWP A;  1SEM A;  3I55 T;  3KXT A;  2VB6 A;  3VYG A;  1VQ4 Q;  2DAQ A;  3B4V C;  1N9R A;  1D1C A;  2NLU A;  1YIJ Q;  4PJO D;  3GPL A;  2H3J A;  4PJO A;  2VRW B;  1OOT A;  1YFN A;  2Z0W A;  4MZP A;  3H0H A;  3PIP A;  1QVG A;  2E12 A;  3MEK A;  1YJN A;  3SEK C;  2V8J A;  3NFC A;  1JXO A;  3I55 A;  2DX1 A;  3OYD A;  4JS4 A;  2DRK A;  2FPF A;  2W0T A;  1WI7 A;  1QKX A;  4PLL A;  2WSC E;  4AT1 B;  4BE2 A;  2QA4 Q;  1UTI A;  1GBR A;  3DB3 A;  2KDP A;  5FU7 C;  4A4K A;  1OX9 A;  3JCM g;  2LMJ A;  4J9F A;  1LVK A;  1ZQ1 A;  4L59 A;  1C0M A;  3P8H A;  2DNU A;  2LDM A;  5EX0 A;  2YT6 A;  4L6V 5;  2ORV A;  2FPE A;  1PC0 A;  2O9V A;  3EFO A;  4BD3 A;  5LJ3 h;  2EFI A;  2J06 A;  4HVU A;  3R5C A;  4NS5 A;  3C95 A;  4KUL A;  3RER A;  2RK2 A;  1B34 A;  5HY6 A;  2WGC A;  4A54 A;  1FYN A;  3UEJ A;  4ESR A;  1MGQ A;  1OU9 A;  5HCK A;  1TBN A;  2J9R A;  2CH4 A;  2DMO A;  2NU1 I;  1RUW A;  3CMA Q;  1D0Y A;  1ZSZ B;  4D8K A;  1K9M U;  2V8K A;  1Y07 A;  2PQ8 A;  3QJY A;  2QA4 A;  4R55 A;  1PKS A;  1ABO A;  1UEC A;  1YI2 T;  2P0Q A;  2LB7 A;  1K8A U;  3JB9 I;  3QUI A;  1PTQ A;  4QVC A;  1PSE A;  4LUD A;  3PVQ A;  4A4E A;  3JRZ A;  4ORZ A;  2HDA A;  1V1H A;  2DVJ A;  1OVO A;  1U3O A;  1BYM A;  1B7T A;  2ED0 A;  1AN1 I;  1IW4 A;  4EMG A;  4Z89 A;  4F7U G;  1YI2 A;  3VDU A;  3R5B A;  2DPP B;  2CT4 A;  2NUZ A;  2LP5 A;  5FRN A;  1G5V A;  1RAF B;  1WGS A;  7WGA A;  3MEW A;  2P0K A;  3FLG A;  3RDV A;  1EFN A;  4BY6 B;  3CMA A;  1K73 U;  4LE9 A;  2LJ1 A;  1DS3 I;  5FUV A;  3CCS T;  2MOX A;  2JW4 A;  1KD1 U;  1IGU A;  2V1Q A;  2EKH A;  2KSS A;  3CPW P;  3OYY A;  1PG5 B;  2CSQ A;  2X3T A;  2RHU A;  1QVF S;  2DK3 A;  1S72 T;  3MEU A;  2DKV A;  2DD5 A;  2V53 A;  2DTH A;  2LJ3 A;  4F16 A;  2RHX A;  3SWN A;  2K2V A;  3M4G A;  2GKV A;  3CCJ Q;  1ULN A;  2H3E B;  5E3P A;  2LTO A;  1VQO A;  3CD6 A;  1MND A;  2Y90 A;  2SGE I;  2QG9 B;  1H64 1;  1S72 A;  2KAF A;  2PTK A;  1W3S A;  3CME Q;  2C0I A;  3CEY A;  3G6E A;  1CGJ I;  3SFM A;  3VS5 A;  2R57 A;  1QCO A;  2HAX A;  4PJO G;  2JS2 A;  2YSQ A;  5CK9 A;  4GY5 A;  2GVI A;  2MPX C;  3M53 A;  3HTR A;  1R0R I;  5A2Q E;  1Y0M A;  4KGX B;  4QKU A;  1NJI C;  1NBE B;  4B9W A;  2CWF A;  2ROT A;  1W4S A;  2J7I A;  4BY6 C;  1FAQ A;  1VQ7 A;  2CRE A;  4UXJ A;  3OMG A;  5FLX E;  4D8D A;  5D7U A;  3CCJ A;  1BCM A;  4Z88 A;  4OMM A;  2K2M A;  3VUB A;  5J8C A;  5GAM g;  1OPL A;  1RAI B;  3OVO A;  4LDW A;  1TUR A;  2HQH A;  2X52 A;  5L8R E;  3CPW A;  4M77 C;  1KBF A;  2EGE A;  1K9M C;  3EG9 A;  1BIA A;  3GLX A;  1LR9 A;  4X1V A;  2K3X A;  1S72 Q;  4XTZ A;  3JCM V;  1GCQ C;  1MMG A;  4FYY B;  1WYX A;  4DBF A;  1HSQ A;  2L3P A;  3CCU Q;  1VQL A;  3I55 Q;  2X4J A;  2PU9 B;  5KYN A;  4FCY A;  4OVA A;  3BJI A;  1VQ4 T;  4RTX A;  1ZHI A;  3JB9 F;  2MIO A;  2RHZ A;  2Y4X A;  3A8L B;  2XG8 D;  3QKJ A;  1W2B P;  1Y71 A;  4HGU A;  1JB0 E;  1UDL A;  1VQ5 T;  1VQ7 Q;  2CS7 A;  2DFU A;  4E7Z A;  2V8I A;  2RM4 A;  1WHG A;  2Y4Y A;  1VIF A;  3CCE A;  1QCF A;  4WTO B;  1UHA A;  1VQ8 Q;  4XU3 A;  3RBB B;  2CH4 W;  2OVO A;  3RUX A;  2CP0 A;  1PKT A;  3UEY A;  1K7U A;  3VRY A;  3QBY A;  1VQN Q;  4JZ3 A;  3PNW C;  3TRE A;  3TOB A;  4M75 F;  4FSX A;  2KMT A;  2EIF A;  3QO3 A;  3PMT A;  3R5A A;  5L23 A;  5LJ3 f;  1RLQ C;  1D1B A;  1EIF A;  2FPD A;  3CC7 T;  1PD0 A;  3OXF A;  4RTY A;  4DBQ A;  1I8F A;  2BZ8 A;  1VQK A;  3AT1 B;  3EHR A;  3HPW A;  2YUQ A;  1MHN A;  1CE3 A;  2CWH A;  1WGT A;  4PJO B;  2VKN A;  4J83 A;  4M7D C;  2DER A;  3CCE Q;  1TH7 A;  1VQ8 A;  3VS3 A;  1VQM T;  2JYY A;  2EKO A;  1OYX A;  2RIJ A;  5GJV B;  1CKB A;  1VQN A;  2GQV A;  4ZTJ A;  3QXE B;  1YI2 Q;  2DEU A;  3G4S A;  2YLC A;  4II1 A;  1MJ9 A;  5IAY A;  2CSI A;  1HD3 A;  3SGQ I;  2FRW A;  5AT1 B;  2EVR A;  2NU2 I;  4FKD A;  2M51 A;  1BI2 A;  3V8J A;  1NJI U;  3GNG A;  3LYI A;  1X74 A;  1M90 U;  1VQ8 T;  2O2O A;  2CZ0 B;  4WCI A;  3QYG B;  4ZTF A;  3CCJ T;  2ABL A;  4CRI A;  2E1H A;  1VQK Q;  1T3L A;  3DKM A;  4KGV B;  1ZSZ C;  2P4T A;  3JCM J;  1MMD A;  1UG1 A;  1YIJ T;  1I5L A;  2J6K A;  5D6W A;  2OTJ Q;  1YWP A;  4XU2 A;  1N5Z A;  4M78 C;  2RJD A;  4OMP A;  4M77 G;  4LD6 A;  4M7D B;  2CP2 A;  1WGC A;  3CCS Q;  5GAN 8;  1YHQ A;  1M27 C;  1X43 A;  2RQW A;  1HYO A;  2LQW A;  5CR2 A;  1XTD A;  4LDU A;  1GCP A;  4M78 G;  3OYK A;  4J6W A;  3CD6 Q;  1PNJ A;  2CP7 A;  2ENM A;  2L5Q A;  3V7C A;  2E10 A;  3PGG A;  2NYS A;  2P4R A;  3CC2 T;  3BDU A;  4N0A C;  3CME A;  2GKR I;  1YJN T;  1Y96 B;  2EJ9 A;  2JXB A;  2RI2 A;  3T9N A;  1MMN A;  3E59 A;  3KUF A;  2V26 A;  4TVR A;  1B34 B;  2DL7 A;  1VYV A;  2XI9 A;  1KD1 C;  2HL5 C;  2PVG B;  4RTZ A;  2EWN A;  4FU6 A;  2JTM A;  1NPR A;  4J9I A;  1M1F A;  2NU0 I;  1QP2 A;  1IZ6 A;  4IUQ A;  2VAS A;  5GAO p;  1MT1 A;  2A3L A;  4UXI A;  3C4S A;  2ARP F;  3ME9 A;  1WX6 A;  3REB B;  2OTJ A;  5FRO A;  3CME T;  1M1K C;  1BI3 A;  1SRL A;  1X6O A;  2M02 A;  2JS0 A;  4HCZ A;  4C0D B;  3P8D A;  1NUB A;  3VS7 A;  5GAN 2;  3CCS A;  1YHQ Q;  2KMR A;  1KHC A;  3E9G A;  2BZY A;  2HMA A;  2ORW A;  1KBE A;  4C8Q E;  2M9U A;  1WXB A;  1FWZ A;  1UGS B;  2F3C I;  4X9C A;  2LX7 A;  4X9D A;  3MET A;  1NM7 A;  3JCM h;  2RNA A;  2YXY A;  2M0Y A;  4SGB I;  4ME7 A;  4C92 C;  3L2V A;  5HK3 A;  2O01 E;  1NJI R;  1LNX A;  2K57 A;  2QGG A;  5GAM e;  2N71 A;  1SSF A;  4LDY A;  4OB2 B;  2OTL Q;  2ERW A;  2ENZ A;  3CCU A;  2JM8 A;  1VQL Q;  1RAE B;  2KT8 A;  2JT4 A;  1QW1 A;  5EC7 A;  3EHQ A;  3M0U A;  4FYW B;  5CKF A;  1Y57 A;  1N6A A;  1JRI A;  5CKD A;  2KMO A;  2GFA A;  2OAU A;  4IUV A;  3SWN C;  3V7S A;  1YCS B;  2FZC B;  2UVO A;  1U1S A;  4AML A;  3G71 T;  4OMF B;  2XIC A;  2WVJ A;  4XTV A;  3V8L A;  2QQE A;  3IQL A;  2LQ8 A;  1HPT A;  4OP0 A;  3I56 A;  3SDZ A;  1K9M R;  2EJF A;  2MMP A;  1VA7 A;  1TWB A;  4FW1 A;  5AYF A;  8AT1 B;  1CT2 I;  1G83 A;  2KYM A;  4RKU E;  1YIT T;  2JA1 A;  2B8T A;  2RQR A;  3UGL A;  1QVG P;  3KBG A;  1UUC A;  5CO7 A;  2QAZ A;  1QLY A;  2COW A;  4E7J A;  4UC4 A;  2K6D A;  3EGU A;  2WAC A;  4OMQ A;  2OTL A;  2M5X A;  5CKH A;  1M5Q 1;  3HKS A;  1R8O B;  2V1C C;  5C0M A;  3OS5 A;  3CMA T;  2AK5 A;  1M9S A;  3QHS A;  4A4F A;  2LNV A;  2KXD A;  1Q81 U;  5FUY A;  5HK0 A;  2I2L A;  3BW1 A;  5IHK A;  1E6G A;  2FYK A;  2DE0 X;  4KH0 B;  4M4Z A;  4VUB A;  5FRM A;  3MO8 A;  2RD1 A;  4O6J A;  3G1J A;  3OYH A;  5HKC A;  2DEQ A;  2E5K A;  2IPO B;  3C0C A;  3QWP A;  3I56 Q;  2OTL T;  1OMT A;  2E5Q A;  2KEA A;  2A28 A;  2DET A;  2EQM A;  2D9T A;  2EAY A;  1KJW A;  1SG5 A;  4ZN3 A;  5I2S A;  3QTL D;  1NG2 A;  4ELY C;  3V8K A;  2KRM A;  1QVP A;  1UGQ B; 
#chains in the Genus database with same CATH homology
 1HXD A;  4R56 A;  1SGE I;  3E19 A;  2LC4 A;  2JXD A;  4F7U G;  2DXB A;  3UWN A;  4EMK A;  1YI2 A;  1PTR A;  2L7X A;  3VDU A;  2CZ6 B;  1VQN T;  1YTP A;  2DB6 A;  2RHY A;  3VE5 A;  3JSC A;  2DPP B;  2VC8 A;  2G3R A;  3HH2 C;  4WF2 A;  2RK1 A;  5FRN A;  1G5V A;  1M8V A;  4M7D F;  2XD0 A;  2YLB A;  1WGS A;  3X28 B;  3D00 A;  1PSF A;  2ZGW A;  3MEW A;  2OTJ T;  3OS1 A;  1VQ9 A;  1SGY I;  2P0K A;  2WSE E;  3FLG A;  3OS0 A;  2JVV A;  2X35 A;  5GAN h;  4B9X A;  4NL2 A;  4XTU A;  4BY6 B;  3CMA A;  4V2S A;  2LUY A;  4J6Y A;  3WVD B;  2KDS A;  3RES A;  3VV0 A;  5CCL A;  1K73 U;  3J80 E;  1DS3 I;  5FUV A;  2XK0 A;  1Y96 A;  3OYE A;  3CCS T;  3JCM P;  4M78 E;  2QXF A;  4M78 B;  1U8R A;  3WVE B;  5KCO A;  1KD1 U;  5GAO r;  1VUB A;  1AHJ B;  4E47 A;  1M1G A;  3H8Z A;  5GAO l;  2KSS A;  3OYY A;  5GAN d;  4XU0 A;  1FXX A;  1OZ3 A;  2RHU A;  4DQ2 A;  1XA6 A;  4E1P A;  2E73 A;  5EG2 A;  3FC3 A;  1QVF S;  1OYV I;  2EQJ A;  2DD4 A;  2DK3 A;  4JRP A;  2PUO B;  4EMK B;  4N4H A;  1S72 T;  3VU3 C;  5GAN 4;  3MEU A;  2DD5 A;  2P0P A;  2V53 A;  3LX7 A;  2DTH A;  3DLL A;  3JB9 J;  3FIF A;  5J3B A;  4M7A C;  3OXL A;  3GIB A;  2RHX A;  2PVO B;  2K2V A;  3SWN A;  1FX7 A;  3M4G A;  1YJW A;  2P6A C;  4N4G A;  1O75 A;  2GKV A;  2FNF X;  4FT2 A;  4JCV E;  3CCU T;  3PMI A;  5CVI A;  2QEX T;  2LTO A;  2L8D A;  3RKY A;  5CQY A;  3CCL T;  3CC4 A;  1IY5 A;  4F7U A;  3JB9 D;  3M55 A;  4M7D A;  1YJ9 A;  2R5M A;  4Y91 A;  2XDD A;  2RI3 A;  4ZGE B;  4C8Q D;  4BDZ A;  2E41 A;  3EFS A;  4N0A A;  4A24 A;  5LJ5 d;  3JAM E;  4C92 E;  1OZ2 A;  1VQO A;  2JNG A;  2K5I A;  1SGQ I;  3CD6 A;  2Y90 A;  2KVQ G;  1KQS A;  4OB0 B;  4M78 D;  2EQU A;  4PLI A;  3JCM Q;  4HT9 A;  2PVD B;  4MMK A;  3CCR A;  3NTK A;  4KT0 E;  5GMK h;  3G71 A;  1H64 1;  1LJO A;  1TUS A;  4YTL A;  1XOV A;  1KHI A;  1S72 A;  1BMO A;  2KAF A;  3JCM c;  1VQ7 T;  2EQK A;  2MWO A;  4BDY A;  3CPF A;  1G3Y A;  1W3S A;  2E64 A;  3G6E A;  3CEY A;  3A8O B;  4N4I A;  4EMK C;  1WJQ A;  3OYF A;  2CYZ B;  2K4Y A;  3CC2 A;  2QQA A;  3SFM A;  4M75 B;  1CGJ I;  1TGS I;  4OVO A;  1PCE A;  2R57 A;  1Y1C A;  1XNI A;  2LX9 A;  1W4R A;  2O4X B;  2HAX A;  3A8M B;  2M16 A;  4PJO G;  3JB9 H;  2XHC A;  3M9Q A;  3CCL A;  2XKO C;  1NZ9 A;  2KY9 A;  3VJP A;  3S3N A;  3A8G B;  1W2B S;  4JLI A;  5CK9 A;  3RKX A;  4GY5 A;  2GVI A;  1D3B B;  3CBP A;  3M53 A;  4C5I A;  1IRE B;  2E6N A;  2FB7 A;  2KK4 A;  2A7Y A;  3C12 A;  3FDR A;  3OMC A;  4BI4 A;  2DZ9 A;  5A2Q E;  3JCM W;  1VQO T;  1N13 A;  5FU7 B;  2LT4 A;  3LGL A;  1EN7 A;  4J8O A;  4JLG A;  4UXJ A;  1NJI C;  1TBO A;  2ZCF B;  4B9W A;  4XTW A;  2JN0 A;  1W4S A;  4BY6 C;  2RO0 A;  5M9O A;  1FAQ A;  3JCM f;  5CKE A;  1VQ7 A;  1WNL A;  1UB4 A;  2KQW A;  2X4X A;  5A0G A;  2BKD N;  4QW2 A;  5I21 A;  5KH6 A;  5LJ5 e;  2L3R A;  3OMG A;  4RG2 A;  4C0Z A;  3HFN A;  5FLX E;  3RMQ A;  3UPU A;  2QQD A;  5D6X A;  3S6W A;  3CCJ A;  3JCM e;  3INZ A;  1M1K U;  1VQL T;  4M7D E;  5CCM A;  2NU4 I;  5GMK i;  1Y8F A;  2ELI A;  4J7I A;  3VUB A;  4E1R A;  1U1T A;  1WJR A;  2YQP A;  2VYT A;  1BUS A;  1UGP B;  2AHJ B;  5IN1 A;  4DOW A;  3OYM A;  1CGI I;  1KQ2 A;  2KCX A;  5GAM g;  3OB9 A;  3CC4 T;  3OVO A;  3M57 A;  4LDW A;  5GAM h;  1TUR A;  2QQB A;  5L8R E;  3CPW A;  1JJ2 A;  4M77 C;  1KBF A;  5GMK l;  1UEB A;  5J26 A;  1K9M C;  2HD0 A;  1BIA A;  3GLX A;  1LR9 A;  1VQP T;  1LOJ A;  1HJA I;  1D3B A;  2K3X A;  5HI7 A;  4O5V A;  5GAO n;  3OS2 A;  4XTZ A;  1Q82 U;  2XU8 A;  3JCM V;  4E7L A;  5EX3 A;  2QNC A;  1PPF I;  5GAN 5;  2GF7 A;  1YHQ T;  2UZ3 A;  2RJE A;  3L2U A;  5I2M A;  4BI3 A;  1FYB A;  1VQL A;  2X4J A;  2PU9 B;  5GAN 6;  1FAR A;  4F7U B;  2ZPI B;  4M75 C;  4OVA A;  1DS2 I;  4LDX A;  3BJI A;  2SGD I;  3GNF B;  3MHX A;  1VQ4 T;  1ZHI A;  2DTI A;  2E65 A;  3JB9 F;  2ZPF B;  1R79 A;  1SGD I;  2RHZ A;  2Y4X A;  3A8L B;  2XG8 D;  3QKJ A;  4HA8 A;  4EPC A;  3CXC A;  1CSO I;  3OL0 A;  2L8E A;  1Y71 A;  5LJ5 f;  2C06 A;  3RMS A;  3QJ6 A;  3VUZ A;  3HSB A;  4A4H A;  1JB0 E;  4BB7 A;  1VIE A;  4HGU A;  1VQP A;  3L2Q A;  1M8C A;  1Q86 U;  1AN1 I;  4M75 G;  3TJQ A;  1VQ5 T;  2QI2 A;  2ZPH B;  3L1A A;  3LGF A;  4IUT A;  2CS7 A;  4ZN1 A;  4F7U F;  4BE0 A;  2V8I A;  2LT1 A;  3M54 A;  3CXC S;  2RM4 A;  2RJC A;  3A8H B;  5GAM j;  2CGH A;  4HCC A;  2Y4Y A;  4BAC A;  1VIF A;  3CCE A;  2GKT I;  3CCQ T;  4M77 F;  4XU3 A;  4OB3 B;  2PUK B;  4IUR A;  1V1I A;  3OQ5 A;  1N9S A;  2OVO A;  2YRV A;  4L5G A;  3RUX A;  3LLR A;  4GI3 C;  1TOT A;  3OSS C;  1VQK T;  4C8Q B;  2LCC A;  3AHU A;  1Y7X A;  3UEY A;  5LL6 S;  4JS5 A;  2DVE A;  2LEO A;  3QBY A;  2DTO A;  2DXU A;  4EDU A;  3JB9 G;  1Q86 C;  3Q1J A;  4XTY A;  3SGB I;  1TBQ R;  4PJO F;  5J39 A;  1I4K 1;  1KG1 A;  3ER0 A;  3PNW C;  3TRE A;  3X20 B;  3OSV A;  2ROW A;  3G7Z A;  4M75 F;  2GCX A;  3QYH B;  4FSX A;  1WQ7 A;  3PT9 A;  1ZBX A;  4HT8 A;  4IKF A;  5DY9 A;  2KMT A;  4IUP A;  2EIF A;  4C5G A;  3QO3 A;  3PMT A;  4CI0 C;  1PJU A;  1TBR R;  5LJ3 f;  2QQR A;  1Q7Y C;  3CXL A;  4L9M A;  5KE3 A;  1H3Z A;  1EIF A;  3CPW S;  3CC7 T;  1GXI E;  1SGP I;  3WXM B;  4OB1 B;  4J7F A;  2DZC A;  1M4Z A;  2HBP A;  3C94 A;  4C92 F;  1YJW T;  2QQC A;  3PIO A;  3OXF A;  4UXH A;  3QG1 A;  2EYQ A;  4M77 B;  1I8F A;  4RCB A;  1VQK A;  4M7A F;  2J87 A;  2DKG A;  5CCA A;  3M58 A;  3UGI A;  5CAI A;  5GMK e;  3HPW A;  3G4S T;  2LVM A;  2X4W A;  2KMP A;  3L2Z A;  2RHI A;  5GMK j;  3HRT A;  4RCC A;  5CIU A;  1MHN A;  3CCV A;  2QA4 T;  1N8R C;  3E2I A;  4PNO A;  5CKB A;  1CE3 A;  2JUF A;  4X34 A;  5GAM d;  4PJO B;  2F5T X;  3M56 A;  3CCR T;  4J83 A;  4M7D C;  1CT0 I;  2N17 A;  3HL8 A;  2CZ1 B;  4BI8 B;  1X75 C;  1RL2 A;  1TH7 A;  3E1S A;  1VQ8 A;  3S3O A;  4XTX A;  3QDR B;  2K5F A;  3HFO A;  4IUU A;  1VQM T;  3X26 B;  2X4Y A;  3JCM d;  3CC7 A;  5GAM f;  3CCQ A;  4Q5W A;  2JYY A;  2LQK A;  1YBY A;  2EKO A;  1OYX A;  3LH0 A;  4J5Y A;  2M1H A;  4M7A D;  2VUB A;  1QVF A;  5DAE A;  2QNF A;  4E7H A;  2GQV A;  1VQN A;  4ZTJ A;  3QXE B;  4M78 F;  1E7D A;  3URG A;  5KCH A;  3G4S A;  2QDY B;  2YLC A;  5GAN e;  1Q81 C;  4II1 A;  1N8R U;  2HQE A;  3CBM A;  5IAY A;  2MAM A;  3MP8 A;  2XRC A;  3SGQ I;  1SGN I;  2K3Y A;  2NU2 I;  1M8B A;  3QSU A;  4C8Q A;  4D6W A;  4FKD A;  3TEE A;  2JW6 A;  3OW2 S;  3FJP A;  4RG8 A;  1BI2 A;  3RIR A;  3V8J A;  1NJI U;  1K8A C;  3E9F A;  4MML A;  1X01 A;  3GNG A;  3LYI A;  1X74 A;  1M90 U;  2M0O A;  1VQ8 T;  3TCJ A;  4C0G A;  1YU6 C;  1O9S A;  2BUD A;  2CZ0 B;  2YHT A;  3HRU A;  5GAN g;  2ENN A;  3QYG B;  4BE1 A;  1JJ2 S;  4Z02 A;  4ZTF A;  4Y28 E;  4CRI A;  3QZ9 B;  2E1H A;  2E70 A;  3CCJ T;  3DKM A;  4OF1 A;  3PFS A;  5C6S A;  1U5K A;  2P4T A;  1K73 C;  1KMA A;  2KMQ A;  1NE8 A;  1R0R I;  3QPH A;  4J6X A;  4DOV A;  3J7A F;  5CQX A;  1CT4 I;  3JCM J;  2V1C A;  2WSF E;  5LJ5 g;  1WPY A;  4NL3 A;  4ZGD B;  3OA6 A;  3CBO A;  1YIJ T;  3KY9 A;  4M7A B;  5KE2 A;  3V7R A;  2QQ9 A;  5LJ3 j;  5DLO A;  2DXC A;  3R6O A;  1I5L A;  2NU3 I;  1IW4 A;  5D6W A;  5GAO m;  5FU6 C;  4XU2 A;  3OXG A;  2ZPG B;  1P92 A;  4M78 C;  1BIB A;  2RJD A;  3QZ5 B;  3SD4 A;  4RMO A;  3LWH A;  4PJO E;  4M77 G;  3ASK A;  1HK9 A;  2EJG A;  4KBM B;  4QQD A;  3X24 B;  4LD6 A;  3GP8 A;  2QEX A;  3PDN A;  4NOY A;  4M7D B;  2VGM A;  1CHO I;  2IG0 A;  2LRQ A;  2PQW A;  2E5R A;  2DIQ A;  5DLQ E;  5GAN 8;  3L2R A;  1VQM A;  1YHQ A;  3ZEH A;  1YJ9 T;  2HNI A;  3LWI A;  1G3S A;  2FL7 A;  1XTD A;  4C8Q G;  5CR2 A;  1I81 A;  1NPP A;  5LJ3 e;  4DA4 A;  3H6Z A;  4LDU A;  4M7D D;  4E7K A;  1IY6 A;  4MZM A;  2L89 A;  1XX6 A;  3BY7 A;  4M77 E;  4M78 G;  5LJ3 g;  3CD6 T;  5GAN 7;  1VQ4 A;  2DXT A;  5FUW A;  5FUX A;  3OYK A;  1OI1 A;  4J6W A;  4M7A E;  2SGP I;  2WCY A;  1YIJ A;  4PL6 A;  3JCM X;  2L5Q A;  4MZT A;  3V7C A;  4C8Q F;  2E10 A;  3M59 A;  3PGG A;  3GOX A;  3CCM T;  1Q7Y U;  1V29 B;  4C8Q C;  4JUV A;  3CC2 T;  3DLM A;  4QQG A;  3BDU A;  4N0A C;  3MCA B;  3CME A;  2GKR I;  1YJN T;  2R58 A;  1Y96 B;  2EJ9 A;  2RI2 A;  1KC8 U;  3T9N A;  3DB4 A;  4HCB A;  3M5A A;  5GAO q;  3KUF A;  4TVR A;  3E59 A;  1HDL A;  2RH2 A;  4C5H A;  3TU4 K;  1B34 B;  4M75 E;  1Q82 C;  1KQS S;  2ZZD A;  2XI9 A;  2FHD A;  1KD1 C;  3EFR A;  1RI0 A;  2F5K A;  2PVG B;  3HP9 A;  2EWN A;  4FIB A;  4QQ6 A;  2XID A;  2MF2 A;  3G6E T;  2DO3 A;  1KQ1 A;  2VXF A;  3L42 A;  4FU6 A;  2JTM A;  1NPR A;  1XQH A;  4LDV A;  4A4G A;  1M1F A;  5LJ5 j;  5DM7 R;  5LJ3 d;  5GAN j;  2NU0 I;  1QP2 A;  3A5Z B;  3UGD A;  1IZ6 A;  4IUQ A;  5GAO p;  4PKC C;  3EAE A;  2XDB A;  1XBT A;  2O4X A;  2VGN A;  1MT1 A;  2A3L A;  4ATO A;  4UXI A;  3C4S A;  3HRS A;  5A0D A;  2ARP F;  4MDW A;  3ME9 A;  3MEA A;  4B6D A;  2XDP A;  4JDS A;  2OTJ A;  1VQ9 T;  5FRO A;  5D6Y A;  3VDP A;  3CME T;  1M1K C;  2RA2 A;  1BI3 A;  3LW5 E;  2DIP A;  1X6O A;  1W2B A;  3UFF A;  2DJZ A;  4FL6 A;  4HCZ A;  2YUU A;  4HKE A;  4C0D B;  2CKK A;  3P8D A;  3PTA A;  3FEO A;  1WJS A;  4F7U E;  5GAN 2;  1QP3 A;  3CCS A;  4M77 A;  2SGF I;  3P8B B;  2KMR A;  1OMU A;  3OYC A;  4ELZ C;  2MWP A;  1KHC A;  3OYA A;  3E9G A;  3I55 T;  2ORW A;  1BKB A;  3OBY A;  3KXT A;  4FT4 A;  4C5E A;  3VYG A;  4C8Q E;  4JJN K;  1KBE A;  2M9U A;  2VV5 A;  1FWZ A;  1UGS B;  1YIT A;  2DAQ A;  4X9C A;  3F70 A;  1N9R A;  2F3C I;  3B4V C;  4M75 D;  3MET A;  4X9D A;  1NUB A;  2JZM A;  2NLU A;  3JCM h;  4PJO D;  3HHT B;  3GPL A;  4M7A G;  2HQX A;  2BUS A;  2H3J A;  4SGB I;  4PJO A;  2VRW B;  4ME7 A;  4QVZ A;  4C92 C;  3L2V A;  5HK3 A;  2O01 E;  4LD9 K;  4OGC A;  3VKI A;  2QPO A;  1WQW A;  1LNX A;  2K57 A;  2RI5 A;  3S3M A;  4EMH A;  3N5B B;  3CCM A;  4MZP A;  5GAM e;  3NTI A;  3PIP A;  1QVG A;  1SSF A;  2QQS A;  2E12 A;  4LDY A;  2N71 A;  4OB2 B;  3CCV T;  2ERW A;  1YJN A;  2ENZ A;  3CCU A;  3MEK A;  3SEK C;  2V8J A;  3NFC A;  2JTF A;  5A0L A;  3OBW A;  4M77 D;  1QW1 A;  2R5A A;  3I55 A;  4P5N A;  5CKF A;  1VQ6 A;  3VYH B;  4C92 G;  3OYD A;  1N6A A;  1JRI A;  5CKD A;  4JS4 A;  2KMO A;  2GFA A;  2OAU A;  4IUV A;  3SWN C;  3V7S A;  5GAN f;  1QVG S;  4M7A A;  2ZPB B;  2W0T A;  2DIG A;  2MI6 A;  4PLL A;  3OYL A;  4M7D G;  4MDX A;  2SGE I;  1N27 A;  2WSC E;  1U1S A;  1VQ5 A;  1LR8 A;  3UT1 A;  3G71 T;  3FRN A;  4BE2 A;  1BI0 A;  4OMF B;  2XIC A;  3DB3 A;  1G3T A;  4QVD A;  2WVJ A;  3NTH A;  5FU7 C;  4XTV A;  4A4K A;  3V8L A;  3OY9 A;  2RB6 A;  3JCM g;  2QQE A;  5GAN 3;  2LQ8 A;  3SB2 A;  1HPT A;  2SGQ I;  4PJO C;  4GLK A;  5IT9 E;  1ZQ1 A;  4L59 A;  2A20 A;  3MP6 A;  4OP0 A;  3I56 A;  3P8H A;  2LDM A;  2B0U C;  4C0F A;  5EX0 A;  3OYI A;  1UVF A;  3SDZ A;  1JBM A;  2CJS C;  2EJF A;  2MMP A;  2IVW A;  4A53 A;  4L6V 5;  2GFU A;  4XAX B;  3ZFJ A;  2ORV A;  4E7I A;  1VQ6 T;  3QII A;  2QQ0 A;  5FU6 B;  5AYF A;  3J81 E;  4KUI A;  4BD3 A;  3BDL A;  2EFI A;  5LJ3 h;  3JCM b;  1CT2 I;  1SGR I;  2N1A B;  4RKU E;  1YIT T;  2JA1 A;  3SWN B;  2B8T A;  3RKW A;  3UGL A;  3ZBD A;  1KC8 C;  4NS5 A;  3GF5 A;  3KBG A;  2B8A A;  2JZ2 A;  1UUC A;  1BI1 A;  3C95 A;  4KUL A;  5CO7 A;  4JRK A;  4M78 A;  4C92 B;  3RER A;  2RK2 A;  4E7J A;  2K5L A;  4UC4 A;  1B34 A;  5HY6 A;  2D6F A;  4M75 A;  4A54 A;  2QTX A;  3L2W A;  2WAC A;  3UEJ A;  2OTL A;  2M5X A;  1MGQ A;  5CKH A;  3OYG A;  5GMK m;  1LR7 A;  1TBN A;  1M5Q 1;  3HKS A;  4BUG A;  1UGR B;  1R8O B;  4XU1 A;  2J9R A;  1H0Z A;  2V1C C;  5C0M A;  3OS5 A;  3BFM A;  3CMA T;  2NU1 I;  1G3W A;  2E6Z A;  4XK8 E;  5LJ5 h;  5JHW C;  3O8V A;  1X4S A;  2JOY A;  1M9S A;  3QHS A;  2N52 A;  1Y1B A;  3MP1 A;  3UDC A;  4A4F A;  2LNV A;  1M90 C;  4JRI A;  1K9M U;  1Q81 U;  5FUY A;  4OGE A;  5HK0 A;  2I2L A;  3BW1 A;  2V8K A;  4ZGJ B;  2FYK A;  3OYB A;  1Y07 A;  3QJY A;  2QA4 A;  1RFH A;  4VUB A;  4R55 A;  3MO8 A;  5FRM A;  2RD1 A;  4O6J A;  1UVG A;  1Z7K B;  3OYH A;  1DJ7 B;  2D0Q B;  2P0Q A;  5HKC A;  4C0D C;  2DEQ A;  3QUI A;  3JB9 I;  1YI2 T;  1K8A U;  1TIH A;  3FB9 A;  1PTQ A;  3X25 B;  5HQ8 A;  3QWP A;  2ODD A;  4QVC A;  1PSE A;  3M4Y A;  3OYN A;  2CZ7 B;  2OTL T;  1OMT A;  2E5Q A;  3CCE T;  2VXE A;  4C92 A;  4XQ3 A;  2F69 A;  2FVU A;  2LCL A;  3I56 T;  4KUD K;  2EQM A;  4C92 D;  2OD1 A;  2RJF A;  2D9T A;  4A4E A;  3JRZ A;  2EAY A;  1E7L A;  1V1H A;  4FM4 B;  3RU0 A;  2BIV A;  1OVO A;  3MEV A;  4ZN3 A;  3OYJ A;  1VDD A;  5I2S A;  2ZPE B;  3QTL D;  4ELY C;  3V8K A;  4JRQ A;  2K9H A;  3OW2 A;  1BYM A;  1QVP A;  1UGQ B;  1YCY A;  4EMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...