3FC3A

Crystal structure of the beta-beta-alpha-me type ii restriction endonuclease hpy99i
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
189
structure length
189
Chain Sequence
b'MLKNDDFVIAKNQLGNIVPNSVGVIRAVNGKSAMVLFIGLNELKRVDFSELEAIDIYRTGKGYDKKICNICHILKNTDGFEINQTDAKGRKTTRPSCRECRKNIDGVKLSSTEKKKMDEIAPPKGSVFTCPICEKRSIVGVTANLVHDHNHDTGWGREWICDSCNTGLGRFKDNPKFLEKVIEYLKKYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease Hpy99I
publication title Crystal structure of the beta beta alpha-Me type II restriction endonuclease Hpy99I with target DNA.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/dna
total genus 48
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02945 Endonuclease_7 Recombination endonuclease VII
A PF18350 SH3_17 Restriction endonuclease SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fc3A01
3.30.60.130 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3fc3A02
3.40.1800.10 Alpha Beta 3-Layer(aba) Sandwich His-Me finger endonuclease fold His-Me finger endonucleases 3fc3A03
4QQ6A 3OYDA 2D9TA 1SSFA 3OYHA 2K3XA 2X35A 3QJ6A 4C5IA 2RJEA 3PNWC 3UWNA 2F5KA 4IUPA 2M16A 2DIQA 2VYTA 2EKOA 3FDRA 2QQRA 2XDPA 2GFUA 4A4GA 4BACA 4Z02A 1OYXA 3FEOA 2RJDA 3S3MA 2XK0A 1E7DA 3OYJA 4BDZA 2RI5A 3OMGA 3BDLA 5KH6A 4QVZA 2BKDN 4BE2A 4E7JA 2R5AA 4E7IA 2YRVA 2P0KA 3E9GA 3META 4B9WA 3OB9A 3OYKA 4IKFA 3ME9A 5KCHA 3LH0A 3S3NA 3MEVA 3PFSA 3PMTA 3QKJA 4QW2A 2RJFA 2JTFA 4PLIA 5CIUA 3Q1JA 3L42A 3QIIA 5C0MA 4N4IA 3OA6A 2RHUA 3E9FA 3OS1A 2MWPA 1WGSA 3LX7A 4Q5WA 2CKKA 2L8DA 4IUUA 2EQKA 5C6SA 4BE0A 3F70A 3OY9A 2JZ2A 2PQWA 4IUVA 4A4FA 3LGLA 4II1A 2E5QA 3MP6A 3OYEA 5J26A 3KUFA 4LD6A 3L2RA 2R58A 4C5HA 1OI1A 4RG2A 3S6WA 2RHXA 2L89A 2LVMA 1KHCA 3OQ5A 3MP8A 2BIVA 2EQJA 3NTIA 3OYBA 2G3RA 2K3YA 4X34A 2MWOA 3UT1A 4BD3A 2RI3A 3O8VA 1EN7A 4BE1A 5KCOA 1OZ2A 3EAEA 3H6ZA 4IUQA 3OYLA 3L2UA 2DAQA 4IUTA 2GF7A 4IURA 5IN1A 3OMCA 5KE3A 4BDYA 3OYAA 3NTKA 3MEUA 4HCZA 2RHIA 3LLRA 5FRNA 2R5MA 2M1HA 4A4EA 2FHDA 3LGFA 3L2WA 4C5GA 2EQMA 2RHZA 2QNCA 4ZTFA 2EFIA 2BUDA 4CRIA 1XNIA 5FRMA 1G5VA 3MP1A 2RO0A 4QQDA 3DB4A 3NTHA 3MO8A 3OYMA 3OYCA 3CEYA 3P8DA 4QQGA 5FROA 3PMIA 4N4HA 3FC3A 4FU6A 1H3ZA 3MEAA 4PLLA 2LDMA 2HQXA 2O4XB 4B9XA 4FL6A 2LCCA 3LYIA 3P8HA 2RI2A 1OZ3A 4E7KA 1WJSA 2EQUA 3OYIA 1MHNA 4ZTJA 3FLGA 4C5EA 2X4XA 4N4GA 5IAYA 3QBYA 2B8AA 3OYFA 5D6XA 5KE2A 4E7LA 1WJQA 3ZEHA 2HQEA 3C4SA 2X4YA 2L3RA 5D6WA 3SD4A 1N27A 4PL6A 2GFAA 2LTOA 4UC4A 4E7HA 5D6YA 3L2VA 3M9QA 3MEWA 4EDUA 4GY5A 2QQSA 5J39A 3OS0A 4A4HA 2R57A 2WACA 1RI0A 2X4WA 3H8ZA 4OVAA 5M9OA 3L2QA 4NS5A 3S3OA 2DIGA 2O4XA 3ASKA 2E6NA 3OS2A 2IG0A 2QNFA 1WJRA 1E7LA 2NLUA 4L59A 3OYGA 2M0OA 3DLMA 2RJCA 3GOXA 2LRQA 2RHYA 3DB3A 3OYNA
chains in the Genus database with same CATH superfamily
4QQ6A 2FZCB 9WGAA 1ZSZA 2PQ8A 4C5IA 2ZCFB 3M59A 1K7UA 1WGTA 2E5KA 5GAMg 1MV0B 3PIOA 1NZ9A 4CC3A 1NUBA 1WXTA 1KD1R 1E7DA 1O9SA 2DKVA 2NU4I 2BKDN 2YRVA 5KYYA 4HT8A 2VB6A 2ESWA 1WGCA 2RPNA 2XICA 4CC2A 1WNLA 3EG2A 1AVZC 2LC4A 1C1AA 1M1FA 4JS5A 2DD4A 3FRNA 1Z7KB 1PD1A 2DX1A 1CGJI 3L2ZA 1WZOA 1Q95G 2IPOB 4M75C 1W3SA 1U8RA 5LJ5h 3UOEA 4EPCA 3SGQI 1QWEA 3SWNB 4X9CA 3I56Q 4BD3A 2RI3A 1Y96B 1KC8R 5IHKA 1HJAI 3UGIA 5FUWA 2XHCA 1IZ6A 3NTKA 4A4KA 1K9AA 1UVGA 3UGLA 4EMGA 5D7UA 2A3LA 2EFIA 4M75A 3VYGA 1VA7A 2A36A 1PTQA 3OYMA 4JZ4A 2O31A 4SGBI 2WSCE 5GAMf 2N1AB 2BZYA 3MEKA 1NLPC 2DVEA 3CD6T 1QVGP 1Q7YR 2DMOA 2V8KA 2F2WA 3C95A 3PT9A 3SHWA 1RLQC 5D6XA 1U1TA 4XAXB 3CCST 4F14A 1M1GA 2DF6A 3HRUA 4RCBA 4E7HA 1YHQT 1CGII 2G6FX 1EZZB 1VQ5Q 5M9OA 2P0PA 1TURA 2E64A 2Y4XA 3M4GA 4A54A 2K5IA 1UGSB 5GAMj 4L59A 2QQCA 1WQ7A 1UJYA 2E3HA 2PZ1A 5LL6S 1AWOA 1SGEI 2V1RA 4D8KA 1Y07A 4KULA 3RMSA 1OYXA 2DZ9A 5GAOp 2EJGA 5GAOn 4OMMA 3CD6A 4RTYA 4N0AA 3QDRB 4DBRA 1N13A 2R5AA 4B9WA 2ENMA 2BZ8A 2K5LA 1Q86C 3CCSA 2OTJT 3EFSA 4PLIA 2P84A 2RMOA 3UATA 1C6VX 2AT1B 1YHQA 4FIBA 3A8MB 4MMKA 3FJPA 2IIMA 4DOVA 1M90R 4IUVA 3R5AA 1HDLA 2CSQA 1K7VA 4ZGDB 2MPXC 5FU6C 1WHJA 3A98A 3HP9A 1VQ8Q 3CC7T 3QTLD 3VS5A 1JJ2P 1BKBA 2QTXA 2QTVA 2GBQA 3JB9H 4KUIA 2A0FB 4IURA 1C0MA 2FVUA 1BMOA 4PJOB 1WDXA 2D6FA 2VXEA 2ED1A 2OTJA 3V7SA 4JCVE 1RADB 1N8RU 1VQOT 4LUDA 4QVDA 1OQKA 1SG5A 5E3QA 3DB4A 2CZ0B 2DL5A 3A8GB 4J7FA 4M78F 1H3ZA 4FM4B 4KGVB 3REBB 4WTOB 1FMWA 2YUNA 3REAB 3JCMb 3VRYA 2K7AA 2QQDA 2KBTA 3ULRB 1VQNQ 1I81A 5HKCA 4HT9A 3CCVA 3CC7A 1R0CB 5LJ5g 4ZN1A 4KGZB 3C4SA 1V1CA 4PJOD 2QQBA 1E7OA 2PVDB 2DB6A 3SEKC 4EDUA 4GY5A 4C8QD 3CCRT 2CP3A 3ASKA 3A8LB 3CCET 5FLXE 2QQEA 1TU0B 2JXBA 3G6EQ 2BE7D 3OYGA 2M0OA 2NU2I 2LP5A 3JB9D 1Q82C 3EG3A 1X6GA 2KCXA 3FJ5A 1NBEB 2X35A 1FY7A 2KXCA 3VS7A 2F5KA 4IUPA 2MCNA 2L3PA 4A4GA 2DIQA 2HQHA 2JW6A 3CMEQ 1RAEB 2LZ6B 2ABLA 3BDUA 4E7IA 5CKDA 4PJNA 3QHSA 1T0JA 2L7XA 4FYXB 3MJXA 5FU7B 3X24B 1VQMT 2DVJA 1AZEA 3TQ7P 3QAHA 2CKKA 1YI2T 2EJFA 3CCRA 2ZPBB 2ZAEA 3SEMA 2YHTA 3UA7A 2DEQA 3CCEA 2CWFA 3KUFA 5AYFA 4C5HA 3UA6A 2NU1I 3KXTA 1TBQR 2EQJA 5LJ5f 1MMDA 2B0UC 1FAQA 1PSEA 1K1ZA 2JT4A 3CCUQ 1YJ9Q 5KYUB 4WF2A 1TOVA 4IUTA 1I8FA 4AG2C 2LB7A 5KE3A 2EYZA 1TUGB 3HH2C 1ZSZB 2MYSA 1OU8A 4M77G 2K9GA 2DIPA 1Y8FA 2RQTA 4ZTFA 2DK3A 2BUDA 4A63B 1VQMA 2AIRB 3EG1A 1D0XA 1I07A 1Q81C 1G5VA 2XMFA 1RAGB 1PPFI 4HCBA 2O9VA 1LR7A 2KMPA 3MO8A 4HCKA 4DBFA 1QP3A 2D1XA 2KMQA 2OZUA 3KBGA 1M9SA 1UE9A 5LJ5j 3E1SA 2CREA 1UECA 3QZ5B 7AT1B 1RL2A 2EBPA 3HKSA 2JS2A 1GCPA 3HRSA 2RQWA 3OW2A 2PUOB 4DA4A 1D1CA 5E3PA 3EGXA 2LTOA 4GLMA 3CBMA 3VYHB 1BIBA 4F7UF 1FYBA 4MDXA 1WA7A 1WHLA 1M30A 2MOXA 2DYIA 1RI0A 2KNBB 1B07A 3E2UA 4RTXA 2QNFA 5FUVA 1VYVA 4ATOA 5LJ3d 5DLOA 1RAIB 2XD0A 2LUYA 3TJQA 4C0GA 4RTWA 1W70A 5IHIA 1PRMC 2CUBA 4BDZA 3J81E 1YP5A 2VRWB 1FXXA 4J9IA 1T0HA 3EGDA 1HEVA 1WHHA 3MEVA 4D6WA 5I11A 1X74A 1PD0A 1YJWA 1SRMA 5AT1B 2KMRA 1VQ4Q 2C0OA 2WVJA 1WI7A 1I4K1 3LGLA 4OMLA 1YFNA 1SHFA 5FWCA 2ROLA 3OW2S 2L8EA 2NU0I 2JVVA 1YBYA 2KI7A 4ESRA 3TU4K 1K73C 3GIBA 1TBOA 1LVKA 5IH2A 3A8OB 1OX9A 3O8VA 2EW3A 3H6ZA 3G4SQ 2LQNA 2SGDI 2CT4A 2CGHA 5IN1A 3JB9J 1VYUA 3VV0A 1HXDA 2BE9B 1YNZA 4OB3B 5FRNA 2J6KA 1LNXA 3SB2A 1PKSA 2DZCA 4CRIA 3OYCA 5GAN2 5GANh 4F7UA 3NMZC 2DL3A 1EX4A 4BI3A 3WVDB 3VS3A 1VQPT 2F5TX 3VS1A 4OMOA 1YIJA 4ZN3A 1IO6A 5LJ3e 3VDUA 1PWTA 4V2SA 3QBYA 4JRPA 3OYFA 4E7LA 1PCXA 3RIRA 3SD4A 3O5ZA 3OXFA 1DS2I 2GFAA 4UC4A 3CCLQ 2DD5A 2J05A 1M1KR 1LPLA 2SEMA 3RNJA 2OTLQ 2XDBA 3QDFA 2D0QB 4NS5A 3HL8A 5CCMA 5HQ8A 2YUQA 2HKQB 2EJ9A 4XU2A 4JPBW 3U23A 3DB3A 1D0ZA 1K8AR 3OYDA 3CBPA 1VQ5T 1AWJA 1H92A 4LXCA 3ER0A 1JBMA 3FDRA 4HVWA 1FARA 3TCJA 2QQRA 1PZWA 4JJCA 4M75G 2EIFA 1VQPA 3BDLA 3ZBDA 1GFDA 4FT4A 2WSEE 1VQKT 1P92A 2DJQA 5FU6B 1SGQI 4EMKC 1VQ9A 3OS1A 3CCJQ 1M8CA 1JRIA 4IUUA 4BE0A 2JYYA 2D8HA 3OY9A 2JZ2A 4Z8AA 4R0KA 1SGRI 3MP6A 4LD6A 2JUFA 1S72A 3R6OA 2JW4A 1VQ6T 4XTYA 2RB6A 1X2QA 1ULMA 4DBQA 1MMGA 2K5FA 1ZQ1A 3M0TA 4M7AF 4EMKA 3OBWA 4KH1B 1VQ8T 3OYAA 3R5DA 2VWFA 3QUIA 5GAOm 3LW5E 1VQKA 4FKDA 4AMCA 1BI2A 2LT1A 2R5MA 4FW1A 1WQWA 2RHZA 2MAMA 5CKBA 1IRXA 3UPUA 4J9CA 4F04B 3CMAQ 2QA4Q 1LR8A 3H0HA 3GP8A 1H0ZA 1ARKA 4N4HA 4M7DF 3CC2T 1OYVI 1Q81U 4HKEA 3X20B 3G1JA 4BB7A 1ACMB 1W1FA 2GQIA 1MHNA 1KD1C 1WHGA 4M77E 2V1CC 1VQ6A 2VGNA 3C94A 2NUZA 1IXDA 2QXFA 2LX7A 3JCMP 1G83A 1SGPI 1U1SA 3X28B 3OS0A 3I5RA 1I5LA 3QXEB 3QG1A 1D1BA 2SGPI 4GBQA 4VUBA 1R0RI 4PK4A 2RJCA 3BFMA 2IVWA 4M7AC 4EMHA 1UDLA 1D3BB 5GAOl 2V1CA 3CC2A 1NG2A 3RKWA 2MIOA 4BI4A 2L3QA 2XDPA 1JXOA 2RI5A 1D1AA 5GANg 4X1VA 3D7SB 3E9GA 4A53A 1P9ZA 2GTJA 4M7DC 1XQHA 3CMET 1OOTA 1QKWA 4ZGEB 3Q1JA 2PVOB 3I55T 1QCNA 2DKGA 1VIEA 2DBKA 2L8DA 1K8AU 2COZA 2FO0A 4J83A 2K4YA 1F1BB 4M7AA 2ARPF 3RESA 2PQWA 2HMAA 4R55A 1Y1BA 5HCKA 1OULA 3EGXB 2RHXA 1NLOC 2C0TA 1IY5A 1ULKA 2WCYA 3CBOA 4FYYB 3OYBA 1XTDA 2G3RA 4HVUA 1KFZA 2FPDA 1VQLA 3QWXX 1JB0E 4M7DA 4E6RA 1K9MC 2GQVA 1K73U 2KGTA 1Z2IA 4OGCA 3UEYA 1BB9A 3H41A 3CCUT 2AKLA 3RBBB 1YJ9T 4C5GA 1UFFA 2FRWA 4C92C 1N8RR 3MP1A 2QDYB 3I55A 4LD9K 1X4SA 3NTHA 2DO3A 2XG8D 2KYBA 3PMIA 1BCOA 4PLLA 3EGDB 1VQ7Q 2EGEA 1NPRA 2CH4W 5GANf 1UGPB 2E73A 4JJDA 3MPUB 5A2QE 4PL6A 1K4US 3M4YA 2FZGB 2OD1A 2YQPA 2SRCA 3LH5A 1YITQ 4C92A 2O9SA 1UEBA 4OVAA 2P6AC 2YSQA 3TOBA 1PG5B 4LN2A 4DBHA 2E6NA 1HD3A 4XU1A 2JM8A 2NLUA 2GKVA 3LWHA 2H3EB 4OP0A 2N71A 6AT1B 4HCCA 1E6GA 2KSSA 5IT9E 1DS3I 2HL5C 5HK3A 5GANj 2PUKB 3OXGA 1QVFA 4IIMA 1BBZA 2HSEB 3H0FA 4QVZA 2DE0X 2K79A 2ED0A 2YUOA 1PRLC 3HRTA 3OB9A 2COWA 2HAXA 4F7UB 1T3SA 3TREA 3L42A 2PU9B 3SFMA 1BIAA 2W0ZA 2GCXA 4M75E 1ULNA 3QWYA 5GJVB 2J6FA 1S72Q 1AT1B 2CP2A 4C92E 1WHKA 5LJ5d 4C0ZA 2L0AA 4J6WA 2LVMA 3OQ5A 1QW1A 3FSYA 3R5CA 1KBFA 1M4ZA 4J7IA 4JRKA 5CQYA 4JJBA 4IUQA 3JV3A 3SGBI 5JHWC 2LNVA 3G71Q 2E12A 3LLRA 3QO3A 3URGA 3QYHB 2DL7A 2MMPA 4J8OA 4PFOA 1I0CA 1QVFS 1I5OB 5GJWB 1PM3A 2VC8A 1PNJA 3THKA 3NFCA 4IIOA 1UG1A 3CC4Q 2L5QA 2E1HA 2LCSA 2FYKA 1NEGA 3LYIA 3P8HA 1Q9BA 2QDLA 1Y0MA 4QKUA 3M0RA 5CKEA 8ATCB 1QVFP 3X25B 2GIVA 1E6HA 4M77B 1CT2I 1TGSI 3HHTB 1N27A 4KT0E 2FB7A 1QCFA 5D6YA 2DL8A 1EFNA 3L2VA 3MEWA 4F17A 4D8DA 4C0FA 2JTEA 2R57A 1UGQB 3GF5A 1WFWA 1YWOA 4ELYC 1SRLA 1MT1A 2EGCA 4BE2A 1D0YA 5GAN5 2KMOA 4MPIA 2K6DA 4BY6C 4JLIA 2NUPA 2KDPA 3QJ6A 1SGNI 2A7YA 3PNWC 1G3WA 2C0IA 5GAN4 1U3OA 1D09B 1Z9ZA 3S3MA 1UGVA 4M77D 1WXBA 1YJNQ 1V1IA 1LCKA 3D00A 4MDWA 3PTAA 1K76A 3RUXA 3ME9A 3VKIA 3PGGA 4F7UG 1TUDA 2YLBA 4AG1C 4Y28E 4MZMA 1BI0A 2E4HA 4N4IA 1TIHA 4HGUA 2MWPA 3LX7A 3A5ZB 5KYWA 1VQOA 1Q86R 2WGCA 5C6SA 3JCMX 1HSQA 3F70A 4WP4A 1TTHB 1NJIC 2AZSA 4A4FA 2EYXA 3V8JA 4OB1B 3WVEB 3E19A 3RMQA 2L2PA 1UHAA 1GCQC 1NEBA 3MP8A 2CYZB 1EIFA 4M78C 2DXUA 3ZL7C 3HFOA 4LDVA 2DTOA 5FUYA 2YDLA 3H9NA 2HBPA 5CO7A 2YUPA 2RIJA 2AK5A 4BDYA 2X9HA 2ORVA 2AHJB 2M1HA 3LGFA 3MCAB 3CCMT 1K9MU 2DXTA 3JSCA 1GBRA 2J6OA 2RN8A 2QEXT 2SGEI 2KY9A 2RO0A 2ENZA 2E10A 2FNFX 1RABB 2NYSA 4QQGA 2EYWA 2D8JA 1GCQA 1BK2A 2VUBA 4GLKA 5LJ3h 2LDMA 1XBTA 2QA4T 4M78A 4F16A 2EPDA 3BE3A 1BUSA 3R6NA 1IHWA 5CCLA 2Y4YA 2RQRA 1OX8A 5IAYA 1IGQA 4RTZA 4LDWA 4M7AB 2V8JA 2JS0A 4LUEA 3M53A 4OB0B 4OMQA 3TSWA 1W4RA 5J8CA 1JU5C 1YI2A 5KYYB 2O4XA 2RQVA 1Y71A 2IG0A 2HKNA 3CCMA 1SEMA 4FW2A 4RTUA 2A20A 4RKUE 3OYNA 2QEXA 2CJSC 1KHIA 3UDCA 4FSSA 3CCQT 3TO6A 1IB8A 2X52A 1AEYA 4Y92A 1LR9A 2ZPGB 4CC7A 3OYJA 4PKCC 4DEXA 2GKTI 1IREB 1TOTA 3VE5A 5CKFA 2LJ1A 3S3NA 2KRMA 2OU2A 5C0MA 2RHUA 3SDZA 5DY9A 3EG0A 5IXBA 2KR3A 2JNGA 2O01E 4QT7A 1X6OA 4FT2A 3CD6Q 2YXYA 3GNFB 1FMKA 2R58A 3SWNC 5HY6A 3EG9A 2VGMA 1OI1A 4M75B 2BIVA 3NTIA 4C92B 3UEJA 2LMJA 3CCQA 2MWOA 3BY7A 1HPTA 1WX6A 3CCSQ 3JCMJ 1J3TA 3JAME 1YHQQ 1IHVA 1TG0A 4K11A 1M3AA 3OMCA 1TSFA 1KMAA 2A37A 1Q86U 2CSIA 4ELZC 3QPHA 4A4EA 3L2WA 2E5RA 2I0NA 3PIPA 1G2BA 3QSUA 2F1LA 1XNIA 2SGFI 3TSZA 3SWNA 3JRZA 5FROA 1RI9A 2RA2A 4M75D 4FU6A 1Y96A 2ATCB 4C92D 1Q81R 2E65A 3HFNA 4J9GA 2CH4A 2VV5A 1N9SA 2VKNA 1WJSA 3HPWA 4C5EA 2QGFB 3VRZA 3OW2P 4M7AG 1MNDA 2YWWA 1CT0I 5KE2A 3I56T 3ZEHA 4OMFB 2OTJQ 1ZLMA 3EH1A 4KRTA 4PJJA 5J8FA 2HEQA 3NGPA 1KQ1A 2LQKA 1DJ7B 1AN1I 2WACA 4JRIA 1TXQA 4PJOF 3GOXA 1VOMA 4E7KA 4M7DG 2OI3A 1SSFA 2EKHA 2ZGWA 3CCVQ 3CC7Q 1ZBXA 2JMCA 2CT3A 4C8QF 3JCMd 4JJNK 1FMVA 4ME7A 3UFFA 1ABQA 1OPLA 1H3HA 3FSXA 1SGYI 3JB9F 3J7AF 5I21A 4BUGA 1U06A 2L3SA 2COYA 3OYKA 5LJ3g 4J9FA 5KCHA 4O6JA 1Y1CA 1QKXA 3I56A 3AT1B 1AHJB 2QGGA 2YRCA 5CKHA 5CR2A 4FSXA 4Q5WA 1X75C 1M3BA 3AHUA 2CP5A 2B86A 1WPYA 4RMOA 1G3SA 1Q82U 2V26A 4Z89A 2CZ6B 4RTTA 4M4ZA 1LJOA 1UUCA 3S6WA 1X69A 1IY6A 2L89A 2W10A 2LNHB 4C92G 4F7UE 2V1QA 2QYZA 4JRQA 1GXIE 4X34A 4ZGJB 1QWFA 1YWPA 1EN7A 2XI9A 2M9UA 1GL5A 4E7ZA 4PJOC 2P0QA 1K73R 1K0XA 4NL3A 2NUPB 5GMKe 3CCRQ 2KK4A 4C8QC 3VS2A 1T3LA 3CCEQ 4TVRA 1WYXA 2BTTA 5FW9A 2RF0A 1XX6A 3P8BB 3NPFA 4PFPA 1PHTA 1M8MA 2JXDA 1VQ5A 1RACB 1M2OA 5DM7R 5L23A 4PNOA 4UXHA 3M58A 3HSBA 2F3CI 3FLGA 5LJ3f 4PJOA 1JXMA 1TBNA 3INZA 2F2VA 2HQEA 3JCMe 2X4YA 2K57A 3CPWA 1VQMQ 4C8QA 2KRSA 3RKYA 3L1AA 4L5GA 5GAMd 1RUWA 4A4HA 3TO9A 2KYMA 3OS2A 1JEGA 1R79A 1CE3A 1UHCA 1MNEA 4DQ2A 3QJYA 1BI1A 3UF4A 3V7CA 3DLLA 1QCOA 1QVPA 2CZ1B 1RFHA 2OAUA 1RAAB 2VYTA 5KYNA 2GFUA 3FIFA 5LJ3j 1BYMA 1WXUA 2DPPB 1V76A 5GMKm 1VQNT 2X3XD 5HI7A 2N17A 1VQ8A 4IKFA 2CWHA 3CQTA 4FYVB 5CCAA 4XK8E 4QW2A 2H8HA 5CIUA 1XA6A 1N6AA 4XQ3A 4M78B 2X3TA 1U5SA 4KGXB 4HA8A 4J9HA 5J26A 3G6ET 1B34A 1R8OB 1SKUB 3X26B 2FEIA 3E59A 3LWIA 1KC8C 3PE0A 3CPWS 1ZBJA 5GAN8 2K3YA 3RERA 3BW1A 4AFZC 1YJWQ 3RDVA 1AZGB 4CI0C 1W2BA 1VQNA 3EFOA 2RHIA 3QWPA 1KIKA 4E2FB 1HYOA 2QNCA 5DLQE 2RNAA 2J87A 1UB4A 1VDDA 5GAN7 1RAHB 2QG9B 2ENNA 3BJIA 1XOVA 5GMKl 3M5AA 5GAMe 1Q7YC 3FC3A 3MEAA 2RC4A 2YT6A 2FRYA 3G6EA 3OYYA 1P9GA 3HTRA 3VUBA 1QVGA 4UXJA 1JO8A 4J9EA 3CMEA 3GLXA 4XTXA 1UHFA 2F69A 2MI6A 2RM4A 3A8HB 3M9QA 4Y91A 3EG9B 1NXUA 1Z9QA 4KH0B 3S3OA 2RK2A 3OSSC 2DERA 1YIJQ 3VS6A 3OXLA 1PJUA 4M7AE 2K3XA 3C0CA 4LDXA 1CT4I 2EAYA 5ECAA 1W2BS 2M5XA 2EKOA 4OVOA 1KSWA 3RKXA 4R56A 4BACA 2RJDA 1RLPC 1Y7XA 1KK7A 1AD5A 3EHRA 4OMNA 4E7JA 1TWBA 4LNPA 2Y90A 1FWZA 1NYFA 2P4TA 4ANJA 4A24A 4JUVA 3PFSA 1KG1A 3CCUA 4M7DE 2DXBA 1YJ9A 3M57A 1M90C 3OA6A 3E9FA 4M78G 4XTWA 1W2BP 4OB2B 1ZX6A 1KQSA 4KUDK 2ECZA 5I2MA 1CSKA 2EYQA 1NYGA 1QVGS 2GKRI 4RUGA 2DFUA 3OYEA 4ZNXA 4NL2A 2XIDA 1AWXA 5FUXA 4HXJA 3JCMQ 1VQPQ 2CP6A 1KHCA 1NPPA 1JJ2A 2JTMA 3M0PA 4ORZA 3CXLA 5KCOA 1VQ9Q 2DAQA 1H641 2GF7A 2J06A 5HK0A 2JN0A 2HNIA 1RAFB 4HCZA 2VXFA 2WSFE 4N0AC 1K9MR 1K7TA 1AOJA 1ZA1B 3VJPA 1FYNA 1KBEA 2HD0A 3WXMB 1ABOA 4PJLA 2XDDA 2KAFA 1VQ4T 4LE9A 2LQWA 2ERWA 1OZ3A 2EQUA 2EGAA 1VQKQ 2ODDA 2EQIA 3I9QA 1M27C 1S1NA 1WJQA 2E70A 2HZYA 2MF2A 1KQSS 1HK9A 1YU6C 3G4ST 2LT4A 1CKBA 1TS9A 3JCMW 3EHQA 3EGUA 2GGRA 2PVGB 2KQWA 2DIGA 2EYYA 2DYBA 3OVOA 5GMKi 2ORWA 2B8TA 1W4SA 1JJ2S 4HVVA 1KQSP 1MJBA 4XU3A 2DM1A 3OYHA 1VQ6Q 3I5SA 1VQ4A 4XTVA 2DTIA 2XKOC 3FEOA 3EH2A 1KD1U 1M3CA 1CHOI 2EWNA 1KJWA 3M54A 3CCVT 2P0KA 4EIKA 1CKAA 1IW4A 3PMTA 2KROA 2JTFA 1IGUA 1X01A 1QLYA 3CCLT 3RU0A 1B3QA 3G4SA 2FG0A 2OAWA 3OBYA 2LEOA 5IHNA 2OTLT 4J5YA 2O88A 4EMKB 2HBWA 4DEYA 3CC2Q 2LJ3A 2ZPIB 2E5QA 2SGQI 2X51A 3L2RA 4C8QB 2OVOA 3CXCA 3OL0A 1WKXA 5LJ5e 4E1PA 2I2LA 3UT1A 2QQAA 4YTLA 3H0IA 4BE1A 5EC7A 1KC8U 5I2SA 1W6XA 4J6XA 3RR6A 3QYGB 3PDNA 4O5VA 3TVTA 3JB9I 5I22A 3MHXA 4OGEA 4AMLA 1R77A 3CCLA 3CCJT 2ROWA 5EX0A 4FCYA 2DRMA 3CEYA 2OTLA 1PTRA 1VQLQ 2LQ8A 2LCCA 2NU3I 2KVQG 2JJ9A 3M0SA 1Q7YU 1OMTA 2Y0MA 2QQ0A 3EFRA 3IQLA 3JCMc 1MUZA 2BZXA 4MZTA 3NHNA 1KQ2A 1NE8A 5CK9A 2L3RA 5D6WA 2LJ0A 2NUTA 2K2MA 5A0GA 1QP2A 1X6BA 3KFVA 1MV3A 3I55Q 3MKDA 1B34B 1OEBA 1CSOI 4UXIA 3CXCS 2JM9A 1N9RA 4C0DC 2GVIA 3DLMA 2HL3A 3CMAT 3CCJA 3N5BB 1V1HA 2JOYA 2DL4A 3EFOB 2YRDA 2M16A 5GAN6 4MMLA 3TOAA 1M8BA 2ZPFB 2FZKB 1WIEA 3C12A 3CXCP 3OMGA 2MK5A 2ROTA 1R0BG 7WGAA 4DOWA 2V8IA 1H8KA 2VASA 2DRKA 2HSPA 1QQJA 1D3BA 1VUBA 1V29B 4M7DB 4PJOG 4FYWB 1QMCA 4CC4B 2P4RA 3B4VC 1M90U 2VVKA 1OPKA 1SF9A 1Q82R 1WTJA 1GRIA 5J3BA 4M7AD 3GBQA 5A0DA 4C8QG 4B6MA 2KT8A 1PCEA 3V8LA 2QA4A 3CMAA 3PVQA 4PJMA 2QK0A 1M2VA 1NJIR 4XTUA 1SSHA 5IXFA 2EVRA 2QAZA 5E3RA 3JB9G 2W0TA 4P5NA 5KYXA 2HCKA 4M78E 5GMKh 2D0NA 1M8VA 1TH7A 1VYTA 3MEUA 3M0UA 4M7DD 1OU9A 2FHDA 2N1UA 2J9RA 1YJWT 2Z0WA 2KMTA 1AWWA 1ZA2B 1OVOA 1GBQA 2E41A 2PTKA 3OSVA 2RQUA 4MZPA 1I1JA 2CZ7B 3I35A 1WHMA 3JCMV 1YTPA 5DAEA 4B9XA 2X4JA 3OYIA 3UGDA 3JCMh 4N4GA 1A0NB 3M55A 1M1KC 3VUZA 1UTIA 4RG8A 2KDSA 3R5BA 4X9DA 1TUCA 4J9BA 2QQSA 2X4WA 1FX7A 3H8ZA 3L2QA 1K8AC 1O75A 5GAOr 1OMUA 4JLGA 3TEEA 1SGDI 1E7LA 3M56A 2YLCA 2RK1A 4AFQC 1PC0A 1Y57A 2DEUA 4L6V5 3OS5A 3UWNA 1YCSB 2NWMA 1VQ7T 4WCIA 4JZ3A 2XK0A 2PNIA 2JMAA 1YIJT 3VU3C 2CP7A 2CDTA 2RH2A 2UVOA 2DA9A 2UZ3A 3M0QA 4NOYA 1VIFA 4LDUA 3LH0A 2QPOA 2RJFA 3CPFA 1X27A 2ZPHB 3PVLA 4M77F 2XU8A 1WGSA 1PSFA 3DKMA 1N5ZA 1YITT 2V53A 2FL7A 3FB9A 4AFSC 1SHGA 4AT1B 1BCMA 2E6ZA 1ZUUA 2CUDA 4RG2A 1HJDA 2KXDA 2GTOA 5CVIA 3VDPA 1VQ7A 3OYLA 3L2UA 2XRCA 2M0YA 1VQOQ 4DNCA 1SPKA 4E1RA 2QQ9A 1ZUYA 2FPEA 3J80E 2CP0A 2DXCA 2EQMA 3T9NA 1VQ9T 5GAMh 3GNGA 2DBMA 1YITA 2KT1A 3P8DA 1NJIU 9ATCB 1MGQA 2ZPEB 1OV3A 2HDAA 2HQXA 1X2KA 1S72T 4FL6A 2RI2A 1G3TA 5CAIA 4M77C 3A1PA 3VS4A 2JA1A 4B6DA 5A0LA 4L9MA 1YCYA 1K0SA 1G8XA 1X43A 2KEAA 2M02A 2DTHA 5GAOq 1U5KA 1JQQA 3G71T 4J6YA 2K2VA 4JS4A 1M5Q1 1PKTA 4OF1A 5J39A 1B7TA 2DETA 4PFZA 1ZUKA 5GANd 3GPLA 3G7ZA 2RHYA 1LOJA 2M51A 5EG2A 3VS0A 2D9TA 5CQXA 2E3IA 2RJEA 4M77A 1UGRB 2CWGA 5KYWB 8AT1B 2QASA 4BY6B 4Z02A 3CC4T 4XTZA 3KY9A 5KH6A 5EX3A 3META 4OMPA 1YI2Q 4BI8B 2F2XA 2N52A 3QKJA 1ZSGA 3CCMQ 1MMAA 3JCMg 3QIIA 2QEXQ 2DJZA 3G71A 2EQKA 2CS7A 4II1A 4XU0A 2AZVA 1S20A 2NUTB 1WLPB 2OX7A 4RTVA 1UVFA 3V8KA 2H3JA 5FU7C 2BUSA 1MJAA 3TO7A 4KBMB 2K3BA 5GAN3 2KE9A 4GI3C 1YN8A 1MMNA 2ZZDA 2ELIA 2JZMA 1OZ2A 3EAEA 3CC4A 4JDSA 1ZHIA 1YJNT 4PJOE 1GFCA 2RD1A 1N8RC 1BI3A 3QZ9B 2DILA 4C8QE 3E2IA 5FRMA 5FWBA 2YUUA 2FPFA 4QQDA 2GNCA 4RCCA 3CCQQ 1TUSA 1MJ9A 4QVCA 2X3WD 2QI2A 5L8RE 1UJ0A 4AFUC 2O4XB 1ZSZC 2K9HA 3V7RA 2DLPA 5GANe 4ZTJA 2X4XA 4C0DB 2LCLA 4M78D 2J7IA 2B8AA 2A28A 4M75F 2LX9A 1VQLT 4C92F 3JCMf 3CPWP 5GMKj 2O2OA 1UUEA 2OJ2A 1XJWB 1YJNA 1M1KU 1G3YA 1NM7A 2DNUA 4E47A 1M2VB 2C06A 2KRNA 4Z88A 4E7SA 5KYUA 3ZFJA 4J9DA 2A08A 1WJRA 2AKKA 5KYXB 1BU1A 1TBRR 4LDYA 2LRQA
chains in the Genus database with same CATH topology
4QQ6A 4C5IA 2ZCFB 3M59A 5GAMg 3PIOA 1NZ9A 1NUBA 1E7DA 1O9SA 2NU4I 2BKDN 2YRVA 4HT8A 2XICA 1WNLA 2LC4A 1M1FA 4JS5A 2DD4A 3FRNA 1Z7KB 1CGJI 3L2ZA 4M75C 1W3SA 1U8RA 5LJ5h 4EPCA 3SGQI 3SWNB 4X9CA 4BD3A 2RI3A 1Y96B 1HJAI 3UGIA 5FUWA 2XHCA 1IZ6A 3NTKA 4A4KA 1UVGA 3UGLA 4EMGA 2A3LA 2EFIA 4M75A 3VYGA 1PTQA 3OYMA 4SGBI 2WSCE 5GAMf 2N1AB 3MEKA 2DVEA 3CD6T 2V8KA 3C95A 3PT9A 5D6XA 1U1TA 4XAXB 3CCST 1M1GA 3HRUA 4RCBA 4E7HA 1YHQT 1CGII 5M9OA 2P0PA 1TURA 2E64A 2Y4XA 3M4GA 4A54A 2K5IA 1UGSB 5GAMj 4L59A 2QQCA 1WQ7A 5LL6S 1SGEI 1Y07A 4KULA 3RMSA 1OYXA 2DZ9A 5GAOp 2EJGA 5GAOn 3CD6A 4N0AA 3QDRB 1N13A 2R5AA 4B9WA 2K5LA 1Q86C 3CCSA 2OTJT 3EFSA 4PLIA 1YHQA 4FIBA 3A8MB 4MMKA 3FJPA 4DOVA 4IUVA 1HDLA 4ZGDB 5FU6C 3HP9A 3CC7T 3QTLD 1BKBA 2QTXA 3JB9H 4KUIA 4IURA 2FVUA 1BMOA 4PJOB 2D6FA 2VXEA 2OTJA 3V7SA 4JCVE 1N8RU 1VQOT 4QVDA 3DB4A 2CZ0B 3A8GB 4J7FA 4M78F 1H3ZA 4FM4B 3JCMb 2QQDA 1I81A 5HKCA 4HT9A 3CCVA 3CC7A 5LJ5g 4ZN1A 3C4SA 4PJOD 2QQBA 2PVDB 2DB6A 3SEKC 4EDUA 4GY5A 4C8QD 3CCRT 3ASKA 3A8LB 3CCET 5FLXE 2QQEA 3OYGA 2M0OA 2NU2I 3JB9D 1Q82C 2KCXA 2X35A 2F5KA 4IUPA 4A4GA 2DIQA 2JW6A 3BDUA 4E7IA 5CKDA 3QHSA 2L7XA 5FU7B 3X24B 1VQMT 2CKKA 1YI2T 2EJFA 3CCRA 2ZPBB 2YHTA 2DEQA 3CCEA 3KUFA 5AYFA 4C5HA 2NU1I 3KXTA 1TBQR 2EQJA 5LJ5f 1FAQA 1PSEA 4WF2A 4IUTA 1I8FA 5KE3A 3HH2C 4M77G 2DIPA 1Y8FA 4ZTFA 2DK3A 2BUDA 1VQMA 1Q81C 1G5VA 1PPFI 4HCBA 1LR7A 2KMPA 3MO8A 1QP3A 2KMQA 3KBGA 1M9SA 5LJ5j 3E1SA 3QZ5B 1RL2A 3HKSA 3HRSA 3OW2A 2PUOB 4DA4A 2LTOA 3CBMA 3VYHB 1BIBA 4F7UF 1FYBA 4MDXA 1RI0A 2QNFA 5FUVA 4ATOA 5LJ3d 5DLOA 2XD0A 2LUYA 3TJQA 4C0GA 4BDZA 3J81E 2VRWB 1FXXA 3MEVA 4D6WA 1X74A 1YJWA 2KMRA 2WVJA 1I4K1 3LGLA 3OW2S 2L8EA 2NU0I 2JVVA 1YBYA 3TU4K 1K73C 3GIBA 1TBOA 3A8OB 3O8VA 3H6ZA 2SGDI 2CGHA 5IN1A 3JB9J 3VV0A 1HXDA 4OB3B 5FRNA 1LNXA 3SB2A 2DZCA 4CRIA 3OYCA 5GAN2 5GANh 4F7UA 4BI3A 3WVDB 1VQPT 2F5TX 1YIJA 4ZN3A 5LJ3e 3VDUA 4V2SA 3QBYA 4JRPA 3OYFA 4E7LA 3RIRA 3SD4A 3OXFA 1DS2I 2GFAA 4UC4A 2DD5A 2XDBA 2D0QB 4NS5A 3HL8A 5CCMA 5HQ8A 2EJ9A 4XU2A 3DB3A 3OYDA 3CBPA 1VQ5T 3ER0A 1JBMA 3FDRA 1FARA 3TCJA 2QQRA 4M75G 2EIFA 1VQPA 3BDLA 3ZBDA 4FT4A 2WSEE 1VQKT 1P92A 5FU6B 1SGQI 4EMKC 1VQ9A 3OS1A 1M8CA 1JRIA 4IUUA 4BE0A 2JYYA 3OY9A 2JZ2A 1SGRI 3MP6A 4LD6A 2JUFA 1S72A 3R6OA 1VQ6T 4XTYA 2RB6A 2K5FA 1ZQ1A 4M7AF 4EMKA 3OBWA 1VQ8T 3OYAA 3QUIA 5GAOm 3LW5E 1VQKA 4FKDA 1BI2A 2LT1A 2R5MA 1WQWA 2RHZA 2MAMA 5CKBA 3UPUA 1LR8A 3GP8A 1H0ZA 4N4HA 4M7DF 3CC2T 1OYVI 1Q81U 4HKEA 3X20B 4BB7A 1MHNA 1KD1C 4M77E 2V1CC 1VQ6A 2VGNA 3C94A 2QXFA 3JCMP 1SGPI 1U1SA 3X28B 3OS0A 1I5LA 3QXEB 3QG1A 2SGPI 4VUBA 1R0RI 2RJCA 3BFMA 2IVWA 4M7AC 4EMHA 1D3BB 5GAOl 2V1CA 3CC2A 3RKWA 4BI4A 2XDPA 2RI5A 5GANg 3E9GA 4A53A 4M7DC 1XQHA 3CMET 4ZGEB 3Q1JA 2PVOB 3I55T 2DKGA 1VIEA 2L8DA 1K8AU 4J83A 2K4YA 4M7AA 2ARPF 3RESA 2PQWA 4R55A 1Y1BA 2RHXA 1IY5A 2WCYA 3CBOA 3OYBA 1XTDA 2G3RA 1VQLA 1JB0E 4M7DA 1K9MC 2GQVA 1K73U 4OGCA 3UEYA 3CCUT 1YJ9T 4C5GA 4C92C 3MP1A 2QDYB 3I55A 4LD9K 1X4SA 3NTHA 2DO3A 2XG8D 3PMIA 4PLLA 1NPRA 5GANf 1UGPB 2E73A 5A2QE 4PL6A 3M4YA 2OD1A 2YQPA 4C92A 1UEBA 4OVAA 2P6AC 2E6NA 4XU1A 2NLUA 2GKVA 3LWHA 4OP0A 2N71A 4HCCA 2KSSA 5IT9E 1DS3I 5HK3A 5GANj 2PUKB 3OXGA 1QVFA 4QVZA 3OB9A 3HRTA 2HAXA 4F7UB 3TREA 3L42A 2PU9B 3SFMA 1BIAA 2GCXA 4M75E 4C92E 5LJ5d 4C0ZA 4J6WA 2LVMA 3OQ5A 1QW1A 1KBFA 1M4ZA 4J7IA 4JRKA 5CQYA 4IUQA 3SGBI 5JHWC 2LNVA 2E12A 3LLRA 3QO3A 3URGA 3QYHB 2MMPA 4J8OA 1QVFS 2VC8A 3NFCA 2L5QA 2E1HA 2FYKA 3LYIA 3P8HA 5CKEA 3X25B 4M77B 1CT2I 1TGSI 3HHTB 1N27A 4KT0E 2FB7A 5D6YA 3L2VA 3MEWA 4C0FA 2R57A 1UGQB 3GF5A 4ELYC 1MT1A 4BE2A 5GAN5 2KMOA 4BY6C 4JLIA 3QJ6A 1SGNI 2A7YA 3PNWC 1G3WA 5GAN4 3S3MA 4M77D 1V1IA 3D00A 4MDWA 3PTAA 3RUXA 3ME9A 3VKIA 3PGGA 4F7UG 2YLBA 4Y28E 4MZMA 1BI0A 4N4IA 1TIHA 4HGUA 2MWPA 3LX7A 3A5ZB 1VQOA 5C6SA 3JCMX 3F70A 1NJIC 4A4FA 3V8JA 4OB1B 3WVEB 3E19A 3RMQA 3MP8A 2CYZB 1EIFA 4M78C 2DXUA 3HFOA 4LDVA 2DTOA 5FUYA 2HBPA 5CO7A 4BDYA 2ORVA 2AHJB 2M1HA 3LGFA 3MCAB 3CCMT 1K9MU 2DXTA 3JSCA 2QEXT 2SGEI 2KY9A 2RO0A 2ENZA 2E10A 2FNFX 4QQGA 2VUBA 4GLKA 5LJ3h 2LDMA 1XBTA 2QA4T 4M78A 1BUSA 5CCLA 2Y4YA 5IAYA 4LDWA 4M7AB 2V8JA 3M53A 4OB0B 1W4RA 1YI2A 2O4XA 1Y71A 2IG0A 3CCMA 2A20A 3OYNA 2QEXA 4RKUE 2CJSC 1KHIA 3UDCA 3CCQT 1LR9A 2ZPGB 3OYJA 4PKCC 2GKTI 1IREB 1TOTA 3VE5A 5CKFA 3S3NA 5C0MA 2RHUA 3SDZA 5DY9A 2JNGA 2O01E 1X6OA 4FT2A 3GNFB 2R58A 3SWNC 5HY6A 2VGMA 1OI1A 4M75B 2BIVA 3NTIA 4C92B 3UEJA 3CCQA 2MWOA 3BY7A 1HPTA 3JCMJ 3JAME 3OMCA 1KMAA 1Q86U 4ELZC 3QPHA 4A4EA 3L2WA 2E5RA 3PIPA 3QSUA 1XNIA 2SGFI 3SWNA 3JRZA 5FROA 2RA2A 4M75D 4FU6A 1Y96A 4C92D 2E65A 3HFNA 2VV5A 1N9SA 1WJSA 3HPWA 4C5EA 4M7AG 1CT0I 5KE2A 3I56T 3ZEHA 4OMFB 1KQ1A 2LQKA 1DJ7B 1AN1I 2WACA 4JRIA 4PJOF 3GOXA 4M7DG 4E7KA 1SSFA 2ZGWA 1ZBXA 4C8QF 3JCMd 4JJNK 4ME7A 3UFFA 1SGYI 3JB9F 3J7AF 5I21A 4BUGA 3OYKA 5LJ3g 5KCHA 4O6JA 1Y1CA 3I56A 1AHJB 5CKHA 5CR2A 4FSXA 4Q5WA 1X75C 3AHUA 1WPYA 4RMOA 1G3SA 1Q82U 2CZ6B 1LJOA 1UUCA 3S6WA 1IY6A 2L89A 4C92G 4F7UE 4JRQA 1GXIE 4X34A 4ZGJB 1EN7A 2XI9A 2M9UA 4PJOC 2P0QA 4NL3A 5GMKe 2KK4A 4C8QC 4TVRA 1XX6A 3P8BB 2JXDA 1VQ5A 5DM7R 4PNOA 4UXHA 3M58A 3HSBA 2F3CI 3FLGA 5LJ3f 4PJOA 1TBNA 3INZA 2HQEA 3JCMe 2X4YA 2K57A 3CPWA 4C8QA 3RKYA 3L1AA 4L5GA 5GAMd 4A4HA 2LRQA 3OS2A 1R79A 1CE3A 4DQ2A 3QJYA 1BI1A 3V7CA 3DLLA 1RFHA 1QVPA 2CZ1B 2OAUA 2VYTA 2GFUA 3FIFA 5LJ3j 1BYMA 2DPPB 5GMKm 1VQNT 5HI7A 2N17A 1VQ8A 4IKFA 5CCAA 4XK8E 4QW2A 5CIUA 1XA6A 1N6AA 4XQ3A 4M78B 4HA8A 5J26A 3G6ET 1B34A 1R8OB 3X26B 3E59A 3LWIA 1KC8C 3CPWS 5GAN8 2K3YA 3RERA 3BW1A 4CI0C 1W2BA 1VQNA 2RHIA 3QWPA 2QNCA 5DLQE 2J87A 1UB4A 1VDDA 5GAN7 2ENNA 3BJIA 1XOVA 5GMKl 3M5AA 5GAMe 1Q7YC 3FC3A 3MEAA 3G6EA 3OYYA 3VUBA 1QVGA 4UXJA 3CMEA 3GLXA 4XTXA 2F69A 2MI6A 2RM4A 3A8HB 3M9QA 4Y91A 3S3OA 2RK2A 3OSSC 3OXLA 1PJUA 4M7AE 2K3XA 4LDXA 1CT4I 2EAYA 1W2BS 2M5XA 2EKOA 4OVOA 3RKXA 4R56A 4BACA 2RJDA 1Y7XA 4E7JA 2Y90A 1FWZA 2P4TA 4A24A 4JUVA 3PFSA 1KG1A 3CCUA 4M7DE 2DXBA 1YJ9A 3M57A 1M90C 3OA6A 3E9FA 4M78G 4XTWA 4OB2B 1KQSA 4KUDK 5I2MA 2EYQA 1QVGS 2GKRI 3OYEA 4NL2A 2XIDA 5FUXA 3JCMQ 1KHCA 1NPPA 1JJ2A 2JTMA 3CXLA 5KCOA 2DAQA 1H641 2GF7A 5HK0A 2JN0A 2HNIA 4HCZA 2VXFA 2WSFE 4N0AC 3VJPA 1KBEA 2HD0A 3WXMB 2XDDA 2KAFA 1VQ4T 2ERWA 1OZ3A 2EQUA 2ODDA 1WJQA 1KQSS 2E70A 2MF2A 1HK9A 1YU6C 3G4ST 2LT4A 3JCMW 2PVGB 2KQWA 2DIGA 3OVOA 5GMKi 2ORWA 2B8TA 1W4SA 1JJ2S 4XU3A 3OYHA 1VQ4A 4XTVA 2DTIA 2XKOC 3FEOA 1KD1U 1CHOI 2EWNA 3M54A 3CCVT 2P0KA 1IW4A 3PMTA 2JTFA 1X01A 3CCLT 3RU0A 3G4SA 3OBYA 2LEOA 2OTLT 4J5YA 4EMKB 2ZPIB 2E5QA 2SGQI 3L2RA 4C8QB 2OVOA 3CXCA 3OL0A 5LJ5e 4E1PA 2I2LA 3UT1A 2QQAA 4YTLA 4BE1A 1KC8U 5I2SA 4J6XA 3QYGB 3PDNA 4O5VA 3JB9I 3MHXA 4OGEA 3CCLA 3CCJT 2ROWA 5EX0A 3CEYA 2OTLA 1PTRA 2LQ8A 2LCCA 2NU3I 2KVQG 1Q7YU 1OMTA 2QQ0A 3EFRA 3JCMc 4MZTA 1KQ2A 1NE8A 5CK9A 2L3RA 5D6WA 5A0GA 1QP2A 1B34B 1CSOI 4UXIA 3CXCS 1N9RA 4C0DC 2GVIA 3DLMA 3CMAT 3CCJA 3N5BB 1V1HA 2JOYA 2M16A 5GAN6 4MMLA 1M8BA 2ZPFB 3C12A 3OMGA 4DOWA 2V8IA 1D3BA 1VUBA 1V29B 4M7DB 4PJOG 3B4VC 1M90U 5J3BA 4M7AD 5A0DA 4C8QG 1PCEA 3V8LA 2QA4A 3CMAA 4XTUA 3JB9G 2W0TA 4P5NA 4M78E 5GMKh 1M8VA 1TH7A 3MEUA 4M7DD 2FHDA 2J9RA 1YJWT 2KMTA 1OVOA 2E41A 3OSVA 4MZPA 2CZ7B 3JCMV 1YTPA 5DAEA 4B9XA 2X4JA 3OYIA 3UGDA 3JCMh 4N4GA 3M55A 1M1KC 3VUZA 4RG8A 2KDSA 4X9DA 2QQSA 2X4WA 1FX7A 3H8ZA 3L2QA 1K8AC 1O75A 5GAOr 1OMUA 4JLGA 3TEEA 1SGDI 1E7LA 3M56A 2YLCA 2RK1A 4L6V5 3OS5A 3UWNA 1VQ7T 2XK0A 1YIJT 3VU3C 2RH2A 2UZ3A 4NOYA 1VIFA 4LDUA 3LH0A 2QPOA 2RJFA 3CPFA 2ZPHB 4M77F 2XU8A 1PSFA 1WGSA 3DKMA 1YITT 2V53A 2FL7A 3FB9A 2E6ZA 4RG2A 5CVIA 3VDPA 1VQ7A 3OYLA 3L2UA 2XRCA 4E1RA 2QQ9A 3J80E 2DXCA 2EQMA 3T9NA 1VQ9T 5GAMh 3GNGA 1YITA 3P8DA 1NJIU 1MGQA 2ZPEB 2HQXA 1S72T 4FL6A 2RI2A 1G3TA 5CAIA 4M77C 2JA1A 4B6DA 5A0LA 4L9MA 1YCYA 2DTHA 1U5KA 5GAOq 3G71T 4J6YA 2K2VA 4JS4A 1M5Q1 5J39A 4OF1A 5GANd 3GPLA 3G7ZA 2RHYA 1LOJA 5EG2A 2D9TA 5CQXA 2RJEA 4M77A 1UGRB 4BY6B 4Z02A 3CC4T 4XTZA 3KY9A 5KH6A 5EX3A 3META 4BI8B 2N52A 3QKJA 3JCMg 3QIIA 2DJZA 3G71A 2EQKA 2CS7A 4II1A 4XU0A 1UVFA 3V8KA 2H3JA 5FU7C 2BUSA 4KBMB 5GAN3 4GI3C 2ZZDA 2ELIA 2JZMA 1OZ2A 3EAEA 3CC4A 4JDSA 1ZHIA 1YJNT 4PJOE 2RD1A 1N8RC 1BI3A 3QZ9B 4C8QE 3E2IA 5FRMA 2YUUA 4QQDA 4RCCA 1TUSA 4QVCA 2QI2A 5L8RE 2O4XB 2K9HA 3V7RA 5GANe 4ZTJA 2X4XA 4C0DB 2LCLA 4M78D 2B8AA 4M75F 2LX9A 1VQLT 4C92F 3JCMf 5GMKj 1YJNA 1M1KU 1G3YA 4E47A 2C06A 3ZFJA 1WJRA 1TBRR 4LDYA 2B0UC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QQ6 A;  3OYD A;  2D9T A;  1SSF A;  3OYH A;  2K3X A;  2X35 A;  3QJ6 A;  4C5I A;  2RJE A;  3PNW C;  3UWN A;  2F5K A;  4IUP A;  2M16 A;  2DIQ A;  2VYT A;  2EKO A;  3FDR A;  2QQR A;  2XDP A;  2GFU A;  4A4G A;  4BAC A;  4Z02 A;  1OYX A;  3FEO A;  2RJD A;  3S3M A;  2XK0 A;  1E7D A;  3OYJ A;  4BDZ A;  2RI5 A;  3OMG A;  3BDL A;  5KH6 A;  4QVZ A;  2BKD N;  4BE2 A;  4E7J A;  2R5A A;  4E7I A;  2YRV A;  2P0K A;  3E9G A;  3MET A;  4B9W A;  3OB9 A;  3OYK A;  4IKF A;  3ME9 A;  5KCH A;  3LH0 A;  3S3N A;  3MEV A;  3PFS A;  3PMT A;  3QKJ A;  4QW2 A;  2RJF A;  2JTF A;  4PLI A;  5CIU A;  3Q1J A;  3L42 A;  3QII A;  5C0M A;  4N4I A;  3OA6 A;  2RHU A;  3E9F A;  3OS1 A;  2MWP A;  1WGS A;  3LX7 A;  4Q5W A;  2CKK A;  2L8D A;  4IUU A;  2EQK A;  5C6S A;  4BE0 A;  3F70 A;  3OY9 A;  2JZ2 A;  2PQW A;  4IUV A;  4A4F A;  3LGL A;  4II1 A;  2E5Q A;  3MP6 A;  3OYE A;  5J26 A;  3KUF A;  4LD6 A;  3L2R A;  2R58 A;  4C5H A;  1OI1 A;  4RG2 A;  3S6W A;  2RHX A;  2L89 A;  2LVM A;  1KHC A;  3OQ5 A;  3MP8 A;  2BIV A;  2EQJ A;  3NTI A;  3OYB A;  2G3R A;  2K3Y A;  4X34 A;  2MWO A;  3UT1 A;  4BD3 A;  2RI3 A;  3O8V A;  1EN7 A;  4BE1 A;  5KCO A;  1OZ2 A;  3EAE A;  3H6Z A;  4IUQ A;  3OYL A;  3L2U A;  2DAQ A;  4IUT A;  2GF7 A;  4IUR A;  5IN1 A;  3OMC A;  5KE3 A;  4BDY A;  3OYA A;  3NTK A;  3MEU A;  4HCZ A;  2RHI A;  3LLR A;  5FRN A;  2R5M A;  2M1H A;  4A4E A;  2FHD A;  3LGF A;  3L2W A;  4C5G A;  2EQM A;  2RHZ A;  2QNC A;  4ZTF A;  2EFI A;  2BUD A;  4CRI A;  1XNI A;  5FRM A;  1G5V A;  3MP1 A;  2RO0 A;  4QQD A;  3DB4 A;  3NTH A;  3MO8 A;  3OYM A;  3OYC A;  3CEY A;  3P8D A;  4QQG A;  5FRO A;  3PMI A;  4N4H A;  3FC3 A;  4FU6 A;  1H3Z A;  3MEA A;  4PLL A;  2LDM A;  2HQX A;  2O4X B;  4B9X A;  4FL6 A;  2LCC A;  3LYI A;  3P8H A;  2RI2 A;  1OZ3 A;  4E7K A;  1WJS A;  2EQU A;  3OYI A;  1MHN A;  4ZTJ A;  3FLG A;  4C5E A;  2X4X A;  4N4G A;  5IAY A;  3QBY A;  2B8A A;  3OYF A;  5D6X A;  5KE2 A;  4E7L A;  1WJQ A;  3ZEH A;  2HQE A;  3C4S A;  2X4Y A;  2L3R A;  5D6W A;  3SD4 A;  1N27 A;  4PL6 A;  2GFA A;  2LTO A;  4UC4 A;  4E7H A;  5D6Y A;  3L2V A;  3M9Q A;  3MEW A;  4EDU A;  4GY5 A;  2QQS A;  5J39 A;  3OS0 A;  4A4H A;  2R57 A;  2WAC A;  1RI0 A;  2X4W A;  3H8Z A;  4OVA A;  5M9O A;  3L2Q A;  4NS5 A;  3S3O A;  2DIG A;  2O4X A;  3ASK A;  2E6N A;  3OS2 A;  2IG0 A;  2QNF A;  1WJR A;  1E7L A;  2NLU A;  4L59 A;  3OYG A;  2M0O A;  3DLM A;  2RJC A;  3GOX A;  2LRQ A;  2RHY A;  3DB3 A;  3OYN A; 
#chains in the Genus database with same CATH topology
 4QQ6 A;  2FZC B;  9WGA A;  1ZSZ A;  2PQ8 A;  4C5I A;  2ZCF B;  3M59 A;  1K7U A;  1WGT A;  2E5K A;  5GAM g;  1MV0 B;  3PIO A;  1NZ9 A;  4CC3 A;  1NUB A;  1WXT A;  1KD1 R;  1E7D A;  1O9S A;  2DKV A;  2NU4 I;  2BKD N;  2YRV A;  5KYY A;  4HT8 A;  2VB6 A;  2ESW A;  1WGC A;  2RPN A;  2XIC A;  4CC2 A;  1WNL A;  3EG2 A;  1AVZ C;  2LC4 A;  1C1A A;  1M1F A;  4JS5 A;  2DD4 A;  3FRN A;  1Z7K B;  1PD1 A;  2DX1 A;  1CGJ I;  3L2Z A;  1WZO A;  1Q95 G;  2IPO B;  4M75 C;  1W3S A;  1U8R A;  5LJ5 h;  3UOE A;  4EPC A;  3SGQ I;  1QWE A;  3SWN B;  4X9C A;  3I56 Q;  4BD3 A;  2RI3 A;  1Y96 B;  1KC8 R;  5IHK A;  1HJA I;  3UGI A;  5FUW A;  2XHC A;  1IZ6 A;  3NTK A;  4A4K A;  1K9A A;  1UVG A;  3UGL A;  4EMG A;  5D7U A;  2A3L A;  2EFI A;  4M75 A;  3VYG A;  1VA7 A;  2A36 A;  1PTQ A;  3OYM A;  4JZ4 A;  2O31 A;  4SGB I;  2WSC E;  5GAM f;  2N1A B;  2BZY A;  3MEK A;  1NLP C;  2DVE A;  3CD6 T;  1QVG P;  1Q7Y R;  2DMO A;  2V8K A;  2F2W A;  3C95 A;  3PT9 A;  3SHW A;  1RLQ C;  5D6X A;  1U1T A;  4XAX B;  3CCS T;  4F14 A;  1M1G A;  2DF6 A;  3HRU A;  4RCB A;  4E7H A;  1YHQ T;  1CGI I;  2G6F X;  1EZZ B;  1VQ5 Q;  5M9O A;  2P0P A;  1TUR A;  2E64 A;  2Y4X A;  3M4G A;  4A54 A;  2K5I A;  1UGS B;  5GAM j;  4L59 A;  2QQC A;  1WQ7 A;  1UJY A;  2E3H A;  2PZ1 A;  5LL6 S;  1AWO A;  1SGE I;  2V1R A;  4D8K A;  1Y07 A;  4KUL A;  3RMS A;  1OYX A;  2DZ9 A;  5GAO p;  2EJG A;  5GAO n;  4OMM A;  3CD6 A;  4RTY A;  4N0A A;  3QDR B;  4DBR A;  1N13 A;  2R5A A;  4B9W A;  2ENM A;  2BZ8 A;  2K5L A;  1Q86 C;  3CCS A;  2OTJ T;  3EFS A;  4PLI A;  2P84 A;  2RMO A;  3UAT A;  1C6V X;  2AT1 B;  1YHQ A;  4FIB A;  3A8M B;  4MMK A;  3FJP A;  2IIM A;  4DOV A;  1M90 R;  4IUV A;  3R5A A;  1HDL A;  2CSQ A;  1K7V A;  4ZGD B;  2MPX C;  5FU6 C;  1WHJ A;  3A98 A;  3HP9 A;  1VQ8 Q;  3CC7 T;  3QTL D;  3VS5 A;  1JJ2 P;  1BKB A;  2QTX A;  2QTV A;  2GBQ A;  3JB9 H;  4KUI A;  2A0F B;  4IUR A;  1C0M A;  2FVU A;  1BMO A;  4PJO B;  1WDX A;  2D6F A;  2VXE A;  2ED1 A;  2OTJ A;  3V7S A;  4JCV E;  1RAD B;  1N8R U;  1VQO T;  4LUD A;  4QVD A;  1OQK A;  1SG5 A;  5E3Q A;  3DB4 A;  2CZ0 B;  2DL5 A;  3A8G B;  4J7F A;  4M78 F;  1H3Z A;  4FM4 B;  4KGV B;  3REB B;  4WTO B;  1FMW A;  2YUN A;  3REA B;  3JCM b;  3VRY A;  2K7A A;  2QQD A;  2KBT A;  3ULR B;  1VQN Q;  1I81 A;  5HKC A;  4HT9 A;  3CCV A;  3CC7 A;  1R0C B;  5LJ5 g;  4ZN1 A;  4KGZ B;  3C4S A;  1V1C A;  4PJO D;  2QQB A;  1E7O A;  2PVD B;  2DB6 A;  3SEK C;  4EDU A;  4GY5 A;  4C8Q D;  3CCR T;  2CP3 A;  3ASK A;  3A8L B;  3CCE T;  5FLX E;  2QQE A;  1TU0 B;  2JXB A;  3G6E Q;  2BE7 D;  3OYG A;  2M0O A;  2NU2 I;  2LP5 A;  3JB9 D;  1Q82 C;  3EG3 A;  1X6G A;  2KCX A;  3FJ5 A;  1NBE B;  2X35 A;  1FY7 A;  2KXC A;  3VS7 A;  2F5K A;  4IUP A;  2MCN A;  2L3P A;  4A4G A;  2DIQ A;  2HQH A;  2JW6 A;  3CME Q;  1RAE B;  2LZ6 B;  2ABL A;  3BDU A;  4E7I A;  5CKD A;  4PJN A;  3QHS A;  1T0J A;  2L7X A;  4FYX B;  3MJX A;  5FU7 B;  3X24 B;  1VQM T;  2DVJ A;  1AZE A;  3TQ7 P;  3QAH A;  2CKK A;  1YI2 T;  2EJF A;  3CCR A;  2ZPB B;  2ZAE A;  3SEM A;  2YHT A;  3UA7 A;  2DEQ A;  3CCE A;  2CWF A;  3KUF A;  5AYF A;  4C5H A;  3UA6 A;  2NU1 I;  3KXT A;  1TBQ R;  2EQJ A;  5LJ5 f;  1MMD A;  2B0U C;  1FAQ A;  1PSE A;  1K1Z A;  2JT4 A;  3CCU Q;  1YJ9 Q;  5KYU B;  4WF2 A;  1TOV A;  4IUT A;  1I8F A;  4AG2 C;  2LB7 A;  5KE3 A;  2EYZ A;  1TUG B;  3HH2 C;  1ZSZ B;  2MYS A;  1OU8 A;  4M77 G;  2K9G A;  2DIP A;  1Y8F A;  2RQT A;  4ZTF A;  2DK3 A;  2BUD A;  4A63 B;  1VQM A;  2AIR B;  3EG1 A;  1D0X A;  1I07 A;  1Q81 C;  1G5V A;  2XMF A;  1RAG B;  1PPF I;  4HCB A;  2O9V A;  1LR7 A;  2KMP A;  3MO8 A;  4HCK A;  4DBF A;  1QP3 A;  2D1X A;  2KMQ A;  2OZU A;  3KBG A;  1M9S A;  1UE9 A;  5LJ5 j;  3E1S A;  2CRE A;  1UEC A;  3QZ5 B;  7AT1 B;  1RL2 A;  2EBP A;  3HKS A;  2JS2 A;  1GCP A;  3HRS A;  2RQW A;  3OW2 A;  2PUO B;  4DA4 A;  1D1C A;  5E3P A;  3EGX A;  2LTO A;  4GLM A;  3CBM A;  3VYH B;  1BIB A;  4F7U F;  1FYB A;  4MDX A;  1WA7 A;  1WHL A;  1M30 A;  2MOX A;  2DYI A;  1RI0 A;  2KNB B;  1B07 A;  3E2U A;  4RTX A;  2QNF A;  5FUV A;  1VYV A;  4ATO A;  5LJ3 d;  5DLO A;  1RAI B;  2XD0 A;  2LUY A;  3TJQ A;  4C0G A;  4RTW A;  1W70 A;  5IHI A;  1PRM C;  2CUB A;  4BDZ A;  3J81 E;  1YP5 A;  2VRW B;  1FXX A;  4J9I A;  1T0H A;  3EGD A;  1HEV A;  1WHH A;  3MEV A;  4D6W A;  5I11 A;  1X74 A;  1PD0 A;  1YJW A;  1SRM A;  5AT1 B;  2KMR A;  1VQ4 Q;  2C0O A;  2WVJ A;  1WI7 A;  1I4K 1;  3LGL A;  4OML A;  1YFN A;  1SHF A;  5FWC A;  2ROL A;  3OW2 S;  2L8E A;  2NU0 I;  2JVV A;  1YBY A;  2KI7 A;  4ESR A;  3TU4 K;  1K73 C;  3GIB A;  1TBO A;  1LVK A;  5IH2 A;  3A8O B;  1OX9 A;  3O8V A;  2EW3 A;  3H6Z A;  3G4S Q;  2LQN A;  2SGD I;  2CT4 A;  2CGH A;  5IN1 A;  3JB9 J;  1VYU A;  3VV0 A;  1HXD A;  2BE9 B;  1YNZ A;  4OB3 B;  5FRN A;  2J6K A;  1LNX A;  3SB2 A;  1PKS A;  2DZC A;  4CRI A;  3OYC A;  5GAN 2;  5GAN h;  4F7U A;  3NMZ C;  2DL3 A;  1EX4 A;  4BI3 A;  3WVD B;  3VS3 A;  1VQP T;  2F5T X;  3VS1 A;  4OMO A;  1YIJ A;  4ZN3 A;  1IO6 A;  5LJ3 e;  3VDU A;  1PWT A;  4V2S A;  3QBY A;  4JRP A;  3OYF A;  4E7L A;  1PCX A;  3RIR A;  3SD4 A;  3O5Z A;  3OXF A;  1DS2 I;  2GFA A;  4UC4 A;  3CCL Q;  2DD5 A;  2J05 A;  1M1K R;  1LPL A;  2SEM A;  3RNJ A;  2OTL Q;  2XDB A;  3QDF A;  2D0Q B;  4NS5 A;  3HL8 A;  5CCM A;  5HQ8 A;  2YUQ A;  2HKQ B;  2EJ9 A;  4XU2 A;  4JPB W;  3U23 A;  3DB3 A;  1D0Z A;  1K8A R;  3OYD A;  3CBP A;  1VQ5 T;  1AWJ A;  1H92 A;  4LXC A;  3ER0 A;  1JBM A;  3FDR A;  4HVW A;  1FAR A;  3TCJ A;  2QQR A;  1PZW A;  4JJC A;  4M75 G;  2EIF A;  1VQP A;  3BDL A;  3ZBD A;  1GFD A;  4FT4 A;  2WSE E;  1VQK T;  1P92 A;  2DJQ A;  5FU6 B;  1SGQ I;  4EMK C;  1VQ9 A;  3OS1 A;  3CCJ Q;  1M8C A;  1JRI A;  4IUU A;  4BE0 A;  2JYY A;  2D8H A;  3OY9 A;  2JZ2 A;  4Z8A A;  4R0K A;  1SGR I;  3MP6 A;  4LD6 A;  2JUF A;  1S72 A;  3R6O A;  2JW4 A;  1VQ6 T;  4XTY A;  2RB6 A;  1X2Q A;  1ULM A;  4DBQ A;  1MMG A;  2K5F A;  1ZQ1 A;  3M0T A;  4M7A F;  4EMK A;  3OBW A;  4KH1 B;  1VQ8 T;  3OYA A;  3R5D A;  2VWF A;  3QUI A;  5GAO m;  3LW5 E;  1VQK A;  4FKD A;  4AMC A;  1BI2 A;  2LT1 A;  2R5M A;  4FW1 A;  1WQW A;  2RHZ A;  2MAM A;  5CKB A;  1IRX A;  3UPU A;  4J9C A;  4F04 B;  3CMA Q;  2QA4 Q;  1LR8 A;  3H0H A;  3GP8 A;  1H0Z A;  1ARK A;  4N4H A;  4M7D F;  3CC2 T;  1OYV I;  1Q81 U;  4HKE A;  3X20 B;  3G1J A;  4BB7 A;  1ACM B;  1W1F A;  2GQI A;  1MHN A;  1KD1 C;  1WHG A;  4M77 E;  2V1C C;  1VQ6 A;  2VGN A;  3C94 A;  2NUZ A;  1IXD A;  2QXF A;  2LX7 A;  3JCM P;  1G83 A;  1SGP I;  1U1S A;  3X28 B;  3OS0 A;  3I5R A;  1I5L A;  3QXE B;  3QG1 A;  1D1B A;  2SGP I;  4GBQ A;  4VUB A;  1R0R I;  4PK4 A;  2RJC A;  3BFM A;  2IVW A;  4M7A C;  4EMH A;  1UDL A;  1D3B B;  5GAO l;  2V1C A;  3CC2 A;  1NG2 A;  3RKW A;  2MIO A;  4BI4 A;  2L3Q A;  2XDP A;  1JXO A;  2RI5 A;  1D1A A;  5GAN g;  4X1V A;  3D7S B;  3E9G A;  4A53 A;  1P9Z A;  2GTJ A;  4M7D C;  1XQH A;  3CME T;  1OOT A;  1QKW A;  4ZGE B;  3Q1J A;  2PVO B;  3I55 T;  1QCN A;  2DKG A;  1VIE A;  2DBK A;  2L8D A;  1K8A U;  2COZ A;  2FO0 A;  4J83 A;  2K4Y A;  1F1B B;  4M7A A;  2ARP F;  3RES A;  2PQW A;  2HMA A;  4R55 A;  1Y1B A;  5HCK A;  1OUL A;  3EGX B;  2RHX A;  1NLO C;  2C0T A;  1IY5 A;  1ULK A;  2WCY A;  3CBO A;  4FYY B;  3OYB A;  1XTD A;  2G3R A;  4HVU A;  1KFZ A;  2FPD A;  1VQL A;  3QWX X;  1JB0 E;  4M7D A;  4E6R A;  1K9M C;  2GQV A;  1K73 U;  2KGT A;  1Z2I A;  4OGC A;  3UEY A;  1BB9 A;  3H41 A;  3CCU T;  2AKL A;  3RBB B;  1YJ9 T;  4C5G A;  1UFF A;  2FRW A;  4C92 C;  1N8R R;  3MP1 A;  2QDY B;  3I55 A;  4LD9 K;  1X4S A;  3NTH A;  2DO3 A;  2XG8 D;  2KYB A;  3PMI A;  1BCO A;  4PLL A;  3EGD B;  1VQ7 Q;  2EGE A;  1NPR A;  2CH4 W;  5GAN f;  1UGP B;  2E73 A;  4JJD A;  3MPU B;  5A2Q E;  4PL6 A;  1K4U S;  3M4Y A;  2FZG B;  2OD1 A;  2YQP A;  2SRC A;  3LH5 A;  1YIT Q;  4C92 A;  2O9S A;  1UEB A;  4OVA A;  2P6A C;  2YSQ A;  3TOB A;  1PG5 B;  4LN2 A;  4DBH A;  2E6N A;  1HD3 A;  4XU1 A;  2JM8 A;  2NLU A;  2GKV A;  3LWH A;  2H3E B;  4OP0 A;  2N71 A;  6AT1 B;  4HCC A;  1E6G A;  2KSS A;  5IT9 E;  1DS3 I;  2HL5 C;  5HK3 A;  5GAN j;  2PUK B;  3OXG A;  1QVF A;  4IIM A;  1BBZ A;  2HSE B;  3H0F A;  4QVZ A;  2DE0 X;  2K79 A;  2ED0 A;  2YUO A;  1PRL C;  3HRT A;  3OB9 A;  2COW A;  2HAX A;  4F7U B;  1T3S A;  3TRE A;  3L42 A;  2PU9 B;  3SFM A;  1BIA A;  2W0Z A;  2GCX A;  4M75 E;  1ULN A;  3QWY A;  5GJV B;  2J6F A;  1S72 Q;  1AT1 B;  2CP2 A;  4C92 E;  1WHK A;  5LJ5 d;  4C0Z A;  2L0A A;  4J6W A;  2LVM A;  3OQ5 A;  1QW1 A;  3FSY A;  3R5C A;  1KBF A;  1M4Z A;  4J7I A;  4JRK A;  5CQY A;  4JJB A;  4IUQ A;  3JV3 A;  3SGB I;  5JHW C;  2LNV A;  3G71 Q;  2E12 A;  3LLR A;  3QO3 A;  3URG A;  3QYH B;  2DL7 A;  2MMP A;  4J8O A;  4PFO A;  1I0C A;  1QVF S;  1I5O B;  5GJW B;  1PM3 A;  2VC8 A;  1PNJ A;  3THK A;  3NFC A;  4IIO A;  1UG1 A;  3CC4 Q;  2L5Q A;  2E1H A;  2LCS A;  2FYK A;  1NEG A;  3LYI A;  3P8H A;  1Q9B A;  2QDL A;  1Y0M A;  4QKU A;  3M0R A;  5CKE A;  8ATC B;  1QVF P;  3X25 B;  2GIV A;  1E6H A;  4M77 B;  1CT2 I;  1TGS I;  3HHT B;  1N27 A;  4KT0 E;  2FB7 A;  1QCF A;  5D6Y A;  2DL8 A;  1EFN A;  3L2V A;  3MEW A;  4F17 A;  4D8D A;  4C0F A;  2JTE A;  2R57 A;  1UGQ B;  3GF5 A;  1WFW A;  1YWO A;  4ELY C;  1SRL A;  1MT1 A;  2EGC A;  4BE2 A;  1D0Y A;  5GAN 5;  2KMO A;  4MPI A;  2K6D A;  4BY6 C;  4JLI A;  2NUP A;  2KDP A;  3QJ6 A;  1SGN I;  2A7Y A;  3PNW C;  1G3W A;  2C0I A;  5GAN 4;  1U3O A;  1D09 B;  1Z9Z A;  3S3M A;  1UGV A;  4M77 D;  1WXB A;  1YJN Q;  1V1I A;  1LCK A;  3D00 A;  4MDW A;  3PTA A;  1K76 A;  3RUX A;  3ME9 A;  3VKI A;  3PGG A;  4F7U G;  1TUD A;  2YLB A;  4AG1 C;  4Y28 E;  4MZM A;  1BI0 A;  2E4H A;  4N4I A;  1TIH A;  4HGU A;  2MWP A;  3LX7 A;  3A5Z B;  5KYW A;  1VQO A;  1Q86 R;  2WGC A;  5C6S A;  3JCM X;  1HSQ A;  3F70 A;  4WP4 A;  1TTH B;  1NJI C;  2AZS A;  4A4F A;  2EYX A;  3V8J A;  4OB1 B;  3WVE B;  3E19 A;  3RMQ A;  2L2P A;  1UHA A;  1GCQ C;  1NEB A;  3MP8 A;  2CYZ B;  1EIF A;  4M78 C;  2DXU A;  3ZL7 C;  3HFO A;  4LDV A;  2DTO A;  5FUY A;  2YDL A;  3H9N A;  2HBP A;  5CO7 A;  2YUP A;  2RIJ A;  2AK5 A;  4BDY A;  2X9H A;  2ORV A;  2AHJ B;  2M1H A;  3LGF A;  3MCA B;  3CCM T;  1K9M U;  2DXT A;  3JSC A;  1GBR A;  2J6O A;  2RN8 A;  2QEX T;  2SGE I;  2KY9 A;  2RO0 A;  2ENZ A;  2E10 A;  2FNF X;  1RAB B;  2NYS A;  4QQG A;  2EYW A;  2D8J A;  1GCQ A;  1BK2 A;  2VUB A;  4GLK A;  5LJ3 h;  2LDM A;  1XBT A;  2QA4 T;  4M78 A;  4F16 A;  2EPD A;  3BE3 A;  1BUS A;  3R6N A;  1IHW A;  5CCL A;  2Y4Y A;  2RQR A;  1OX8 A;  5IAY A;  1IGQ A;  4RTZ A;  4LDW A;  4M7A B;  2V8J A;  2JS0 A;  4LUE A;  3M53 A;  4OB0 B;  4OMQ A;  3TSW A;  1W4R A;  5J8C A;  1JU5 C;  1YI2 A;  5KYY B;  2O4X A;  2RQV A;  1Y71 A;  2IG0 A;  2HKN A;  3CCM A;  1SEM A;  4FW2 A;  4RTU A;  2A20 A;  4RKU E;  3OYN A;  2QEX A;  2CJS C;  1KHI A;  3UDC A;  4FSS A;  3CCQ T;  3TO6 A;  1IB8 A;  2X52 A;  1AEY A;  4Y92 A;  1LR9 A;  2ZPG B;  4CC7 A;  3OYJ A;  4PKC C;  4DEX A;  2GKT I;  1IRE B;  1TOT A;  3VE5 A;  5CKF A;  2LJ1 A;  3S3N A;  2KRM A;  2OU2 A;  5C0M A;  2RHU A;  3SDZ A;  5DY9 A;  3EG0 A;  5IXB A;  2KR3 A;  2JNG A;  2O01 E;  4QT7 A;  1X6O A;  4FT2 A;  3CD6 Q;  2YXY A;  3GNF B;  1FMK A;  2R58 A;  3SWN C;  5HY6 A;  3EG9 A;  2VGM A;  1OI1 A;  4M75 B;  2BIV A;  3NTI A;  4C92 B;  3UEJ A;  2LMJ A;  3CCQ A;  2MWO A;  3BY7 A;  1HPT A;  1WX6 A;  3CCS Q;  3JCM J;  1J3T A;  3JAM E;  1YHQ Q;  1IHV A;  1TG0 A;  4K11 A;  1M3A A;  3OMC A;  1TSF A;  1KMA A;  2A37 A;  1Q86 U;  2CSI A;  4ELZ C;  3QPH A;  4A4E A;  3L2W A;  2E5R A;  2I0N A;  3PIP A;  1G2B A;  3QSU A;  2F1L A;  1XNI A;  2SGF I;  3TSZ A;  3SWN A;  3JRZ A;  5FRO A;  1RI9 A;  2RA2 A;  4M75 D;  4FU6 A;  1Y96 A;  2ATC B;  4C92 D;  1Q81 R;  2E65 A;  3HFN A;  4J9G A;  2CH4 A;  2VV5 A;  1N9S A;  2VKN A;  1WJS A;  3HPW A;  4C5E A;  2QGF B;  3VRZ A;  3OW2 P;  4M7A G;  1MND A;  2YWW A;  1CT0 I;  5KE2 A;  3I56 T;  3ZEH A;  4OMF B;  2OTJ Q;  1ZLM A;  3EH1 A;  4KRT A;  4PJJ A;  5J8F A;  2HEQ A;  3NGP A;  1KQ1 A;  2LQK A;  1DJ7 B;  1AN1 I;  2WAC A;  4JRI A;  1TXQ A;  4PJO F;  3GOX A;  1VOM A;  4E7K A;  4M7D G;  2OI3 A;  1SSF A;  2EKH A;  2ZGW A;  3CCV Q;  3CC7 Q;  1ZBX A;  2JMC A;  2CT3 A;  4C8Q F;  3JCM d;  4JJN K;  1FMV A;  4ME7 A;  3UFF A;  1ABQ A;  1OPL A;  1H3H A;  3FSX A;  1SGY I;  3JB9 F;  3J7A F;  5I21 A;  4BUG A;  1U06 A;  2L3S A;  2COY A;  3OYK A;  5LJ3 g;  4J9F A;  5KCH A;  4O6J A;  1Y1C A;  1QKX A;  3I56 A;  3AT1 B;  1AHJ B;  2QGG A;  2YRC A;  5CKH A;  5CR2 A;  4FSX A;  4Q5W A;  1X75 C;  1M3B A;  3AHU A;  2CP5 A;  2B86 A;  1WPY A;  4RMO A;  1G3S A;  1Q82 U;  2V26 A;  4Z89 A;  2CZ6 B;  4RTT A;  4M4Z A;  1LJO A;  1UUC A;  3S6W A;  1X69 A;  1IY6 A;  2L89 A;  2W10 A;  2LNH B;  4C92 G;  4F7U E;  2V1Q A;  2QYZ A;  4JRQ A;  1GXI E;  4X34 A;  4ZGJ B;  1QWF A;  1YWP A;  1EN7 A;  2XI9 A;  2M9U A;  1GL5 A;  4E7Z A;  4PJO C;  2P0Q A;  1K73 R;  1K0X A;  4NL3 A;  2NUP B;  5GMK e;  3CCR Q;  2KK4 A;  4C8Q C;  3VS2 A;  1T3L A;  3CCE Q;  4TVR A;  1WYX A;  2BTT A;  5FW9 A;  2RF0 A;  1XX6 A;  3P8B B;  3NPF A;  4PFP A;  1PHT A;  1M8M A;  2JXD A;  1VQ5 A;  1RAC B;  1M2O A;  5DM7 R;  5L23 A;  4PNO A;  4UXH A;  3M58 A;  3HSB A;  2F3C I;  3FLG A;  5LJ3 f;  4PJO A;  1JXM A;  1TBN A;  3INZ A;  2F2V A;  2HQE A;  3JCM e;  2X4Y A;  2K57 A;  3CPW A;  1VQM Q;  4C8Q A;  2KRS A;  3RKY A;  3L1A A;  4L5G A;  5GAM d;  1RUW A;  4A4H A;  3TO9 A;  2KYM A;  3OS2 A;  1JEG A;  1R79 A;  1CE3 A;  1UHC A;  1MNE A;  4DQ2 A;  3QJY A;  1BI1 A;  3UF4 A;  3V7C A;  3DLL A;  1QCO A;  1QVP A;  2CZ1 B;  1RFH A;  2OAU A;  1RAA B;  2VYT A;  5KYN A;  2GFU A;  3FIF A;  5LJ3 j;  1BYM A;  1WXU A;  2DPP B;  1V76 A;  5GMK m;  1VQN T;  2X3X D;  5HI7 A;  2N17 A;  1VQ8 A;  4IKF A;  2CWH A;  3CQT A;  4FYV B;  5CCA A;  4XK8 E;  4QW2 A;  2H8H A;  5CIU A;  1XA6 A;  1N6A A;  4XQ3 A;  4M78 B;  2X3T A;  1U5S A;  4KGX B;  4HA8 A;  4J9H A;  5J26 A;  3G6E T;  1B34 A;  1R8O B;  1SKU B;  3X26 B;  2FEI A;  3E59 A;  3LWI A;  1KC8 C;  3PE0 A;  3CPW S;  1ZBJ A;  5GAN 8;  2K3Y A;  3RER A;  3BW1 A;  4AFZ C;  1YJW Q;  3RDV A;  1AZG B;  4CI0 C;  1W2B A;  1VQN A;  3EFO A;  2RHI A;  3QWP A;  1KIK A;  4E2F B;  1HYO A;  2QNC A;  5DLQ E;  2RNA A;  2J87 A;  1UB4 A;  1VDD A;  5GAN 7;  1RAH B;  2QG9 B;  2ENN A;  3BJI A;  1XOV A;  5GMK l;  3M5A A;  5GAM e;  1Q7Y C;  3FC3 A;  3MEA A;  2RC4 A;  2YT6 A;  2FRY A;  3G6E A;  3OYY A;  1P9G A;  3HTR A;  3VUB A;  1QVG A;  4UXJ A;  1JO8 A;  4J9E A;  3CME A;  3GLX A;  4XTX A;  1UHF A;  2F69 A;  2MI6 A;  2RM4 A;  3A8H B;  3M9Q A;  4Y91 A;  3EG9 B;  1NXU A;  1Z9Q A;  4KH0 B;  3S3O A;  2RK2 A;  3OSS C;  2DER A;  1YIJ Q;  3VS6 A;  3OXL A;  1PJU A;  4M7A E;  2K3X A;  3C0C A;  4LDX A;  1CT4 I;  2EAY A;  5ECA A;  1W2B S;  2M5X A;  2EKO A;  4OVO A;  1KSW A;  3RKX A;  4R56 A;  4BAC A;  2RJD A;  1RLP C;  1Y7X A;  1KK7 A;  1AD5 A;  3EHR A;  4OMN A;  4E7J A;  1TWB A;  4LNP A;  2Y90 A;  1FWZ A;  1NYF A;  2P4T A;  4ANJ A;  4A24 A;  4JUV A;  3PFS A;  1KG1 A;  3CCU A;  4M7D E;  2DXB A;  1YJ9 A;  3M57 A;  1M90 C;  3OA6 A;  3E9F A;  4M78 G;  4XTW A;  1W2B P;  4OB2 B;  1ZX6 A;  1KQS A;  4KUD K;  2ECZ A;  5I2M A;  1CSK A;  2EYQ A;  1NYG A;  1QVG S;  2GKR I;  4RUG A;  2DFU A;  3OYE A;  4ZNX A;  4NL2 A;  2XID A;  1AWX A;  5FUX A;  4HXJ A;  3JCM Q;  1VQP Q;  2CP6 A;  1KHC A;  1NPP A;  1JJ2 A;  2JTM A;  3M0P A;  4ORZ A;  3CXL A;  5KCO A;  1VQ9 Q;  2DAQ A;  1H64 1;  2GF7 A;  2J06 A;  5HK0 A;  2JN0 A;  2HNI A;  1RAF B;  4HCZ A;  2VXF A;  2WSF E;  4N0A C;  1K9M R;  1K7T A;  1AOJ A;  1ZA1 B;  3VJP A;  1FYN A;  1KBE A;  2HD0 A;  3WXM B;  1ABO A;  4PJL A;  2XDD A;  2KAF A;  1VQ4 T;  4LE9 A;  2LQW A;  2ERW A;  1OZ3 A;  2EQU A;  2EGA A;  1VQK Q;  2ODD A;  2EQI A;  3I9Q A;  1M27 C;  1S1N A;  1WJQ A;  2E70 A;  2HZY A;  2MF2 A;  1KQS S;  1HK9 A;  1YU6 C;  3G4S T;  2LT4 A;  1CKB A;  1TS9 A;  3JCM W;  3EHQ A;  3EGU A;  2GGR A;  2PVG B;  2KQW A;  2DIG A;  2EYY A;  2DYB A;  3OVO A;  5GMK i;  2ORW A;  2B8T A;  1W4S A;  1JJ2 S;  4HVV A;  1KQS P;  1MJB A;  4XU3 A;  2DM1 A;  3OYH A;  1VQ6 Q;  3I5S A;  1VQ4 A;  4XTV A;  2DTI A;  2XKO C;  3FEO A;  3EH2 A;  1KD1 U;  1M3C A;  1CHO I;  2EWN A;  1KJW A;  3M54 A;  3CCV T;  2P0K A;  4EIK A;  1CKA A;  1IW4 A;  3PMT A;  2KRO A;  2JTF A;  1IGU A;  1X01 A;  1QLY A;  3CCL T;  3RU0 A;  1B3Q A;  3G4S A;  2FG0 A;  2OAW A;  3OBY A;  2LEO A;  5IHN A;  2OTL T;  4J5Y A;  2O88 A;  4EMK B;  2HBW A;  4DEY A;  3CC2 Q;  2LJ3 A;  2ZPI B;  2E5Q A;  2SGQ I;  2X51 A;  3L2R A;  4C8Q B;  2OVO A;  3CXC A;  3OL0 A;  1WKX A;  5LJ5 e;  4E1P A;  2I2L A;  3UT1 A;  2QQA A;  4YTL A;  3H0I A;  4BE1 A;  5EC7 A;  1KC8 U;  5I2S A;  1W6X A;  4J6X A;  3RR6 A;  3QYG B;  3PDN A;  4O5V A;  3TVT A;  3JB9 I;  5I22 A;  3MHX A;  4OGE A;  4AML A;  1R77 A;  3CCL A;  3CCJ T;  2ROW A;  5EX0 A;  4FCY A;  2DRM A;  3CEY A;  2OTL A;  1PTR A;  1VQL Q;  2LQ8 A;  2LCC A;  2NU3 I;  2KVQ G;  2JJ9 A;  3M0S A;  1Q7Y U;  1OMT A;  2Y0M A;  2QQ0 A;  3EFR A;  3IQL A;  3JCM c;  1MUZ A;  2BZX A;  4MZT A;  3NHN A;  1KQ2 A;  1NE8 A;  5CK9 A;  2L3R A;  5D6W A;  2LJ0 A;  2NUT A;  2K2M A;  5A0G A;  1QP2 A;  1X6B A;  3KFV A;  1MV3 A;  3I55 Q;  3MKD A;  1B34 B;  1OEB A;  1CSO I;  4UXI A;  3CXC S;  2JM9 A;  1N9R A;  4C0D C;  2GVI A;  3DLM A;  2HL3 A;  3CMA T;  3CCJ A;  3N5B B;  1V1H A;  2JOY A;  2DL4 A;  3EFO B;  2YRD A;  2M16 A;  5GAN 6;  4MML A;  3TOA A;  1M8B A;  2ZPF B;  2FZK B;  1WIE A;  3C12 A;  3CXC P;  3OMG A;  2MK5 A;  2ROT A;  1R0B G;  7WGA A;  4DOW A;  2V8I A;  1H8K A;  2VAS A;  2DRK A;  2HSP A;  1QQJ A;  1D3B A;  1VUB A;  1V29 B;  4M7D B;  4PJO G;  4FYW B;  1QMC A;  4CC4 B;  2P4R A;  3B4V C;  1M90 U;  2VVK A;  1OPK A;  1SF9 A;  1Q82 R;  1WTJ A;  1GRI A;  5J3B A;  4M7A D;  3GBQ A;  5A0D A;  4C8Q G;  4B6M A;  2KT8 A;  1PCE A;  3V8L A;  2QA4 A;  3CMA A;  3PVQ A;  4PJM A;  2QK0 A;  1M2V A;  1NJI R;  4XTU A;  1SSH A;  5IXF A;  2EVR A;  2QAZ A;  5E3R A;  3JB9 G;  2W0T A;  4P5N A;  5KYX A;  2HCK A;  4M78 E;  5GMK h;  2D0N A;  1M8V A;  1TH7 A;  1VYT A;  3MEU A;  3M0U A;  4M7D D;  1OU9 A;  2FHD A;  2N1U A;  2J9R A;  1YJW T;  2Z0W A;  2KMT A;  1AWW A;  1ZA2 B;  1OVO A;  1GBQ A;  2E41 A;  2PTK A;  3OSV A;  2RQU A;  4MZP A;  1I1J A;  2CZ7 B;  3I35 A;  1WHM A;  3JCM V;  1YTP A;  5DAE A;  4B9X A;  2X4J A;  3OYI A;  3UGD A;  3JCM h;  4N4G A;  1A0N B;  3M55 A;  1M1K C;  3VUZ A;  1UTI A;  4RG8 A;  2KDS A;  3R5B A;  4X9D A;  1TUC A;  4J9B A;  2QQS A;  2X4W A;  1FX7 A;  3H8Z A;  3L2Q A;  1K8A C;  1O75 A;  5GAO r;  1OMU A;  4JLG A;  3TEE A;  1SGD I;  1E7L A;  3M56 A;  2YLC A;  2RK1 A;  4AFQ C;  1PC0 A;  1Y57 A;  2DEU A;  4L6V 5;  3OS5 A;  3UWN A;  1YCS B;  2NWM A;  1VQ7 T;  4WCI A;  4JZ3 A;  2XK0 A;  2PNI A;  2JMA A;  1YIJ T;  3VU3 C;  2CP7 A;  2CDT A;  2RH2 A;  2UVO A;  2DA9 A;  2UZ3 A;  3M0Q A;  4NOY A;  1VIF A;  4LDU A;  3LH0 A;  2QPO A;  2RJF A;  3CPF A;  1X27 A;  2ZPH B;  3PVL A;  4M77 F;  2XU8 A;  1WGS A;  1PSF A;  3DKM A;  1N5Z A;  1YIT T;  2V53 A;  2FL7 A;  3FB9 A;  4AFS C;  1SHG A;  4AT1 B;  1BCM A;  2E6Z A;  1ZUU A;  2CUD A;  4RG2 A;  1HJD A;  2KXD A;  2GTO A;  5CVI A;  3VDP A;  1VQ7 A;  3OYL A;  3L2U A;  2XRC A;  2M0Y A;  1VQO Q;  4DNC A;  1SPK A;  4E1R A;  2QQ9 A;  1ZUY A;  2FPE A;  3J80 E;  2CP0 A;  2DXC A;  2EQM A;  3T9N A;  1VQ9 T;  5GAM h;  3GNG A;  2DBM A;  1YIT A;  2KT1 A;  3P8D A;  1NJI U;  9ATC B;  1MGQ A;  2ZPE B;  1OV3 A;  2HDA A;  2HQX A;  1X2K A;  1S72 T;  4FL6 A;  2RI2 A;  1G3T A;  5CAI A;  4M77 C;  3A1P A;  3VS4 A;  2JA1 A;  4B6D A;  5A0L A;  4L9M A;  1YCY A;  1K0S A;  1G8X A;  1X43 A;  2KEA A;  2M02 A;  2DTH A;  5GAO q;  1U5K A;  1JQQ A;  3G71 T;  4J6Y A;  2K2V A;  4JS4 A;  1M5Q 1;  1PKT A;  4OF1 A;  5J39 A;  1B7T A;  2DET A;  4PFZ A;  1ZUK A;  5GAN d;  3GPL A;  3G7Z A;  2RHY A;  1LOJ A;  2M51 A;  5EG2 A;  3VS0 A;  2D9T A;  5CQX A;  2E3I A;  2RJE A;  4M77 A;  1UGR B;  2CWG A;  5KYW B;  8AT1 B;  2QAS A;  4BY6 B;  4Z02 A;  3CC4 T;  4XTZ A;  3KY9 A;  5KH6 A;  5EX3 A;  3MET A;  4OMP A;  1YI2 Q;  4BI8 B;  2F2X A;  2N52 A;  3QKJ A;  1ZSG A;  3CCM Q;  1MMA A;  3JCM g;  3QII A;  2QEX Q;  2DJZ A;  3G71 A;  2EQK A;  2CS7 A;  4II1 A;  4XU0 A;  2AZV A;  1S20 A;  2NUT B;  1WLP B;  2OX7 A;  4RTV A;  1UVF A;  3V8K A;  2H3J A;  5FU7 C;  2BUS A;  1MJA A;  3TO7 A;  4KBM B;  2K3B A;  5GAN 3;  2KE9 A;  4GI3 C;  1YN8 A;  1MMN A;  2ZZD A;  2ELI A;  2JZM A;  1OZ2 A;  3EAE A;  3CC4 A;  4JDS A;  1ZHI A;  1YJN T;  4PJO E;  1GFC A;  2RD1 A;  1N8R C;  1BI3 A;  3QZ9 B;  2DIL A;  4C8Q E;  3E2I A;  5FRM A;  5FWB A;  2YUU A;  2FPF A;  4QQD A;  2GNC A;  4RCC A;  3CCQ Q;  1TUS A;  1MJ9 A;  4QVC A;  2X3W D;  2QI2 A;  5L8R E;  1UJ0 A;  4AFU C;  2O4X B;  1ZSZ C;  2K9H A;  3V7R A;  2DLP A;  5GAN e;  4ZTJ A;  2X4X A;  4C0D B;  2LCL A;  4M78 D;  2J7I A;  2B8A A;  2A28 A;  4M75 F;  2LX9 A;  1VQL T;  4C92 F;  3JCM f;  3CPW P;  5GMK j;  2O2O A;  1UUE A;  2OJ2 A;  1XJW B;  1YJN A;  1M1K U;  1G3Y A;  1NM7 A;  2DNU A;  4E47 A;  1M2V B;  2C06 A;  2KRN A;  4Z88 A;  4E7S A;  5KYU A;  3ZFJ A;  4J9D A;  2A08 A;  1WJR A;  2AKK A;  5KYX B;  1BU1 A;  1TBR R;  4LDY A;  2LRQ A; 
#chains in the Genus database with same CATH homology
 4QQ6 A;  4C5I A;  2ZCF B;  3M59 A;  5GAM g;  3PIO A;  1NZ9 A;  1NUB A;  1E7D A;  1O9S A;  2NU4 I;  2BKD N;  2YRV A;  4HT8 A;  2XIC A;  1WNL A;  2LC4 A;  1M1F A;  4JS5 A;  2DD4 A;  3FRN A;  1Z7K B;  1CGJ I;  3L2Z A;  4M75 C;  1W3S A;  1U8R A;  5LJ5 h;  4EPC A;  3SGQ I;  3SWN B;  4X9C A;  4BD3 A;  2RI3 A;  1Y96 B;  1HJA I;  3UGI A;  5FUW A;  2XHC A;  1IZ6 A;  3NTK A;  4A4K A;  1UVG A;  3UGL A;  4EMG A;  2A3L A;  2EFI A;  4M75 A;  3VYG A;  1PTQ A;  3OYM A;  4SGB I;  2WSC E;  5GAM f;  2N1A B;  3MEK A;  2DVE A;  3CD6 T;  2V8K A;  3C95 A;  3PT9 A;  5D6X A;  1U1T A;  4XAX B;  3CCS T;  1M1G A;  3HRU A;  4RCB A;  4E7H A;  1YHQ T;  1CGI I;  5M9O A;  2P0P A;  1TUR A;  2E64 A;  2Y4X A;  3M4G A;  4A54 A;  2K5I A;  1UGS B;  5GAM j;  4L59 A;  2QQC A;  1WQ7 A;  5LL6 S;  1SGE I;  1Y07 A;  4KUL A;  3RMS A;  1OYX A;  2DZ9 A;  5GAO p;  2EJG A;  5GAO n;  3CD6 A;  4N0A A;  3QDR B;  1N13 A;  2R5A A;  4B9W A;  2K5L A;  1Q86 C;  3CCS A;  2OTJ T;  3EFS A;  4PLI A;  1YHQ A;  4FIB A;  3A8M B;  4MMK A;  3FJP A;  4DOV A;  4IUV A;  1HDL A;  4ZGD B;  5FU6 C;  3HP9 A;  3CC7 T;  3QTL D;  1BKB A;  2QTX A;  3JB9 H;  4KUI A;  4IUR A;  2FVU A;  1BMO A;  4PJO B;  2D6F A;  2VXE A;  2OTJ A;  3V7S A;  4JCV E;  1N8R U;  1VQO T;  4QVD A;  3DB4 A;  2CZ0 B;  3A8G B;  4J7F A;  4M78 F;  1H3Z A;  4FM4 B;  3JCM b;  2QQD A;  1I81 A;  5HKC A;  4HT9 A;  3CCV A;  3CC7 A;  5LJ5 g;  4ZN1 A;  3C4S A;  4PJO D;  2QQB A;  2PVD B;  2DB6 A;  3SEK C;  4EDU A;  4GY5 A;  4C8Q D;  3CCR T;  3ASK A;  3A8L B;  3CCE T;  5FLX E;  2QQE A;  3OYG A;  2M0O A;  2NU2 I;  3JB9 D;  1Q82 C;  2KCX A;  2X35 A;  2F5K A;  4IUP A;  4A4G A;  2DIQ A;  2JW6 A;  3BDU A;  4E7I A;  5CKD A;  3QHS A;  2L7X A;  5FU7 B;  3X24 B;  1VQM T;  2CKK A;  1YI2 T;  2EJF A;  3CCR A;  2ZPB B;  2YHT A;  2DEQ A;  3CCE A;  3KUF A;  5AYF A;  4C5H A;  2NU1 I;  3KXT A;  1TBQ R;  2EQJ A;  5LJ5 f;  1FAQ A;  1PSE A;  4WF2 A;  4IUT A;  1I8F A;  5KE3 A;  3HH2 C;  4M77 G;  2DIP A;  1Y8F A;  4ZTF A;  2DK3 A;  2BUD A;  1VQM A;  1Q81 C;  1G5V A;  1PPF I;  4HCB A;  1LR7 A;  2KMP A;  3MO8 A;  1QP3 A;  2KMQ A;  3KBG A;  1M9S A;  5LJ5 j;  3E1S A;  3QZ5 B;  1RL2 A;  3HKS A;  3HRS A;  3OW2 A;  2PUO B;  4DA4 A;  2LTO A;  3CBM A;  3VYH B;  1BIB A;  4F7U F;  1FYB A;  4MDX A;  1RI0 A;  2QNF A;  5FUV A;  4ATO A;  5LJ3 d;  5DLO A;  2XD0 A;  2LUY A;  3TJQ A;  4C0G A;  4BDZ A;  3J81 E;  2VRW B;  1FXX A;  3MEV A;  4D6W A;  1X74 A;  1YJW A;  2KMR A;  2WVJ A;  1I4K 1;  3LGL A;  3OW2 S;  2L8E A;  2NU0 I;  2JVV A;  1YBY A;  3TU4 K;  1K73 C;  3GIB A;  1TBO A;  3A8O B;  3O8V A;  3H6Z A;  2SGD I;  2CGH A;  5IN1 A;  3JB9 J;  3VV0 A;  1HXD A;  4OB3 B;  5FRN A;  1LNX A;  3SB2 A;  2DZC A;  4CRI A;  3OYC A;  5GAN 2;  5GAN h;  4F7U A;  4BI3 A;  3WVD B;  1VQP T;  2F5T X;  1YIJ A;  4ZN3 A;  5LJ3 e;  3VDU A;  4V2S A;  3QBY A;  4JRP A;  3OYF A;  4E7L A;  3RIR A;  3SD4 A;  3OXF A;  1DS2 I;  2GFA A;  4UC4 A;  2DD5 A;  2XDB A;  2D0Q B;  4NS5 A;  3HL8 A;  5CCM A;  5HQ8 A;  2EJ9 A;  4XU2 A;  3DB3 A;  3OYD A;  3CBP A;  1VQ5 T;  3ER0 A;  1JBM A;  3FDR A;  1FAR A;  3TCJ A;  2QQR A;  4M75 G;  2EIF A;  1VQP A;  3BDL A;  3ZBD A;  4FT4 A;  2WSE E;  1VQK T;  1P92 A;  5FU6 B;  1SGQ I;  4EMK C;  1VQ9 A;  3OS1 A;  1M8C A;  1JRI A;  4IUU A;  4BE0 A;  2JYY A;  3OY9 A;  2JZ2 A;  1SGR I;  3MP6 A;  4LD6 A;  2JUF A;  1S72 A;  3R6O A;  1VQ6 T;  4XTY A;  2RB6 A;  2K5F A;  1ZQ1 A;  4M7A F;  4EMK A;  3OBW A;  1VQ8 T;  3OYA A;  3QUI A;  5GAO m;  3LW5 E;  1VQK A;  4FKD A;  1BI2 A;  2LT1 A;  2R5M A;  1WQW A;  2RHZ A;  2MAM A;  5CKB A;  3UPU A;  1LR8 A;  3GP8 A;  1H0Z A;  4N4H A;  4M7D F;  3CC2 T;  1OYV I;  1Q81 U;  4HKE A;  3X20 B;  4BB7 A;  1MHN A;  1KD1 C;  4M77 E;  2V1C C;  1VQ6 A;  2VGN A;  3C94 A;  2QXF A;  3JCM P;  1SGP I;  1U1S A;  3X28 B;  3OS0 A;  1I5L A;  3QXE B;  3QG1 A;  2SGP I;  4VUB A;  1R0R I;  2RJC A;  3BFM A;  2IVW A;  4M7A C;  4EMH A;  1D3B B;  5GAO l;  2V1C A;  3CC2 A;  3RKW A;  4BI4 A;  2XDP A;  2RI5 A;  5GAN g;  3E9G A;  4A53 A;  4M7D C;  1XQH A;  3CME T;  4ZGE B;  3Q1J A;  2PVO B;  3I55 T;  2DKG A;  1VIE A;  2L8D A;  1K8A U;  4J83 A;  2K4Y A;  4M7A A;  2ARP F;  3RES A;  2PQW A;  4R55 A;  1Y1B A;  2RHX A;  1IY5 A;  2WCY A;  3CBO A;  3OYB A;  1XTD A;  2G3R A;  1VQL A;  1JB0 E;  4M7D A;  1K9M C;  2GQV A;  1K73 U;  4OGC A;  3UEY A;  3CCU T;  1YJ9 T;  4C5G A;  4C92 C;  3MP1 A;  2QDY B;  3I55 A;  4LD9 K;  1X4S A;  3NTH A;  2DO3 A;  2XG8 D;  3PMI A;  4PLL A;  1NPR A;  5GAN f;  1UGP B;  2E73 A;  5A2Q E;  4PL6 A;  3M4Y A;  2OD1 A;  2YQP A;  4C92 A;  1UEB A;  4OVA A;  2P6A C;  2E6N A;  4XU1 A;  2NLU A;  2GKV A;  3LWH A;  4OP0 A;  2N71 A;  4HCC A;  2KSS A;  5IT9 E;  1DS3 I;  5HK3 A;  5GAN j;  2PUK B;  3OXG A;  1QVF A;  4QVZ A;  3OB9 A;  3HRT A;  2HAX A;  4F7U B;  3TRE A;  3L42 A;  2PU9 B;  3SFM A;  1BIA A;  2GCX A;  4M75 E;  4C92 E;  5LJ5 d;  4C0Z A;  4J6W A;  2LVM A;  3OQ5 A;  1QW1 A;  1KBF A;  1M4Z A;  4J7I A;  4JRK A;  5CQY A;  4IUQ A;  3SGB I;  5JHW C;  2LNV A;  2E12 A;  3LLR A;  3QO3 A;  3URG A;  3QYH B;  2MMP A;  4J8O A;  1QVF S;  2VC8 A;  3NFC A;  2L5Q A;  2E1H A;  2FYK A;  3LYI A;  3P8H A;  5CKE A;  3X25 B;  4M77 B;  1CT2 I;  1TGS I;  3HHT B;  1N27 A;  4KT0 E;  2FB7 A;  5D6Y A;  3L2V A;  3MEW A;  4C0F A;  2R57 A;  1UGQ B;  3GF5 A;  4ELY C;  1MT1 A;  4BE2 A;  5GAN 5;  2KMO A;  4BY6 C;  4JLI A;  3QJ6 A;  1SGN I;  2A7Y A;  3PNW C;  1G3W A;  5GAN 4;  3S3M A;  4M77 D;  1V1I A;  3D00 A;  4MDW A;  3PTA A;  3RUX A;  3ME9 A;  3VKI A;  3PGG A;  4F7U G;  2YLB A;  4Y28 E;  4MZM A;  1BI0 A;  4N4I A;  1TIH A;  4HGU A;  2MWP A;  3LX7 A;  3A5Z B;  1VQO A;  5C6S A;  3JCM X;  3F70 A;  1NJI C;  4A4F A;  3V8J A;  4OB1 B;  3WVE B;  3E19 A;  3RMQ A;  3MP8 A;  2CYZ B;  1EIF A;  4M78 C;  2DXU A;  3HFO A;  4LDV A;  2DTO A;  5FUY A;  2HBP A;  5CO7 A;  4BDY A;  2ORV A;  2AHJ B;  2M1H A;  3LGF A;  3MCA B;  3CCM T;  1K9M U;  2DXT A;  3JSC A;  2QEX T;  2SGE I;  2KY9 A;  2RO0 A;  2ENZ A;  2E10 A;  2FNF X;  4QQG A;  2VUB A;  4GLK A;  5LJ3 h;  2LDM A;  1XBT A;  2QA4 T;  4M78 A;  1BUS A;  5CCL A;  2Y4Y A;  5IAY A;  4LDW A;  4M7A B;  2V8J A;  3M53 A;  4OB0 B;  1W4R A;  1YI2 A;  2O4X A;  1Y71 A;  2IG0 A;  3CCM A;  2A20 A;  3OYN A;  2QEX A;  4RKU E;  2CJS C;  1KHI A;  3UDC A;  3CCQ T;  1LR9 A;  2ZPG B;  3OYJ A;  4PKC C;  2GKT I;  1IRE B;  1TOT A;  3VE5 A;  5CKF A;  3S3N A;  5C0M A;  2RHU A;  3SDZ A;  5DY9 A;  2JNG A;  2O01 E;  1X6O A;  4FT2 A;  3GNF B;  2R58 A;  3SWN C;  5HY6 A;  2VGM A;  1OI1 A;  4M75 B;  2BIV A;  3NTI A;  4C92 B;  3UEJ A;  3CCQ A;  2MWO A;  3BY7 A;  1HPT A;  3JCM J;  3JAM E;  3OMC A;  1KMA A;  1Q86 U;  4ELZ C;  3QPH A;  4A4E A;  3L2W A;  2E5R A;  3PIP A;  3QSU A;  1XNI A;  2SGF I;  3SWN A;  3JRZ A;  5FRO A;  2RA2 A;  4M75 D;  4FU6 A;  1Y96 A;  4C92 D;  2E65 A;  3HFN A;  2VV5 A;  1N9S A;  1WJS A;  3HPW A;  4C5E A;  4M7A G;  1CT0 I;  5KE2 A;  3I56 T;  3ZEH A;  4OMF B;  1KQ1 A;  2LQK A;  1DJ7 B;  1AN1 I;  2WAC A;  4JRI A;  4PJO F;  3GOX A;  4M7D G;  4E7K A;  1SSF A;  2ZGW A;  1ZBX A;  4C8Q F;  3JCM d;  4JJN K;  4ME7 A;  3UFF A;  1SGY I;  3JB9 F;  3J7A F;  5I21 A;  4BUG A;  3OYK A;  5LJ3 g;  5KCH A;  4O6J A;  1Y1C A;  3I56 A;  1AHJ B;  5CKH A;  5CR2 A;  4FSX A;  4Q5W A;  1X75 C;  3AHU A;  1WPY A;  4RMO A;  1G3S A;  1Q82 U;  2CZ6 B;  1LJO A;  1UUC A;  3S6W A;  1IY6 A;  2L89 A;  4C92 G;  4F7U E;  4JRQ A;  1GXI E;  4X34 A;  4ZGJ B;  1EN7 A;  2XI9 A;  2M9U A;  4PJO C;  2P0Q A;  4NL3 A;  5GMK e;  2KK4 A;  4C8Q C;  4TVR A;  1XX6 A;  3P8B B;  2JXD A;  1VQ5 A;  5DM7 R;  4PNO A;  4UXH A;  3M58 A;  3HSB A;  2F3C I;  3FLG A;  5LJ3 f;  4PJO A;  1TBN A;  3INZ A;  2HQE A;  3JCM e;  2X4Y A;  2K57 A;  3CPW A;  4C8Q A;  3RKY A;  3L1A A;  4L5G A;  5GAM d;  4A4H A;  2LRQ A;  3OS2 A;  1R79 A;  1CE3 A;  4DQ2 A;  3QJY A;  1BI1 A;  3V7C A;  3DLL A;  1RFH A;  1QVP A;  2CZ1 B;  2OAU A;  2VYT A;  2GFU A;  3FIF A;  5LJ3 j;  1BYM A;  2DPP B;  5GMK m;  1VQN T;  5HI7 A;  2N17 A;  1VQ8 A;  4IKF A;  5CCA A;  4XK8 E;  4QW2 A;  5CIU A;  1XA6 A;  1N6A A;  4XQ3 A;  4M78 B;  4HA8 A;  5J26 A;  3G6E T;  1B34 A;  1R8O B;  3X26 B;  3E59 A;  3LWI A;  1KC8 C;  3CPW S;  5GAN 8;  2K3Y A;  3RER A;  3BW1 A;  4CI0 C;  1W2B A;  1VQN A;  2RHI A;  3QWP A;  2QNC A;  5DLQ E;  2J87 A;  1UB4 A;  1VDD A;  5GAN 7;  2ENN A;  3BJI A;  1XOV A;  5GMK l;  3M5A A;  5GAM e;  1Q7Y C;  3FC3 A;  3MEA A;  3G6E A;  3OYY A;  3VUB A;  1QVG A;  4UXJ A;  3CME A;  3GLX A;  4XTX A;  2F69 A;  2MI6 A;  2RM4 A;  3A8H B;  3M9Q A;  4Y91 A;  3S3O A;  2RK2 A;  3OSS C;  3OXL A;  1PJU A;  4M7A E;  2K3X A;  4LDX A;  1CT4 I;  2EAY A;  1W2B S;  2M5X A;  2EKO A;  4OVO A;  3RKX A;  4R56 A;  4BAC A;  2RJD A;  1Y7X A;  4E7J A;  2Y90 A;  1FWZ A;  2P4T A;  4A24 A;  4JUV A;  3PFS A;  1KG1 A;  3CCU A;  4M7D E;  2DXB A;  1YJ9 A;  3M57 A;  1M90 C;  3OA6 A;  3E9F A;  4M78 G;  4XTW A;  4OB2 B;  1KQS A;  4KUD K;  5I2M A;  2EYQ A;  1QVG S;  2GKR I;  3OYE A;  4NL2 A;  2XID A;  5FUX A;  3JCM Q;  1KHC A;  1NPP A;  1JJ2 A;  2JTM A;  3CXL A;  5KCO A;  2DAQ A;  1H64 1;  2GF7 A;  5HK0 A;  2JN0 A;  2HNI A;  4HCZ A;  2VXF A;  2WSF E;  4N0A C;  3VJP A;  1KBE A;  2HD0 A;  3WXM B;  2XDD A;  2KAF A;  1VQ4 T;  2ERW A;  1OZ3 A;  2EQU A;  2ODD A;  1WJQ A;  1KQS S;  2E70 A;  2MF2 A;  1HK9 A;  1YU6 C;  3G4S T;  2LT4 A;  3JCM W;  2PVG B;  2KQW A;  2DIG A;  3OVO A;  5GMK i;  2ORW A;  2B8T A;  1W4S A;  1JJ2 S;  4XU3 A;  3OYH A;  1VQ4 A;  4XTV A;  2DTI A;  2XKO C;  3FEO A;  1KD1 U;  1CHO I;  2EWN A;  3M54 A;  3CCV T;  2P0K A;  1IW4 A;  3PMT A;  2JTF A;  1X01 A;  3CCL T;  3RU0 A;  3G4S A;  3OBY A;  2LEO A;  2OTL T;  4J5Y A;  4EMK B;  2ZPI B;  2E5Q A;  2SGQ I;  3L2R A;  4C8Q B;  2OVO A;  3CXC A;  3OL0 A;  5LJ5 e;  4E1P A;  2I2L A;  3UT1 A;  2QQA A;  4YTL A;  4BE1 A;  1KC8 U;  5I2S A;  4J6X A;  3QYG B;  3PDN A;  4O5V A;  3JB9 I;  3MHX A;  4OGE A;  3CCL A;  3CCJ T;  2ROW A;  5EX0 A;  3CEY A;  2OTL A;  1PTR A;  2LQ8 A;  2LCC A;  2NU3 I;  2KVQ G;  1Q7Y U;  1OMT A;  2QQ0 A;  3EFR A;  3JCM c;  4MZT A;  1KQ2 A;  1NE8 A;  5CK9 A;  2L3R A;  5D6W A;  5A0G A;  1QP2 A;  1B34 B;  1CSO I;  4UXI A;  3CXC S;  1N9R A;  4C0D C;  2GVI A;  3DLM A;  3CMA T;  3CCJ A;  3N5B B;  1V1H A;  2JOY A;  2M16 A;  5GAN 6;  4MML A;  1M8B A;  2ZPF B;  3C12 A;  3OMG A;  4DOW A;  2V8I A;  1D3B A;  1VUB A;  1V29 B;  4M7D B;  4PJO G;  3B4V C;  1M90 U;  5J3B A;  4M7A D;  5A0D A;  4C8Q G;  1PCE A;  3V8L A;  2QA4 A;  3CMA A;  4XTU A;  3JB9 G;  2W0T A;  4P5N A;  4M78 E;  5GMK h;  1M8V A;  1TH7 A;  3MEU A;  4M7D D;  2FHD A;  2J9R A;  1YJW T;  2KMT A;  1OVO A;  2E41 A;  3OSV A;  4MZP A;  2CZ7 B;  3JCM V;  1YTP A;  5DAE A;  4B9X A;  2X4J A;  3OYI A;  3UGD A;  3JCM h;  4N4G A;  3M55 A;  1M1K C;  3VUZ A;  4RG8 A;  2KDS A;  4X9D A;  2QQS A;  2X4W A;  1FX7 A;  3H8Z A;  3L2Q A;  1K8A C;  1O75 A;  5GAO r;  1OMU A;  4JLG A;  3TEE A;  1SGD I;  1E7L A;  3M56 A;  2YLC A;  2RK1 A;  4L6V 5;  3OS5 A;  3UWN A;  1VQ7 T;  2XK0 A;  1YIJ T;  3VU3 C;  2RH2 A;  2UZ3 A;  4NOY A;  1VIF A;  4LDU A;  3LH0 A;  2QPO A;  2RJF A;  3CPF A;  2ZPH B;  4M77 F;  2XU8 A;  1PSF A;  1WGS A;  3DKM A;  1YIT T;  2V53 A;  2FL7 A;  3FB9 A;  2E6Z A;  4RG2 A;  5CVI A;  3VDP A;  1VQ7 A;  3OYL A;  3L2U A;  2XRC A;  4E1R A;  2QQ9 A;  3J80 E;  2DXC A;  2EQM A;  3T9N A;  1VQ9 T;  5GAM h;  3GNG A;  1YIT A;  3P8D A;  1NJI U;  1MGQ A;  2ZPE B;  2HQX A;  1S72 T;  4FL6 A;  2RI2 A;  1G3T A;  5CAI A;  4M77 C;  2JA1 A;  4B6D A;  5A0L A;  4L9M A;  1YCY A;  2DTH A;  1U5K A;  5GAO q;  3G71 T;  4J6Y A;  2K2V A;  4JS4 A;  1M5Q 1;  5J39 A;  4OF1 A;  5GAN d;  3GPL A;  3G7Z A;  2RHY A;  1LOJ A;  5EG2 A;  2D9T A;  5CQX A;  2RJE A;  4M77 A;  1UGR B;  4BY6 B;  4Z02 A;  3CC4 T;  4XTZ A;  3KY9 A;  5KH6 A;  5EX3 A;  3MET A;  4BI8 B;  2N52 A;  3QKJ A;  3JCM g;  3QII A;  2DJZ A;  3G71 A;  2EQK A;  2CS7 A;  4II1 A;  4XU0 A;  1UVF A;  3V8K A;  2H3J A;  5FU7 C;  2BUS A;  4KBM B;  5GAN 3;  4GI3 C;  2ZZD A;  2ELI A;  2JZM A;  1OZ2 A;  3EAE A;  3CC4 A;  4JDS A;  1ZHI A;  1YJN T;  4PJO E;  2RD1 A;  1N8R C;  1BI3 A;  3QZ9 B;  4C8Q E;  3E2I A;  5FRM A;  2YUU A;  4QQD A;  4RCC A;  1TUS A;  4QVC A;  2QI2 A;  5L8R E;  2O4X B;  2K9H A;  3V7R A;  5GAN e;  4ZTJ A;  2X4X A;  4C0D B;  2LCL A;  4M78 D;  2B8A A;  4M75 F;  2LX9 A;  1VQL T;  4C92 F;  3JCM f;  5GMK j;  1YJN A;  1M1K U;  1G3Y A;  4E47 A;  2C06 A;  3ZFJ A;  1WJR A;  1TBR R;  4LDY A;  2B0U C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...