3FCAA

Genetic incorporation of a metal-ion chelating amino acid into proteins as biophysical probe
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
291
structure length
290
Chain Sequence
MMERLIGSTPIVRLDSIDSRILKLEKNNPGGSVKDRPALFMILDAEKRGLLKNGIVEPTSGNMGIAIAMIGAKRGHRVILTMPETMSVERRKVLKMLGAELVLTPGELGMKGAVEKALEISRETGAHMLNQFENPYNVYSHQFTTGPEILKQMDYQIDAFVAGVGTGGTISGVGRVLKGFFGNGVKIVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITVEDEEAYEMARYLAKKEGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genetic incorporation of a metal-ion chelating amino acid into proteins as a biophysical probe.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Cysteine synthase
total genus 113
structure length 290
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2008-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fcaA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fcaA02
1WTCA 3ZEIA 3SPXA 4LMBA 1JBQA 2DH5A 2Q3DA 3IQIX 4LMAA 4OREX 5B53A 3SS9X 1K7EB 2BHTA 4IL5A 2O2EA 4JBLA 3FGPA 3TBHA 1TZ2A 1M54A 4L27A 5B55A 1A5SB 3AEXA 1OASA 2ECQA 4NU8X 1QOPB 1O58A 4D9IA 2ECOA 3IAUA 4QYSA 5D85A 1KFJB 5B1HA 4F4FA 1WDWB 1KFKB 5T6MA 4L3VA 3L6RA 3FCAA 3T4PA 1CX9B 1TYZA 5D86A 4D99A 3VSAA 1TTQB 1A50B 5B1IA 1TJPB 2Q3BA 5D87A 5D84A 1UBSB 1P5JA 1WBJB 3PC3A 5DW0A 5C3UA 2ZSJA 3RR2A 1QOQB 1Z7YA 4HN4B 1V8ZA 2CLKB 3DKIA 5DBEX 1VB3A 5DBHX 5DW3A 1RQXA 5BW6B 4D9FA 5KINB 5J5VA 4ZQCB 1A5BB 1CW2B 4HPJB 3CEPB 1VE5A 2BHSA 2RKBA 2GN1A 2ZPUA 5IW8A 1C8VB 5I7AA 4D9EA 3PC2A 4JBNA 5EY5B 3HMKA 1Y7LA 2PQMA 3X43A 2EFYA 5B36A 2CLMB 3VBEA 1FCJA 2CLOB 5I6DA 1TZMA 4D8WA 2JC3A 1V71A 2WSYB 5E0KB 4COOA 4L0DA 1C29B 2GN2A 4D92A 1K7FB 1K8ZB 2CLFB 5JJCA 1PWEA 4PCUA 1UIMA 1X1QA 3PC4A 4D96A 5B3AA 1J0EA 1Z7WA 4L28A 2C2BA 3BM5A 4Y6GB 1KFCB 1KFEB 4AECA 2EGUA 4XUGB 1J0AA 4I1YA 5IXJA 1K8XB 4HPXB 4ZU1X 2GN0A 1BKSB 1FUYB 1TZKA 1F2DA 1E5XA 1TTPB 2V03A 3AEYA 1TZJA 2J9ZB 2O2JA 5CGQB 5CVCA 3IQGX 2TSYB 4OFXA 5HBGA 4D9GA 2C2GA 5I7RA 3PR2B 1UINA 3SS7X 1A5AB 2CLIB 4NEGA 3L6BA 1TDJA 2DH6A 1WKVA 1K8YB 2ISQA 1J0CA 4KKXB 4AIRA 1J0DA 4D9BA 3R0ZA 5I7HA 1V7CA 4D8TA 3R0XA 4D9MA 2CLLB 4LI3X 4D9NA 4D9CA 1D6SA 2RHGB 3V7NA 2CLHB 1KFBB 3X44A 4D97A 1C9DB 2TYSB 4WX2B 4D9KA 5KZMB 2ZR8A 2RH9B 5JISA 1K3UB 3IQHX 2Q3CA 4H27A 1K7XB 4D8UA 2J9XB 4HT3B 1J0BA 1PWHA 2J9YB 3L6CA 2CLEB 4ZU6X 3VSCA 5I7OA 5IWCA 5I7WA 3DWIA 5DVZA 1VE1A 3VC3A 3VSDA 5J43A 1BEUB 2D1FA 4HO1X 1KL7A 3DWGA 2TRSB
chains in the Genus database with same CATH superfamily
3UANA 2WAMA 3PXBA 5AW9A 2G77B 3BWVA 3BB4A 5LDGA 2TECE 1PLJA 3RGGA 3QPBA 3RJ9A 1Y3FE 4QEZA 1GUZA 3LBAA 5BQOA 4YQFA 2AOWA 3D59A 4TRRA 3K7EA 4MV7A 2C5LA 2H06A 3EXHC 2OBLA 4YUAA 4JH0A 3M6WA 3LE8A 2WD9A 4DANA 3TWOA 1VI6A 3SJ7A 1QHXA 1DQPA 2C5BA 1G9TA 2WV7A 4LXYA 4TV8F 3OP1A 4IO1A 1H4TA 2QAIA 3N2KA 4R1NA 3UT0A 3SHOA 4PZAA 4R16A 4KDEA 2IODA 4P31A 3V4LA 2H8GA 3PFGA 5DXAA 4A0GA 4BJ3A 1USIA 2HA4A 1R8JA 3ENNA 5G4LA 1XJ5A 1DMSA 1DJNA 2A0UA 5DWDA 3UJDA 4YRDA 3CNHA 4MQ5A 2IYQA 1ZM3A 5AOBA 3SSOA 3IAXA 5FPYA 3JVDA 2RCNA 4UPDA 5KU7A 1WCYA 1U3TA 1UBSB 1QK5A 1M2OB 2PLRA 3Q5DA 3PVZA 1CFZA 1J07A 2IV2X 4WLFA 4MVWA 2R7NA 3LPCA 2XMBA 3LNTA 3N5CA 1Q1EA 2P0EA 3GB9A 5BQFA 2L17A 2Y1EA 4Y6PA 4GECA 5NLLA 4DCJA 3OLZA 5JATA 4Q9JA 3PUXA 1OHHD 4C0LA 4Q3OA 1KAHA 1ZUNB 5HJ2A 4UBNA 1J70A 2DWUA 2QRKA 3PC2A 4DNQA 1AO3A 2FGKA 3O3CA 4NS4A 3A7DA 4ND1A 4CNBA 1P19A 2OCGA 4LY6A 4TV9A 1MO3A 4HAXA 3ZCXA 5EYPB 1KHTA 4DBVO 4RV5A 3CZPA 5HKKD 3O0TA 1Q1AA 2B4RO 3V97A 4DMCA 3EBPA 2HK9A 4EDHA 2CLFB 5F98A 4ND8B 5A2GA 2XECA 3CJTA 5D2CA 4B5LA 4S1WA 4DFDA 5EPUA 1R18A 4ALNA 1NE2A 1SXJB 3R5HA 3KD3A 4GLOA 3MSCA 2AYXA 3A1DA 5FTLA 3QBEA 2Z8XA 2BMDA 4UTZA 1K5PA 4N7JA 5I3CA 4BBZA 5EMJA 1O2DA 4JT4A 4ZK2A 1PBNA 1KARA 1T3HA 4KGDA 1GNRA 4O4JA 1OT3A 2FE4A 2V03A 3OM8A 4I55B 5HX7A 2I91A 2OP0A 2NU6A 4HXYA 3L8MA 1L4HA 4PGGA 1B42A 4EABA 5C51B 1UBLS 3DP9A 2VJLA 1AE1A 5F35A 4BLOA 1ZL2A 1KO4A 4HNGA 5F64A 5JHHB 4MMXB 3NVAA 4FYMA 2AEMA 2JA2A 4PX5A 3SC4A 4ALMA 2AI3A 4A9AA 1ECFA 1VCMA 2VQ6A 5K03A 1OLXA 2H51A 1VQ1A 1U6IA 2DMRA 1N6NA 1XX6A 2FH5B 3O4GA 3OPYI 4FC6A 4WNAB 4UCQA 2WNSA 1EFVA 3GJ4A 3HUEA 3RS3A 3N58A 4PIVA 1KGSA 4ZAFA 4WZZA 1KVSA 1HLGA 3BD8A 1XAGA 3EC1A 3OKPA 5F1OA 4DHEA 8ABPA 4D9CA 1E8DA 3RK0A 4RXMA 4NNJA 5CH3A 4D45A 3O1JC 1X7ZA 1I9CA 4UUQA 3SHFA 4XGIA 5DP1A 1HTBA 2A1IA 4DMHA 2QLLA 3NEAA 1GNPA 3AFMA 4JENA 1OYOA 4A2CA 3G0HA 3OPQA 2AD1A 4GH5A 4XQCA 3SHWA 2C5GA 3KU4A 5FJJA 4C07A 3ASVA 3TIXB 4ZZ3A 3IURA 3B1ZA 3I2YX 2J5XA 4HO1X 4NBLA 2AS0A 3PTLA 1VBFA 3SJCA 1JEQB 2X5KO 3F3KA 1P60A 3BH0A 2QXYA 3LFUA 5JSZB 3OFJA 4HB3A 5BORA 1Q1GA 3D4NA 1EM8A 1TEHA 2VTBA 2Z5LA 2ZTLA 1L4UA 1D8AA 1PF7E 4YDHB 3I0MA 3OZGA 4H0NA 3ABSB 2O20A 3MWDA 2WYIA 2EP8A 2DWOA 1U2DC 4HQRA 1ZNZA 3BQMB 4DCOA 5JCOC 2KM1A 3QEMB 3TQTA 3OY2A 3BCUA 2C2MA 1T0IA 1LSOA 2Q0XA 3DAPA 4EUEA 4ZIRB 1D3AA 1FC0A 4PHGA 4DA0A 4FXOA 1XD2B 5LXTB 3F2VA 1L7AA 2I34A 1NVTA 4HB2A 1UZLA 5B1DA 4E94A 3SZGA 3ZLUA 5I47A 2P1DA 3AYXB 1W76A 3KQOA 3R2JA 1ST3A 3G8BA 3ZWCA 1E3JA 5KS2A 4D81A 4HAVA 1KC3A 4EVQA 3GNQA 1BA2A 2FKNA 1TF5A 2CCGA 2YXPX 2ZYIA 2WYHA 2BVNA 3R6TA 4DZRA 3N86A 3HYRA 1KDPA 5EWLB 1VJRA 2HWXA 3Q8XB 4KNYA 1N77A 1K66A 5GY7A 2NPOA 1U7TA 5JG7A 4L9SA 3CEPB 1H1DA 2PYIA 4J43A 1AJEA 1VE7A 5FA6A 5IT5A 4P22A 3RREA 4W4TA 1KMIY 3NU1A 4INOA 4WZBA 5FULA 4PYMA 3GN2A 1HI9A 1GPYA 4NBUA 1LVUA 4JR0A 1Q17A 3M9XA 4WOJA 4E6PA 3SQMA 2MR6A 3W4JA 3AIIA 4GRIA 2OCAA 5DYGA 2DQ4A 1G8GA 2W6CX 3I01A 4KUGA 1H6BA 1LS1A 3IB6A 4QA9A 4F4UA 1AGXA 1B41A 5D6OA 2QUAA 3BMNB 2EJUA 4EB6A 1QJ4A 4EF5A 3V34A 5A06A 1E58A 1G7CA 1RAEA 1Z73A 3IAM6 1RHJA 4I9GA 1PQYA 2UYYA 2WIDA 3GUHA 3GLIE 3ZYZA 1IAVA 2Y05A 3F6YA 1UK9A 3OQJA 1V9CA 3PDIA 1IRXA 3MJDA 4U7PB 3FKSA 1P39A 1SC4A 3STWA 4UUNA 4CUKA 5C5DA 5KNDH 5KQRA 2VTVA 1W35A 3WE7A 1BFUA 4HXEB 3NBFA 1TL7C 4YRSA 1VRVA 4JR2A 5HM6A 2HQBA 1E2EA 3ENVA 3U09A 3V8MA 2PNFA 4OFBA 4YUZA 3PXDA 2WJ4A 1KDOA 1ABFA 2IC5A 3Q9LA 4OMFG 9ATCA 5HK9A 2FSGA 2DHCA 1P80A 4U5QA 3VPSA 5CFLA 4JVOA 2IZ6A 1I7DA 2JH8A 1W34A 2GHIA 4OQLA 5KNBH 1PT6A 4ZXPA 3IBFA 3OIWA 2IIVA 5K01A 1NDHA 1M72A 4AMUA 3JCZA 4UM5A 3H3FA 3HKEB 3F9CA 4K9QA 1HT1E 4JC4A 3U26A 1M2JA 3AJRA 3K09C 4TL6A 2PAAA 1L1FA 4QX6A 2H1CA 1BNCA 1OROA 3JQDA 3N7UA 1BWPA 1IEQA 5ECDA 2H3EA 1NRIA 1M74A 3EVEA 4CN8A 4PAMA 1LWNA 1ES9A 2VTKA 1AHNA 1SA0B 3ABIA 3GL9A 4PC1A 3AB3A 2PRKA 1KIMA 1YZNA 2AK2A 2J87A 3PHLA 5FBZA 3RANA 1EM6A 3VPDA 4W8OA 2VF2A 2NAPA 2FEAA 3COJA 2NYVA 2J0EA 2VYVD 3LZCA 1U8TA 4KRXA 3RC2A 3VH3A 4LSZA 1EAYA 3BXHA 3P9CA 4O4IB 1ZUIA 3OEWA 1ZDMA 3QTBA 4NEQA 2FN7A 2NZXA 2ZI5A 1P0MA 1ZD9A 1JIUA 4Z49A 2RGYA 2CHGA 2D0IA 2XQGA 3MRSA 3WLTA 4A2PA 1SBCA 1H2RS 3K0CC 1XVAA 4LJ6A 4Y6QA 2PO7A 3IKLA 4O63O 3MB5A 1KFKB 3H2SA 4C2BA 4JN6B 1IOWA 2VRNA 3V7WA 1HF3A 1XXHA 3G0CA 2JLYA 2GWHA 1GA6A 4G36A 2ZB7A 1FFXB 4B4OA 1YAJA 1EHCA 2PCLA 2FDXA 3AUUA 3QA3E 1NXTA 1IG0A 2WWIA 5EJ6A 2OM6A 3DD1A 1F4VA 1RPTA 3JZAA 1E9CA 2OENG 4UM9B 1SOAA 1XNJA 4CIBA 3WQBA 2GXAA 4A10A 1ZH2A 1NI3A 3CNLA 3LQRA 4C0SA 1WX1A 1NPDA 4DA8A 4JCCA 3DXZA 4HQOA 3L8HA 3U9LA 2DAPA 1T1JA 3CFYA 3BE6A 3ZQ4A 2WWRA 2GO7A 1L4YA 1RLMA 2D0PB 2A33A 2YVUA 3HDJA 4FOLA 3W2IA 2CNNA 1O97D 3K4QA 3CBQA 4R1UA 4I0WB 1SVUA 1Y1RA 1N2JA 1OW3B 2P90A 3SZUA 5JD5A 1GTSA 1DT3A 1V6SA 1THMA 3G2LA 2AJDA 2XUAA 1SVIA 2OK7A 3EK2A 4L85A 4OKNA 1CZOA 1SHJA 1QK3A 4LXXA 1N0HA 4OGWA 3P94A 4RVCA 5JYEA 1T8YA 5DI9A 4TWBA 3T7AA 1AKUA 3WADA 4FZ5A 2P79A 3EVDA 4RFLA 5K3BA 1UMCB 4UAVA 4BFUA 4EHAA 5C1BA 5C7YA 1I30A 3NIFB 4DQKA 4O8CA 2A84A 2DHEA 3NIBA 1BAPA 2VDWB 2PQ6A 2I8LA 1QPZA 1AQLA 1L3CA 3U3KA 1W85A 2BOVA 2FETA 5BSTA 1RLUA 3U3XA 1XA3A 4DMFA 1ZGJA 2PWAA 1U94A 1ECJA 3DJYA 1HL3A 1FRFS 2OXRA 2VJMA 2FEWB 3WJ1A 2I1VB 2RGRA 5CIWA 2F8MA 4MPRA 2VPIA 4UNPA 1D9ZA 1YS6A 3MWKA 2IYWA 4QEDA 2R7MA 5FTKA 1M2VB 1JXOA 4DJDC 3T1YB 3DE6X 3X2FA 1PCXA 5TGDA 3DM9B 1VI2A 1NC3A 3H9UA 4Z0HO 2ZRFA 2VOJA 4HRXA 4UAUA 1GPWB 1BDHA 1CT9A 2WC1A 5AJVB 3VRHA 2YWGA 3ZJYA 1GL7A 1SUDA 2W6ID 4MW0A 1Y81A 2YV3A 5EMMA 1X2EA 2HCRA 4MI3A 4TLCA 3GRAA 1OH5A 3PICA 1CQIA 3KXLA 1NFFA 2EIHA 1DZIA 4WHMA 3EXHA 1Y9ZA 4NPCA 2J45A 1XIVA 4DXAA 1WB9A 2YHSA 3W6NA 2HHJA 3ETEA 4MB2A 4P93A 1VHTA 2AG1A 1VMEA 4BVKA 3FPJA 1RQGA 3FZYA 1GXSA 4LWPA 5LA6A 2OILA 5A9SB 2I80A 4B6GA 2V74B 4L5BA 2ACKA 2WD7A 3D0RA 3OEED 4N0PA 4OXYA 4EY6A 1H0KA 1V16B 1Y5IA 1M0TA 2Z30A 3PU6A 4GMHA 3TSOA 3EXG2 4HS4A 4PZ9A 3L8ZA 2VSOA 3STUA 3PSHA 1MHPA 1UMCA 2NZJA 2FWAA 3QLUC 4IQGA 4IJUA 1FU4A 1MXFA 4LHZA 4RIFA 1NX6A 4JS0A 1NV9A 1UJMA 1IHXA 1Q14A 4ZKDA 5LXTA 4R9UC 1YA6A 3MJRA 4V38A 1DIGA 5LQAA 2IXDA 3ZDYB 4C9BA 5BW8A 5KVVA 1O54A 3FTPA 4QFBA 1JMKC 3NDRA 3TQRA 4P1ZA 5LWQA 2DP4E 1R9MA 1WKBA 2GLXA 2R87A 2GFHA 4LKRA 3SF8B 1OIXA 5ICMA 1NDQA 4QOJA 1W5AA 3H1BA 4PPYA 4US1R 4BB0A 2HHHB 3DJFA 1SZDA 4DV6B 4R0MA 3NJ4A 4KH0A 5JQWA 1U8XX 5C18A 2BFWA 3GCGA 1N2IA 2PZAA 2ZI6A 4G1FA 4NLLA 1JF8A 2SCUA 1UP7A 3NNNA 2REOA 3AETB 4NHEA 1ZJZA 2UZIR 4B09A 2P3LA 4ZO7A 3C7DB 3PITA 3WKEA 1JNXX 3EOZA 2DHRA 2O6HA 4J07A 4NESA 5L7WA 1I6WA 4FLMA 4F6RB 2R1TB 1ZAKA 3G5UA 1ZJYA 4IXWA 1GA4A 3FYUB 2CDAA 2ZPTX 3VHLB 2QTMA 1TJYA 1H3FA 3L6EA 2QE7A 1GZ5A 4JBYA 3QEOA 4Q48A 3QNMA 4QVKA 1HM5A 5JT1A 5EG5A 1RZ3A 2DFKB 4ZP1A 2HV8A 1BGWA 2O8NA 3F6BX 3O1IC 4MAFA 3UPDA 1WMDA 3HJCA 3U2QA 3A6ZA 3HYSA 3UMRA 2XDWA 2HJGA 4PC6A 4HXGA 4PIPA 2VWGA 4HWPA 5CM9C 1ZD8A 4QGHA 5CM8B 2H2HA 3I2GA 4HDKA 2AXPA 1P1HA 1O5IA 3R3VA 4TUYB 5FOXA 3GLIA 3MJTA 4G5FA 4EGSA 2HA2A 4G1EB 1YZHA 3MLBA 4OXQA 4C1NA 2C2GA 4Z7OB 1JI3A 2GJSA 1LW6E 1CZKA 1GQOA 3N59A 2JVIA 5JZVA 2J0SA 5ARCA 1K8QA 4UVEA 4MJXA 1DUVG 1T1RA 2EGGA 1DGQA 3C1UA 4B3XA 5KC9A 1K88A 1PWZA 2IUEA 3AVOA 4HHEA 1QG6A 2NTJA 4JLVA 3P2KA 4NCJA 4BNNA 3IQDB 1E4OA 2DUJA 1OIWA 1B15A 3UEOA 2PKWA 1Q0TA 2EF0A 4EPXA 2VPXA 3K2BA 2QP9X 1P31A 2F2TA 1WB5A 2BGTA 2YZNA 4GOJA 1H5UA 5AIBA 2HJRA 3QYFA 5B6JA 2Y2UA 2ZU0C 3D2CA 4NFYA 1AG9A 2H85A 3RFCA 1IUKA 3N8NA 2QGNA 3C3KA 3QWBA 5L51A 1MH9A 3EVFA 4REQB 1Z6TA 2ZS7A 4ITVA 2OAP1 1DLJA 4IZIA 4MJLA 4RPKA 5EXTA 4EO9A 2HRCA 4CEIB 2JI7A 1XTJA 1NQ5A 3FPCA 4W8GA 3R6LA 1YMQA 2ZRQA 4AJPA 1C3VA 1CP2A 3AERA 2XVYA 2H3HA 3FN4A 4HBZA 2QYOA 3MJ4A 4NE2A 2QTWB 4MVJE 5BOSA 3QYJA 2I4RA 1NBMA 4FP9A 1G2IA 5FTWA 1PT5A 2NXEA 4MWGA 2HWYA 3PS9A 2WYUA 1H0HA 1TIPA 1HA3A 1UR5A 1U2GA 1DRKA 3O1HB 4QTYA 1QHIA 2VPYA 3I6ZA 2ZVDA 4J1QA 5COAA 2ZUFA 4G9EA 2G82A 1EE9A 2ZUTA 4RF2A 1NOKA 3ZD7A 4TMTA 4BV8A 1CR0A 1DAKA 1J9ZA 1H8ED 1W5BA 1W87A 2LDXA 2V9PA 3FJOA 4UARA 4ZARA 4C4AA 4E46A 2DT5A 1VPLA 2F3TA 4UE2A 4ARBA 1WDLA 3V2GA 4RETA 1Y42X 3I32A 4YGXB 1R64A 3R7SA 3TIFA 3KQYA 3QBVA 4OB8A 4DREA 621PA 1XHLA 2ZU6A 4Y18A 1H2XA 1NXOA 3MUOA 1C7ZA 1U0FA 1F5SA 2DWPA 4YR9A 1KO8A 1QRSA 3E3OA 4ND3A 1G1MA 1OBHA 3T12A 1EFVB 5I01A 1CERA 1CQJA 1F8YA 4S1NA 3DSRA 3GD5A 4RZHA 3FNRA 3LQ1A 5AT1A 1MW8X 2IVFA 3F71A 4ND2A 4B85A 2HFJA 2QTCA 3V8RA 1KZ9A 4QDJA 1X87A 4D5EA 3F4LA 4AZWA 1Z12A 3FR8A 4C4RA 1N36B 3BTUA 1UKVY 1Y8AA 3OZUA 4EWLA 2OO5C 3KQQA 1F2VA 4MR8B 2C9ZA 3VPXA 1FA9A 4DWWA 1QF7A 4ZPXA 4ZEOA 3HA7A 1F06A 3C3JA 3OM9A 4RHFA 4ZOLB 4LDRA 3WTBA 3TJRA 4CKWB 4COOA 3IQEA 3ZI4A 1P4RA 2AXEA 4L3WA 1NVGA 2HBRA 1D0IA 4GYYA 4DSUA 4PVCA 4ZZ1A 5IJ9B 3HZOA 1DDIA 1RVV1 3DW1X 3N28A 3LPDA 4JJZA 3RQIA 4OM7A 9MHTA 1XSEA 3CF0A 1R10A 1M67A 1Z26A 1M1YA 3AM5A 4BO8A 2IHTA 4OO3A 4EGQA 5MFZA 1O0BA 3VA7A 4XQEA 1RHQA 2FI1A 3GEIA 1E9VA 4MYDA 1C3XA 4KPGA 3QFCA 2Q3LA 3FJYA 3PUKA 3K6JA 4D4JA 3AM1A 3V4VB 3NEPX 4BVJA 1M2KA 1U3VA 2Q8QA 2XB4A 2YHIB 4XWOA 4RLSA 1QF6A 4W5OA 4RIGA 4XRRA 4XCVA 1VL2A 4MXDA 1P0CA 1YDHA 2YBEA 4FX5A 4X1KA 2ATVA 2YWRA 4LOIA 4V24A 1TOAA 2CL0X 4JZKA 4UFNA 1M2OA 2Y76A 4D9MA 5C7LO 4IIXA 3TLYA 5JV5A 1YR6A 3LCMA 2WZBA 4I50B 4GQBA 3I6YA 1GNSA 4Q7LA 3W3ZB 4PYLA 2J3DA 3DO8A 5J4HA 4LNUA 4PSDA 3F4KA 2RH9B 3DULA 3FIUA 1RWXA 4HT3B 5EJGA 3ITEA 3RARA 3VZPA 1KYIA 2GBPA 3OTHA 1OLUB 2YVKA 2ASEA 3N87A 5JMWA 3THXB 3R3YA 1HEIA 1B6RA 1ZZEA 2DYKA 4CE6A 3ZZ1A 1OXXK 3GBVA 3HPQA 4KUHA 1QCZA 3LA8A 4DGSA 3V7UA 2DJIA 1T91A 2IYLD 4JGGA 2VC2B 3UA4A 1D7AA 3OOHA 1YJ5A 1WEKA 4I6GA 3OFSA 5KX5F 4ENTA 1E66A 4FK8A 1NA5A 4U8HA 3RH0A 3SFVA 4D0RA 1YFLA 4LWOA 3P2MA 4PW0A 5DTJA 1QV9A 2G9NA 2PWBA 1E2DA 4DT1B 1XYVA 3V1NA 2GBIA 2MOKA 2XODA 3E35A 3HK2A 5BYAA 2UYGA 1XU9A 3OWXA 6LDHA 4RPCA 1F7VA 2VUHB 2PDAA 5F2EA 3C14C 1Y89A 4RH3A 5AW2A 4AY6A 2LW7A 3LT2A 3MOSA 3GRKA 3M5CA 1G21E 2OSBA 3I30X 1V4VA 1Q50A 3C45A 4Q93A 3SHQA 3BX1A 3VSAA 1O87A 1MEJA 3AZPA 3L8DA 4QGGA 3MUFA 1U2TA 5JVDB 1GQSA 5LC1A 2YYAA 1N2EA 4FOSA 1OZAA 5I8ZA 1PSZA 3DEIA 2B1GA 1JU3A 1HQDA 1DKLA 2WOJA 4I9UA 2W43A 5JD3A 4D4MA 1MQSA 3GDWA 2V6JA 5KSOA 3NANA 3DL0A 4W7IA 4GC9A 3TQCA 4RQTA 5TQ2B 4B3CA 2FSFA 2W22A 5EKUA 4E2FA 4PWYA 3ZCSA 1FK8A 3KT3A 3L4KA 2F6RA 1HORA 1ZD5A 5MDHA 4LZNA 1O6BA 2QUBA 1ETUA 5HS6A 4DAOA 1ZIDA 4DQUA 2UUPA 4JROA 5DMHA 2ZRGA 5IPFA 3JQRA 4FMPA 4CIWA 1PFQA 2WMOB 1YU9A 1BCSA 3Q4GA 3V1LA 2V6FA 2HXSA 5L45A 2EERA 4Z4CA 1IZ9A 3GOQA 5A71A 3GJSA 3UKOA 2QVXX 4EO4A 3FF1A 4EKEA 4YXFA 3T9AA 2QDKA 1E4EB 2F8TA 4PSAA 5TPZA 1GYQA 5GJVC 1JJBA 3ST7A 4BKMA 1U0HC 5LYJB 3D0KA 2JIZD 3IV7A 4JK3A 1V3VA 1MU0A 3NBMA 3VR3D 3ISVA 4HAOA 2FUKA 2QMZA 3QQ5A 4IG9A 4QYIB 3DLPX 1U28A 2H5JA 2QW0X 3H65A 4P3XA 2GN0A 4P4TA 4EHJA 1ZAYA 4JCOA 1T5TA 3UGTA 4EGFA 2YWEA 4PAOA 1L5LA 1PR3A 3AZOA 4KN8A 4UU7A 1E64A 2FWJA 1QV6A 4YP5A 4YPVA 2O50A 1UZMA 1ZNQO 1RKXA 3PFKA 4GPZA 1M1YE 2ZDGA 4IXNA 2YY5A 4LZJA 1GDHA 3COZA 3JASA 5DM1A 4DPKA 3QVTA 1ETHA 1H22A 4AP5A 3BZBA 3SP1A 1ABEA 2GPAA 3Q8WA 2DLDA 3EXG1 4IHJB 1I33A 4J1TC 3LHKA 5KOJB 4Z4IA 1NXSA 4BO2A 1KEUA 4E11A 4DR7B 1LK7A 1QIHA 4M9RA 4BX0A 2GDZA 1NDUA 3ONEA 5C46F 3GJYA 2IX9A 3PRJA 1BJKA 1XKLA 2XYVA 3OQHA 3KAKA 1VP9A 4OQYA 5EFZA 1GY8A 4RAOA 1FXWF 4XUDA 3SDBA 3ZKWA 4M0PA 4RSGA 1WU8A 4R7GA 4JBHA 1ZJWA 3G68A 3VC3A 3MK31 1G9SA 2ORYA 2Z6VA 4MW5A 2BKXA 3RYIB 4L8VA 1ZXXA 2H92A 4AJIA 3P2IA 3OOYA 1QANA 2BY4A 4MUMA 4TXLA 4ZHQA 1XCPA 3KUCA 3WKAA 3MUNA 1EUQA 3TW8B 3UAGA 2IOQA 4MV5A 3GCZA 4AB1A 1H93A 5EIBC 4JBLA 3KPYA 4TTRA 4X63A 4YX9A 2VDKB 3GLHE 4AWXA 3LBNA 3OTGA 1JLLB 3AI2A 3IS3A 1FFHA 4RGYA 2BMAA 1ZEMA 4YONB 1EWTA 5DNAA 3IXMA 2GPWA 3WWOA 2WPNA 4FQ7A 4IVQA 4TMKA 5D5QA 2A9QA 1HFKA 3KXKA 3RS4A 1WCV1 1SGWA 3GAMA 4ZOBA 1Y34E 3UK6A 3AL0C 1E2UA 2HA6A 4CKEB 3WQSB 3R20A 3L7KA 4GM0A 2GPNA 5HCUA 1AKQA 4RCVA 4IZOA 2R1VA 4DS3A 2LZ0A 4P4NA 2Q5CA 2JRLA 1T1IA 2QU7A 3D6VA 3P0IA 3JASB 4MUGA 4XVQA 3PT5A 1IZ8A 1FDOA 3E03A 4NIMA 5CYOA 3IERA 4G1VA 1XPOA 2ZB3A 3NB0A 3TLKA 4R2IA 5F9FA 2ZDHA 4REMA 2AYYA 4UHJA 2QL6A 4EF6A 3I2JA 4N7RA 3RB8A 2XNHA 3TZKA 1DJOA 1TQDA 3P2OA 5FBQB 3L1IA 4JHLA 3S0JA 1G3MA 1YNOA 1XPJA 4FDLA 1U7OA 1UPFA 3O75A 2FF7A 1RAHA 3FD8A 4FU0A 4HF7A 3BCRA 4GICA 4XA8A 1OYVA 1L7XA 1SWWA 5F7JA 1TZMA 1C0PA 1QZZA 2B8WA 3WGVA 5IWAB 2VNIA 3S7ZA 2GNOA 3ER8A 3WNQA 2H0AA 2KHZA 1HDGO 1G7SA 3RTEA 4DMKA 1L8XA 2OWEA 4YBRA 2NUTB 3B6JA 1YDEA 4R7ZA 4YAEA 1RZVA 1FVOA 3P9IA 3W34A 3CUVA 4BCDA 3GJ7A 1T4DA 2PSFA 2BUBA 4C4TA 3EFBA 1QIKA 4MH0R 1W36C 4IAOA 4GP6A 5LMZA 3H1TA 1EBFA 2PSJA 1PHRA 2BZ1A 1I2BA 2N47A 2O3RA 3KYBA 2Q8NA 3D8SA 4R54A 7GPBA 3LG2A 4Q9LA 4Z3KA 2WTAA 3U16A 3T5BA 3P9XA 4GAEA 3H1AA 4Q03A 3ZY6A 3WYNA 5BQPA 4PQGA 5FPTA 1J00A 1K86A 2C59A 1PO7A 5KDDA 4TWIA 3KZXA 5DNVA 4CKZA 1QLHA 2J3IA 2IEIA 1C80A 2IYTA 1NIPA 2PTHA 4HDMB 3LKVA 1SCJA 3L4BA 4EFMA 1G5PA 4F46A 5GMOA 3E5RA 4P5DA 5H0IA 5E3JA 2D2IA 4AIRA 3SXPA 5A5EA 4KODA 3TBFA 4N54A 3T5AA 3WGLA 1E0DA 1Z6XA 2NMVA 3OJFA 5IJAA 2ZE8A 2G40A 3R41A 4G5HA 4H15A 4YAFA 2HSGA 5TF0A 3W9YA 4NNPA 2WK1A 4UDYX 3H1FA 5JS1A 4J76A 4G5GA 1VHLA 1P7ZA 1EFCA 3LHDA 3A04A 4JEHA 4BQSA 1A9QA 2FJUA 4HY3A 1GFWA 4E1AA 4FEYA 5GONF 3HKBB 4MQFA 5F21A 2OAEA 1NXPA 2QW1A 3R5FA 4TLLB 2B2XA 3T0IA 3I9FA 2XGOA 3BILA 5JNSA 5HMLA 5AJZA 1E1NA 4YJFB 4JVNA 3G3EA 4K5QA 3NFYA 4KSYA 3HXQA 3CXRA 3AVYA 2IZ5A 4IVRA 1ATZA 1ECCA 3N76A 3GAFA 1VLHA 4RHYA 5KKCA 2QUIA 1CR1A 3N39C 3UB4A 4YMWA 2EP7A 1XAHA 2CBZA 1Y4ZA 4K3VA 4PZLA 1U2GC 5DHRA 1FQOA 1L3BA 2AOVA 2ORWA 1B26A 4MRMA 5E4TA 1BU8A 4FYWA 1Z4KA 4X3OA 5DULA 3L7YA 5K6TA 3MQ2A 4XLLA 2ZJ3A 3GNSA 3WBBA 4E12A 1KC1A 1PZFA 1EFRA 1DEAA 1RNLA 1KO5A 1ZI6A 2VLIA 3I5MA 4JJ4A 2JG3A 1PR4A 5HOEA 2QMOA 2G0NA 1B0PA 1MX3A 4FE3A 4A1OA 2XUDA 1E3IA 2A4KA 1LVHA 2OXIA 5AXCA 1JLRA 5ICGA 4CLRA 5DEOA 1AK9A 5ALPA 1NOIA 3H18A 3IEXA 2ZATA 1RMYA 5F78A 2IYRA 4LTMA 1I0IA 1X74A 1XTRA 3T5DA 3FOZA 1JFSA 1Z9BA 2BLLA 4U2KA 2C4VA 2GD2A 4MKRA 2EZ4A 1HRKA 4LOLA 4W5QA 4FKBA 4PNHA 4QC2A 3FLBA 3QNUA 2HGSA 1E8MA 1X9GA 4OQPA 4INPA 3AC0A 1MDBA 3GNLA 4K2AA 3N3BC 4TKUB 2IOYA 3OLXA 4PSCA 2WJVA 3NCHA 1ZKMA 3UMSA 2XWQA 4I8DA 2BMWA 4QQRA 3VHXB 1VIAA 2DQSA 4AJEA 4BE7B 3AUJB 4TWAA 3E23A 4K3UA 3OQMA 1MZVA 1R88A 4LTDA 4XWWA 1AUPA 2CHUA 2B8TA 2I1QA 5AJYA 5HFJA 2FEXA 3KFVA 1Y82A 4B31A 3AT1A 2VUUA 1TTHA 5BVHB 1XJWA 4KXUA 4TLBA 1QVZA 2R4UA 4KN9S 4OBWA 1ZK3A 3JQ6A 2WUGA 1WDTA 3CW2A 2VS1A 4ALKA 3F49S 1GARA 1E62A 3GZ4A 4Q1AA 3X0DA 1TMOA 4P7GA 4D3XA 4LISA 3I05A 3HN7A 4UE6A 5KTOA 1KOLA 4MQEA 4E5DA 5IZCA 1CLEA 4J3FA 1SOMA 1JLHA 4FOPA 1VHWA 1VPDA 3HY3A 2BCJQ 1N1MA 5FPSA 2HO5A 3D8RA 4FSHA 4M2LA 3HWX1 1CS4C 4FILA 4NMLA 4FJ1A 4AIIA 2JLRA 4RL4A 3QUTA 5SZJA 3W6OA 4HPWA 2QSUA 2L69A 3ZGNA 4RDHA 3WJ2A 1L7QA 2VAVA 2SBTA 4FCCA 3NNDA 5AK4A 4BLTA 1KEWA 4KLCA 3ZGXA 3AOGA 1NJ8A 3B6IA 1JU9A 2RSLA 3A6PC 1EUCB 3DXXA 2IA5A 3VR1A 3QEJA 1P4SA 1UPBA 4RF4A 4PU0A 4RTJA 5IT0A 1WUYA 4FLEA 4EYEA 4KN6A 4F84A 5E1OA 3WRYA 2BFFA 2RCYA 1XNQB 3U3MA 2GSDA 3I4FA 4BU1A 1RADA 2CJWA 3AUSA 3L7NA 3CXUA 4LG1A 4QPCA 4MS1A 1BX0A 1FLVA 4NZPA 3BQ9A 2C2WA 1NQAO 4URHA 2O2CA 1D5WA 4HQ0A 3VYVA 4PBTA 3UXMA 1NTOA 3FSEA 3K35A 2JFFA 2P8SA 2Y4NA 5KHAA 2ZETA 5IK2D 1I5EA 4JEUA 3KD2A 1SBTA 2FEPA 2FB9A 4FHCA 4GRDA 3VR3A 4LNAA 3VKFA 3ZV7A 1DIBA 1E69A 2GBGA 4LOJA 3GWZA 3BXZA 2AEEA 3ND6A 2IPNA 4PRZA 3SOPA 5KWIA 4TYMA 3F97A 4HJXA 4BP9A 3EVBA 2RGEA 2IU3A 1REQA 1VA4A 1I1OA 4II2A 3GPBA 3VZBA 3OSUA 2EW2A 4XX0A 1D03A 1TVMA 3SLGA 2DETA 2QLNA 3SI7A 3T7EA 2RHBA 4UATA 2Y1GA 5JZMA 3UAZA 1FB5A 3IBSA 2KQUA 3PNLA 3GG2A 2WIKA 2PR2A 3LVRE 2C07A 3A4LA 4RD3A 3GLGE 2CVZA 2TS1A 3DBIA 3LP5A 1R8QA 2Q28A 2YNMC 4QJ3A 2Q6VA 1NHGA 4EIWA 2PBLA 5CLGA 4OHPA 5HWSA 3LT5A 1GR0A 2Q2VA 4KH1A 2XGJA 3QWAA 1W88A 5AM5A 2Z58A 4WXHA 3OZEA 2WMDA 5HA5A 1AMNA 5CT6A 4YP9A 4KR9A 2PZFA 3Q3JB 2QMUA 3TPFA 1S6YA 1XTUA 2PAFA 4KQGA 4AMVA 3PHJA 1UBFA 5TEWA 3L4JA 1TCBA 1DRWA 1W2HA 4FHDA 1H8HA 3DFKA 1D09A 1QVAA 3IUQA 3LOUA 1YZVA 2QI9F 3LU1A 4UZFA 5IASA 4GD3Q 4AKTA 4F85A 4X1OA 4FDAA 3AOEC 4KMOA 3JARB 4MZXA 1Z29A 1XALA 1KK0A 3FHLA 1NMSA 3PHBE 4MLPA 4ZQIA 1E9FA 4GX1A 4MIOA 2WM8A 1KORA 4D4HA 2O8BA 3U49A 2RKWA 5JPDA 1F4PA 4CEHB 1UL1X 3K5IA 5G53C 1L4EA 3O8DA 4ER0A 5LMNB 2PA3A 2IYXA 1RP7A 2VK4A 3UA3A 1T4BA 1VG9B 2Q9UA 2Q5JA 3P45A 4QRDA 4BRUA 4HQNA 5FBLB 2VXBA 1QH1B 2BKVA 4GEKA 1YQ9A 2XWBF 3ME5A 1U3FA 2AW3A 3EGWA 2HHAA 3FMVA 3ZJTA 3EFHA 4ZIRA 4N82A 1OD6A 1IJFA 3HBNA 5GAJA 3ED5A 3W2TA 4LVOA 1TO1E 2OBFA 1Q11A 1NOJA 3O38A 4L0CA 3TSYA 4JUBA 3RSSA 4F86A 2ZUVA 1PGOA 2NU7A 4D9GA 3MWFA 4MA4A 1GPMA 1IHPA 1SUCA 4HEJA 4KIWA 1NBOA 1M76A 2DR2A 3JQ9C 1LBTA 1U0JA 3M34A 4JJ6A 4DNXA 1Y3HA 2F62A 3QLVC 3FCYA 3M1AA 4G0WA 7REQB 3ICEA 4KCGA 4DQ0A 2HBZA 3WDMA 2C57A 1MT0A 4MI6A 4DC9A 2W48A 3UM9A 4CEIA 1F5NA 3H5IA 2B1IA 4EFKA 3QKSA 4V0LA 2V6GA 2VAPA 5DIFA 2HSWA 5CIYA 3AW9A 1T0JB 1MKYA 3I53A 3FAZA 5CVVA 1FJ2A 4X44A 2LUOA 4EY5A 4CIYA 3HR7A 1RPZA 4U4AA 4DV2B 4GLJA 2GAAA 4II7A 2P5TB 4DV3B 3TTWA 4KQXA 4UTRA 2GK3A 1A1SA 3OI7A 4GYKA 3GAAA 4IIDA 3W2EA 4GGPA 1NX9A 1P33A 4LHVA 4FYKA 1MJNA 4MR8A 4Y2YA 3LA6A 3KOOA 5C8YB 3C97A 4R8MA 1ILEA 3ABZA 4NWIA 4WDRA 4RDIA 1T2DA 1K7EB 3MYRA 1LQ2A 1ZCZA 4JI1B 3SDZA 4TTJA 4QM7A 3TTXA 5AJTA 2VRCD 3TL3A 1F2UB 3AVVA 4K9KA 2CT8A 4O25A 4Q7QA 4GOMD 4ACAA 1Z6PA 3HP1A 5BR4A 3NHWA 1JQ3A 5CDTA 1PU2A 2GMWA 2LKDA 2V7TA 4UC0A 4EEZA 2R5NA 3CJRA 2O7NA 4QPDA 3U4AA 3LCVB 2HT1A 4E4RA 1EZZA 3MRXA 3RKUA 3AVWA 3S44A 2L2QA 3IKTA 5IC5A 1NAIA 5BSFA 3W5UA 4MITA 3RLFA 4J49A 5TGZA 1E96A 1QLJA 4XSHA 5EUBA 4ND8A 2OV1A 2GZAA 3FBGA 2QQ5A 3KCQA 4RZUA 2EFGA 4NFLA 4J8PA 1PUIA 2QX8A 2XB8A 1IIBA 2XCIA 4BYMA 6REQA 5T4BA 3GRZA 1FS4A 1P2VA 1UPCA 4X60A 3ILVA 3FKSD 1MQ8B 3NHSA 3H05A 3MHTA 3K4PA 3JQBC 4H6PA 4O59O 1QH9A 1NMYA 1QK4A 2QTFA 1Y3BE 4YQYA 5DU2A 4HDCA 5A3SA 4L6IA 2I4NA 2Z08A 4JDUA 3W90A 4QBIA 2FQYA 5JTUA 5IYZA 5F7OA 4M54A 5PGMA 1IQUA 4JIGA 4OUDB 3IAS6 4C6TA 1WCIB 3L6OO 2CVHA 3HY4A 3TNJA 4TZTA 3OM1A 2WJIA 2LR0A 2IQ5A 3VR4A 2A0WA 5AW6A 3U81A 3WX0A 4Z4GA 3L04A 4TSKA 1G6OA 4NDAA 4OMCA 1NWCA 4AXXA 1ISRA 1NZJA 1ULBA 2ZVQX 1GQRA 4MZDA 4AZ3A 2C77A 2NVUA 2XNKA 5EJ5A 2Y1OA 3NAQA 5IDQA 3H1PA 1KF0A 1T26A 2I62A 1MPTA 1RHRA 3GH3A 2L0XA 1KK3A 1NI5A 3NUQA 4DF3A 3LHIA 1ULHA 3L77A 4OK3A 1N9GA 2RIPA 3VZQA 3DF7A 4YCCA 1UXIA 3FRJA 1GQFA 3B2QA 1X7YB 3TFWA 5F23A 4X3PA 3CF2A 1DEKA 1CY1A 4L6CA 3TFOA 1B7GO 1EYZA 5IAJA 5P21A 3EQ8A 1XCOA 1FP4A 3IPXA 4IUCS 4NJMB 3I1JA 1AVTA 4IDEA 5ALYA 2WJAA 4Y8VA 4B3GA 4NEGA 4RSMA 3N8DA 4F9EA 1BDJA 4LYJA 1PNVA 4JJAA 1BW9B 1NVFA 4KHZA 2V7BA 2BLNA 2IHUA 3OHMA 1KJ9A 4ZICA 3ZJ4A 1NFQA 3K9CA 4EW1A 2ID8A 2JAWA 5GOTA 3Q40A 4HUTA 5BUQA 4NCAA 1CUEA 3HN6A 4Y1RB 5A0TA 1IBKB 2ATCA 4YIKA 4Z9AA 3MCZA 3LX6A 1ONBA 1Q7CA 5BT9A 1QQBA 4UU0A 1RXWA 1IM2A 2H11A 3GX1A 4TTSA 3IMCA 3CUSA 2RC6A 3UYLA 4BTEA 5JANA 2SICE 4A8HA 1TIBA 3TJZA 4OPMA 3H9GA 3QKTA 4TMYA 1C2TA 4IHJA 2QQFA 1E77A 3HKDA 3QI7A 4CPDA 3H2KA 2C29D 1YKFA 4ILEA 3R7BA 1Y5NA 3WGMA 1JW9B 4WCFB 2W2MA 4UMFA 3QOXA 2C7PA 1TA0A 3IJ5A 1E6MA 1J7KA 2I7XA 3DQZA 3FWYA 5CNJA 2Y67A 4M0FA 1JG3A 1CBUA 4ZKEA 5B4UA 2XADA 3C98A 2IW3A 5DM0A 5J40A 7ABPA 1MX1A 4FGZA 5HKAA 4G56A 3WV5A 1NJ1A 3JSXA 4KR6A 1I3OA 3MQ4A 4OMDA 3WFJA 1L4LA 1ZN2A 3HCBA 1XEAA 3Q7TA 4RULA 2JCBA 2CNDA 4QYIA 4B3JA 3RD5A 3IAUA 4X7MA 1PV4A 3CW9A 3QRWA 3RFTA 4DJTA 2HXGA 4QPNA 2C94A 5GVRA 4UVHA 1MQAA 1BCSB 4QBFA 5KTTA 4GQAA 2UXCB 2QP3A 2RGUA 3HB0A 4RKEA 2OY0A 3EPHA 5SY6A 3EG9B 2B5WA 3JQ8A 3M2PA 4DZZA 1P17A 3HJBA 3GUUA 3I5UA 4BN4A 4JHXA 4D43A 3DVSX 5COBA 3OIDA 5LIRA 2E21A 1T34A 3N6VA 3CR8A 2Z04A 5CRIA 2QAJA 3ZWDA 3LRPA 3KKQA 2F3QA 1LPPA 1RAFA 2PYDA 4EA8A 6REQB 4QUDA 2XEXA 4MUBA 5BW5A 2E3JA 1GUBA 2G0TA 1M6VA 1ECLA 2J3KA 3FCXA 3HBFA 4LRXA 3ISTA 4G97A 4J0DA 1EJ6A 3SU8A 1NW6A 1X7WB 4V2UA 1LLFA 1B8UA 1N2SA 3PUWA 4ERXA 1A9PA 3DR5A 5WRFA 3G9QA 5AJXA 2PHZA 1EMDA 2C20A 4EF4A 1A2QA 2VJKA 3LC1O 1MNQA 4XSGA 5GJWC 5H59A 2WPDA 4CG3A 3HUTA 3C4QA 5CW2A 2NSHA 3TZLA 2ZRBA 1Y4UA 3VI4B 4U3JA 1VYHA 1DV2A 2BGIA 1QH8A 4WWHA 4YGYA 1N4AA 2QLJA 3GGJA 4FB5A 1XA4A 1QBKC 1PQWA 2WSBA 3U5TA 3KDAA 4KRFA 3FPGA 2VHXA 2WNHA 1BXGA 3GLRA 1FYWA 1RABA 4KXMA 4ZHQB 1X80A 1GADO 2JBAB 1E79A 1UADA 4IIFA 5DO9A 4Q3EA 5A9RA 1VFNA 1U8YA 2DJ5A 4XWYA 4CEJB 4W1RA 1SAYA 3DDNA 3ML1A 3PP8A 1T0HB 1UFQA 1V1JA 2PKYX 1VMIA 2CZCA 1JTVA 1PJCA 2CDCA 2VKQA 4TOIA 2GCOA 1R6UA 3T0GA 2HCBA 3PQ2A 4Y0NA 2YJ5A 2JLXA 5EVJA 4D02A 1AM4D 1PK7A 3N05A 1N0WA 3RK1A 1Q3HA 1RM4A 2V55B 4P3PA 1V5IA 3FYUA 4K7JA 4XX1A 3ESCA 3UMFA 4TWJA 4KITB 5L3VA 1JAXA 1NVMB 2D7CA 2EJBA 2XDQA 1J8VA 1CNMA 3MGGA 3IO3A 5DZSA 1WXWA 2YVQA 2QPOA 3P9NA 3BBLA 3AR5A 5EA2A 4M88A 1HDYA 1TMKA 4IF6A 4RCYA 1E0SA 1KDZA 3TRIA 2X13A 3TKLA 2RI1A 4BHTA 4D42A 1XCJA 5BR7A 2A9OA 3GCXA 5CG2A 1YIOA 2QRVA 2R85A 4P82A 4KIJA 5H5JA 1ZJ6A 2QM0A 4PFQA 4YHHB 3IAHA 5HVNA 1EE2A 1MAAA 3PCTA 1UBMS 1Z83A 2XTJA 4Q15A 4R1OA 4XD7A 5THXA 3SY8A 4PG8A 1Y9DA 3WMXA 3S1SA 4RKYA 1RWNA 1BDIA 5M5BA 4LC9A 1T9KA 4V02A 1GN9A 2G9RA 4URYR 1VKHA 2XCLA 4BMCA 4ZVMA 1DU4A 4TMFA 4C88A 3QV2A 5BV7A 5C9ZA 4EJ0A 3A36A 3VAYA 1M8PA 1FZTA 2FUEA 2Q41A 3ANLA 4HADA 4TZ6A 5F51A 3I45A 1W59A 3N2LA 4FI3F 2GRAA 1ST2A 3U1VA 4QUKA 3V6MA 3B6MA 2X1VA 1QC5A 4X6UA 2G4CA 3L7JA 4R7TA 3QW4B 1QDLB 4AP6A 2VEDA 2Y1WA 3ZXIA 4ZT3A 3IJPA 4CKBB 1KRXA 1J1ZA 1Z8NA 3GFPA 4QDKA 1N5LA 2ID4A 4A91A 1VECA 1ZK0A 4PN3A 2WLTA 4A4DA 5LP6B 3PBKA 3WMRA 3EE6A 2IPAB 3DE5X 1G5QA 3C43A 2ZW9A 4OB6A 4S1PA 3ND9A 2ADFA 1OBVA 2B69A 4LN1A 2QS9A 2Y0CA 3UYKA 3AR8A 2FR1A 1S2NA 4J7UA 3BA6A 1UXJA 4OK5A 5DN6A 5EZ6B 4NNOA 5ITVA 2ZOSA 2MSEB 4HNAA 3A4NA 3PPIA 4DIEA 2XE4A 1S3GA 1KVUA 4AWAA 1E5TA 3MTEA 3BJRA 5CW1A 4C0HA 2J5QA 1EESA 5GZ1A 2FPKA 2X8WA 4GKKB 2GYYA 3BK7A 2Y3IA 1YU6A 4WVFA 3VSEA 1Q7EA 1ZG3A 2OD9A 3LSYA 1EE1A 3U7RA 5CT5A 5TE9A 5KO2A 3O8CA 1PL0A 1WF3A 3QEAZ 5SZKB 1TUEA 2R86A 3X43A 2VYQA 1K5HA 3T7DA 4LGMA 4CV3A 4ZJUA 1BMFD 1G8HA 2QJWA 4NPHA 1Z33A 4B32A 2NZYA 5AVJA 4F9TA 4F5DA 1T8TA 2AMVA 4R51A 4DRZA 3ESBA 2X23A 5AP9A 1LKZA 3WV4A 1QYXA 2CVQA 1TAQA 4F04A 1V0JA 2NYRA 3I72A 1C0LA 4M9XA 1HKUA 3TCKA 1V8PA 2Q3FA 1JG4A 2QTAA 4BGIA 1CYEA 3NTXA 1YCFA 1S02A 2CLDX 4GLFA 6Q21A 5KYKA 2XE8A 1CR2A 2Q5EA 3SX0A 4G41A 1NUQA 1NVAA 1RAAA 1JHAA 2ZIXA 3DZJA 3O4JA 4RSRA 4B2LA 5HP4A 2R1TA 4Q39A 3DLBA 5B5SA 1EVIA 3TYXA 4BMSA 4E7PA 2R3SA 4HGYA 4CL0A 3PZBA 3IPYA 3CY6A 2QT0A 1FY2A 4L9WA 3CVJA 1QFYA 1B00A 2Q46A 4RY8A 3UMGA 4F56A 3DGEC 4U8GA 5CXUA 3WMGA 4Z86A 4X93A 3KM0A 4B84A 4CCYA 2F55A 4BL5A 5AFSA 1G6Q1 4K9SA 4INJA 3F8SA 4LSWA 3MG9A 1W19A 3CLRD 2PEYA 1FLNA 4B9EA 3OIFA 3BWEA 4AO7A 3UJ8A 1RE1A 2A5JA 4BAGA 3GYBA 3RWMB 4WBXC 2OFOA 5D8DA 1NQVA 4JLDA 1XZNA 3U7HB 4B2PA 2IDZA 2QR5A 3UTCA 2RC5A 1F6BA 4NJEA 2ZK7A 1WE2A 4XZ3A 2BH9A 2B6HA 3VNUA 2BFEB 5JCPA 3B9BA 1NP6A 2PIAA 1WXQA 5LZ8A 4DCVA 3BL8A 3D6JA 3UT5B 4XH9B 4FQ5A 5ED0A 4BRWA 1RAGA 5KJ6A 1MVLA 4PG5A 3MLEA 5ALRA 2VT3A 3ZGZA 4IFIA 1BZYA 1P2FA 4R2MA 4Q16A 4OQMA 5IVIA 3EQ7A 8AT1A 2OOKA 3PFWO 2QTBA 5B53A 4EY8A 1ZN9A 2W6NA 3GA0A 2VEOA 1OLXB 1ZQ9A 1TZ2A 1KOJA 1NW8A 1XCLA 3B85A 3DEHA 1U9YA 4MIEA 2ZG6A 3WLNA 2DEUA 4FGJA 2QLFA 5D1HA 1H2WA 1UWVA 3FMOB 1ZM2A 4EG5A 2VHYA 4OXXA 1VB5A 3PNQA 4O2BF 4F2WA 1XXHE 3LWZA 4DXHA 3QHQA 2CGEA 4AF6A 2PMDA 3IKVA 1C8BA 5G40A 4C7VA 1QCCA 4JVLA 2ZZMA 4FMDF 1T8RA 3DAHA 1AQYA 4KWIA 1YBVA 1RWPA 2GM3A 1IMJA 3IFSA 1VM6A 4BFWA 3C8ZA 1EQUA 3LD9A 2PFKA 1FYFA 2FFQA 1L4GA 4U7TB 4NDZA 2NT3A 2YN0A 4TXJA 3SOZA 3TIVA 2RJ3A 1NZDA 3EZ2A 3OT4A 4WLOA 1PYGA 4LRUA 3EGIA 4QOHA 5CFMA 3CVUA 5C3UA 4LZOA 1X7XA 3F90A 3B1XA 1JLMA 1CSEE 4RUKA 4B7ZA 4TV9B 4J6FA 2VJOA 3L5OA 1P1CA 4A0FA 2IYYA 1ECPA 3FWKA 2LXNA 5K0ZA 4YT2A 1XG5A 4F3TA 1KY3A 2H1IA 4MWBA 5EIOA 4Z4FA 3IDSA 1ZA2A 3TDKA 3Q2IA 1Z25A 3F2IA 4YCMA 1A69A 4DV4B 4FGWA 4UD2A 2HHCA 2UYOA 3BF8A 3SKVA 2IEYA 4D9EA 2YZ7A 1MB4A 3KQLA 1NHWA 1QCYA 3LT4A 2QI9C 2VQ3A 3C3MA 3T9EA 3IV6A 4IMJB 4BJHB 5CDYA 1CY7A 3IIEA 4GI1A 2H57A 4I4IA 3GVIA 4MLZA 1CHDA 5DFAA 4CMIA 1V39A 2IXBA 2Y27A 3EMVA 3ZHUA 2N75A 3BXXA 1UK7A 4FN5A 4I55F 1GV1A 4EMBA 4WY2A 5LVAA 1KYXA 1TA4A 2BFPA 2B1JA 3BXGA 5ABPA 3HO1A 1Z4LA 4WY5A 1P2TA 2DE0X 3BM5A 1K0UA 1DS6A 2NO5A 3BTVA 4R69A 2F9FA 2WJYA 1Q6YA 4PLPA 1JQJC 4AI6A 2WYOA 4H6XA 3TRHA 3WSTA 3CWZA 5C52B 2ZWPA 2QV0A 3IPCA 4JVSB 5CB6A 2WE7A 3I6IA 3DMRA 4X8MA 2IGBA 3UBTA 3CVVA 3R76A 2WY2D 5CLLA 3K6SA 3RASA 2E0IA 3RAEC 2QN2A 4RY2A 3VDXA 4G0ZA 1X1EA 3TTUA 4AYWA 3PXCX 1MJGM 1Z5ZA 1V25A 4E09A 1CJBA 5CB4F 2B4KA 3OIVA 5KYWB 2G08A 2XMPA 1QKJA 1PJ2A 1R6BX 3DEAA 2BKLA 3LI2A 1ZYUA 2BEJA 2WB4A 3TLGA 3DHVA 3CE9A 3C8MA 1JG2A 1MJHA 4WERA 3FPEA 3O0DA 1QO0D 1LI4A 2PLFA 1C0EA 3H6GA 4HFMA 4HQKA 3KJNA 3HPRA 2XWPA 3I83A 1MDFA 4UHEA 5EJ9A 1Y98A 3NTOA 3DMHA 4IRXA 2FPSA 3A9WA 5JI3E 2WJZB 4MDYA 4JGBA 4UCFA 3TQQA 2EDAA 2X0IA 4RVSA 3PWZA 1YUMA 2FW0A 3KYJB 5E7QA 1Z4IA 1SC1A 4RJLA 3GK3A 4BN0A 4OATA 1TZCA 4ZHQF 1I13A 2XYHA 5K7SA 4HYEA 5FL3A 3MGCA 4JOBA 4ZAVA 2PU7A 4OCZA 2FUG6 2D5IA 2XUFA 1MVOA 1ONSA 1V48A 3AU8A 3KJEA 3PUYA 1XZJA 1XZMA 4QRHA 5BUSA 2BEVB 3USCS 4UMEA 1A97A 3VKHA 1VE3A 3DG9A 3QLEA 4OAPA 3G0OA 4BEBA 1U6JA 2EFHB 3BSYA 3TUZC 4Q7KA 2XUHA 4LYFA 2EX4A 3I9NA 4XIJA 2ZSFA 5HHTA 2IY9A 3O21A 3IBGA 5D85A 2BKUA 5BV0A 2WWYA 1G0NA 4QFDA 4NU0A 3WB2A 3B78A 4G0OA 2CZGA 5K3EA 3WYFA 5KQPA 4CM8B 5FLYA 3IXQA 4HNQA 2R4TA 2W2TA 4YVFA 4C1BA 3N1UA 2ZROA 3B8EA 1Z2OX 2WJ6A 2FSHA 2Z2IA 2YZ2A 3I64A 2NG1A 4KO2S 1XE3A 3QUQA 2HNKA 1SVKA 4OXNA 1XMVA 4FN4A 5FUXA 3HMQA 5KPDA 4RVNA 2BPOA 4DUGD 5J9FA 5JO9A 3DMTA 5JVDF 3H7AA 4FFVA 4L0MA 3AK4A 5JQGB 4GMKA 4JSYA 5B4TA 1DEXA 4R6WA 3PTAA 1P2BA 2P91A 1BWQA 4LDQA 4O1IA 5I3ZA 3KYDB 2ZPUA 4TTIA 2IOFA 4BV3A 3V00A 1DKRA 1L7MA 5FNVF 4H6VA 4G65A 4MYUA 1LSUA 5C31A 4YRMA 3RQSA 1F60A 3ESQA 1RTTA 3VR2D 3QTLA 1D2GA 4IXMA 4WXPA 3S2ZA 5CLIA 1D04A 4DJEC 5BWMA 1M6EX 4TV9F 1DZ3A 4FXPA 2FSPA 2JC3A 3VVLA 1FJXA 4JLMA 5CVJA 3SJAA 5KDOA 1GDDA 1II0A 3BN3A 4JP2A 5E6UA 3UOWA 1R50A 4GU5A 1AXGA 1OQAA 1TW2A 3KPWA 3QKSB 5TVKA 5ITWA 4DR1B 1B8VA 3KZNA 4X54A 3RIHA 3UJBA 4BZZA 3T4UA 4O5OA 3NO4A 3LW7A 4D80A 4X3CA 2QR2A 2XDYA 3GRPA 4KYVA 1NRJB 1ULTA 4NG4A 4Y9UA 1SG0A 4N5MA 4RZ2A 4B6PA 1UDRA 1ZGAA 1WMFA 3OPNA 1FUYB 3RSOA 1TTPB 2W2LD 3TNLA 1SXQA 1U4OA 4Y9RA 3ANTA 3RTAA 4UAJA 1TUBA 4RPHA 1TF7A 5K3FA 3ICWA 5ELLA 3L0IB 5IC6A 2JL1A 4F97A 4LE2A 5I4KA 1OA1A 4ETMA 1RYFA 3HS3A 4P5EA 4B4DA 1SFRA 2A3NA 1XZ8A 3IBCA 2A88A 4PG4A 4WFQA 3EMBA 4WIAA 4RH1A 3E0XA 4WA8A 2X4LA 1J7JA 3K9WA 1Y0BA 3FI0A 2FW7A 3IDAA 1VHDA 3U7EB 5IULC 2EW1A 4PLTA 2FZGA 2CXNA 2LV8A 2SKDA 2NUTA 4MV0A 3QX8A 1NVBA 3OY7A 2ANCA 4QOGA 5AI9A 4C20A 4ETIA 4U2FA 1LW7A 3IR6A 4U7JA 4H4EA 3SNKA 3GFGA 2F3RA 5JDCC 4BE4A 3PLAE 1GPJA 1P72A 3LUHA 4JBIA 3K0BA 4R98A 3VDMA 3D7NA 4M1SA 2XA9A 2R68A 4KO3S 3OE7D 4AP9A 5KHLB 2GZ1A 2P9EA 3C39A 3VU1A 3K72B 3E15A 4Y2VA 3T3MB 1G20B 1EK2A 3OO0A 3Q6MA 2RI0A 5LU8A 3JYLA 4YJ2A 4MICA 1JHRA 4CF4A 1E6LA 5L4LA 1GU1A 1E7WA 1CUWA 3ORQA 2P9QA 4RENA 3RYFB 3NPMA 5I9NA 4PLWA 4Y3UA 2M2IA 3D02A 4H2DA 3K0CA 3UQZA 1ULZA 4GMFA 3VVBA 1S7GA 2ACEA 3T61A 2O05A 2JCXA 4MVJA 4PRKA 4YCJA 1E5LA 3QUAA 2HEIA 5HIKA 5AK3A 2W6OA 1WMSA 5BO5A 2E82A 4UNSA 2AVNA 1KI9A 1DDGA 3SQLA 3X1MA 1N8TA 2E18A 2F43B 1QKIA 3KLPX 1QX4A 1TJPB 1CVIA 2P0YA 3F7MA 3G89A 1TI7A 5DW0A 5CAEB 1E1RD 2P9JA 1MF7A 1WUHS 1Z2NX 2NVOA 3QVJA 2ZB4A 1I3MA 3A2NA 1A9XB 1BGXT 4DDWA 2DVMA 2FZLA 1MFZA 1W8DA 1HE4A 4G9GA 2C4WA 1Z0DA 2IH2A 1IBRA 1KYYA 1QE5A 1V1MB 3DLAA 5JAUA 1AZWA 4YTEA 3EG9A 2QT1A 5ED4A 2X9GA 5I7AA 1G19A 2H6EA 5EZSA 1L0BA 2XCOA 4KPUB 4CQMA 2JHPA 3RUFA 5LYJA 1GKIA 1GQ2A 4YCDA 1NQWA 4OSEA 1FP1D 1ZOSA 5BQXA 1DTSA 2Q1SA 3E18A 1NATA 1ZVJA 2GTHA 1E9RA 3FVQA 4GE0A 3AL2A 4NCBA 1ZKDA 5DHFA 4Z0TA 2IU4A 4NV3A 4YUVA 2FHPA 3UV7A 4H3HB 4EW2A 1GAQA 1B3RA 4QICA 2O48X 4KZKA 2XNDA 4R05A 2Y0PA 1RRCA 2XTZA 2E5FA 4QU8A 3PQ8A 2GB4A 2PUJA 4BU0A 3C5EA 5J2TF 1KO1A 1V8FA 3AY7A 5FB3A 4CDRA 2OO5A 3EDCA 3JVUA 3LWDA 4ME6A 4U00A 5JH7B 3T9CA 1NG9A 1F2DA 1WW3A 3HKDB 2FZ5A 1X1BA 5A3VA 3UICA 5A7GA 5HPYB 2CE7A 3CNBA 4BTLA 2QX6A 2XT9A 5EZ5A 2NU9A 3AM4A 2OG1A 3HKCB 4HAWA 3M3PA 5HG0A 5G0TA 2PZBA 2ZWAA 1U0BB 4B3HA 3V4SA 1Z4QA 4E5NA 2CUNA 3CNOA 3HHPA 1G7RA 4NBNA 3NTQA 1HMPA 1NN1A 5F33A 2CLLB 3LV8A 4YREA 4L6AA 4RNDB 4FCTA 2GCGA 5I5GA 2XWSA 3HY6A 5JFOA 4DEXA 5JCZA 2DBQA 4GOKA 4F71A 4YRZA 5JSUA 1TM1E 1IZZA 4A6DA 1DCFA 4V0QA 3NT4A 5JSYA 1X7ZB 3HU1A 3ZWVA 1A8PA 1AA9A 2B37A 1ZBQA 1GXSB 3VHXA 4EKNB 2JD0A 3WL7A 4LY0A 1Z8FA 1CIVA 1LSJA 3B3GA 3FIJA 3NI2A 4JBNA 3ANXA 3SQOA 5AVRA 1JA1A 3OPYA 4AMBA 2XGMA 4BNVA 2O8FA 1N5JA 2DH5A 4MUNA 3V46A 1R5OA 1T8PA 3AIKA 4R41A 1T9BA 4J0QA 2VOEA 3SD7A 3J7AC 4BB6A 1G20A 1WZIA 1ZIOA 4RABA 3JWGA 1XA0A 4WAUA 3WXMA 4Z9FA 1AGRA 1OASA 4J3NA 3FSJX 3ZDZB 2DC1A 2Q49A 5E38A 4V0OA 3BL5A 4DIFA 2QXUA 2BE9A 4MA5A 1JVNA 5JH7A 1SCAA 3AWIA 3B2NA 4LECA 4UEJA 1Y48E 4OXKA 2EBFX 3R3HA 4ZD6A 4MWOA 1C1YA 3IMFA 1G8MA 1YRAA 1W30A 2E5WA 3H8JA 5FPHA 4XYEA 2IYPA 2AQKA 3ROKA 4ZVNA 5J4KA 1QRAA 1ZL0A 3UMCA 4FPXA 4WPGA 2F00A 4EW3A 4BNFA 2Y0EA 4O02B 1YASA 2DGDA 2QX9A 4WNCA 4LDNA 3EUAA 1I0ZA 1P4JA 2NO1A 4AF8A 2R00C 5DPMA 3TKYA 2V96A 4F5EA 3U4QA 1ZMXA 1BKYA 4YRRA 3PDUA 4BZWA 3Q1KA 1GUAA 1KI1A 2CHFA 4P83A 3U7QA 5LL6P 1ZC4A 1SVNA 2H7VA 4L78A 4RFSA 3ODGA 1FDTA 4ZVRA 2J3QA 2FSIA 2DTEA 1E9SA 5L9AA 5G41A 4IX9A 2WFAA 1QORA 3ROEA 2W83A 5J1TB 4HNVA 2FV8A 4NFSA 3DBOB 2IP4A 1Y8QA 3CJQA 2FZCA 1XZGA 1ZZGA 4DLWA 3ZV4A 1RZUA 4BO0A 1B6SA 4LJ8A 5EXEA 4HXFB 3DBRB 4HMPA 3TSWA 1J0EA 2JIQA 4E6EA 3ROTA 2JIPA 5E6UB 4AQYB 2ACVA 4HDMA 4JP1A 3C6ZA 5F1KA 2NV6A 1QMGA 2AMYA 5IBPA 4OU4A 3SK0A 2GEDA 1PTKA 2E89A 4PBRA 3RHTA 4BYGA 1KDYA 1SCUB 2QZJA 1YBAA 2XUPA 2OTCA 2PV7A 3E9YA 3PE6A 3PQ4A 1XRRA 4HVAA 5HTKA 5KC8A 2UUBB 1LZKA 1RRKA 2CFRA 2X8JB 3JARA 4MKGA 3HKBA 4MQFB 4UBIA 1KDVA 1KK1A 1P45A 2PL3A 2CMKA 4J90A 4RV9A 1GGVA 3UK0A 2BSAA 1A98A 3OECA 4MUIA 1EFKA 4A27A 4LI3X 4MWSA 1VL5A 1F8XA 1LFDB 1Y3AA 2AWOA 4RVGA 5IJ9A 5LP6A 1XEWY 2AB0A 3CURA 3SX4A 4GPAA 3ZGLA 4EG6A 2V1UA 3H1EA 4KOAA 2AG5A 4JI3B 1IHYA 2QG6A 2B20A 1DIAA 5AI6A 2XT6A 3FUUA 3D6UA 4D4GA 5CBPB 1G5TA 1M34A 5KQLA 5G2OA 3VVCA 1RBYA 1QOZA 1FSSA 3H16A 1A9TA 1UPUA 4FCVA 4LCEA 5AOVA 3DONA 2H2IA 1DUSA 5KJ1A 1X8XA 2D2FA 1E3MA 3HMKA 3H9EO 3VNBA 1NLFA 3V48A 4UAGA 3E9CA 4KYUA 2VBGA 2JDIA 1D1SA 2FUG1 5FUBA 1LK0A 3ZE7A 3ZYCA 4BBJA 1SURA 1G18A 3AFIA 3IVRA 4AG3A 4JC0A 1SA0A 4EW6A 4ZEMA 4MEAA 1OXSC 1FF9A 1FMJA 4DQLA 3OUUA 1KXJA 2VWQA 5DNEA 4WBNF 4E7OA 1G2PA 2FRDC 4MRSA 3CLUD 3F98A 4Q02A 1O58A 2B8EA 3WNZA 5C37A 2WQ6A 1ZNYA 4LV5B 1F4LA 2PFGA 1WG8A 2YHAA 4PYJA 4BVFA 1MW9X 4JJ7A 1PDOA 1NBAA 3I04M 3RSLA 4F3NA 3DMDA 4UTPA 4OTZA 1EWRA 2FPLA 3KL4A 2H1OA 3M5PA 5IP5A 5ENVA 2FN9A 1TTQB 2R7AA 2J7KA 2WSLA 2XE7A 2AG8A 2BJHA 3JAWB 3NHUA 5GGXA 2W93A 4PANA 4JJKA 1L7VC 4R5MA 1OKKA 3NHZA 1NLUA 3QVGB 4BBAA 1BXRA 2GJAA 2FLWA 5FV7A 3S2UA 2GD0A 5CFQA 2L18A 3JATB 1ECGA 3K9FC 5FPQA 2R1UA 1YTUA 4YYZA 1GLVA 3EEIA 4QECA 2FLVA 1PVDA 3MCUA 4LDPA 1XPRA 3WGOA 4EVIA 1XDBA 3HGMA 3T7JA 2O14A 2P69A 3OE5A 2PQMA 4HRAA 1J22A 4KYTA 3BRCA 4CMKA 5BR8B 1DOAA 5KVAA 5J63A 3HDGA 3A28A 5FWNA 1F9AA 1Z5OA 5H4GA 2ZSBA 3AEKB 1L5QA 1VKRA 4CKEA 4JV5B 3ZE8A 3TGWA 4N7BA 5CVUA 4KXFB 3VPFA 1XZQA 3C7CB 3LQ4A 3EX7C 1JR3E 1HNWB 5JJCA 3BMXA 2XXJA 3VGPA 1JSZA 4UNRA 3SVLA 4BMVA 1P8AA 4FHFA 4ZODA 3F3SA 4IUDS 3IAAA 2Z98A 3F8TA 1DQZA 1AKTA 3BAZA 4IRUB 2PX5A 2P2DA 1VLJA 2Q50A 4J7AA 4EGCB 5BN4A 2IF0A 1KMHB 2ZIVB 2VL7A 1EP2B 1DBVO 2B3TA 3ADOA 3JS5A 3LH5A 4JJFA 4WT7A 3JAKA 2VJYA 3HJHA 3X2EA 2PX3A 1UQUA 3ICQB 3KKOA 5LD2C 1OA0A 2W42A 3PC7A 4ZO4A 4CTOA 4KQFA 3NETA 4HAUA 3ACCA 5C1PA 1RC0A 1U9JA 4YRQA 1DAEA 3FY4A 2PUAA 1G5FA 1GGMA 1I7PA 1L5RA 1ULAA 3G17A 1NVEA 2VJAA 2Q21A 4D8TA 5BSWA 4JSRA 4IJMA 16PKA 1X7XB 1GOTA 1XNHA 2JGNA 2O0JA 3DKKA 2YASA 3JQPA 3UXYA 4DMMA 1SU7A 1P3DA 4KXVA 2CXXA 3M6VA 4KI7A 4RA9A 2XQIA 3T15A 3SIWA 1BO6A 4YUXA 4FCWA 1V3UA 5B7PA 2XB2A 4BO1A 4XM0A 5JDCA 3A3KA 3QK7A 4Q6BA 5ALSA 3OM0A 1DX9A 3SAJA 3T5GA 1RXCA 2D8AA 2EYUA 1CPYA 1JFFB 4M60A 4MOWA 1XWWA 4LA4A 1E2IA 3VOSA 5C8YF 5JR3A 5IYZB 4ECEA 3FB4A 3DWIA 2XXAB 5D3QA 1OX4A 3CRMA 4QQKA 3KQKA 2P0AA 2HZ7A 3FZQA 4IHJF 1N75A 1KL7A 3EA5A 4NEHB 2ZCUA 1X77A 3PNPA 1XMQB 2OG2A 4M8KA 5ALTA 3ZK7A 3E9MA 3GIWA 5EE9A 3OE1A 4J16A 2BDUA 1XMOB 1FFCA 5C4MA 3SFTA 2KI5A 2R6CA 3GHHA 1FFAA 3WL4A 1DBSA 4DG8A 2D2VA 1PJAA 2JLSA 5CITA 4N18A 2XMDA 1MN6A 3E05A 4FOTA 4DTCA 4NJOA 5JNLA 4FBMA 4P7BA 1U7ZA 3HADA 4R8RA 4FFLA 1CC1S 1BHQ1 4OBXA 3R9WA 1QAOA 4NOKA 4ACBA 3PC8C 4B82A 3UMJA 3NXKA 4U2DA 2FK8A 2WTXA 3IMKA 4QDUA 5EQJB 2WPDD 4TRMA 3H6KA 1FNCA 4FYPA 2W4IA 3V1TC 3W4IA 1ZOLA 1SH7A 5JO0A 1P5JA 1TC2A 2ZFUA 1O94A 4WJLA 1SG6A 3DZIA 1OGYA 4Q1DA 3SS8A 3V2IA 4BFXA 1I2MA 1HT3A 1LC0A 1I4WA 1D4AA 4HD8A 3ISJA 5C2JB 2COKA 4BKRA 4HNHA 2WM9B 4NU5A 2I7CA 3L02A 1OYYA 2ZPAA 3THWB 5IM4F 3WOVA 1HGXA 2GN1A 2C97A 1MVNA 3NOOA 4MQBA 2I6FA 3AOEA 3TM5A 4BFCA 3COWA 3G23A 5HKKA 2CC2A 3OD1A 4X1IB 2FMFA 3K1ZA 1P75A 5H02A 1KY5A 3ZLBA 2I55A 1FCJA 2AN4A 1D2RA 1DLIA 2IHNA 1KETA 2P4HX 1N5MA 1VBKA 2V7WA 2GAOA 2H2GA 4YWJA 2ZE5A 1YQXA 2ZJYA 3KB6A 1GRVA 1ZSNA 3GFTA 3HBLA 4B6SA 2V5UA 3OJEA 1FMLA 1FP4B 1B6GA 2GZHA 3IQWA 2BP7B 3JZFA 4P80A 4DT1A 4RVUA 3K1YA 5TLSA 2V7EA 4H1WA 1PX0A 4WKPA 2PY6A 4I5FA 4JLOA 1YJXA 4MB6A 2YOFA 3FGOA 3MLAA 4TTPA 2O1SA 4K6KA 1GZUA 5IXJA 4N3AA 1A71A 1ARZA 3DOUA 3L41A 4EEKA 1S8OA 1XTVA 2IUFA 3DDOA 1TEXA 2CWDA 5CGQB 1LPOA 3MPUA 1UH5A 1MX5A 4F06A 1U4SA 3W9UA 5L3SA 1YB2A 3NTVA 4HEA1 4N5LA 3VC1A 4M0LA 3HSKA 3GELA 2X76A 5K20A 1ORIA 2YKGA 1UJCA 1Y63A 1UT6A 2CF6A 3O9MA 4TSRA 5HIIA 4ZYVA 1WV0A 2ATXA 4IZ6A 5IJZA 3JAMA 2DECA 3OCUA 1MIOB 1TMGE 1W75A 1FUKA 4RE5A 1ZGBA 1GSOA 1JDZA 5CLJA 3ILYA 3Q1LA 4IJQA 1XQ1A 2AQIA 3IDFA 1PHPA 1YI0A 3M5WA 3R8CA 4B43A 4GI2A 1OLSA 1KZYC 3FGZA 1E3EA 5KYWA 1H8EA 4YLEA 4JLNA 2X9LA 1GL9B 4DYHA 5LOVA 4OP2A 4X8LA 1UEJA 3FBTA 2I65A 2VNSA 4FDUA 1ZEJA 3MTJA 4MP8A 3TECE 2RBKA 2B1RA 4YN3A 3IHTA 1RIIA 2EKBA 1CVRA 3BERA 2ZTVA 3R7WB 1HT0A 1D9XA 3BB1A 3OURA 3JVEA 4DKJA 1Q92A 5LD2B 2WWHA 3OUZA 1B0AA 5BQ5A 4ICIA 1LRKA 4GBJA 4FDTA 2XMCA 4I3FA 2QTRA 4LJLA 4RTRA 1N2GA 3NH9A 3FCSB 4A8JB 5HF8A 5FFNA 2IELA 3NDPA 4I4TA 1QAMA 2FWIA 1FFEA 4EJ6A 1KMCA 1Z4PX 2UUOA 3LCCA 4ZYUA 3L0YA 5IS2A 3OSZA 4MRPA 4H7DA 2ZR7A 1EK5A 3JYNA 1S2LA 1OWMA 2OQIA 2XVAA 4PC2A 2VDLB 3QOYA 3KJIA 3GRVA 4Z1MD 3DUFB 2E48A 2IHKA 3WY9A 5HUJA 1BQ4A 4P0QB 3JAWA 3V32A 1L5YA 1IXKA 1W47A 4MRVA 4V0SA 1BWRA 3KLOA 4CRWB 2GHQA 1NF3A 1RQLA 3E9RA 2ISCA 3FNFA 4TMXA 1BXRB 1JBKA 1VZ3A 4Q21A 5AKLA 1J2JA 2WU4A 4Q18A 3S3TA 3T7KA 1U3GA 4K6OA 1OV6A 3EZ7A 2HNAA 2YHBA 2NTEA 3AKYA 4TTVA 5JBNA 3H84A 5D51S 3RYHB 2H5IA 4RPLA 3B7WA 5ER6A 4ZEXA 1T13A 5J4LA 4M9ZA 2HMTA 3O2QB 1AY0A 1IXZA 3GQVA 4OBEA 4CQJA 1HK7A 1U31A 2IZ0A 1LD3A 4PZ0A 2YWDA 5EXXA 5SYAA 5B64A 3ZGOA 5JJLA 4C4YA 4M22A 3BWXA 4HGQA 3NVDA 1LWOA 1IN8A 3E9QA 3KSAC 2HF7A 3JWEA 2Z3VA 4X91A 2PWYA 3G2JA 3PHCA 3CUUA 1R37A 2HU8A 5IANA 3S2SA 2LKCA 2GN8A 1YJBA 4HR7A 3CSUA 1EP1B 3TRDA 3PKJA 2ZUBA 2O5CA 3HB1A 3V4FA 3AR6A 3R5JA 4ZQHA 3S2YA 3ZBPA 1NNSA 2ILVA 5I8PA 1JLLA 1QXSA 1LTQA 5C7IO 4F93B 4DL9A 4QWWA 4BNMA 1ZHOA 4U7HA 4XDGA 4WGFA 2VA8A 3K9HA 3SHVA 4ISCA 3SE7A 3IAS1 1CZRA 3HDYA 4UXJA 2AIRA 1GG9A 4MVJP 5CDFA 1AZTA 3EFOB 3V8NA 2JA1A 4IGEA 5LSAA 1I80A 5AHRA 2DFPA 1BE6A 3NAGA 2HGZA 3UY4A 1GITA 3D81A 3SCZA 3LRTA 4GZLA 1GU7A 1H4VB 1Q0RA 3RUCA 3K2IA 4MDHA 1ZHFA 4X9XA 3RS0A 2VK1A 1MA3A 4IKOA 3GLKA 1PDWA 1SUSA 2AEJA 4GPIB 1S2IA 4D1YA 3L0CA 1I4OA 1YDFA 4ZFNA 3S8YA 4G2NA 1EFRD 1PD0A 1TGVA 4V1CB 1ODTC 1V7CA 2H1WA 4HNRA 5FWYB 4YPFA 2IH4A 3TL6A 4KG7A 1XDGA 4Z5XA 1G55A 4UE3S 4LV6A 3SBEA 4Q1BA 3ETLA 5GM2A 2CHQA 3WR5A 1DIRA 4DBLC 4IVNA 4DB4A 5K6RA 3AHGA 3IP9A 4BE9A 1JDPA 1VZ2A 3ZY3A 1Q5PA 4QDXA 4FGKA 4RTKA 2C9YA 2GN9A 1CUYA 3KZ1E 4ND4A 2GUGA 4WKBA 5SZHB 1LK5A 1DVRA 2JBWA 4QXRA 1OBOA 5I7VA 3S4YA 4FYJA 4JEIA 2RGBA 2GYUA 2N0SA 2YFKA 2WFZA 2IP2A 1J20A 1WHSA 1XTKA 3O83A 3TI7A 2EDCA 4P3YA 1VKJA 4R1SA 5K0LA 4DN6A 5I4BA 1QRRA 5K0CA 4HYTA 4AQ7A 3KAPA 3H3XA 3L01A 1TO2E 1I3KA 4F3KA 5IT9A 1JEOA 2DX7A 1JSXA 3RRJA 3HA3A 2QD4A 4MCHA 2O7SA 2WE8A 1GKUB 2BF7A 2JJMA 3AP2A 1U0EA 4IEEA 2UAGA 1SBYA 3HM9A 3I3OA 1J23A 1VJ5A 4OL0A 1QC5B 5DX1A 5D1NA 3DFUA 4RK0A 3WQRA 2YV5A 1XO1A 2CBXA 4PLZA 2X0KA 2X15A 3K0KA 4M0KA 2ZJZA 3MCTA 1T4MA 4GP7A 5CTAA 4EEXA 1T35A 2FWRA 1PJRA 3HLKA 1Q44A 1HRDA 2JJ2A 1YHYA 3PRKE 3K70D 4B87A 1H2BA 5A1TA 5IG2A 4UQPA 3KTAB 4QBGB 4B76A 2QJFA 3D1JA 3NVMB 4IF4A 1P0FA 4MLDA 2D4AA 1Z2AA 5AJWA 1CW2B 1GPNA 1KVQA 1X9HA 1YZYA 4OHOA 4GP9A 3UH1A 4AFNA 1E99A 4DUYB 1U1IA 4UM8B 2G67A 3L6UA 4G01B 3ED1A 4I5EA 1K92A 1NBWB 5A4JA 5JAZA 1E1MA 2VRWA 2FJ0A 5DE3A 5DF1A 2G6BA 3GEBA 1ZD2P 3IIJA 3PXGA 4HUQB 1VPEA 2IIBA 4M1EA 3R75A 2HF9A 1F6DA 1ENZA 1JHVA 2R44A 4B3FX 4KXXA 3REQB 4OVKA 5HTOA 4EJSB 2EJWA 2R9VA 3ZE2B 4YCBA 5A3JA 3D0OA 1T9AA 3KELA 4BZQA 5LDHA 3O9VA 4Q3KA 2XRFA 1HZZA 1TW3A 4YJ3B 3TQOA 4C4ZA 1TFUA 1K4KA 1Q20A 2R8RA 2AR0A 4WLVA 5B3JA 4ER6A 1OZ0A 3NAZA 5DYTA 2KPOA 5EQDA 1LGYA 2OXEA 3AVQA 2Z6QA 1DHRA 4IG4A 5CPBA 1R12A 1K2VN 4NBSA 2QTLA 1JI0A 1KKUA 3L6DA 2HUNA 3WDSA 2G8NA 1JL3A 3ZWKA 1OUMA 2C1EA 1CP3A 2HRZA 3ZXYA 1JR3A 2OFPA 1Y1TA 3A4VA 4P9NA 3WLIA 2GARA 1IY1A 3DD5A 4GWGA 4QGBA 5MGNA 4A1FA 2G0AA 3HVHA 3LTNC 5BNFA 4L74A 5EHQA 5BOVA 2PGXA 4D0SA 1IK4A 1GFIA 4GZ5A 2XB6A 3LRXA 1QNFA 1OLSB 3L2OB 5LLSA 2DERA 3EY9A 1U0NA 4B7CA 4OI0A 2HMVA 3AMVA 2WIGA 2D2XA 4EHFA 1L8QA 3VO2A 1JBEA 4EENA 1JSCA 1G21B 1EX7A 2NPIA 1A2BA 4GSLA 4CEHA 1H4QA 3UH0A 1EDOA 3PHHA 3P20A 1YA8A 2GAFA 2WAAA 3U44A 3NBAA 1YV9A 2GCNA 2O0LA 3A8TA 3VUFA 2I6UA 3U4QB 2ZXEA 3FMFA 3ITDA 3BDIA 5IHPA 3OCXA 4XASA 2IIQA 4F21A 4RH0A 3ZV5A 2O3JA 1JEEA 1E89A 1XCMA 2G9VA 2OR3A 3C6BA 3BWDD 1O95C 2HK7A 1PEDA 2XLCA 3IA7A 3SYKA 3CSDA 3F0TA 5TXGA 3KLMX 4WZAA 3UUEA 2RHLA 2YY6A 1MG0A 3FOAA 1ZGZA 1Y1PA 3EDMA 1WW8A 2GEBA 4KO4S 4W9NC 5C32A 4OX9Y 1KMMA 1NURA 4Y1GA 4AZ0B 1L1QA 2V6IA 3ZDQA 3BE4A 1KQGA 3MYYA 4WEOA 1JB1A 3U3OA 5CA1F 3CNNA 1TCUA 1JJFA 3LLMA 1L5SA 3QOFA 1WHSB 2C7VA 5HYVA 1OI3A 1OWLA 3GDGA 3KKPA 3NW9A 2C92A 1KZ7B 3NC1C 4A8JA 4XSVA 4BP1A 3RF6A 1HFWA 1RZRD 3S2FA 3LDUA 4MRNA 5FHRA 3HI4A 3WLSA 5EESA 1L4KA 2R65A 1SCBA 2Y66A 4O2BB 3A4TA 1DTEA 1QVWA 4E30A 2WHXA 3O2JA 1JU4A 2A1TR 2WTBA 3L4SO 3WLMA 5EZYB 4K6MA 3OZTA 1PZXA 2O8CA 1RRMA 4AMZA 4E03A 2YMPA 1JQ5A 1OBFO 4ZRMA 5AI5A 1CU1A 2HJWA 3NWEA 2IYAA 2I2XB 2B7BA 3EULA 5KNCH 2H5LA 3P0JA 4RLFA 4M4SA 4KOEC 3VU3A 3FM9A 3AL3A 3IPAA 1PR5A 1BXZA 3LPAA 4PZUA 5DLYA 5ITZA 5KOYA 2XQKA 1I5OA 3DTVA 3EEYA 4BGVA 721PA 4PCVA 3GMTA 1O0SA 4YRLA 4BC0A 4HVLA 4UHFA 1SU8A 3BRWD 5KYYA 3W05A 2ZI7A 4EK9A 4Y2UA 5FNVA 3RJMA 4X64B 5KNDD 5E1BA 3L7CA 4N3BA 2Y92A 4CCYB 2JIRA 1F48A 2YC2C 4MR9A 3Q7EA 4TKVB 3DXYA 3EY4A 2BEKA 3IILA 1U4NA 4LVCA 4OHCA 2HIHA 4S1TA 2CCJA 4PY2A 3WGJA 3PXXA 3G0DA 4D8WA 2QYSA 3IIMA 2ZIZA 3QVSA 1O08A 2XIJA 3OBBA 1YKSA 4DM3A 2REBA 5AW8A 4RX1A 1ZICA 3CCCA 3OG9A 2CFCA 2IPLA 3L3BA 4XYMA 3S2EA 5LNK1 1PGPA 3B70A 3IDQA 4JKOA 4P08A 4TS1A 2NP6A 1ID8A 1J1UA 4YV0A 5AKHA 4G9BA 1SG9A 4IIVA 4ZRNA 2H18A 2R6JA 2NYAA 1T0PA 2Y6VA 1GNQA 4MUHA 2AJTA 4CW7A