3FC3A

Crystal structure of the beta-beta-alpha-me type ii restriction endonuclease hpy99i
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
189
structure length
189
Chain Sequence
MLKNDDFVIAKNQLGNIVPNSVGVIRAVNGKSAMVLFIGLNELKRVDFSELEAIDIYRTGKGYDKKICNICHILKNTDGFEINQTDAKGRKTTRPSCRECRKNIDGVKLSSTEKKKMDEIAPPKGSVFTCPICEKRSIVGVTANLVHDHNHDTGWGREWICDSCNTGLGRFKDNPKFLEKVIEYLKKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease Hpy99I
publication title Crystal structure of the beta beta alpha-Me type II restriction endonuclease Hpy99I with target DNA.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/dna
total genus 48
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02945 Endonuclease_7 Recombination endonuclease VII
A PF18350 SH3_17 Restriction endonuclease SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fc3A01
3.30.60.130 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3fc3A02
3.40.1800.10 Alpha Beta 3-Layer(aba) Sandwich His-Me finger endonuclease fold His-Me finger endonucleases 3fc3A03
4BDZA 3CEYA 3MEAA 4A4FA 2LRQA 3OMCA 2QQRA 4IUVA 4B9XA 2E6NA 3LLRA 1WJQA 4EDUA 4BD3A 4IUPA 3E9GA 3PNWC 5D6WA 3L2WA 3F70A 5C0MA 3KUFA 2EQJA 2FHDA 1SSFA 5KH6A 2QNCA 3OA6A 1EN7A 2CKKA 2DIGA 3PFSA 3L2UA 3LH0A 4HCZA 5KCHA 3NTIA 2QQSA 3FLGA 3ZEHA 2L3RA 2R5AA 3MP6A 3ASKA 2YRVA 3M9QA 4PLLA 3OYDA 3MP1A 4PL6A 5KE3A 4E7HA 1N27A 2R58A 3OS0A 2EFIA 2M0OA 3DB4A 1RI0A 3LGFA 3C4SA 3PMTA 3OB9A 3QIIA 2K3YA 4C5EA 3H6ZA 2EKOA 3MP8A 4OVAA 3OY9A 3OYIA 4BE1A 4E7IA 1XNIA 4E7LA 2F5KA 4L59A 3UWNA 2VYTA 3OS1A 4E7KA 2R57A 4Q5WA 2RI2A 4NS5A 3PMIA 2O4XB 3E9FA 3MEVA 5D6YA 3OYAA 1E7DA 2B8AA 2RI5A 2X4WA 4Z02A 2XDPA 2E5QA 4GY5A 3MEWA 5C6SA 4FU6A 4N4GA 4IKFA 3OQ5A 2EQMA 3S3MA 3DLMA 4ZTFA 2GF7A 2QNFA 2R5MA 1OYXA 3QBYA 2LCCA 4N4HA 2GFAA 2RI3A 3MEUA 2G3RA 3OYGA 4BE0A 5KE2A 2RJEA 3OS2A 3UT1A 2MWPA 1OI1A 2JTFA 2WACA 2XK0A 4QW2A 3OYCA 3OYKA 1WGSA 2BKDN 2X35A 2LDMA 3S6WA 1WJRA 2NLUA 3LX7A 2HQEA 5CIUA 5D6XA 3MO8A 1MHNA 3LYIA 4RG2A 3OYMA 4BDYA 5M9OA 5J39A 4UC4A 2K3XA 4X34A 3L2QA 2RHXA 3FDRA 3LGLA 4IUQA 2EQKA 1OZ2A 4LD6A 2RHUA 2RJFA 4C5HA 5FROA 3OYHA 3QKJA 3OYFA 2O4XA 3GOXA 2BUDA 4BE2A 1H3ZA 2RHZA 5J26A 3OYBA 2D9TA 3SD4A 3ME9A 4QQGA 2M1HA 2PQWA 3QJ6A 3P8HA 4C5GA 3H8ZA 5IAYA 4C5IA 3OYEA 4N4IA 3OYJA 2X4YA 3S3NA 2DIQA 2LTOA 3OMGA 2P0KA 4IUUA 3Q1JA 2L8DA 3NTKA 3OYNA 1OZ3A 5FRMA 4FL6A 5FRNA 3META 4B9WA 1G5VA 2IG0A 2RJDA 2L89A 2BIVA 3O8VA 4E7JA 3BDLA 2EQUA 5IN1A 2X4XA 1KHCA 4IURA 3S3OA 1E7LA 2M16A 2DAQA 3NTHA 4PLIA 4QQDA 4II1A 2RHIA 2LVMA 2MWOA 3OYLA 3L2VA 4BACA 4QVZA 4A4HA 5KCOA 4A4GA 3P8DA 2RO0A 3FEOA 2JZ2A 3DB3A 3L2RA 3FC3A 2RJCA 4IUTA 4QQ6A 4A4EA 1WJSA 4CRIA 3EAEA 2GFUA 3L42A 2RHYA 2HQXA 4ZTJA
chains in the Genus database with same CATH superfamily
4WCIA 3A98A 4A4FA 2CZ7B 2LRQA 1PTQA 2NU0I 1FYBA 3SWNC 1RABB 1AWJA 3V7CA 4M7DE 2AZVA 4XTWA 3L2WA 3F70A 5EX3A 5IXFA 1PCEA 3JCMd 1NJIU 1TSFA 3CCLT 3EG3A 2KMOA 5LJ5f 1WI7A 2RIJA 5FUXA 3FLGA 3G6EQ 2R5AA 4PLLA 2K4YA 1ACMB 2LUYA 2XD0A 3CCJQ 4UXIA 1QVFA 4C5EA 4ZNXA 1VQKA 1M3CA 2DVJA 3JCMX 1VQLA 1V1CA 1PSEA 2O4XB 2EYWA 3OYAA 3RKYA 2E5QA 3JB9F 1YBYA 3HH2C 1YCSB 5GJVB 4M77G 3EHRA 5LJ3g 4QT7A 5A0LA 1SGNI 3RERA 1C1AA 1YJNA 3JCMV 4FT2A 2QNFA 4JZ4A 4J9FA 1BCMA 4J9IA 1ZSZA 2A28A 2PVDB 2LCCA 4FYXB 3GP8A 4BE0A 4AMLA 4EMKB 4PJOG 1P9ZA 2RB6A 1NLPC 5FU6C 2CWGA 2YUOA 2BTTA 4J7FA 1YITA 3CD6A 3I56T 1KMAA 4X34A 5I2SA 1R77A 2HL3A 3VRYA 1WPYA 4AG1C 3I55T 4HA8A 1VQPT 5CKFA 5IHNA 5GAOr 2JYYA 1QVFS 1E7OA 1WHGA 3NHNA 3CXCA 2B0UC 1WXBA 1N9RA 1E6GA 1Y1CA 1OULA 3NTKA 1ZA2B 1K9MR 1Q7YR 4J6XA 2SEMA 3VS1A 1I1JA 1PKTA 3OW2S 2KMRA 2AK5A 2V1CA 4D8KA 1U5SA 1ZSZC 2Y90A 2CWFA 3TO6A 1TBNA 1P92A 2A0FB 4KRTA 2DXBA 2RJCA 1V76A 1YJNT 5CQYA 2E5KA 3VKIA 4DQ2A 1OU9A 3JB9J 1GFDA 4OMLA 1K76A 3J81E 1X43A 2YSQA 2V1QA 1YCYA 1QMCA 1X74A 5JHWC 5GMKj 3X20B 5GAMf 2K5LA 2JTMA 3LH0A 5GAOp 2LNVA 3NTIA 1YITT 1I8FA 3BW1A 2GVIA 3FSXA 2FL7A 2R58A 4Z8AA 3A8LB 3LGFA 1R0BG 1GL5A 4CC2A 3OBYA 4MZPA 4BE1A 1N13A 2L7XA 2XKOC 3SB2A 2V1CC 4NS5A 2ELIA 2G6FX 1JJ2S 1CT2I 1HSQA 2ZZDA 4RTTA 2NU1I 1UDLA 5GMKm 1KQ1A 3DLMA 4XTYA 2GKRI 3HPWA 2GNCA 3CPFA 2R5MA 1OYVI 1OMTA 4M7DB 3CQTA 2P0QA 1IXDA 2H3JA 4ATOA 3CCRT 3OYCA 2X35A 1BI2A 1K8AC 2HQEA 1VQKQ 1VQLQ 2QTVA 4D8DA 2EJ9A 4HKEA 1KFZA 1YJWA 5CCLA 4JPBW 3WVEB 4C5HA 4XU3A 5KYNA 3CMEA 4OF1A 4LUEA 1D1BA 3QG1A 3CC7A 3SD4A 1B3QA 2JOYA 3CC2T 2K5IA 2CP0A 3OYJA 3S3NA 1D0YA 2ROLA 1H8KA 5GANj 4F04B 4FL6A 5GAN7 2BIVA 4FKDA 1YWPA 2QDLA 3M0PA 4IURA 4ELYC 3CD6Q 2DXCA 2OAUA 1I81A 4XTXA 6AT1B 2MWOA 3GNFB 3CMAA 4PNOA 2OJ2A 1KQSA 1Q95G 4RTUA 2QQ9A 1Y96B 3DB3A 2HKQB 4FYVB 3TQ7P 1M3AA 3P8BB 2VVKA 3M59A 3T9NA 2OD1A 3UATA 2LMJA 4GI3C 4OMOA 2HQHA 3KUFA 1SRLA 4JRKA 3KFVA 2CS7A 1JB0E 3L2UA 2QEXA 2K6DA 2DJQA 5A2QE 1LVKA 1RADB 4HT9A 1QP2A 2ZPHB 1BKBA 3CC7T 3OXLA 2MOXA 1ABQA 2J9RA 3UWNA 3D00A 2VYTA 1ZA1B 1SKUB 3QWXX 5AT1B 1K8AU 1IHWA 2VXEA 2Y4XA 3RDVA 1BCOA 3LH5A 3UEYA 2XRCA 3CCVT 3OL0A 4JZ3A 3M53A 2RN8A 1MNDA 2X3WD 1O9SA 1I0CA 2HBWA 5GAN6 3OS2A 2JS0A 3PT9A 1VIEA 2A3LA 4RUGA 2UZ3A 2X9HA 1QW1A 3LW5E 2XG8D 4RG2A 1T3SA 5J39A 4MPIA 2K3XA 2DTHA 4JRQA 4M75A 4KUIA 2NU4I 1XBTA 4BE2A 3OYBA 2P0PA 5GMKh 4CI0C 4JJNK 3SGQI 4C5IA 4UXHA 2OTJA 3GPLA 1VQNA 1G5VA 1M2OA 2ZCFB 1RI9A 1I07A 4Y91A 3QSUA 2DL3A 1NM7A 4II1A 1YJWQ 3CMEQ 2CP2A 1HEVA 1JU5C 2RMOA 2CP7A 4M77F 1WJSA 2DPPB 3EAEA 1W2BA 1VQ8A 5IT9E 4LDXA 3JB9G 2RNAA 5HY6A 1T0HA 5J3BA 5GAN4 2B86A 3QZ5B 3E9GA 4X9DA 1M8MA 4PJOF 5KH6A 2HCKA 3TOBA 1CSKA 1YTPA 4ANJA 4F16A 3CCMQ 1B34B 1X2QA 1UGPB 3EGDA 4XTVA 2C06A 3ASKA 2YQPA 1QP3A 4PFPA 3CMAQ 3HHTB 3HKSA 1RI0A 1ZX6A 2CP3A 2L0AA 3PMTA 4JS4A 2N17A 2KI7A 3H6ZA 1HDLA 3CXCP 2EBPA 2V8IA 2CDTA 1OU8A 4J6WA 2FZGB 5A0GA 4LDYA 4C8QE 1HXDA 1RLQC 4WF2A 3EFOB 2WGCA 9WGAA 8ATCB 2GF7A 1XQHA 1TBQR 2QEXQ 1BB9A 3NFCA 3QBYA 1OYXA 3C12A 4R0KA 1Q7YC 3MEUA 1NZ9A 5KE2A 5LJ3h 3TREA 1VQ5A 2FEIA 1KSWA 1TBRR 1F1BB 1JQQA 3UPUA 2KVQG 1WHHA 3E2UA 2KXCA 5EC7A 4QKUA 2DEUA 1VYTA 4M7AE 4OB0B 2HDAA 1UUCA 3URGA 1V1HA 3REAB 3MCAB 3QKJA 2EJGA 2K7AA 3L1AA 2M0YA 1VQ4T 1OEBA 2C0TA 4J9GA 2DZ9A 9ATCB 2DL5A 5LJ5d 1WHKA 2HKNA 2CZ1B 1QLYA 1S72A 1K4US 1PCXA 3VUZA 2FPDA 3A5ZB 2LQNA 3RKWA 1CKBA 4B9WA 3H41A 3ZBDA 2MPXC 1Y7XA 4FCYA 3CC4T 3OYYA 1QVGP 4R55A 1E7LA 3NTHA 1WXTA 1VYUA 2F2VA 3PGGA 2NU3I 3PE0A 4WTOB 4BACA 4KGZB 5FUWA 1TIHA 1G3WA 5GANe 3EG9B 1UG1A 2IPOB 3MKDA 2JM8A 2KT1A 1ZSGA 4BDZA 2MYSA 2VWFA 1UUEA 2OTJQ 1OOTA 2JT4A 1I5OB 3EGXA 3I35A 2DK3A 4DEXA 5J8FA 1IREB 2NUPA 1VQNQ 2LCSA 3MEKA 2RK2A 5KCHA 3GIBA 1M2VA 3E1SA 1SPKA 4PJLA 3C94A 4E6RA 5LJ5g 4PL6A 4FYWB 1AOJA 2M0OA 1Q7YU 2YXYA 3SDZA 2E73A 1S1NA 1JRIA 2K79A 3OYIA 1VQ8Q 4L59A 1TOTA 4HCCA 2CUBA 4C92E 1WIEA 1WGCA 5HQ8A 2RI5A 2HAXA 3BDUA 4FU6A 1BIAA 2QQEA 1TURA 1UVFA 4E1RA 5CO7A 4XU0A 2DM1A 1XTDA 1X69A 3REBB 1AVZC 1SG5A 1M4ZA 2MWPA 3RNJA 1QCNA 3V8KA 1R0CB 1WGSA 4HXJA 2ENMA 1SGRI 4M75D 1ZUKA 1ULKA 1MMAA 5CIUA 3CCQQ 3G71Q 1K7VA 1VIFA 3LGLA 1GCQC 3OYHA 1ZBXA 1RAFB 4MDWA 3OYFA 2O4XA 5GAMd 2KCXA 3VS6A 2RHZA 4OMPA 4QQGA 2LNHB 3G6ET 4C0GA 4KGXB 5GAN5 2DFUA 4EPCA 1VQ5Q 4C8QB 4LDWA 3CCJT 1N8RC 5FRMA 4EMKA 4JCVE 5FRNA 1Z9QA 2IG0A 2RJDA 4O5VA 1D09B 2QQ0A 3BY7A 2RHIA 1WQ7A 2P4RA 1EIFA 2ARPF 2F2WA 1X6OA 4NL3A 2DYBA 3TO9A 4M7AB 2WSEE 3UA7A 4BY6B 1S72Q 4HGUA 2L8EA 3MPUB 5A0DA 1H3HA 4M78E 1MMDA 5GAMg 1OVOA 2ERWA 2XDDA 4AFSC 5GAOl 1PNJA 4ORZA 5LJ3d 4ZN1A 2RQRA 5KE3A 3M0TA 2LT1A 2CP5A 1WQWA 3SGBI 3OY9A 3CCUA 1X2KA 4K11A 2EW3A 1QQJA 2GKTI 4LN2A 5IXBA 2O88A 2GIVA 4JRIA 1GXIE 1BI3A 2KRSA 1KQ2A 4IKFA 2WCYA 1UHFA 2QQAA 1VDDA 4TVRA 3QO3A 1IW4A 1N6AA 5IHKA 3C95A 1W6XA 2ORWA 2EQIA 3JB9H 3UGIA 3HSBA 2ZPEB 1W2BP 2ABLA 3UA6A 1UGSB 1Y0MA 3UGLA 3BFMA 1N8RU 4F17A 3TVTA 3OVOA 1ZLMA 2EWNA 1TXQA 2RHXA 3I5RA 3FRNA 4E7ZA 2YUNA 5CCAA 5LJ5j 4JRPA 2H8HA 2QG9B 4LD9K 3WVDB 4KGVB 1Q86C 2XICA 4PKCC 3ME9A 3LWIA 4P5NA 1UB4A 2D0QB 4N4IA 2ENZA 4C92B 1W70A 1JBMA 4IUUA 2Z0WA 1HYOA 2K5FA 2RQVA 4M7DA 3JSCA 3R5AA 2L89A 3O8VA 1YNZA 4MZTA 2F3CI 3S3OA 3KBGA 1ZUYA 4F7UE 4OVOA 4AFZC 1MV3A 1NEBA 2ZGWA 2XIDA 3OXGA 1HK9A 4L5GA 4L9MA 1M90C 4J9HA 2BE9B 2JMCA 2PQ8A 2RHYA 2RQTA 1UHCA 2PZ1A 3A8GB 4M7AD 2KBTA 3MEAA 4BI3A 3C0CA 3R5CA 4B9XA 3LLRA 1WJQA 4IUPA 5I11A 3AT1B 5GAN2 1VQKT 2QNCA 3EHQA 2JZMA 1VQLT 3M57A 2HBPA 5KYXB 4HCZA 4V2SA 3R6NA 1LPLA 2BZXA 2L3RA 4OMNA 4AT1B 2COZA 1UGRB 5L23A 1G83A 2KYMA 1WTJA 1Y96A 1D3BB 1TU0B 2K3BA 1PM3A 1X6GA 1SHGA 2XDPA 3OBWA 5C6SA 3IQLA 4JJBA 2FPEA 1FWZA 4OMMA 4E47A 2OTLA 4PJJA 1X75C 2SGQI 4RKUE 1LR9A 3CD6T 3VDPA 2YHTA 4GBQA 1Q81C 1Q86U 1FYNA 4JLGA 1OI1A 2DIPA 4FYYB 1BBZA 1PD1A 4M75F 2N1UA 2BKDN 5CVIA 2KGTA 4M78B 3X25B 3CXCS 1VQ6A 3HL8A 2SGFI 3KY9A 3MJXA 1Q9BA 3CCUQ 1JO8A 5GAMj 1QVGA 2COWA 1CE3A 4J7IA 3M54A 1VQOA 1D1CA 4BI8B 4B6DA 3EG2A 2PQWA 4LDVA 5IAYA 2QDYB 5L8RE 1PSFA 1M90U 4C92D 4Z88A 1QCOA 1G8XA 2QQBA 1AT1B 2LTOA 2P0KA 2L8DA 1DS3I 2D1XA 3META 3UFFA 1WA7A 3I5SA 2HSPA 2YWWA 2CSQA 2ORVA 1KHCA 1RAGB 1VQMA 2E12A 4OP0A 3GNGA 2E6ZA 5GMKl 4QQDA 1IZ6A 1LNXA 1X4SA 2AIRB 1MMNA 4C0DC 3FEOA 1RL2A 3VJPA 1GBRA 1AEYA 4CRIA 2LJ0A 3ZL7C 3PIPA 1YHQA 3L42A 5GANf 2VKNA 4IUVA 2E6NA 1LCKA 4BD3A 3JB9I 2MIOA 5KYWB 2OAWA 2CWHA 1YIJA 1SF9A 2ATCB 1K73C 1AD5A 5LJ3j 3CCMA 2JN0A 4KULA 2W10A 4FIBA 2A20A 4J5YA 5GAN3 2ED1A 3DB4A 1N9SA 1Q81U 5DLQE 3JCMf 5LJ5h 2QASA 2VC8A 3TO7A 1HD3A 2F5KA 4F7UB 2DKGA 4PFZA 1NEGA 3X28B 1E7DA 2X4WA 4Y92A 5I21A 1TGSI 4KUDK 4J9EA 2EQMA 3TU4K 4ZTFA 3CCEA 2KSSA 2WSFE 1N8RR 3JCMQ 2OU2A 2XI9A 1YJWT 3A8MB 3CMET 1UECA 1B34A 2WACA 1M1KC 2DA9A 4BUGA 4M78D 4QW2A 5E3PA 1VUBA 3S6WA 3VYHB 1W1FA 2NLUA 2NWMA 1WZOA 1ZQ1A 2LJ3A 3LYIA 5DAEA 3FDRA 4F14A 2DMOA 1NG2A 1Y71A 1R79A 2OTLQ 3PVQA 3EFOA 3CCMT 2AKLA 1KQSS 1WDXA 4M7DD 4DBRA 1LJOA 3TEEA 4J9CA 1H0ZA 3CMAT 1PRMC 3TSZA 2VGMA 3OYNA 1PZWA 2FB7A 3RU0A 1VQ6Q 1UTIA 3UDCA 1TUSA 1T3LA 8AT1B 3EGUA 1KHIA 2X52A 1GCPA 1K73U 1RAAB 2RD1A 2NUTB 2RA2A 1VQOQ 4KH1B 2SGEI 5FWCA 3OSSC 2QEXT 2EKHA 1TH7A 2GFUA 3H8ZA 5I2MA 3CCSQ 4XAXB 3VUBA 1O75A 2COYA 3GBQA 3BE3A 1G3YA 4RTYA 3PNWC 1Y8FA 4E2FB 1D1AA 1WYXA 3M56A 1VQMQ 1M9SA 4VUBA 4XU2A 1E6HA 2K9HA 5GAMh 3NGPA 1HJDA 2ECZA 5CAIA 3QIIA 4XK8E 2EKOA 4OB3B 2YUUA 3BJIA 1YHQQ 1M1KU 3VV0A 3EG9A 1NBEB 1AHJB 2RI2A 4PJMA 1Q86R 4M75C 2CP6A 4ZN3A 3UF4A 1YIJQ 4EMHA 2RM4A 2CSIA 3S3MA 4PJNA 1TG0A 2L3PA 3A8OB 2GBQA 2EYZA 3QWPA 2RH2A 2EIFA 2LJ1A 2O9SA 2LQKA 1MT1A 2X4JA 1BIBA 2UVOA 3NPFA 4SGBI 4A4KA 2DB6A 5GMKe 3CCQA 3G71A 5HCKA 1M90R 3PTAA 2KR3A 5CCMA 2X51A 2OTJT 2EQKA 3FJPA 1VQNT 4LDUA 2DLPA 2KT8A 2QA4A 2DXTA 1M1FA 1EZZB 4OGEA 3PVLA 4N0AA 5FU7B 3JCMP 3CCEQ 2KDPA 4OB2B 2L3QA 3G4SA 2MI6A 1KK7A 5E3RA 3CBOA 1W2BS 2F2XA 4LUDA 2B8TA 3UEJA 1Q82R 1VQ8T 1JJ2P 1IRXA 4HVWA 1P9GA 2CT4A 3HP9A 5ECAA 4DBFA 2QQCA 2DAQA 2YDLA 1WLPB 2CGHA 1IHVA 1U5KA 2GQIA 4QVZA 4DBHA 2D8JA 2ZPFB 2VRWB 2P4TA 4QQ6A 2DE0X 2CREA 1XA6A 2DBKA 4HCBA 2JA1A 2JS2A 5CKEA 1Q81R 4C8QA 5E3QA 1IY5A 5GJWB 3M4GA 3CCQT 2W0ZA 2LX7A 2XMFA 3G71T 3I9QA 4M75G 3MP1A 2DILA 2DXUA 2KROA 1MMGA 2HD0A 1RAHB 2KK4A 1PJUA 3VU3C 1M1GA 2KQWA 2RK1A 1IO6A 1QVPA 4CC3A 2QXFA 3GLXA 5LJ3e 1VQ5T 1YP5A 4M77E 3MEVA 2V26A 4Z02A 1WGTA 4M7AA 1TUDA 1PC0A 2E3HA 3NMZC 2FO0A 1W4RA 2LQWA 1VQ9A 2ZPIB 1AWXA 1UJYA 4PJOE 1WHMA 5LL6S 2D8HA 3RKXA 1AN1I 2I0NA 3JCMe 4OMFB 2XU8A 5GAOq 3SEKC 3JCMb 5D6XA 2AZSA 4UC4A 2VXFA 1S72T 4FSXA 1SGDI 1IB8A 2FG0A 4LD6A 2LEOA 1VQ7A 4DOVA 3CPWA 1M8CA 1KC8C 2X3TA 1RLPC 3KXTA 2C0IA 7WGAA 4D6WA 4RCBA 5KYYB 4M7DF 3HRTA 3M58A 1SRMA 4MDXA 2DL8A 1K73R 2GQVA 2DJZA 3UGDA 1CHOI 3OMGA 4DNCA 1PD0A 2DERA 4M7AC 1Y57A 1AZGB 2JXDA 4BY6C 4XTUA 5HK3A 5IN1A 3VS2A 3V7RA 2M16A 4EMGA 2A08A 2LVMA 3P8DA 1ZHIA 2RO0A 2QA4Q 4IUTA 5EX0A 4Z89A 1YJ9A 3G4SQ 3CEYA 4RMOA 2IIMA 1G3SA 3QZ9B 1K7UA 3CBMA 2QQRA 1NYFA 4C92A 2W0TA 4A53A 2FHDA 3QTLD 1M1KR 1FARA 1JEGA 1FMWA 3SHWA 4ZGEB 2DRKA 1RUWA 2DTIA 2JMAA 1WKXA 4HVVA 2JM9A 2EFIA 1PKSA 4OB1B 1W3SA 3QUIA 2QGFB 2VV5A 4E7LA 4ZGJB 2LCLA 1LOJA 2XDBA 4FM4B 3QYHB 2EGEA 1NXUA 1YI2Q 1XOVA 4GY5A 2LX9A 4N4GA 2CH4A 3VS0A 1GRIA 4BB7A 1NPPA 3OS5A 1KC8U 1M3BA 1KIKA 5HK0A 1M8BA 5KYXA 1MJBA 2ENNA 3EH2A 4QVCA 1GBQA 3PIOA 2J05A 1X01A 2QTXA 3OYKA 1U1TA 4EMKC 4C92C 3LX7A 1MNEA 2KDSA 2M02A 3OYMA 1AZEA 3V8JA 1TBOA 2GGRA 4J9BA 1OZ2A 1D3BA 2KMPA 1IY6A 4M7AG 5KYUB 4RTVA 3VS7A 2MAMA 3R5BA 1VQ9Q 1Z9ZA 2YT6A 3L2ZA 4A54A 3JCMJ 3VS3A 2LZ6B 4M77B 3TOAA 3I56A 1IGUA 3RR6A 4M4ZA 4C0FA 3M5AA 1FY7A 3H0HA 7AT1B 2E10A 3I55A 2X4XA 4M78A 1VQPA 2ED0A 4PJOB 1KD1R 1RAEB 1VQ7Q 2RC4A 3OYLA 2EJFA 2E70A 4FW2A 2JZ2A 5FUYA 1DJ7B 2EGAA 1SGQI 2P6AC 3VRZA 2O9VA 2DNUA 5D7UA 4C8QD 2JW6A 2HNIA 3ULRB 1BI0A 5GANg 4EDUA 3CXLA 1XJWB 1NYGA 1MUZA 3OW2A 5C0MA 2K2VA 1FMVA 2EQJA 2M5XA 2VUBA 2SGDI 3CCUT 3OA6A 2WVJA 2HMAA 4RTZA 3ZEHA 1XX6A 2V8JA 4C0ZA 3OYDA 5FUVA 3JCMW 3M0RA 3SWNB 3OB9A 4JUVA 1OMUA 1M27C 3MP8A 1VA7A 4E7IA 3JCMg 1YJ9Q 1Z2IA 1WHLA 2MF2A 4E7KA 4Q5WA 2R57A 4UXJA 4M78C 2N1AB 3PMIA 2JTEA 4JLIA 4C92G 5KYWA 2JVVA 4GLMA 4PFOA 4J83A 2J87A 4EIKA 3V8LA 4ZGDB 1SGYI 1Q82C 1AWWA 1CT4I 3RIRA 2V1RA 2RJEA 2ESWA 2H3EB 3UT1A 2JTFA 2XK0A 2NYSA 1ZBJA 4M7DC 2FVUA 2F5TX 1KBEA 3O5ZA 1JJ2A 1YU6C 3CCLQ 4BDYA 3OXFA 2RHUA 4F7UA 1U06A 2D6FA 2ZPGB 3CCRA 3LWHA 1UVGA 1OX9A 4M77D 2JW4A 1NPRA 1LR7A 5FU6B 1DS2I 3JAME 2RQUA 4J6YA 1KG1A 1M5Q1 4NOYA 3BDLA 1RAIB 2EQUA 2OI3A 4PJOD 2CJSC 3CC2A 2MCNA 1TS9A 3GF5A 2KNBB 3L2VA 2KEAA 4RTXA 2E64A 3CCSA 1N5ZA 2KYBA 1U8RA 2KMQA 2EGCA 3WXMB 3I56Q 5D6WA 5HI7A 2AT1B 2JNGA 4HVUA 2X3XD 3EG0A 2ROTA 1ZSZB 2EAYA 4XU1A 1EN7A 2DIGA 3I55Q 1VQPQ 4M78G 1OV3A 3CPWP 3HTRA 2J7IA 4AFUC 2MK5A 2OVOA 2V53A 1WXUA 1BI1A 3OS0A 5J8CA 3DKMA 2EVRA 5DY9A 2OTLT 1SGPI 2NU2I 1Q82U 2NUTA 1ABOA 1K1ZA 2DZCA 4OVAA 3JRZA 4E7SA 1KC8R 2SGPI 1K9AA 2KE9A 3HFOA 4ESRA 3E9FA 3QDFA 1CGJI 4Y28E 2FZCB 2PNIA 5LJ3f 1QVGS 1VQ6T 3EG1A 4M7DG 1NLOC 2DBMA 3QWYA 3X24B 1C0MA 1YJNQ 2A36A 2GCXA 4N4HA 2G3RA 2BZYA 1ARKA 2P84A 3A1PA 1VQOT 2DD4A 2KAFA 4AFQC 2PVGB 3R6OA 5CR2A 2ODDA 3R5DA 1WJRA 2QYZA 3CCST 1MJAA 1H92A 3CCVA 5CKBA 5M9OA 1VOMA 3L2QA 1YITQ 2DTOA 2RJFA 4KBMB 2PUKB 3GOXA 1SHFA 1YN8A 1NJIR 2MMPA 1VQMT 1PG5B 3QHSA 1QKXA 3QJ6A 2KY9A 3P8HA 3QAHA 2C0OA 2DEQA 5IH2A 1W4SA 2QI2A 1OZ3A 2LQ8A 1TWBA 2WSCE 1CGII 2GTOA 2O2OA 1YHQT 2FZKB 3FSYA 3HRUA 4M75E 4C0DB 3AHUA 1K7TA 1PPFI 2D0NA 4F7UG 1YIJT 3H0IA 3QDRB 3L2RA 1OPLA 1C6VX 3CCRQ 4A4EA 2E5RA 2A7YA 4C8QF 2HQXA 4CC7A 4ZTJA 2L5QA 4E1PA 1EFNA 2PU9B 5GAN8 1Z7KB 4IIMA 4YTLA 3HFNA 2KMTA 1RFHA 1CT0I 1ULMA 4BI4A 2RPNA 2KXDA 1NUBA 3A8HB 3TSWA 5LJ5e 4DA4A 4HT8A 4CC4B 2CUDA 3INZA 3CC2Q 1BK2A 3OSVA 4MZMA 4FSSA 2FNFX 1MV0B 2E65A 2EYYA 2QAZA 1QCFA 4LNPA 3VYGA 1BU1A 2OX7A 3CCET 3C4SA 3M4YA 4M7AF 2QPOA 4QVDA 1D0XA 3VDUA 3M55A 2QGGA 3FJ5A 5DLOA 3OS1A 2NUZA 3M0QA 4DBQA 5GMKi 1K0SA 1BMOA 1R0RI 5D6YA 1YFNA 3QYGB 4B6MA 1QWEA 1QWFA 5CKDA 1NE8A 1PRLC 2HSEB 2QK0A 1ZUUA 2GFAA 3QXEB 3OYGA 2AHJB 1HJAI 5FU7C 5IHIA 2XHCA 2K9GA 1QVFP 1UGQB 1KD1C 1I5LA 4ELZC 3N5BB 2LC4A 1CKAA 1V29B 4MMLA 2LB7A 3MHXA 1UJ0A 5HKCA 4RG8A 3OW2P 1SGEI 2GTJA 2PVOB 5FROA 3QPHA 2BUDA 3TCJA 2VB6A 1H3ZA 2VASA 4GLKA 3M0UA 1WFWA 2DKVA 2M1HA 3CC7Q 2CYZB 4C5GA 2J6KA 3D7SB 1YWOA 4OGCA 3FIFA 2PTKA 2K57A 2DIQA 1GFCA 1T0JA 3Q1JA 1D0ZA 1H641 2YRCA 4PK4A 2Y0MA 1KBFA 4DOWA 2OZUA 2L3SA 3CCVQ 3J80E 1BUSA 1VQ4A 1UEBA 3THKA 2EYQA 2FRYA 4PLIA 4X9CA 1WHJA 1IGQA 5FWBA 3EFRA 4C92F 3VS5A 2E1HA 1FX7A 3CC4A 5CQXA 5KYYA 2A37A 1Y07A 2ZPBB 5GAMe 1I4K1 2LP5A 1J3TA 1M30A 2CKKA 1FMKA 4MMKA 5GANh 4HCKA 3UOEA 1FAQA 4X1VA 4JJDA 3MP6A 1K9MC 2DX1A 2HL5C 2YRVA 3CBPA 1PTRA 3QJYA 4E7HA 4AMCA 1RACB 2K3YA 2M51A 3M0SA 4KT0E 2YLBA 4M75B 1JXOA 2CZ6B 2F69A 5EG2A 1YI2A 1KD1U 2DD5A 2B8AA 1X27A 1OX8A 3MEWA 2DRMA 2LT4A 1UE9A 3OQ5A 3JCMh 3JB9D 2JXBA 2RQWA 4N0AC 1CSOI 2K2MA 2KRMA 2DF6A 2FPFA 2RI3A 3ZFJA 1S20A 4WP4A 2BZ8A 4LE9A 4DEYA 3FB9A 4KH0B 1LR8A 2QA4T 1WX6A 3H9NA 4XTZA 2N52A 2JJ9A 2E4HA 3G4ST 5CK9A 2YUQA 1K0XA 1MHNA 2IVWA 2KRNA 1B07A 1UHAA 1V1IA 1PHTA 1U3OA 3RMSA 4IUQA 2QQDA 2Y4YA 2ZAEA 3JCMc 5J26A 2N71A 2D9TA 1QKWA 3OYEA 1R8OB 2YRDA 4M78F 4O6JA 4JJCA 1G3TA 3SFMA 4C8QC 3EGDB 1KJWA 1PWTA 1WNLA 2FRWA 4AG2C 3G1JA 4L6V5 2DETA 1U1SA 3EH1A 3G6EA 5DM7R 1GCQA 2M9UA 1TTHB 1YI2T 1JXMA 1K8AR 2DL4A 4A4HA 1TOVA 1MGQA 4JDSA 3CCJA 1K9MU 2SRCA 5KYUA 3PDNA 4IIOA 2ROWA 2GKVA 2V8KA 4A24A 1VYVA 3X26B 3OMCA 3V7SA 2DYIA 4M77A 2DL7A 2F1LA 1A0NB 1SSFA 3PFSA 1B7TA 2CZ0B 1VQ4Q 2QQSA 3VS4A 2DO3A 3M9QA 4PJOA 1FXXA 1N27A 1SEMA 4J9DA 1KQSP 3E59A 4RTWA 1VQ9T 1BYMA 2J06A 2E41A 4R56A 3E2IA 3ER0A 1XNIA 3CC4Q 2BUSA 2O01E 1TUGB 3H0FA 1NJIC 4LXCA 4ME7A 2BE7D 2L2PA 5AYFA 2EYXA 2HZYA 3CPWS 1TUCA 3B4VC 3J7AF 2AKKA 2CH4W 3RUXA 1VQ7T 2YUPA 1Y1BA 2E3IA 1OPKA 2J6OA 3EFSA 4FT4A 1G2BA 3TJQA 2LDMA 2VGNA 4F7UF 1OQKA 4M77C 4XQ3A 3RMQA 3CCLA 4NL2A 3SWNA 1HPTA 3MO8A 3RBBB 5FW9A 3DLLA 3JV3A 2YLCA 2FYKA 2EPDA 4PJOC 4C8QG 1MJ9A 2CT3A 4RCCA 4JS5A 1EX4A 5GAOm 5CKHA 3HRSA 3G7ZA 1M8VA 3EGXB 2X4YA 4OMQA 3RESA 2NUPB 1UFFA 2DVEA 3E19A 4J8OA 1SSHA 1AWOA 1M2VB 1ULNA 4E7JA 2O31A 2HEQA 2PUOB 5GANd 1YJ9T 5I22A 5GAOn 2J6FA 2JUFA 5FLXE 5KCOA 4A4GA 3SEMA 3VE5A 1X6BA 4A63B 3FC3A 2RF0A 4FW1A 1UGVA 3U23A 2I2LA
chains in the Genus database with same CATH topology
4A4FA 2CZ7B 2LRQA 1PTQA 2NU0I 1FYBA 3SWNC 3V7CA 4M7DE 4XTWA 3L2WA 3F70A 5EX3A 1PCEA 3JCMd 1NJIU 3CCLT 2KMOA 5LJ5f 5FUXA 3FLGA 2R5AA 4PLLA 2K4YA 2LUYA 2XD0A 4UXIA 1QVFA 4C5EA 1VQKA 3JCMX 1VQLA 1PSEA 2O4XB 3OYAA 3RKYA 2E5QA 3JB9F 1YBYA 3HH2C 4M77G 5LJ3g 5A0LA 1SGNI 3RERA 1YJNA 3JCMV 4FT2A 2QNFA 2PVDB 2LCCA 3GP8A 4BE0A 4EMKB 4PJOG 2RB6A 5FU6C 4J7FA 1YITA 3CD6A 3I56T 1KMAA 4X34A 5I2SA 1WPYA 3I55T 4HA8A 1VQPT 5CKFA 5GAOr 2JYYA 1QVFS 2B0UC 3CXCA 1N9RA 1Y1CA 3NTKA 4J6XA 3OW2S 2KMRA 2V1CA 2Y90A 1TBNA 1P92A 2DXBA 2RJCA 1YJNT 5CQYA 3VKIA 4DQ2A 3JB9J 3J81E 1YCYA 1X74A 5JHWC 5GMKj 3X20B 5GAMf 2K5LA 2JTMA 3LH0A 5GAOp 2LNVA 3NTIA 1YITT 1I8FA 3BW1A 2GVIA 2FL7A 2R58A 3A8LB 3LGFA 3OBYA 4MZPA 4BE1A 1N13A 2L7XA 2XKOC 3SB2A 2V1CC 4NS5A 2ELIA 1JJ2S 1CT2I 2ZZDA 2NU1I 5GMKm 1KQ1A 3DLMA 4XTYA 2GKRI 3HPWA 3CPFA 2R5MA 1OYVI 1OMTA 4M7DB 2P0QA 2H3JA 4ATOA 3CCRT 3OYCA 2X35A 1BI2A 1K8AC 2HQEA 2EJ9A 4HKEA 1YJWA 5CCLA 3WVEB 4C5HA 4XU3A 3CMEA 4OF1A 3QG1A 3CC7A 3SD4A 2JOYA 3CC2T 2K5IA 3OYJA 3S3NA 5GANj 4FL6A 5GAN7 2BIVA 4FKDA 4IURA 4ELYC 2DXCA 2OAUA 1I81A 4XTXA 2MWOA 3GNFB 3CMAA 4PNOA 1KQSA 2QQ9A 1Y96B 3DB3A 3P8BB 3M59A 3T9NA 2OD1A 4GI3C 3KUFA 4JRKA 2CS7A 1JB0E 3L2UA 2QEXA 5A2QE 4HT9A 1QP2A 2ZPHB 1BKBA 3CC7T 3OXLA 2J9RA 3UWNA 3D00A 2VYTA 1K8AU 2VXEA 2Y4XA 3UEYA 2XRCA 3CCVT 3OL0A 3M53A 1O9SA 5GAN6 3OS2A 3PT9A 1VIEA 2A3LA 2UZ3A 1QW1A 3LW5E 2XG8D 4RG2A 5J39A 2K3XA 2DTHA 4JRQA 4M75A 4KUIA 2NU4I 1XBTA 4BE2A 3OYBA 2P0PA 5GMKh 4CI0C 4JJNK 3SGQI 4C5IA 4UXHA 2OTJA 3GPLA 1VQNA 1G5VA 2ZCFB 4Y91A 3QSUA 4II1A 4M77F 1WJSA 2DPPB 3EAEA 1W2BA 1VQ8A 5IT9E 4LDXA 3JB9G 5HY6A 5J3BA 5GAN4 3QZ5B 3E9GA 4X9DA 4PJOF 5KH6A 1YTPA 1B34B 4XTVA 1UGPB 2C06A 3ASKA 2YQPA 1QP3A 3HHTB 3HKSA 1RI0A 2N17A 4JS4A 3PMTA 3H6ZA 1HDLA 2V8IA 4J6WA 5A0GA 4LDYA 4C8QE 1HXDA 4WF2A 2GF7A 1XQHA 1TBQR 3NFCA 3QBYA 1OYXA 3C12A 1Q7YC 3MEUA 1NZ9A 5KE2A 5LJ3h 3TREA 1VQ5A 1TBRR 3UPUA 2KVQG 4M7AE 4OB0B 1UUCA 3URGA 1V1HA 3MCAB 3QKJA 2EJGA 3L1AA 1VQ4T 2DZ9A 5LJ5d 2CZ1B 1S72A 3VUZA 3A5ZB 3RKWA 4B9WA 3ZBDA 1Y7XA 3CC4T 3OYYA 4R55A 1E7LA 3NTHA 3PGGA 2NU3I 4BACA 5FUWA 1TIHA 1G3WA 5GANe 4BDZA 2DK3A 1IREB 3MEKA 2RK2A 5KCHA 3GIBA 3E1SA 5LJ5g 3C94A 4PL6A 2M0OA 1Q7YU 3SDZA 2E73A 1JRIA 3OYIA 4L59A 1TOTA 4HCCA 4C92E 5HQ8A 2RI5A 2HAXA 3BDUA 4FU6A 1BIAA 2QQEA 1TURA 1UVFA 4E1RA 5CO7A 4XU0A 1XTDA 1M4ZA 2MWPA 3V8KA 1WGSA 1SGRI 4M75D 5CIUA 1VIFA 3LGLA 3OYHA 1ZBXA 4MDWA 3OYFA 2O4XA 5GAMd 2KCXA 2RHZA 4QQGA 3G6ET 4C0GA 5GAN5 4EPCA 4C8QB 4LDWA 3CCJT 1N8RC 5FRMA 4EMKA 4JCVE 5FRNA 2IG0A 2RJDA 4O5VA 2QQ0A 3BY7A 2RHIA 1WQ7A 1EIFA 2ARPF 1X6OA 4NL3A 4M7AB 2WSEE 4BY6B 4HGUA 2L8EA 5A0DA 4M78E 5GAMg 1OVOA 2ERWA 2XDDA 5GAOl 5LJ3d 4ZN1A 5KE3A 2LT1A 1WQWA 3SGBI 3OY9A 3CCUA 2GKTI 4JRIA 1GXIE 1BI3A 1KQ2A 4IKFA 2WCYA 1VDDA 2QQAA 4TVRA 3QO3A 1IW4A 1N6AA 3C95A 2ORWA 3JB9H 3UGIA 3HSBA 2ZPEB 1UGSB 3UGLA 3BFMA 1N8RU 3OVOA 2EWNA 2RHXA 3FRNA 5CCAA 5LJ5j 4JRPA 4LD9K 3WVDB 1Q86C 2XICA 3LWIA 4PKCC 3ME9A 4P5NA 1UB4A 2D0QB 4N4IA 2ENZA 4C92B 1JBMA 4IUUA 2K5FA 4M7DA 3JSCA 2L89A 3O8VA 2F3CI 4MZTA 3S3OA 3KBGA 4F7UE 4OVOA 2ZGWA 2XIDA 3OXGA 1HK9A 4L5GA 4L9MA 1M90C 2RHYA 4M7AD 3A8GB 3MEAA 4BI3A 4B9XA 3LLRA 1WJQA 4IUPA 5GAN2 1VQKT 2QNCA 2JZMA 1VQLT 3M57A 2HBPA 4HCZA 4V2SA 2L3RA 1UGRB 1Y96A 1D3BB 3OBWA 2XDPA 5C6SA 1FWZA 4E47A 2OTLA 2SGQI 1X75C 4RKUE 1LR9A 3CD6T 3VDPA 2YHTA 1Q81C 1Q86U 4JLGA 1OI1A 2DIPA 4M75F 3CXCS 2BKDN 4M78B 5CVIA 3X25B 1VQ6A 3HL8A 2SGFI 3KY9A 5GAMj 1QVGA 1CE3A 4J7IA 3M54A 1VQOA 4BI8B 4B6DA 2PQWA 4LDVA 5IAYA 2QDYB 5L8RE 1PSFA 1M90U 4C92D 2QQBA 2LTOA 2P0KA 2L8DA 1DS3I 3META 3UFFA 2ORVA 1KHCA 1VQMA 2E12A 4OP0A 3GNGA 2E6ZA 5GMKl 4QQDA 1IZ6A 1LNXA 1X4SA 4C0DC 3FEOA 1RL2A 3VJPA 4CRIA 3PIPA 1YHQA 3L42A 5GANf 4IUVA 2E6NA 4BD3A 3JB9I 1YIJA 1K73C 5LJ3j 3CCMA 2JN0A 4KULA 4FIBA 2A20A 4J5YA 5GAN3 3DB4A 1N9SA 1Q81U 5DLQE 3JCMf 5LJ5h 2VC8A 2F5KA 4F7UB 2DKGA 3X28B 1E7DA 2X4WA 5I21A 1TGSI 4KUDK 2EQMA 3TU4K 4ZTFA 3CCEA 2KSSA 2WSFE 3JCMQ 2XI9A 1YJWT 3A8MB 3CMET 1B34A 2WACA 1M1KC 4BUGA 4M78D 4QW2A 1VUBA 3S6WA 3VYHB 2NLUA 1ZQ1A 3LYIA 5DAEA 3FDRA 1Y71A 1R79A 3CCMT 1KQSS 4M7DD 1LJOA 3TEEA 1H0ZA 3CMAT 2VGMA 3OYNA 2FB7A 3RU0A 3UDCA 1TUSA 1KHIA 1K73U 2RD1A 2RA2A 2SGEI 3OSSC 2QEXT 1TH7A 2GFUA 3H8ZA 5I2MA 4XAXB 3VUBA 1O75A 1G3YA 3PNWC 1Y8FA 3M56A 1M9SA 4VUBA 4XU2A 2K9HA 5GAMh 5CAIA 3QIIA 4XK8E 2EKOA 4OB3B 2YUUA 3BJIA 1M1KU 3VV0A 1AHJB 2RI2A 4M75C 4ZN3A 4EMHA 2RM4A 3S3MA 3A8OB 3QWPA 2RH2A 2EIFA 1MT1A 2LQKA 2X4JA 1BIBA 4SGBI 4A4KA 2DB6A 5GMKe 3CCQA 3G71A 3PTAA 5CCMA 2OTJT 2EQKA 3FJPA 1VQNT 4LDUA 2QA4A 2DXTA 1M1FA 4OGEA 3JCMP 4N0AA 5FU7B 4OB2B 3G4SA 2MI6A 3CBOA 1W2BS 2B8TA 3UEJA 1VQ8T 3HP9A 2QQCA 2DAQA 2CGHA 1U5KA 4QVZA 2ZPFB 2VRWB 2P4TA 4QQ6A 1XA6A 4HCBA 2JA1A 5CKEA 4C8QA 1IY5A 3CCQT 3M4GA 3G71T 4M75G 3MP1A 2DXUA 2HD0A 2KK4A 1PJUA 3VU3C 1M1GA 2KQWA 2RK1A 1QVPA 2QXFA 3GLXA 5LJ3e 1VQ5T 4M77E 3MEVA 4Z02A 4M7AA 1W4RA 1VQ9A 2ZPIB 4PJOE 5LL6S 3RKXA 1AN1I 3JCMe 4OMFB 2XU8A 5GAOq 3SEKC 3JCMb 5D6XA 4UC4A 2VXFA 1S72T 4FSXA 1SGDI 4LD6A 2LEOA 1VQ7A 4DOVA 3CPWA 1M8CA 1KC8C 3KXTA 4D6WA 4RCBA 4M7DF 3HRTA 3M58A 4MDXA 2GQVA 2DJZA 3UGDA 1CHOI 3OMGA 4M7AC 2JXDA 4BY6C 4XTUA 5HK3A 5IN1A 3V7RA 2M16A 4EMGA 2LVMA 3P8DA 2RO0A 1ZHIA 4IUTA 5EX0A 1YJ9A 3CEYA 4RMOA 1G3SA 3QZ9B 3CBMA 2QQRA 4C92A 2W0TA 4A53A 2FHDA 3QTLD 1FARA 4ZGEB 2DTIA 2EFIA 4OB1B 1W3SA 3QUIA 4E7LA 2VV5A 4ZGJB 2LCLA 1LOJA 2XDBA 4FM4B 3QYHB 1XOVA 4GY5A 2LX9A 4N4GA 4BB7A 1NPPA 3OS5A 1KC8U 5HK0A 1M8BA 2ENNA 4QVCA 3PIOA 1X01A 2QTXA 3OYKA 1U1TA 4EMKC 4C92C 3LX7A 2KDSA 3OYMA 3V8JA 1TBOA 1OZ2A 1D3BA 2KMPA 1IY6A 4M7AG 2MAMA 3L2ZA 4A54A 3JCMJ 4M77B 3I56A 4C0FA 3M5AA 2E10A 3I55A 2X4XA 4M78A 1VQPA 4PJOB 3OYLA 2EJFA 2E70A 2JZ2A 5FUYA 1DJ7B 1SGQI 2P6AC 2JW6A 4C8QD 2HNIA 1BI0A 5GANg 4EDUA 3CXLA 3OW2A 5C0MA 2K2VA 2EQJA 2M5XA 2VUBA 2SGDI 3CCUT 3OA6A 2WVJA 3ZEHA 1XX6A 2V8JA 4C0ZA 3OYDA 5FUVA 3JCMW 3SWNB 3OB9A 4JUVA 1OMUA 3MP8A 4E7IA 3JCMg 2MF2A 4E7KA 2R57A 4Q5WA 4UXJA 4M78C 2N1AB 3PMIA 4JLIA 4C92G 2JVVA 4J83A 2J87A 3V8LA 4ZGDB 1SGYI 1Q82C 1CT4I 3RIRA 2RJEA 3UT1A 2JTFA 2XK0A 4M7DC 2FVUA 2F5TX 1KBEA 1JJ2A 1YU6C 4BDYA 3OXFA 2RHUA 4F7UA 2D6FA 2ZPGB 3CCRA 3LWHA 1UVGA 4M77D 1NPRA 1LR7A 5FU6B 1DS2I 3JAME 4J6YA 1KG1A 1M5Q1 4NOYA 3BDLA 2EQUA 4PJOD 2CJSC 3CC2A 3GF5A 3L2VA 2E64A 3CCSA 1U8RA 2KMQA 3WXMB 5D6WA 5HI7A 2JNGA 2EAYA 4XU1A 1EN7A 2DIGA 4M78G 2OVOA 2V53A 1BI1A 3OS0A 3DKMA 5DY9A 2OTLT 1SGPI 2NU2I 1Q82U 2DZCA 4OVAA 2SGPI 3JRZA 3HFOA 3E9FA 1CGJI 4Y28E 5LJ3f 1QVGS 1VQ6T 4M7DG 3X24B 2GCXA 4N4HA 2G3RA 1VQOT 2DD4A 2KAFA 2PVGB 3R6OA 5CR2A 2ODDA 1WJRA 3CCST 3CCVA 5CKBA 5M9OA 3L2QA 2DTOA 2RJFA 4KBMB 2PUKB 3GOXA 2MMPA 1VQMT 3QHSA 3QJ6A 2KY9A 3P8HA 2DEQA 1W4SA 2QI2A 1OZ3A 2LQ8A 2WSCE 1CGII 1YHQT 3HRUA 4M75E 4C0DB 3AHUA 1PPFI 4F7UG 1YIJT 3QDRB 3L2RA 4A4EA 2E5RA 2A7YA 4C8QF 2HQXA 4ZTJA 2L5QA 4E1PA 2PU9B 5GAN8 1Z7KB 4YTLA 3HFNA 2KMTA 1RFHA 1CT0I 4BI4A 1NUBA 3A8HB 5LJ5e 4DA4A 4HT8A 3INZA 3OSVA 4MZMA 2FNFX 2E65A 3VYGA 2QPOA 3CCET 4M7AF 3C4SA 3M4YA 4QVDA 3VDUA 3M55A 5DLOA 3OS1A 5GMKi 1BMOA 1R0RI 5D6YA 3QYGB 5CKDA 1NE8A 2GFAA 3QXEB 3OYGA 2AHJB 1HJAI 5FU7C 2XHCA 1UGQB 1KD1C 1I5LA 4ELZC 3N5BB 2LC4A 1V29B 4MMLA 3MHXA 5HKCA 4RG8A 1SGEI 2PVOB 5FROA 3QPHA 2BUDA 3TCJA 1H3ZA 4GLKA 2M1HA 2CYZB 4C5GA 4OGCA 3FIFA 2K57A 2DIQA 3Q1JA 1H641 1KBFA 4DOWA 3J80E 1BUSA 1VQ4A 1UEBA 2EYQA 4X9CA 4PLIA 3EFRA 4C92F 2E1HA 1FX7A 3CC4A 5CQXA 1Y07A 2ZPBB 5GAMe 1I4K1 2CKKA 4MMKA 5GANh 1FAQA 3MP6A 1K9MC 2YRVA 3CBPA 1PTRA 3QJYA 4E7HA 2K3YA 4KT0E 2YLBA 4M75B 2CZ6B 2F69A 5EG2A 1YI2A 1KD1U 2DD5A 2B8AA 3MEWA 2LT4A 3OQ5A 3JB9D 3JCMh 4N0AC 1CSOI 2RI3A 3ZFJA 3FB9A 1LR8A 2QA4T 4XTZA 2N52A 3G4ST 5CK9A 1MHNA 2IVWA 1V1IA 3RMSA 4IUQA 2QQDA 2Y4YA 3JCMc 5J26A 2N71A 2D9TA 3OYEA 1R8OB 4M78F 4O6JA 1G3TA 3SFMA 4C8QC 1WNLA 4L6V5 1U1SA 3G6EA 5DM7R 2M9UA 1YI2T 4A4HA 1MGQA 4JDSA 3CCJA 1K9MU 3PDNA 2ROWA 2GKVA 2V8KA 4A24A 3X26B 3OMCA 3V7SA 4M77A 1SSFA 3PFSA 2CZ0B 2QQSA 2DO3A 3M9QA 4PJOA 1FXXA 1N27A 3E59A 1VQ9T 1BYMA 2E41A 4R56A 3E2IA 3ER0A 1XNIA 2BUSA 2O01E 1NJIC 4ME7A 5AYFA 3CPWS 3B4VC 3J7AF 3RUXA 1VQ7T 1Y1BA 3EFSA 4FT4A 3TJQA 2LDMA 2VGNA 4F7UF 4M77C 4XQ3A 3RMQA 3CCLA 4NL2A 3SWNA 1HPTA 3MO8A 3DLLA 2YLCA 2FYKA 4PJOC 4C8QG 4RCCA 4JS5A 5GAOm 5CKHA 3HRSA 3G7ZA 1M8VA 2X4YA 3RESA 2DVEA 3E19A 4J8OA 4E7JA 2PUOB 5GANd 1YJ9T 5GAOn 2JUFA 5FLXE 5KCOA 4A4GA 3VE5A 3FC3A 2I2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BDZ A;  3CEY A;  3MEA A;  4A4F A;  2LRQ A;  3OMC A;  2QQR A;  4IUV A;  4B9X A;  2E6N A;  3LLR A;  1WJQ A;  4EDU A;  4BD3 A;  4IUP A;  3E9G A;  3PNW C;  5D6W A;  3L2W A;  3F70 A;  5C0M A;  3KUF A;  2EQJ A;  2FHD A;  1SSF A;  5KH6 A;  2QNC A;  3OA6 A;  1EN7 A;  2CKK A;  2DIG A;  3PFS A;  3L2U A;  3LH0 A;  4HCZ A;  5KCH A;  3NTI A;  2QQS A;  3FLG A;  3ZEH A;  2L3R A;  2R5A A;  3MP6 A;  3ASK A;  2YRV A;  3M9Q A;  4PLL A;  3OYD A;  3MP1 A;  4PL6 A;  5KE3 A;  4E7H A;  1N27 A;  2R58 A;  3OS0 A;  2EFI A;  2M0O A;  3DB4 A;  1RI0 A;  3LGF A;  3C4S A;  3PMT A;  3OB9 A;  3QII A;  2K3Y A;  4C5E A;  3H6Z A;  2EKO A;  3MP8 A;  4OVA A;  3OY9 A;  3OYI A;  4BE1 A;  4E7I A;  1XNI A;  4E7L A;  2F5K A;  4L59 A;  3UWN A;  2VYT A;  3OS1 A;  4E7K A;  2R57 A;  4Q5W A;  2RI2 A;  4NS5 A;  3PMI A;  2O4X B;  3E9F A;  3MEV A;  5D6Y A;  3OYA A;  1E7D A;  2B8A A;  2RI5 A;  2X4W A;  4Z02 A;  2XDP A;  2E5Q A;  4GY5 A;  3MEW A;  5C6S A;  4FU6 A;  4N4G A;  4IKF A;  3OQ5 A;  2EQM A;  3S3M A;  3DLM A;  4ZTF A;  2GF7 A;  2QNF A;  2R5M A;  1OYX A;  3QBY A;  2LCC A;  4N4H A;  2GFA A;  2RI3 A;  3MEU A;  2G3R A;  3OYG A;  4BE0 A;  5KE2 A;  2RJE A;  3OS2 A;  3UT1 A;  2MWP A;  1OI1 A;  2JTF A;  2WAC A;  2XK0 A;  4QW2 A;  3OYC A;  3OYK A;  1WGS A;  2BKD N;  2X35 A;  2LDM A;  3S6W A;  1WJR A;  2NLU A;  3LX7 A;  2HQE A;  5CIU A;  5D6X A;  3MO8 A;  1MHN A;  3LYI A;  4RG2 A;  3OYM A;  4BDY A;  5M9O A;  5J39 A;  4UC4 A;  2K3X A;  4X34 A;  3L2Q A;  2RHX A;  3FDR A;  3LGL A;  4IUQ A;  2EQK A;  1OZ2 A;  4LD6 A;  2RHU A;  2RJF A;  4C5H A;  5FRO A;  3OYH A;  3QKJ A;  3OYF A;  2O4X A;  3GOX A;  2BUD A;  4BE2 A;  1H3Z A;  2RHZ A;  5J26 A;  3OYB A;  2D9T A;  3SD4 A;  3ME9 A;  4QQG A;  2M1H A;  2PQW A;  3QJ6 A;  3P8H A;  4C5G A;  3H8Z A;  5IAY A;  4C5I A;  3OYE A;  4N4I A;  3OYJ A;  2X4Y A;  3S3N A;  2DIQ A;  2LTO A;  3OMG A;  2P0K A;  4IUU A;  3Q1J A;  2L8D A;  3NTK A;  3OYN A;  1OZ3 A;  5FRM A;  4FL6 A;  5FRN A;  3MET A;  4B9W A;  1G5V A;  2IG0 A;  2RJD A;  2L89 A;  2BIV A;  3O8V A;  4E7J A;  3BDL A;  2EQU A;  5IN1 A;  2X4X A;  1KHC A;  4IUR A;  3S3O A;  1E7L A;  2M16 A;  2DAQ A;  3NTH A;  4PLI A;  4QQD A;  4II1 A;  2RHI A;  2LVM A;  2MWO A;  3OYL A;  3L2V A;  4BAC A;  4QVZ A;  4A4H A;  5KCO A;  4A4G A;  3P8D A;  2RO0 A;  3FEO A;  2JZ2 A;  3DB3 A;  3L2R A;  3FC3 A;  2RJC A;  4IUT A;  4QQ6 A;  4A4E A;  1WJS A;  4CRI A;  3EAE A;  2GFU A;  3L42 A;  2RHY A;  2HQX A;  4ZTJ A; 
#chains in the Genus database with same CATH topology
 4WCI A;  3A98 A;  4A4F A;  2CZ7 B;  2LRQ A;  1PTQ A;  2NU0 I;  1FYB A;  3SWN C;  1RAB B;  1AWJ A;  3V7C A;  4M7D E;  2AZV A;  4XTW A;  3L2W A;  3F70 A;  5EX3 A;  5IXF A;  1PCE A;  3JCM d;  1NJI U;  1TSF A;  3CCL T;  3EG3 A;  2KMO A;  5LJ5 f;  1WI7 A;  2RIJ A;  5FUX A;  3FLG A;  3G6E Q;  2R5A A;  4PLL A;  2K4Y A;  1ACM B;  2LUY A;  2XD0 A;  3CCJ Q;  4UXI A;  1QVF A;  4C5E A;  4ZNX A;  1VQK A;  1M3C A;  2DVJ A;  3JCM X;  1VQL A;  1V1C A;  1PSE A;  2O4X B;  2EYW A;  3OYA A;  3RKY A;  2E5Q A;  3JB9 F;  1YBY A;  3HH2 C;  1YCS B;  5GJV B;  4M77 G;  3EHR A;  5LJ3 g;  4QT7 A;  5A0L A;  1SGN I;  3RER A;  1C1A A;  1YJN A;  3JCM V;  4FT2 A;  2QNF A;  4JZ4 A;  4J9F A;  1BCM A;  4J9I A;  1ZSZ A;  2A28 A;  2PVD B;  2LCC A;  4FYX B;  3GP8 A;  4BE0 A;  4AML A;  4EMK B;  4PJO G;  1P9Z A;  2RB6 A;  1NLP C;  5FU6 C;  2CWG A;  2YUO A;  2BTT A;  4J7F A;  1YIT A;  3CD6 A;  3I56 T;  1KMA A;  4X34 A;  5I2S A;  1R77 A;  2HL3 A;  3VRY A;  1WPY A;  4AG1 C;  3I55 T;  4HA8 A;  1VQP T;  5CKF A;  5IHN A;  5GAO r;  2JYY A;  1QVF S;  1E7O A;  1WHG A;  3NHN A;  3CXC A;  2B0U C;  1WXB A;  1N9R A;  1E6G A;  1Y1C A;  1OUL A;  3NTK A;  1ZA2 B;  1K9M R;  1Q7Y R;  4J6X A;  2SEM A;  3VS1 A;  1I1J A;  1PKT A;  3OW2 S;  2KMR A;  2AK5 A;  2V1C A;  4D8K A;  1U5S A;  1ZSZ C;  2Y90 A;  2CWF A;  3TO6 A;  1TBN A;  1P92 A;  2A0F B;  4KRT A;  2DXB A;  2RJC A;  1V76 A;  1YJN T;  5CQY A;  2E5K A;  3VKI A;  4DQ2 A;  1OU9 A;  3JB9 J;  1GFD A;  4OML A;  1K76 A;  3J81 E;  1X43 A;  2YSQ A;  2V1Q A;  1YCY A;  1QMC A;  1X74 A;  5JHW C;  5GMK j;  3X20 B;  5GAM f;  2K5L A;  2JTM A;  3LH0 A;  5GAO p;  2LNV A;  3NTI A;  1YIT T;  1I8F A;  3BW1 A;  2GVI A;  3FSX A;  2FL7 A;  2R58 A;  4Z8A A;  3A8L B;  3LGF A;  1R0B G;  1GL5 A;  4CC2 A;  3OBY A;  4MZP A;  4BE1 A;  1N13 A;  2L7X A;  2XKO C;  3SB2 A;  2V1C C;  4NS5 A;  2ELI A;  2G6F X;  1JJ2 S;  1CT2 I;  1HSQ A;  2ZZD A;  4RTT A;  2NU1 I;  1UDL A;  5GMK m;  1KQ1 A;  3DLM A;  4XTY A;  2GKR I;  3HPW A;  2GNC A;  3CPF A;  2R5M A;  1OYV I;  1OMT A;  4M7D B;  3CQT A;  2P0Q A;  1IXD A;  2H3J A;  4ATO A;  3CCR T;  3OYC A;  2X35 A;  1BI2 A;  1K8A C;  2HQE A;  1VQK Q;  1VQL Q;  2QTV A;  4D8D A;  2EJ9 A;  4HKE A;  1KFZ A;  1YJW A;  5CCL A;  4JPB W;  3WVE B;  4C5H A;  4XU3 A;  5KYN A;  3CME A;  4OF1 A;  4LUE A;  1D1B A;  3QG1 A;  3CC7 A;  3SD4 A;  1B3Q A;  2JOY A;  3CC2 T;  2K5I A;  2CP0 A;  3OYJ A;  3S3N A;  1D0Y A;  2ROL A;  1H8K A;  5GAN j;  4F04 B;  4FL6 A;  5GAN 7;  2BIV A;  4FKD A;  1YWP A;  2QDL A;  3M0P A;  4IUR A;  4ELY C;  3CD6 Q;  2DXC A;  2OAU A;  1I81 A;  4XTX A;  6AT1 B;  2MWO A;  3GNF B;  3CMA A;  4PNO A;  2OJ2 A;  1KQS A;  1Q95 G;  4RTU A;  2QQ9 A;  1Y96 B;  3DB3 A;  2HKQ B;  4FYV B;  3TQ7 P;  1M3A A;  3P8B B;  2VVK A;  3M59 A;  3T9N A;  2OD1 A;  3UAT A;  2LMJ A;  4GI3 C;  4OMO A;  2HQH A;  3KUF A;  1SRL A;  4JRK A;  3KFV A;  2CS7 A;  1JB0 E;  3L2U A;  2QEX A;  2K6D A;  2DJQ A;  5A2Q E;  1LVK A;  1RAD B;  4HT9 A;  1QP2 A;  2ZPH B;  1BKB A;  3CC7 T;  3OXL A;  2MOX A;  1ABQ A;  2J9R A;  3UWN A;  3D00 A;  2VYT A;  1ZA1 B;  1SKU B;  3QWX X;  5AT1 B;  1K8A U;  1IHW A;  2VXE A;  2Y4X A;  3RDV A;  1BCO A;  3LH5 A;  3UEY A;  2XRC A;  3CCV T;  3OL0 A;  4JZ3 A;  3M53 A;  2RN8 A;  1MND A;  2X3W D;  1O9S A;  1I0C A;  2HBW A;  5GAN 6;  3OS2 A;  2JS0 A;  3PT9 A;  1VIE A;  2A3L A;  4RUG A;  2UZ3 A;  2X9H A;  1QW1 A;  3LW5 E;  2XG8 D;  4RG2 A;  1T3S A;  5J39 A;  4MPI A;  2K3X A;  2DTH A;  4JRQ A;  4M75 A;  4KUI A;  2NU4 I;  1XBT A;  4BE2 A;  3OYB A;  2P0P A;  5GMK h;  4CI0 C;  4JJN K;  3SGQ I;  4C5I A;  4UXH A;  2OTJ A;  3GPL A;  1VQN A;  1G5V A;  1M2O A;  2ZCF B;  1RI9 A;  1I07 A;  4Y91 A;  3QSU A;  2DL3 A;  1NM7 A;  4II1 A;  1YJW Q;  3CME Q;  2CP2 A;  1HEV A;  1JU5 C;  2RMO A;  2CP7 A;  4M77 F;  1WJS A;  2DPP B;  3EAE A;  1W2B A;  1VQ8 A;  5IT9 E;  4LDX A;  3JB9 G;  2RNA A;  5HY6 A;  1T0H A;  5J3B A;  5GAN 4;  2B86 A;  3QZ5 B;  3E9G A;  4X9D A;  1M8M A;  4PJO F;  5KH6 A;  2HCK A;  3TOB A;  1CSK A;  1YTP A;  4ANJ A;  4F16 A;  3CCM Q;  1B34 B;  1X2Q A;  1UGP B;  3EGD A;  4XTV A;  2C06 A;  3ASK A;  2YQP A;  1QP3 A;  4PFP A;  3CMA Q;  3HHT B;  3HKS A;  1RI0 A;  1ZX6 A;  2CP3 A;  2L0A A;  3PMT A;  4JS4 A;  2N17 A;  2KI7 A;  3H6Z A;  1HDL A;  3CXC P;  2EBP A;  2V8I A;  2CDT A;  1OU8 A;  4J6W A;  2FZG B;  5A0G A;  4LDY A;  4C8Q E;  1HXD A;  1RLQ C;  4WF2 A;  3EFO B;  2WGC A;  9WGA A;  8ATC B;  2GF7 A;  1XQH A;  1TBQ R;  2QEX Q;  1BB9 A;  3NFC A;  3QBY A;  1OYX A;  3C12 A;  4R0K A;  1Q7Y C;  3MEU A;  1NZ9 A;  5KE2 A;  5LJ3 h;  3TRE A;  1VQ5 A;  2FEI A;  1KSW A;  1TBR R;  1F1B B;  1JQQ A;  3UPU A;  2KVQ G;  1WHH A;  3E2U A;  2KXC A;  5EC7 A;  4QKU A;  2DEU A;  1VYT A;  4M7A E;  4OB0 B;  2HDA A;  1UUC A;  3URG A;  1V1H A;  3REA B;  3MCA B;  3QKJ A;  2EJG A;  2K7A A;  3L1A A;  2M0Y A;  1VQ4 T;  1OEB A;  2C0T A;  4J9G A;  2DZ9 A;  9ATC B;  2DL5 A;  5LJ5 d;  1WHK A;  2HKN A;  2CZ1 B;  1QLY A;  1S72 A;  1K4U S;  1PCX A;  3VUZ A;  2FPD A;  3A5Z B;  2LQN A;  3RKW A;  1CKB A;  4B9W A;  3H41 A;  3ZBD A;  2MPX C;  1Y7X A;  4FCY A;  3CC4 T;  3OYY A;  1QVG P;  4R55 A;  1E7L A;  3NTH A;  1WXT A;  1VYU A;  2F2V A;  3PGG A;  2NU3 I;  3PE0 A;  4WTO B;  4BAC A;  4KGZ B;  5FUW A;  1TIH A;  1G3W A;  5GAN e;  3EG9 B;  1UG1 A;  2IPO B;  3MKD A;  2JM8 A;  2KT1 A;  1ZSG A;  4BDZ A;  2MYS A;  2VWF A;  1UUE A;  2OTJ Q;  1OOT A;  2JT4 A;  1I5O B;  3EGX A;  3I35 A;  2DK3 A;  4DEX A;  5J8F A;  1IRE B;  2NUP A;  1VQN Q;  2LCS A;  3MEK A;  2RK2 A;  5KCH A;  3GIB A;  1M2V A;  3E1S A;  1SPK A;  4PJL A;  3C94 A;  4E6R A;  5LJ5 g;  4PL6 A;  4FYW B;  1AOJ A;  2M0O A;  1Q7Y U;  2YXY A;  3SDZ A;  2E73 A;  1S1N A;  1JRI A;  2K79 A;  3OYI A;  1VQ8 Q;  4L59 A;  1TOT A;  4HCC A;  2CUB A;  4C92 E;  1WIE A;  1WGC A;  5HQ8 A;  2RI5 A;  2HAX A;  3BDU A;  4FU6 A;  1BIA A;  2QQE A;  1TUR A;  1UVF A;  4E1R A;  5CO7 A;  4XU0 A;  2DM1 A;  1XTD A;  1X69 A;  3REB B;  1AVZ C;  1SG5 A;  1M4Z A;  2MWP A;  3RNJ A;  1QCN A;  3V8K A;  1R0C B;  1WGS A;  4HXJ A;  2ENM A;  1SGR I;  4M75 D;  1ZUK A;  1ULK A;  1MMA A;  5CIU A;  3CCQ Q;  3G71 Q;  1K7V A;  1VIF A;  3LGL A;  1GCQ C;  3OYH A;  1ZBX A;  1RAF B;  4MDW A;  3OYF A;  2O4X A;  5GAM d;  2KCX A;  3VS6 A;  2RHZ A;  4OMP A;  4QQG A;  2LNH B;  3G6E T;  4C0G A;  4KGX B;  5GAN 5;  2DFU A;  4EPC A;  1VQ5 Q;  4C8Q B;  4LDW A;  3CCJ T;  1N8R C;  5FRM A;  4EMK A;  4JCV E;  5FRN A;  1Z9Q A;  2IG0 A;  2RJD A;  4O5V A;  1D09 B;  2QQ0 A;  3BY7 A;  2RHI A;  1WQ7 A;  2P4R A;  1EIF A;  2ARP F;  2F2W A;  1X6O A;  4NL3 A;  2DYB A;  3TO9 A;  4M7A B;  2WSE E;  3UA7 A;  4BY6 B;  1S72 Q;  4HGU A;  2L8E A;  3MPU B;  5A0D A;  1H3H A;  4M78 E;  1MMD A;  5GAM g;  1OVO A;  2ERW A;  2XDD A;  4AFS C;  5GAO l;  1PNJ A;  4ORZ A;  5LJ3 d;  4ZN1 A;  2RQR A;  5KE3 A;  3M0T A;  2LT1 A;  2CP5 A;  1WQW A;  3SGB I;  3OY9 A;  3CCU A;  1X2K A;  4K11 A;  2EW3 A;  1QQJ A;  2GKT I;  4LN2 A;  5IXB A;  2O88 A;  2GIV A;  4JRI A;  1GXI E;  1BI3 A;  2KRS A;  1KQ2 A;  4IKF A;  2WCY A;  1UHF A;  2QQA A;  1VDD A;  4TVR A;  3QO3 A;  1IW4 A;  1N6A A;  5IHK A;  3C95 A;  1W6X A;  2ORW A;  2EQI A;  3JB9 H;  3UGI A;  3HSB A;  2ZPE B;  1W2B P;  2ABL A;  3UA6 A;  1UGS B;  1Y0M A;  3UGL A;  3BFM A;  1N8R U;  4F17 A;  3TVT A;  3OVO A;  1ZLM A;  2EWN A;  1TXQ A;  2RHX A;  3I5R A;  3FRN A;  4E7Z A;  2YUN A;  5CCA A;  5LJ5 j;  4JRP A;  2H8H A;  2QG9 B;  4LD9 K;  3WVD B;  4KGV B;  1Q86 C;  2XIC A;  4PKC C;  3ME9 A;  3LWI A;  4P5N A;  1UB4 A;  2D0Q B;  4N4I A;  2ENZ A;  4C92 B;  1W70 A;  1JBM A;  4IUU A;  2Z0W A;  1HYO A;  2K5F A;  2RQV A;  4M7D A;  3JSC A;  3R5A A;  2L89 A;  3O8V A;  1YNZ A;  4MZT A;  2F3C I;  3S3O A;  3KBG A;  1ZUY A;  4F7U E;  4OVO A;  4AFZ C;  1MV3 A;  1NEB A;  2ZGW A;  2XID A;  3OXG A;  1HK9 A;  4L5G A;  4L9M A;  1M90 C;  4J9H A;  2BE9 B;  2JMC A;  2PQ8 A;  2RHY A;  2RQT A;  1UHC A;  2PZ1 A;  3A8G B;  4M7A D;  2KBT A;  3MEA A;  4BI3 A;  3C0C A;  3R5C A;  4B9X A;  3LLR A;  1WJQ A;  4IUP A;  5I11 A;  3AT1 B;  5GAN 2;  1VQK T;  2QNC A;  3EHQ A;  2JZM A;  1VQL T;  3M57 A;  2HBP A;  5KYX B;  4HCZ A;  4V2S A;  3R6N A;  1LPL A;  2BZX A;  2L3R A;  4OMN A;  4AT1 B;  2COZ A;  1UGR B;  5L23 A;  1G83 A;  2KYM A;  1WTJ A;  1Y96 A;  1D3B B;  1TU0 B;  2K3B A;  1PM3 A;  1X6G A;  1SHG A;  2XDP A;  3OBW A;  5C6S A;  3IQL A;  4JJB A;  2FPE A;  1FWZ A;  4OMM A;  4E47 A;  2OTL A;  4PJJ A;  1X75 C;  2SGQ I;  4RKU E;  1LR9 A;  3CD6 T;  3VDP A;  2YHT A;  4GBQ A;  1Q81 C;  1Q86 U;  1FYN A;  4JLG A;  1OI1 A;  2DIP A;  4FYY B;  1BBZ A;  1PD1 A;  4M75 F;  2N1U A;  2BKD N;  5CVI A;  2KGT A;  4M78 B;  3X25 B;  3CXC S;  1VQ6 A;  3HL8 A;  2SGF I;  3KY9 A;  3MJX A;  1Q9B A;  3CCU Q;  1JO8 A;  5GAM j;  1QVG A;  2COW A;  1CE3 A;  4J7I A;  3M54 A;  1VQO A;  1D1C A;  4BI8 B;  4B6D A;  3EG2 A;  2PQW A;  4LDV A;  5IAY A;  2QDY B;  5L8R E;  1PSF A;  1M90 U;  4C92 D;  4Z88 A;  1QCO A;  1G8X A;  2QQB A;  1AT1 B;  2LTO A;  2P0K A;  2L8D A;  1DS3 I;  2D1X A;  3MET A;  3UFF A;  1WA7 A;  3I5S A;  2HSP A;  2YWW A;  2CSQ A;  2ORV A;  1KHC A;  1RAG B;  1VQM A;  2E12 A;  4OP0 A;  3GNG A;  2E6Z A;  5GMK l;  4QQD A;  1IZ6 A;  1LNX A;  1X4S A;  2AIR B;  1MMN A;  4C0D C;  3FEO A;  1RL2 A;  3VJP A;  1GBR A;  1AEY A;  4CRI A;  2LJ0 A;  3ZL7 C;  3PIP A;  1YHQ A;  3L42 A;  5GAN f;  2VKN A;  4IUV A;  2E6N A;  1LCK A;  4BD3 A;  3JB9 I;  2MIO A;  5KYW B;  2OAW A;  2CWH A;  1YIJ A;  1SF9 A;  2ATC B;  1K73 C;  1AD5 A;  5LJ3 j;  3CCM A;  2JN0 A;  4KUL A;  2W10 A;  4FIB A;  2A20 A;  4J5Y A;  5GAN 3;  2ED1 A;  3DB4 A;  1N9S A;  1Q81 U;  5DLQ E;  3JCM f;  5LJ5 h;  2QAS A;  2VC8 A;  3TO7 A;  1HD3 A;  2F5K A;  4F7U B;  2DKG A;  4PFZ A;  1NEG A;  3X28 B;  1E7D A;  2X4W A;  4Y92 A;  5I21 A;  1TGS I;  4KUD K;  4J9E A;  2EQM A;  3TU4 K;  4ZTF A;  3CCE A;  2KSS A;  2WSF E;  1N8R R;  3JCM Q;  2OU2 A;  2XI9 A;  1YJW T;  3A8M B;  3CME T;  1UEC A;  1B34 A;  2WAC A;  1M1K C;  2DA9 A;  4BUG A;  4M78 D;  4QW2 A;  5E3P A;  1VUB A;  3S6W A;  3VYH B;  1W1F A;  2NLU A;  2NWM A;  1WZO A;  1ZQ1 A;  2LJ3 A;  3LYI A;  5DAE A;  3FDR A;  4F14 A;  2DMO A;  1NG2 A;  1Y71 A;  1R79 A;  2OTL Q;  3PVQ A;  3EFO A;  3CCM T;  2AKL A;  1KQS S;  1WDX A;  4M7D D;  4DBR A;  1LJO A;  3TEE A;  4J9C A;  1H0Z A;  3CMA T;  1PRM C;  3TSZ A;  2VGM A;  3OYN A;  1PZW A;  2FB7 A;  3RU0 A;  1VQ6 Q;  1UTI A;  3UDC A;  1TUS A;  1T3L A;  8AT1 B;  3EGU A;  1KHI A;  2X52 A;  1GCP A;  1K73 U;  1RAA B;  2RD1 A;  2NUT B;  2RA2 A;  1VQO Q;  4KH1 B;  2SGE I;  5FWC A;  3OSS C;  2QEX T;  2EKH A;  1TH7 A;  2GFU A;  3H8Z A;  5I2M A;  3CCS Q;  4XAX B;  3VUB A;  1O75 A;  2COY A;  3GBQ A;  3BE3 A;  1G3Y A;  4RTY A;  3PNW C;  1Y8F A;  4E2F B;  1D1A A;  1WYX A;  3M56 A;  1VQM Q;  1M9S A;  4VUB A;  4XU2 A;  1E6H A;  2K9H A;  5GAM h;  3NGP A;  1HJD A;  2ECZ A;  5CAI A;  3QII A;  4XK8 E;  2EKO A;  4OB3 B;  2YUU A;  3BJI A;  1YHQ Q;  1M1K U;  3VV0 A;  3EG9 A;  1NBE B;  1AHJ B;  2RI2 A;  4PJM A;  1Q86 R;  4M75 C;  2CP6 A;  4ZN3 A;  3UF4 A;  1YIJ Q;  4EMH A;  2RM4 A;  2CSI A;  3S3M A;  4PJN A;  1TG0 A;  2L3P A;  3A8O B;  2GBQ A;  2EYZ A;  3QWP A;  2RH2 A;  2EIF A;  2LJ1 A;  2O9S A;  2LQK A;  1MT1 A;  2X4J A;  1BIB A;  2UVO A;  3NPF A;  4SGB I;  4A4K A;  2DB6 A;  5GMK e;  3CCQ A;  3G71 A;  5HCK A;  1M90 R;  3PTA A;  2KR3 A;  5CCM A;  2X51 A;  2OTJ T;  2EQK A;  3FJP A;  1VQN T;  4LDU A;  2DLP A;  2KT8 A;  2QA4 A;  2DXT A;  1M1F A;  1EZZ B;  4OGE A;  3PVL A;  4N0A A;  5FU7 B;  3JCM P;  3CCE Q;  2KDP A;  4OB2 B;  2L3Q A;  3G4S A;  2MI6 A;  1KK7 A;  5E3R A;  3CBO A;  1W2B S;  2F2X A;  4LUD A;  2B8T A;  3UEJ A;  1Q82 R;  1VQ8 T;  1JJ2 P;  1IRX A;  4HVW A;  1P9G A;  2CT4 A;  3HP9 A;  5ECA A;  4DBF A;  2QQC A;  2DAQ A;  2YDL A;  1WLP B;  2CGH A;  1IHV A;  1U5K A;  2GQI A;  4QVZ A;  4DBH A;  2D8J A;  2ZPF B;  2VRW B;  2P4T A;  4QQ6 A;  2DE0 X;  2CRE A;  1XA6 A;  2DBK A;  4HCB A;  2JA1 A;  2JS2 A;  5CKE A;  1Q81 R;  4C8Q A;  5E3Q A;  1IY5 A;  5GJW B;  3M4G A;  3CCQ T;  2W0Z A;  2LX7 A;  2XMF A;  3G71 T;  3I9Q A;  4M75 G;  3MP1 A;  2DIL A;  2DXU A;  2KRO A;  1MMG A;  2HD0 A;  1RAH B;  2KK4 A;  1PJU A;  3VU3 C;  1M1G A;  2KQW A;  2RK1 A;  1IO6 A;  1QVP A;  4CC3 A;  2QXF A;  3GLX A;  5LJ3 e;  1VQ5 T;  1YP5 A;  4M77 E;  3MEV A;  2V26 A;  4Z02 A;  1WGT A;  4M7A A;  1TUD A;  1PC0 A;  2E3H A;  3NMZ C;  2FO0 A;  1W4R A;  2LQW A;  1VQ9 A;  2ZPI B;  1AWX A;  1UJY A;  4PJO E;  1WHM A;  5LL6 S;  2D8H A;  3RKX A;  1AN1 I;  2I0N A;  3JCM e;  4OMF B;  2XU8 A;  5GAO q;  3SEK C;  3JCM b;  5D6X A;  2AZS A;  4UC4 A;  2VXF A;  1S72 T;  4FSX A;  1SGD I;  1IB8 A;  2FG0 A;  4LD6 A;  2LEO A;  1VQ7 A;  4DOV A;  3CPW A;  1M8C A;  1KC8 C;  2X3T A;  1RLP C;  3KXT A;  2C0I A;  7WGA A;  4D6W A;  4RCB A;  5KYY B;  4M7D F;  3HRT A;  3M58 A;  1SRM A;  4MDX A;  2DL8 A;  1K73 R;  2GQV A;  2DJZ A;  3UGD A;  1CHO I;  3OMG A;  4DNC A;  1PD0 A;  2DER A;  4M7A C;  1Y57 A;  1AZG B;  2JXD A;  4BY6 C;  4XTU A;  5HK3 A;  5IN1 A;  3VS2 A;  3V7R A;  2M16 A;  4EMG A;  2A08 A;  2LVM A;  3P8D A;  1ZHI A;  2RO0 A;  2QA4 Q;  4IUT A;  5EX0 A;  4Z89 A;  1YJ9 A;  3G4S Q;  3CEY A;  4RMO A;  2IIM A;  1G3S A;  3QZ9 B;  1K7U A;  3CBM A;  2QQR A;  1NYF A;  4C92 A;  2W0T A;  4A53 A;  2FHD A;  3QTL D;  1M1K R;  1FAR A;  1JEG A;  1FMW A;  3SHW A;  4ZGE B;  2DRK A;  1RUW A;  2DTI A;  2JMA A;  1WKX A;  4HVV A;  2JM9 A;  2EFI A;  1PKS A;  4OB1 B;  1W3S A;  3QUI A;  2QGF B;  2VV5 A;  4E7L A;  4ZGJ B;  2LCL A;  1LOJ A;  2XDB A;  4FM4 B;  3QYH B;  2EGE A;  1NXU A;  1YI2 Q;  1XOV A;  4GY5 A;  2LX9 A;  4N4G A;  2CH4 A;  3VS0 A;  1GRI A;  4BB7 A;  1NPP A;  3OS5 A;  1KC8 U;  1M3B A;  1KIK A;  5HK0 A;  1M8B A;  5KYX A;  1MJB A;  2ENN A;  3EH2 A;  4QVC A;  1GBQ A;  3PIO A;  2J05 A;  1X01 A;  2QTX A;  3OYK A;  1U1T A;  4EMK C;  4C92 C;  3LX7 A;  1MNE A;  2KDS A;  2M02 A;  3OYM A;  1AZE A;  3V8J A;  1TBO A;  2GGR A;  4J9B A;  1OZ2 A;  1D3B A;  2KMP A;  1IY6 A;  4M7A G;  5KYU B;  4RTV A;  3VS7 A;  2MAM A;  3R5B A;  1VQ9 Q;  1Z9Z A;  2YT6 A;  3L2Z A;  4A54 A;  3JCM J;  3VS3 A;  2LZ6 B;  4M77 B;  3TOA A;  3I56 A;  1IGU A;  3RR6 A;  4M4Z A;  4C0F A;  3M5A A;  1FY7 A;  3H0H A;  7AT1 B;  2E10 A;  3I55 A;  2X4X A;  4M78 A;  1VQP A;  2ED0 A;  4PJO B;  1KD1 R;  1RAE B;  1VQ7 Q;  2RC4 A;  3OYL A;  2EJF A;  2E70 A;  4FW2 A;  2JZ2 A;  5FUY A;  1DJ7 B;  2EGA A;  1SGQ I;  2P6A C;  3VRZ A;  2O9V A;  2DNU A;  5D7U A;  4C8Q D;  2JW6 A;  2HNI A;  3ULR B;  1BI0 A;  5GAN g;  4EDU A;  3CXL A;  1XJW B;  1NYG A;  1MUZ A;  3OW2 A;  5C0M A;  2K2V A;  1FMV A;  2EQJ A;  2M5X A;  2VUB A;  2SGD I;  3CCU T;  3OA6 A;  2WVJ A;  2HMA A;  4RTZ A;  3ZEH A;  1XX6 A;  2V8J A;  4C0Z A;  3OYD A;  5FUV A;  3JCM W;  3M0R A;  3SWN B;  3OB9 A;  4JUV A;  1OMU A;  1M27 C;  3MP8 A;  1VA7 A;  4E7I A;  3JCM g;  1YJ9 Q;  1Z2I A;  1WHL A;  2MF2 A;  4E7K A;  4Q5W A;  2R57 A;  4UXJ A;  4M78 C;  2N1A B;  3PMI A;  2JTE A;  4JLI A;  4C92 G;  5KYW A;  2JVV A;  4GLM A;  4PFO A;  4J83 A;  2J87 A;  4EIK A;  3V8L A;  4ZGD B;  1SGY I;  1Q82 C;  1AWW A;  1CT4 I;  3RIR A;  2V1R A;  2RJE A;  2ESW A;  2H3E B;  3UT1 A;  2JTF A;  2XK0 A;  2NYS A;  1ZBJ A;  4M7D C;  2FVU A;  2F5T X;  1KBE A;  3O5Z A;  1JJ2 A;  1YU6 C;  3CCL Q;  4BDY A;  3OXF A;  2RHU A;  4F7U A;  1U06 A;  2D6F A;  2ZPG B;  3CCR A;  3LWH A;  1UVG A;  1OX9 A;  4M77 D;  2JW4 A;  1NPR A;  1LR7 A;  5FU6 B;  1DS2 I;  3JAM E;  2RQU A;  4J6Y A;  1KG1 A;  1M5Q 1;  4NOY A;  3BDL A;  1RAI B;  2EQU A;  2OI3 A;  4PJO D;  2CJS C;  3CC2 A;  2MCN A;  1TS9 A;  3GF5 A;  2KNB B;  3L2V A;  2KEA A;  4RTX A;  2E64 A;  3CCS A;  1N5Z A;  2KYB A;  1U8R A;  2KMQ A;  2EGC A;  3WXM B;  3I56 Q;  5D6W A;  5HI7 A;  2AT1 B;  2JNG A;  4HVU A;  2X3X D;  3EG0 A;  2ROT A;  1ZSZ B;  2EAY A;  4XU1 A;  1EN7 A;  2DIG A;  3I55 Q;  1VQP Q;  4M78 G;  1OV3 A;  3CPW P;  3HTR A;  2J7I A;  4AFU C;  2MK5 A;  2OVO A;  2V53 A;  1WXU A;  1BI1 A;  3OS0 A;  5J8C A;  3DKM A;  2EVR A;  5DY9 A;  2OTL T;  1SGP I;  2NU2 I;  1Q82 U;  2NUT A;  1ABO A;  1K1Z A;  2DZC A;  4OVA A;  3JRZ A;  4E7S A;  1KC8 R;  2SGP I;  1K9A A;  2KE9 A;  3HFO A;  4ESR A;  3E9F A;  3QDF A;  1CGJ I;  4Y28 E;  2FZC B;  2PNI A;  5LJ3 f;  1QVG S;  1VQ6 T;  3EG1 A;  4M7D G;  1NLO C;  2DBM A;  3QWY A;  3X24 B;  1C0M A;  1YJN Q;  2A36 A;  2GCX A;  4N4H A;  2G3R A;  2BZY A;  1ARK A;  2P84 A;  3A1P A;  1VQO T;  2DD4 A;  2KAF A;  4AFQ C;  2PVG B;  3R6O A;  5CR2 A;  2ODD A;  3R5D A;  1WJR A;  2QYZ A;  3CCS T;  1MJA A;  1H92 A;  3CCV A;  5CKB A;  5M9O A;  1VOM A;  3L2Q A;  1YIT Q;  2DTO A;  2RJF A;  4KBM B;  2PUK B;  3GOX A;  1SHF A;  1YN8 A;  1NJI R;  2MMP A;  1VQM T;  1PG5 B;  3QHS A;  1QKX A;  3QJ6 A;  2KY9 A;  3P8H A;  3QAH A;  2C0O A;  2DEQ A;  5IH2 A;  1W4S A;  2QI2 A;  1OZ3 A;  2LQ8 A;  1TWB A;  2WSC E;  1CGI I;  2GTO A;  2O2O A;  1YHQ T;  2FZK B;  3FSY A;  3HRU A;  4M75 E;  4C0D B;  3AHU A;  1K7T A;  1PPF I;  2D0N A;  4F7U G;  1YIJ T;  3H0I A;  3QDR B;  3L2R A;  1OPL A;  1C6V X;  3CCR Q;  4A4E A;  2E5R A;  2A7Y A;  4C8Q F;  2HQX A;  4CC7 A;  4ZTJ A;  2L5Q A;  4E1P A;  1EFN A;  2PU9 B;  5GAN 8;  1Z7K B;  4IIM A;  4YTL A;  3HFN A;  2KMT A;  1RFH A;  1CT0 I;  1ULM A;  4BI4 A;  2RPN A;  2KXD A;  1NUB A;  3A8H B;  3TSW A;  5LJ5 e;  4DA4 A;  4HT8 A;  4CC4 B;  2CUD A;  3INZ A;  3CC2 Q;  1BK2 A;  3OSV A;  4MZM A;  4FSS A;  2FNF X;  1MV0 B;  2E65 A;  2EYY A;  2QAZ A;  1QCF A;  4LNP A;  3VYG A;  1BU1 A;  2OX7 A;  3CCE T;  3C4S A;  3M4Y A;  4M7A F;  2QPO A;  4QVD A;  1D0X A;  3VDU A;  3M55 A;  2QGG A;  3FJ5 A;  5DLO A;  3OS1 A;  2NUZ A;  3M0Q A;  4DBQ A;  5GMK i;  1K0S A;  1BMO A;  1R0R I;  5D6Y A;  1YFN A;  3QYG B;  4B6M A;  1QWE A;  1QWF A;  5CKD A;  1NE8 A;  1PRL C;  2HSE B;  2QK0 A;  1ZUU A;  2GFA A;  3QXE B;  3OYG A;  2AHJ B;  1HJA I;  5FU7 C;  5IHI A;  2XHC A;  2K9G A;  1QVF P;  1UGQ B;  1KD1 C;  1I5L A;  4ELZ C;  3N5B B;  2LC4 A;  1CKA A;  1V29 B;  4MML A;  2LB7 A;  3MHX A;  1UJ0 A;  5HKC A;  4RG8 A;  3OW2 P;  1SGE I;  2GTJ A;  2PVO B;  5FRO A;  3QPH A;  2BUD A;  3TCJ A;  2VB6 A;  1H3Z A;  2VAS A;  4GLK A;  3M0U A;  1WFW A;  2DKV A;  2M1H A;  3CC7 Q;  2CYZ B;  4C5G A;  2J6K A;  3D7S B;  1YWO A;  4OGC A;  3FIF A;  2PTK A;  2K57 A;  2DIQ A;  1GFC A;  1T0J A;  3Q1J A;  1D0Z A;  1H64 1;  2YRC A;  4PK4 A;  2Y0M A;  1KBF A;  4DOW A;  2OZU A;  2L3S A;  3CCV Q;  3J80 E;  1BUS A;  1VQ4 A;  1UEB A;  3THK A;  2EYQ A;  2FRY A;  4PLI A;  4X9C A;  1WHJ A;  1IGQ A;  5FWB A;  3EFR A;  4C92 F;  3VS5 A;  2E1H A;  1FX7 A;  3CC4 A;  5CQX A;  5KYY A;  2A37 A;  1Y07 A;  2ZPB B;  5GAM e;  1I4K 1;  2LP5 A;  1J3T A;  1M30 A;  2CKK A;  1FMK A;  4MMK A;  5GAN h;  4HCK A;  3UOE A;  1FAQ A;  4X1V A;  4JJD A;  3MP6 A;  1K9M C;  2DX1 A;  2HL5 C;  2YRV A;  3CBP A;  1PTR A;  3QJY A;  4E7H A;  4AMC A;  1RAC B;  2K3Y A;  2M51 A;  3M0S A;  4KT0 E;  2YLB A;  4M75 B;  1JXO A;  2CZ6 B;  2F69 A;  5EG2 A;  1YI2 A;  1KD1 U;  2DD5 A;  2B8A A;  1X27 A;  1OX8 A;  3MEW A;  2DRM A;  2LT4 A;  1UE9 A;  3OQ5 A;  3JCM h;  3JB9 D;  2JXB A;  2RQW A;  4N0A C;  1CSO I;  2K2M A;  2KRM A;  2DF6 A;  2FPF A;  2RI3 A;  3ZFJ A;  1S20 A;  4WP4 A;  2BZ8 A;  4LE9 A;  4DEY A;  3FB9 A;  4KH0 B;  1LR8 A;  2QA4 T;  1WX6 A;  3H9N A;  4XTZ A;  2N52 A;  2JJ9 A;  2E4H A;  3G4S T;  5CK9 A;  2YUQ A;  1K0X A;  1MHN A;  2IVW A;  2KRN A;  1B07 A;  1UHA A;  1V1I A;  1PHT A;  1U3O A;  3RMS A;  4IUQ A;  2QQD A;  2Y4Y A;  2ZAE A;  3JCM c;  5J26 A;  2N71 A;  2D9T A;  1QKW A;  3OYE A;  1R8O B;  2YRD A;  4M78 F;  4O6J A;  4JJC A;  1G3T A;  3SFM A;  4C8Q C;  3EGD B;  1KJW A;  1PWT A;  1WNL A;  2FRW A;  4AG2 C;  3G1J A;  4L6V 5;  2DET A;  1U1S A;  3EH1 A;  3G6E A;  5DM7 R;  1GCQ A;  2M9U A;  1TTH B;  1YI2 T;  1JXM A;  1K8A R;  2DL4 A;  4A4H A;  1TOV A;  1MGQ A;  4JDS A;  3CCJ A;  1K9M U;  2SRC A;  5KYU A;  3PDN A;  4IIO A;  2ROW A;  2GKV A;  2V8K A;  4A24 A;  1VYV A;  3X26 B;  3OMC A;  3V7S A;  2DYI A;  4M77 A;  2DL7 A;  2F1L A;  1A0N B;  1SSF A;  3PFS A;  1B7T A;  2CZ0 B;  1VQ4 Q;  2QQS A;  3VS4 A;  2DO3 A;  3M9Q A;  4PJO A;  1FXX A;  1N27 A;  1SEM A;  4J9D A;  1KQS P;  3E59 A;  4RTW A;  1VQ9 T;  1BYM A;  2J06 A;  2E41 A;  4R56 A;  3E2I A;  3ER0 A;  1XNI A;  3CC4 Q;  2BUS A;  2O01 E;  1TUG B;  3H0F A;  1NJI C;  4LXC A;  4ME7 A;  2BE7 D;  2L2P A;  5AYF A;  2EYX A;  2HZY A;  3CPW S;  1TUC A;  3B4V C;  3J7A F;  2AKK A;  2CH4 W;  3RUX A;  1VQ7 T;  2YUP A;  1Y1B A;  2E3I A;  1OPK A;  2J6O A;  3EFS A;  4FT4 A;  1G2B A;  3TJQ A;  2LDM A;  2VGN A;  4F7U F;  1OQK A;  4M77 C;  4XQ3 A;  3RMQ A;  3CCL A;  4NL2 A;  3SWN A;  1HPT A;  3MO8 A;  3RBB B;  5FW9 A;  3DLL A;  3JV3 A;  2YLC A;  2FYK A;  2EPD A;  4PJO C;  4C8Q G;  1MJ9 A;  2CT3 A;  4RCC A;  4JS5 A;  1EX4 A;  5GAO m;  5CKH A;  3HRS A;  3G7Z A;  1M8V A;  3EGX B;  2X4Y A;  4OMQ A;  3RES A;  2NUP B;  1UFF A;  2DVE A;  3E19 A;  4J8O A;  1SSH A;  1AWO A;  1M2V B;  1ULN A;  4E7J A;  2O31 A;  2HEQ A;  2PUO B;  5GAN d;  1YJ9 T;  5I22 A;  5GAO n;  2J6F A;  2JUF A;  5FLX E;  5KCO A;  4A4G A;  3SEM A;  3VE5 A;  1X6B A;  4A63 B;  3FC3 A;  2RF0 A;  4FW1 A;  1UGV A;  3U23 A;  2I2L A; 
#chains in the Genus database with same CATH homology
 4A4F A;  2CZ7 B;  2LRQ A;  1PTQ A;  2NU0 I;  1FYB A;  3SWN C;  3V7C A;  4M7D E;  4XTW A;  3L2W A;  3F70 A;  5EX3 A;  1PCE A;  3JCM d;  1NJI U;  3CCL T;  2KMO A;  5LJ5 f;  5FUX A;  3FLG A;  2R5A A;  4PLL A;  2K4Y A;  2LUY A;  2XD0 A;  4UXI A;  1QVF A;  4C5E A;  1VQK A;  3JCM X;  1VQL A;  1PSE A;  2O4X B;  3OYA A;  3RKY A;  2E5Q A;  3JB9 F;  1YBY A;  3HH2 C;  4M77 G;  5LJ3 g;  5A0L A;  1SGN I;  3RER A;  1YJN A;  3JCM V;  4FT2 A;  2QNF A;  2PVD B;  2LCC A;  3GP8 A;  4BE0 A;  4EMK B;  4PJO G;  2RB6 A;  5FU6 C;  4J7F A;  1YIT A;  3CD6 A;  3I56 T;  1KMA A;  4X34 A;  5I2S A;  1WPY A;  3I55 T;  4HA8 A;  1VQP T;  5CKF A;  5GAO r;  2JYY A;  1QVF S;  2B0U C;  3CXC A;  1N9R A;  1Y1C A;  3NTK A;  4J6X A;  3OW2 S;  2KMR A;  2V1C A;  2Y90 A;  1TBN A;  1P92 A;  2DXB A;  2RJC A;  1YJN T;  5CQY A;  3VKI A;  4DQ2 A;  3JB9 J;  3J81 E;  1YCY A;  1X74 A;  5JHW C;  5GMK j;  3X20 B;  5GAM f;  2K5L A;  2JTM A;  3LH0 A;  5GAO p;  2LNV A;  3NTI A;  1YIT T;  1I8F A;  3BW1 A;  2GVI A;  2FL7 A;  2R58 A;  3A8L B;  3LGF A;  3OBY A;  4MZP A;  4BE1 A;  1N13 A;  2L7X A;  2XKO C;  3SB2 A;  2V1C C;  4NS5 A;  2ELI A;  1JJ2 S;  1CT2 I;  2ZZD A;  2NU1 I;  5GMK m;  1KQ1 A;  3DLM A;  4XTY A;  2GKR I;  3HPW A;  3CPF A;  2R5M A;  1OYV I;  1OMT A;  4M7D B;  2P0Q A;  2H3J A;  4ATO A;  3CCR T;  3OYC A;  2X35 A;  1BI2 A;  1K8A C;  2HQE A;  2EJ9 A;  4HKE A;  1YJW A;  5CCL A;  3WVE B;  4C5H A;  4XU3 A;  3CME A;  4OF1 A;  3QG1 A;  3CC7 A;  3SD4 A;  2JOY A;  3CC2 T;  2K5I A;  3OYJ A;  3S3N A;  5GAN j;  4FL6 A;  5GAN 7;  2BIV A;  4FKD A;  4IUR A;  4ELY C;  2DXC A;  2OAU A;  1I81 A;  4XTX A;  2MWO A;  3GNF B;  3CMA A;  4PNO A;  1KQS A;  2QQ9 A;  1Y96 B;  3DB3 A;  3P8B B;  3M59 A;  3T9N A;  2OD1 A;  4GI3 C;  3KUF A;  4JRK A;  2CS7 A;  1JB0 E;  3L2U A;  2QEX A;  5A2Q E;  4HT9 A;  1QP2 A;  2ZPH B;  1BKB A;  3CC7 T;  3OXL A;  2J9R A;  3UWN A;  3D00 A;  2VYT A;  1K8A U;  2VXE A;  2Y4X A;  3UEY A;  2XRC A;  3CCV T;  3OL0 A;  3M53 A;  1O9S A;  5GAN 6;  3OS2 A;  3PT9 A;  1VIE A;  2A3L A;  2UZ3 A;  1QW1 A;  3LW5 E;  2XG8 D;  4RG2 A;  5J39 A;  2K3X A;  2DTH A;  4JRQ A;  4M75 A;  4KUI A;  2NU4 I;  1XBT A;  4BE2 A;  3OYB A;  2P0P A;  5GMK h;  4CI0 C;  4JJN K;  3SGQ I;  4C5I A;  4UXH A;  2OTJ A;  3GPL A;  1VQN A;  1G5V A;  2ZCF B;  4Y91 A;  3QSU A;  4II1 A;  4M77 F;  1WJS A;  2DPP B;  3EAE A;  1W2B A;  1VQ8 A;  5IT9 E;  4LDX A;  3JB9 G;  5HY6 A;  5J3B A;  5GAN 4;  3QZ5 B;  3E9G A;  4X9D A;  4PJO F;  5KH6 A;  1YTP A;  1B34 B;  4XTV A;  1UGP B;  2C06 A;  3ASK A;  2YQP A;  1QP3 A;  3HHT B;  3HKS A;  1RI0 A;  2N17 A;  4JS4 A;  3PMT A;  3H6Z A;  1HDL A;  2V8I A;  4J6W A;  5A0G A;  4LDY A;  4C8Q E;  1HXD A;  4WF2 A;  2GF7 A;  1XQH A;  1TBQ R;  3NFC A;  3QBY A;  1OYX A;  3C12 A;  1Q7Y C;  3MEU A;  1NZ9 A;  5KE2 A;  5LJ3 h;  3TRE A;  1VQ5 A;  1TBR R;  3UPU A;  2KVQ G;  4M7A E;  4OB0 B;  1UUC A;  3URG A;  1V1H A;  3MCA B;  3QKJ A;  2EJG A;  3L1A A;  1VQ4 T;  2DZ9 A;  5LJ5 d;  2CZ1 B;  1S72 A;  3VUZ A;  3A5Z B;  3RKW A;  4B9W A;  3ZBD A;  1Y7X A;  3CC4 T;  3OYY A;  4R55 A;  1E7L A;  3NTH A;  3PGG A;  2NU3 I;  4BAC A;  5FUW A;  1TIH A;  1G3W A;  5GAN e;  4BDZ A;  2DK3 A;  1IRE B;  3MEK A;  2RK2 A;  5KCH A;  3GIB A;  3E1S A;  5LJ5 g;  3C94 A;  4PL6 A;  2M0O A;  1Q7Y U;  3SDZ A;  2E73 A;  1JRI A;  3OYI A;  4L59 A;  1TOT A;  4HCC A;  4C92 E;  5HQ8 A;  2RI5 A;  2HAX A;  3BDU A;  4FU6 A;  1BIA A;  2QQE A;  1TUR A;  1UVF A;  4E1R A;  5CO7 A;  4XU0 A;  1XTD A;  1M4Z A;  2MWP A;  3V8K A;  1WGS A;  1SGR I;  4M75 D;  5CIU A;  1VIF A;  3LGL A;  3OYH A;  1ZBX A;  4MDW A;  3OYF A;  2O4X A;  5GAM d;  2KCX A;  2RHZ A;  4QQG A;  3G6E T;  4C0G A;  5GAN 5;  4EPC A;  4C8Q B;  4LDW A;  3CCJ T;  1N8R C;  5FRM A;  4EMK A;  4JCV E;  5FRN A;  2IG0 A;  2RJD A;  4O5V A;  2QQ0 A;  3BY7 A;  2RHI A;  1WQ7 A;  1EIF A;  2ARP F;  1X6O A;  4NL3 A;  4M7A B;  2WSE E;  4BY6 B;  4HGU A;  2L8E A;  5A0D A;  4M78 E;  5GAM g;  1OVO A;  2ERW A;  2XDD A;  5GAO l;  5LJ3 d;  4ZN1 A;  5KE3 A;  2LT1 A;  1WQW A;  3SGB I;  3OY9 A;  3CCU A;  2GKT I;  4JRI A;  1GXI E;  1BI3 A;  1KQ2 A;  4IKF A;  2WCY A;  1VDD A;  2QQA A;  4TVR A;  3QO3 A;  1IW4 A;  1N6A A;  3C95 A;  2ORW A;  3JB9 H;  3UGI A;  3HSB A;  2ZPE B;  1UGS B;  3UGL A;  3BFM A;  1N8R U;  3OVO A;  2EWN A;  2RHX A;  3FRN A;  5CCA A;  5LJ5 j;  4JRP A;  4LD9 K;  3WVD B;  1Q86 C;  2XIC A;  3LWI A;  4PKC C;  3ME9 A;  4P5N A;  1UB4 A;  2D0Q B;  4N4I A;  2ENZ A;  4C92 B;  1JBM A;  4IUU A;  2K5F A;  4M7D A;  3JSC A;  2L89 A;  3O8V A;  2F3C I;  4MZT A;  3S3O A;  3KBG A;  4F7U E;  4OVO A;  2ZGW A;  2XID A;  3OXG A;  1HK9 A;  4L5G A;  4L9M A;  1M90 C;  2RHY A;  4M7A D;  3A8G B;  3MEA A;  4BI3 A;  4B9X A;  3LLR A;  1WJQ A;  4IUP A;  5GAN 2;  1VQK T;  2QNC A;  2JZM A;  1VQL T;  3M57 A;  2HBP A;  4HCZ A;  4V2S A;  2L3R A;  1UGR B;  1Y96 A;  1D3B B;  3OBW A;  2XDP A;  5C6S A;  1FWZ A;  4E47 A;  2OTL A;  2SGQ I;  1X75 C;  4RKU E;  1LR9 A;  3CD6 T;  3VDP A;  2YHT A;  1Q81 C;  1Q86 U;  4JLG A;  1OI1 A;  2DIP A;  4M75 F;  3CXC S;  2BKD N;  4M78 B;  5CVI A;  3X25 B;  1VQ6 A;  3HL8 A;  2SGF I;  3KY9 A;  5GAM j;  1QVG A;  1CE3 A;  4J7I A;  3M54 A;  1VQO A;  4BI8 B;  4B6D A;  2PQW A;  4LDV A;  5IAY A;  2QDY B;  5L8R E;  1PSF A;  1M90 U;  4C92 D;  2QQB A;  2LTO A;  2P0K A;  2L8D A;  1DS3 I;  3MET A;  3UFF A;  2ORV A;  1KHC A;  1VQM A;  2E12 A;  4OP0 A;  3GNG A;  2E6Z A;  5GMK l;  4QQD A;  1IZ6 A;  1LNX A;  1X4S A;  4C0D C;  3FEO A;  1RL2 A;  3VJP A;  4CRI A;  3PIP A;  1YHQ A;  3L42 A;  5GAN f;  4IUV A;  2E6N A;  4BD3 A;  3JB9 I;  1YIJ A;  1K73 C;  5LJ3 j;  3CCM A;  2JN0 A;  4KUL A;  4FIB A;  2A20 A;  4J5Y A;  5GAN 3;  3DB4 A;  1N9S A;  1Q81 U;  5DLQ E;  3JCM f;  5LJ5 h;  2VC8 A;  2F5K A;  4F7U B;  2DKG A;  3X28 B;  1E7D A;  2X4W A;  5I21 A;  1TGS I;  4KUD K;  2EQM A;  3TU4 K;  4ZTF A;  3CCE A;  2KSS A;  2WSF E;  3JCM Q;  2XI9 A;  1YJW T;  3A8M B;  3CME T;  1B34 A;  2WAC A;  1M1K C;  4BUG A;  4M78 D;  4QW2 A;  1VUB A;  3S6W A;  3VYH B;  2NLU A;  1ZQ1 A;  3LYI A;  5DAE A;  3FDR A;  1Y71 A;  1R79 A;  3CCM T;  1KQS S;  4M7D D;  1LJO A;  3TEE A;  1H0Z A;  3CMA T;  2VGM A;  3OYN A;  2FB7 A;  3RU0 A;  3UDC A;  1TUS A;  1KHI A;  1K73 U;  2RD1 A;  2RA2 A;  2SGE I;  3OSS C;  2QEX T;  1TH7 A;  2GFU A;  3H8Z A;  5I2M A;  4XAX B;  3VUB A;  1O75 A;  1G3Y A;  3PNW C;  1Y8F A;  3M56 A;  1M9S A;  4VUB A;  4XU2 A;  2K9H A;  5GAM h;  5CAI A;  3QII A;  4XK8 E;  2EKO A;  4OB3 B;  2YUU A;  3BJI A;  1M1K U;  3VV0 A;  1AHJ B;  2RI2 A;  4M75 C;  4ZN3 A;  4EMH A;  2RM4 A;  3S3M A;  3A8O B;  3QWP A;  2RH2 A;  2EIF A;  1MT1 A;  2LQK A;  2X4J A;  1BIB A;  4SGB I;  4A4K A;  2DB6 A;  5GMK e;  3CCQ A;  3G71 A;  3PTA A;  5CCM A;  2OTJ T;  2EQK A;  3FJP A;  1VQN T;  4LDU A;  2QA4 A;  2DXT A;  1M1F A;  4OGE A;  3JCM P;  4N0A A;  5FU7 B;  4OB2 B;  3G4S A;  2MI6 A;  3CBO A;  1W2B S;  2B8T A;  3UEJ A;  1VQ8 T;  3HP9 A;  2QQC A;  2DAQ A;  2CGH A;  1U5K A;  4QVZ A;  2ZPF B;  2VRW B;  2P4T A;  4QQ6 A;  1XA6 A;  4HCB A;  2JA1 A;  5CKE A;  4C8Q A;  1IY5 A;  3CCQ T;  3M4G A;  3G71 T;  4M75 G;  3MP1 A;  2DXU A;  2HD0 A;  2KK4 A;  1PJU A;  3VU3 C;  1M1G A;  2KQW A;  2RK1 A;  1QVP A;  2QXF A;  3GLX A;  5LJ3 e;  1VQ5 T;  4M77 E;  3MEV A;  4Z02 A;  4M7A A;  1W4R A;  1VQ9 A;  2ZPI B;  4PJO E;  5LL6 S;  3RKX A;  1AN1 I;  3JCM e;  4OMF B;  2XU8 A;  5GAO q;  3SEK C;  3JCM b;  5D6X A;  4UC4 A;  2VXF A;  1S72 T;  4FSX A;  1SGD I;  4LD6 A;  2LEO A;  1VQ7 A;  4DOV A;  3CPW A;  1M8C A;  1KC8 C;  3KXT A;  4D6W A;  4RCB A;  4M7D F;  3HRT A;  3M58 A;  4MDX A;  2GQV A;  2DJZ A;  3UGD A;  1CHO I;  3OMG A;  4M7A C;  2JXD A;  4BY6 C;  4XTU A;  5HK3 A;  5IN1 A;  3V7R A;  2M16 A;  4EMG A;  2LVM A;  3P8D A;  2RO0 A;  1ZHI A;  4IUT A;  5EX0 A;  1YJ9 A;  3CEY A;  4RMO A;  1G3S A;  3QZ9 B;  3CBM A;  2QQR A;  4C92 A;  2W0T A;  4A53 A;  2FHD A;  3QTL D;  1FAR A;  4ZGE B;  2DTI A;  2EFI A;  4OB1 B;  1W3S A;  3QUI A;  4E7L A;  2VV5 A;  4ZGJ B;  2LCL A;  1LOJ A;  2XDB A;  4FM4 B;  3QYH B;  1XOV A;  4GY5 A;  2LX9 A;  4N4G A;  4BB7 A;  1NPP A;  3OS5 A;  1KC8 U;  5HK0 A;  1M8B A;  2ENN A;  4QVC A;  3PIO A;  1X01 A;  2QTX A;  3OYK A;  1U1T A;  4EMK C;  4C92 C;  3LX7 A;  2KDS A;  3OYM A;  3V8J A;  1TBO A;  1OZ2 A;  1D3B A;  2KMP A;  1IY6 A;  4M7A G;  2MAM A;  3L2Z A;  4A54 A;  3JCM J;  4M77 B;  3I56 A;  4C0F A;  3M5A A;  2E10 A;  3I55 A;  2X4X A;  4M78 A;  1VQP A;  4PJO B;  3OYL A;  2EJF A;  2E70 A;  2JZ2 A;  5FUY A;  1DJ7 B;  1SGQ I;  2P6A C;  2JW6 A;  4C8Q D;  2HNI A;  1BI0 A;  5GAN g;  4EDU A;  3CXL A;  3OW2 A;  5C0M A;  2K2V A;  2EQJ A;  2M5X A;  2VUB A;  2SGD I;  3CCU T;  3OA6 A;  2WVJ A;  3ZEH A;  1XX6 A;  2V8J A;  4C0Z A;  3OYD A;  5FUV A;  3JCM W;  3SWN B;  3OB9 A;  4JUV A;  1OMU A;  3MP8 A;  4E7I A;  3JCM g;  2MF2 A;  4E7K A;  2R57 A;  4Q5W A;  4UXJ A;  4M78 C;  2N1A B;  3PMI A;  4JLI A;  4C92 G;  2JVV A;  4J83 A;  2J87 A;  3V8L A;  4ZGD B;  1SGY I;  1Q82 C;  1CT4 I;  3RIR A;  2RJE A;  3UT1 A;  2JTF A;  2XK0 A;  4M7D C;  2FVU A;  2F5T X;  1KBE A;  1JJ2 A;  1YU6 C;  4BDY A;  3OXF A;  2RHU A;  4F7U A;  2D6F A;  2ZPG B;  3CCR A;  3LWH A;  1UVG A;  4M77 D;  1NPR A;  1LR7 A;  5FU6 B;  1DS2 I;  3JAM E;  4J6Y A;  1KG1 A;  1M5Q 1;  4NOY A;  3BDL A;  2EQU A;  4PJO D;  2CJS C;  3CC2 A;  3GF5 A;  3L2V A;  2E64 A;  3CCS A;  1U8R A;  2KMQ A;  3WXM B;  5D6W A;  5HI7 A;  2JNG A;  2EAY A;  4XU1 A;  1EN7 A;  2DIG A;  4M78 G;  2OVO A;  2V53 A;  1BI1 A;  3OS0 A;  3DKM A;  5DY9 A;  2OTL T;  1SGP I;  2NU2 I;  1Q82 U;  2DZC A;  4OVA A;  2SGP I;  3JRZ A;  3HFO A;  3E9F A;  1CGJ I;  4Y28 E;  5LJ3 f;  1QVG S;  1VQ6 T;  4M7D G;  3X24 B;  2GCX A;  4N4H A;  2G3R A;  1VQO T;  2DD4 A;  2KAF A;  2PVG B;  3R6O A;  5CR2 A;  2ODD A;  1WJR A;  3CCS T;  3CCV A;  5CKB A;  5M9O A;  3L2Q A;  2DTO A;  2RJF A;  4KBM B;  2PUK B;  3GOX A;  2MMP A;  1VQM T;  3QHS A;  3QJ6 A;  2KY9 A;  3P8H A;  2DEQ A;  1W4S A;  2QI2 A;  1OZ3 A;  2LQ8 A;  2WSC E;  1CGI I;  1YHQ T;  3HRU A;  4M75 E;  4C0D B;  3AHU A;  1PPF I;  4F7U G;  1YIJ T;  3QDR B;  3L2R A;  4A4E A;  2E5R A;  2A7Y A;  4C8Q F;  2HQX A;  4ZTJ A;  2L5Q A;  4E1P A;  2PU9 B;  5GAN 8;  1Z7K B;  4YTL A;  3HFN A;  2KMT A;  1RFH A;  1CT0 I;  4BI4 A;  1NUB A;  3A8H B;  5LJ5 e;  4DA4 A;  4HT8 A;  3INZ A;  3OSV A;  4MZM A;  2FNF X;  2E65 A;  3VYG A;  2QPO A;  3CCE T;  4M7A F;  3C4S A;  3M4Y A;  4QVD A;  3VDU A;  3M55 A;  5DLO A;  3OS1 A;  5GMK i;  1BMO A;  1R0R I;  5D6Y A;  3QYG B;  5CKD A;  1NE8 A;  2GFA A;  3QXE B;  3OYG A;  2AHJ B;  1HJA I;  5FU7 C;  2XHC A;  1UGQ B;  1KD1 C;  1I5L A;  4ELZ C;  3N5B B;  2LC4 A;  1V29 B;  4MML A;  3MHX A;  5HKC A;  4RG8 A;  1SGE I;  2PVO B;  5FRO A;  3QPH A;  2BUD A;  3TCJ A;  1H3Z A;  4GLK A;  2M1H A;  2CYZ B;  4C5G A;  4OGC A;  3FIF A;  2K57 A;  2DIQ A;  3Q1J A;  1H64 1;  1KBF A;  4DOW A;  3J80 E;  1BUS A;  1VQ4 A;  1UEB A;  2EYQ A;  4X9C A;  4PLI A;  3EFR A;  4C92 F;  2E1H A;  1FX7 A;  3CC4 A;  5CQX A;  1Y07 A;  2ZPB B;  5GAM e;  1I4K 1;  2CKK A;  4MMK A;  5GAN h;  1FAQ A;  3MP6 A;  1K9M C;  2YRV A;  3CBP A;  1PTR A;  3QJY A;  4E7H A;  2K3Y A;  4KT0 E;  2YLB A;  4M75 B;  2CZ6 B;  2F69 A;  5EG2 A;  1YI2 A;  1KD1 U;  2DD5 A;  2B8A A;  3MEW A;  2LT4 A;  3OQ5 A;  3JB9 D;  3JCM h;  4N0A C;  1CSO I;  2RI3 A;  3ZFJ A;  3FB9 A;  1LR8 A;  2QA4 T;  4XTZ A;  2N52 A;  3G4S T;  5CK9 A;  1MHN A;  2IVW A;  1V1I A;  3RMS A;  4IUQ A;  2QQD A;  2Y4Y A;  3JCM c;  5J26 A;  2N71 A;  2D9T A;  3OYE A;  1R8O B;  4M78 F;  4O6J A;  1G3T A;  3SFM A;  4C8Q C;  1WNL A;  4L6V 5;  1U1S A;  3G6E A;  5DM7 R;  2M9U A;  1YI2 T;  4A4H A;  1MGQ A;  4JDS A;  3CCJ A;  1K9M U;  3PDN A;  2ROW A;  2GKV A;  2V8K A;  4A24 A;  3X26 B;  3OMC A;  3V7S A;  4M77 A;  1SSF A;  3PFS A;  2CZ0 B;  2QQS A;  2DO3 A;  3M9Q A;  4PJO A;  1FXX A;  1N27 A;  3E59 A;  1VQ9 T;  1BYM A;  2E41 A;  4R56 A;  3E2I A;  3ER0 A;  1XNI A;  2BUS A;  2O01 E;  1NJI C;  4ME7 A;  5AYF A;  3CPW S;  3B4V C;  3J7A F;  3RUX A;  1VQ7 T;  1Y1B A;  3EFS A;  4FT4 A;  3TJQ A;  2LDM A;  2VGN A;  4F7U F;  4M77 C;  4XQ3 A;  3RMQ A;  3CCL A;  4NL2 A;  3SWN A;  1HPT A;  3MO8 A;  3DLL A;  2YLC A;  2FYK A;  4PJO C;  4C8Q G;  4RCC A;  4JS5 A;  5GAO m;  5CKH A;  3HRS A;  3G7Z A;  1M8V A;  2X4Y A;  3RES A;  2DVE A;  3E19 A;  4J8O A;  4E7J A;  2PUO B;  5GAN d;  1YJ9 T;  5GAO n;  2JUF A;  5FLX E;  5KCO A;  4A4G A;  3VE5 A;  3FC3 A;  2I2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...