3FCAA

Genetic incorporation of a metal-ion chelating amino acid into proteins as biophysical probe
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
291
structure length
290
Chain Sequence
MMERLIGSTPIVRLDSIDSRILKLEKNNPGGSVKDRPALFMILDAEKRGLLKNGIVEPTSGNMGIAIAMIGAKRGHRVILTMPETMSVERRKVLKMLGAELVLTPGELGMKGAVEKALEISRETGAHMLNQFENPYNVYSHQFTTGPEILKQMDYQIDAFVAGVGTGGTISGVGRVLKGFFGNGVKIVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITVEDEEAYEMARYLAKKEGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase
publication title Genetic incorporation of a metal-ion chelating amino acid into proteins as a biophysical probe.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 113
structure length 290
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2008-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fcaA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fcaA02
5C3UA 3VC3A 3R0XA 2EFYA 2ECQA 2C2BA 2WSYB 3ZEIA 1K3UB 2RHGB 1C29B 4D96A 4ZU1X 2J9ZB 5D84A 1J0BA 1QOPB 5HBGA 3IQGX 1J0AA 3L6BA 2J9XB 4ZU6X 2Q3CA 5IW8A 5I7OA 5I7WA 2ZPUA 5J43A 1OASA 1J0EA 4L27A 4LMBA 3DKIA 1Z7WA 3DWIA 1KL7A 2RKBA 5IXJA 2TYSB 1V7CA 2J9YB 2Q3BA 3L6CA 2BHSA 4LI3X 5B3AA 1A5SB 2ISQA 1K8XB 3L6RA 2CLEB 5DW3A 2C2GA 1VE5A 3FGPA 4L28A 5I6DA 5B53A 3T4PA 4D9EA 1E5XA 1CX9B 1TYZA 1P5JA 1UIMA 3IAUA 1PWHA 5CGQB 1C9DB 4NEGA 1KFCB 3PC2A 3VSDA 4HPXB 5D85A 5DBEX 4D9FA 5D87A 4AIRA 4AECA 1TZ2A 4COOA 1A5AB 1KFKB 4HT3B 5KZMB 1X1QA 5B1IA 1BEUB 3CEPB 3SS9X 1QOQB 1Z7YA 5JISA 4OFXA 4D9NA 4PCUA 5KINB 4H27A 5D86A 1TTQB 2BHTA 2GN2A 4Y6GB 2ECOA 4L0DA 4HO1X 4D9CA 3PC4A 1CW2B 4IL5A 1J0CA 2CLIB 1KFEB 5DW0A 1K7XB 4D99A 5B36A 1WTCA 3V7NA 4KKXB 3HMKA 2D1FA 1WBJB 1WKVA 2V03A 5DBHX 4LMAA 4JBNA 4NU8X 1K8YB 4D97A 1FUYB 4D8UA 1TDJA 2DH5A 2GN0A 1PWEA 4WX2B 5B55A 1J0DA 2JC3A 4D92A 1FCJA 4D8TA 1TZJA 5BW6B 2CLKB 3PR2B 1VE1A 2RH9B 3VSAA 1TZKA 4QYSA 4D9KA 1K8ZB 2O2EA 4OREX 4D8WA 3X43A 5T6MA 1K7EB 1KFBB 1F2DA 1A5BB 5B1HA 4D9BA 5EY5B 3VSCA 2PQMA 1C8VB 4L3VA 2ZSJA 5I7RA 3AEYA 4JBLA 1UBSB 4I1YA 1M54A 1KFJB 3TBHA 2Q3DA 3DWGA 1WDWB 1BKSB 4D9GA 4HN4B 2TSYB 2CLOB 3R0ZA 2CLLB 1V8ZA 1V71A 4ZQCB 3SPXA 2CLHB 4D9IA 1VB3A 5JJCA 4F4FA 3AEXA 1TTPB 5CVCA 3X44A 5E0KB 2ZR8A 1RQXA 3SS7X 3PC3A 5I7AA 3IQHX 1A50B 1Y7LA 3IQIX 2DH6A 5J5VA 2O2JA 5DVZA 1JBQA 2EGUA 2CLMB 1TJPB 1TZMA 3BM5A 3VBEA 1K7FB 5I7HA 2TRSB 1UINA 5IWCA 1D6SA 2CLFB 1O58A 3RR2A 4D9MA 4XUGB 3FCAA 2GN1A 4HPJB
chains in the Genus database with same CATH superfamily
5H5JA 2IU6A 2XZDA 3TLEA 1NW3A 5IDVA 3DQPA 3AI3A 1HT2E 4D96A 1U1GA 1N0UA 1WO8A 1K97A 2VSNA 4PWYA 1LPAB 2BSAA 2FN7A 1HORA 1WF3A 1VJDA 2GA9A 1YZVA 1JWBB 3AF6A 1JHXA 1QQ5A 2RAVA 2ZJAA 3ZDYB 3RVRA 4A8JA 4C3OB 4WBNB 1ZNXA 2ZJ0A 3OESA 2QR5A 2FQYA 4H17A 4R8VA 4U9HS 1JS1X 4H7EA 1Z2EA 3KWJA 3KVNA 3C3DA 4I1IA 4ZZ3A 3DGEC 4OQDA 1J49A 2Q5HA 3ZWWA 4V0KA 5FLKA 1TAQA 2ENUA 1I32A 2XKJE 2IL1A 1X8LA 2UUOA 1ZINA 5TSDA 1PQ4A 3H87A 5KOHB 3E82A 3ELWA 1DKRA 4IDFA 2P9JA 1K5DA 4C4PA 3BXZA 3U09A 3MAGA 1EQ2A 1UDXA 3MUNA 2XOKD 1UCFA 1JR3A 1U8FO 2AI1A 3II6X 3LCVB 3W3AA 4F04A 4B87A 1FZTA 2ZTVA 4Z99A 4MA0A 4WT7A 1N3LA 4OAPA 3V4SA 3T3HA 1QV7A 4RVCA 5BYBA 3W90A 4AXXA 1UEXC 3STYA 1A9RA 1H2WA 1CRWG 3HR4A 4AP6A 1YIDA 4BZWA 4DYVA 4BEWA 4A0QA 1VSVA 2C4VA 1V6SA 1VBNA 2FWRA 2O0HA 2W98A 2Z9DA 3DPSA 3M34A 2IYFA 4TTRA 1UANA 4RFSB 3QWFA 3ZV7A 4AULA 4TXMA 2ZB3A 2YNMA 4FFSA 2WP8J 1RJDA 4Q6WA 4URHA 3LA8A 3DBVO 1XWFA 1XL1A 3LNTA 1NSFA 4IDGA 4D9CA 1BTOA 4DJTA 3H2ZA 4TTQA 5I9LA 1OTXA 4I4CA 1YCDA 4JLUA 3AHGA 4BGEA 1RPZA 2O8BB 1TX4B 3DEFA 4RY9A 3MILA 2CLDX 3I2KA 4X94A 4PZLA 4GKKB 2QR2A 1HDRA 5A2QA 3IRUA 4W6ZA 3D7LA 1LJLA 2X7XA 3JQGB 2B4TO 3QG1A 4QRHA 1ZI6A 3KD3A 1Z39A 2C3PA 1TLLA 4NEQA 3ZTWA 5CLFA 4RACA 1SC1A 4MW7A 3DNFA 3HNRA 4NCAA 1V1RA 1EIZA 1YUBA 4UDXX 1T13A 2NZJA 1IHDA 3AJ8A 3FFWA 1XRRA 3OOJA 4JJGA 3RAFC 5LU8A 4IEEA 2AJDA 3BL6A 1M7BA 1RJEA 2C31A 1EFTA 2HDWA 2R5FA 2VF4X 2ZQ5A 3QY0A 4FSHA 4LYAA 4JI1B 1EK2A 2PL1A 2V7XA 1V4BA 4AYTA 1XNJA 5K8JB 1E8DA 4RA6A 4TZ0A 3N05A 3LK6A 1V3UA 2IEGA 4YHHB 5ETJA 1Z17A 1X9HA 2JJ1D 3GDHA 2A59A 1E0SA 3GU3A 3NH9A 4ZQCB 5EIFA 4QDKA 2RE8A 3T9DA 4PFJA 3R5SA 1K8RA 1Z5WA 2JJ8A 4H4EA 4JT4A 1TM1E 4OP2A 5E0KB 4ZVSA 1EB9A 4NARA 3QEJA 3UK6A 3EGEA 2M2IA 5FXMA 3IQIX 5BR8B 4IIJF 1JWLA 3I8OA 1EGAA 4FGLA 3FYTA 5J4HA 2MCFA 2I7CA 4D57A 4PZAA 3F0TA 2M6RA 3HPQA 5KVSA 5KNCD 1TYEB 3EZFA 3SEAA 5JHGB 3B7GA 3E0QA 1SQ0A 3FCOA 3VR0A 4RCZA 5AUOB 1JLLB 2R5NA 3DB2A 4IDOA 5TS2A 5DYTA 1XEXB 3I83A 3YASA 4BAZA 2RGBA 3NHBA 1B6RA 2MU1A 4UBMA 3SR3A 3MRXA 1SUCA 1YS1X 3CY6A 3FMIA 4XM0A 4NYMR 3AC0A 4P32A 2WTMA 5A5EA 4O4IF 3PQ5A 1VIAA 3SN6A 2AMFA 1NQOA 3DZBA 4OL9A 2O7SA 1U8ZA 1K68A 3I09A 4IRUB 4PPNA 5IVIA 1B0ZA 4CF5A 1PF7E 2O7QA 1RXYA 2GJ8A 1WABA 3IALA 3RAJA 4IIUA 1CPYA 4TN1A 3U9LA 5C8ZA 4L50A 2F8MA 2PRSA 3GUVA 3FTPA 3OZVA 4WEQA 5I4CA 5ALWA 1HPLA 2P0EA 1RAGA 3HCWA 1XLUA 1E3EA 1G5RA 5EERA 4BRWA 5EZYF 3SICE 2YXDA 3A25A 1BMDA 3G17A 4CM8A 1RC8A 1J2YA 1N0WA 1PNVA 5AVKA 4OM7A 4OHFA 4FI3F 1WVGA 1XLWA 2V7EA 2XUPA 3IE0A 3NM6B 4K1LA 2FEAA 1N7IA 4K9RA 1TYBE 3DEKA 4IWNA 3ESYA 3SJUA 4MYRA 1G66A 4LZAA 4KLNA 4KR9A 3FYHA 4WINA 2LKDA 3IVXA 4P2GA 2YV3A 3HV2A 1MAVA 3DMNA 4KNYA 2MYTA 4YRRA 4MQ4A 4EVRA 2V5AA 5KQRA 3D4NA 2Z5GA 1SD5A 4EA8A 3JZIA 3MTGA 3R41A 4XJXA 5JSZB 2RGRA 2MJLA 2QG4A 3TFWA 3O73A 1L7RA 1T2VA 5TQ2A 3NHAA 3I0MA 5K3BA 3CX4A 1P61B 3NAQA 4KP7A 1SR8A 4RHYA 4BMDA 4LRQA 1IZ7A 4QIHA 3JWIA 3PHCA 1TB4A 5TXGA 3A6FA 3QFHA 3IAS6 4IAOA 2RK6A 4ACAA 5AI9A 3S8MA 3H2JA 3KT6A 3LLCA 2HU2A 3PA6A 2CLKB 1T0HB 2IUSA 2WQZA 5CM2Z 3OICA 4IF6A 4Q7QA 2DFVA 5AW0A 4PYRA 2X7JA 3FPCA 4Q7MB 4QXOA 2DWUA 4IX1A 4DMMA 3USZA 2JIDA 4L72A 3GJ4A 1G1MA 5ALXA 3PGKA 1BCRA 1Z6AA 2NQTA 3PQDA 3QLUC 4XWAA 3P2KA 5I9IA 3AESB 1ORIA 3PNSA 3DBHA 3N2YA 4PAWA 4DQVA 3FPFA 3AF2A 3EYAA 3IERA 1VJ5A 1YAJA 4JR1A 3ZCQA 3OZXA 1COWA 4K9KA 3UCFA 1UP4A 4B4KA 1L8XA 3IESA 4BLRA 4DC1A 3KKLA 2Y0PA 4JJIA 3B2NA 3OOHA 5AJWA 4WDRA 2OQVA 3OJ0A 1ZIDA 2RHBA 2ZIFA 4RMGA 4LQ4A 2R47A 5K3FA 1JQLB 5NLLA 2GR9A 3UA3A 4LY6A 1TO1E 1GN9A 5AWFC 3ZYCA 5HHTA 3NHWA 1NDHA 4TVKA 4UNSA 1QX3A 2JFPA 5FKJA 2B5OA 1Y1PA 1J5XA 5JFGA 1LRJA 3PUVA 3U56A 2HWWA 1VL5A 3GCXA 3H0KA 4LEIA 4Z9YA 5D7NA 4RTPA 3A3NA 3BM5A 4XD7A 1U2RA 3HCCA 1EH5A 4I55B 4CVNA 2A84A 1T4BA 1XPJA 3BSWA 4C0HA 4ETNA 1FFXA 1UR5A 4C43A 4D26A 1I2ZA 2AWNA 1HG0A 2EFYA 2RHMA 3IDAA 2ECQA 1ZICA 4LJAA 2PUFA 1EFVB 4CM6A 1SUDA 4YPVA 4XWTA 4UMFA 4E2WA 4F5WA 1HFJA 3WGNA 3ZGZA 4V0MA 4NE9A 1GTSA 3UBMA 2ZJFA 2FFBA 5DBIA 1CF2O 2XE8A 4G1UC 1YZ3A 3GLTA 4RV4A 2IGTA 2LE0A 2PBFA 3CEMA 1DAEA 5JXGA 5LPNA 5HIJA 4L15A 4W9NC 3X1WA 1AZLA 1LPPA 1LPSA 2GZAA 4J9UE 4XFDA 5FPSA 5FULA 1OYYA 2WMDA 4AURA 3ZUGA 2XYRA 2R65A 4JKOA 1YO6A 2P9ZA 3B9PA 1G41A 3HFSA 3U3MA 5KNDA 4BE4A 2CB9A 4NBWA 1MXHA 2NP7A 1KFCB 3G7SA 1FFAA 2I6FA 3WHLA 1X8JA 1NP6A 1KBZA 1P81A 3HN6A 3VR3A 2JK1A 3PPYA 3QVGB 4PCLA 3KJIA 3KOOA 2ZR9A 3O0TA 1EE2A 1YJQA 4QULA 4XIGS 4XIYA 3VH4A 2ODEA 3ZV6A 1U3VA 2NZVG 3HWRA 3ELDA 1W2HA 3T9FA 2W2QA 2ZTMA 4MS3B 3VKVA 2PLAA 4ZOLF 2JHGA 1DO0A 3JV7A 4ZVRA 2QV0A 4IKEA 4ENSA 2CSXA 3RASA 4ZK6A 1FW6A 4CODB 1AKWA 1EBBA 2KBFA 3E5RA 4EJ0A 3DF9A 4RHTA 4YUAA 5SZKB 2PRIA 4MQFA 4EA9A 4DJDC 3ZU6A 2BPOA 4D3ZA 2FRXA 5CP8A 2YINC 3RV4A 2ZCVA 5A0FA 4GMDA 1M1XB 5KYUA 3G2LA 1HY3A 1TTHA 5KDLA 3EQ7A 4AQDA 4PTYA 1EX6A 4D44A 1XMIA 3K71B 4M3NA 2PUDA 1QG6A 3GFPA 1RKUA 3T5GA 3W5JA 1XZ8A 1AXRA 4E08A 5KSOA 1C7QA 1PNRA 1N1GA 1T4DA 1T5DX 1XQ1A 2DUUA 3DDWA 1J0DA 1DEAA 1SXJD 2OUIA 2QQEA 3G8BA 3C2QA 1CNMA 1T9AA 3WLOA 3I39X 3WIDA 3KYBA 1SQ5A 3PITA 1HFWA 4QUBA 1VKJA 1TA4A 2O2DA 1O2DA 4WFJA 3U62A 3PNPA 4LBYA 4PNPA 2GTIA 4MEBA 5ECYA 2H59A 4ECAA 1YHZA 5IYZB 3IQEA 4GL2A 2I91A 1AGYA 1BQ4A 3VU9A 3AUJB 4U7WA 4OXNA 3G0CA 2WWGA 4AMGA 4L57A 3T3EA 4O4JF 2PX3A 1QRRA 4YWJA 2I2CA 4JJEA 5JECA 2EQAA 4US1R 2YL2A 2R8EA 2CJPA 1J8DA 1EWKA 3QMWA 2GHQA 4H7JA 1OWMA 1ORVA 1QLHA 4FFWA 2Q6OA 4RPGA 2HEGA 3RVPA 4DS3A 1Z63A 2BGGA 1GD1O 2P0YA 3I23A 3BMCB 1AQYA 3I8XA 3P0RA 4JP2A 1SXJB 1GGEA 3MGGA 2QROA 4LBVA 5LNK6 1EE9A 3DXZA 2E6UX 1QPGA 4BGVA 3NP9A 1MX3A 1Y1RA 4HNAA 4XUEA 3VR5H 2EJTA 5T64A 2XMQA 2WZBA 4JC5A 4NENB 1K4MA 3F8WA 5AVTA 3IIEA 1JJAA 2PGAA 4LOIA 3VI3B 3WVNA 3T1VA 1EWVA 1HKHA 1LSSA 2J67A 3P2YA 4IVQA 1ISJA 4UHHA 3GLFB 4EY6A 4OJYA 1VE9A 1DADA 2WILA 3MSXA 3VC7A 3WGTA 3FOEC 2X5KO 3DHNA 4G0ZA 2HNBA 3U40A 5LD2B 4HB2A 4AYXA 4MW2A 3VKFA 2DMRA 1X1AA 2Q49A 1GPKA 4MPTA 1T2AA 3IAM1 3PUZA 4NQZA 4Q3CA 4EW1A 2J9ZB 4Q4CA 1OGIA 4CMBA 1EJBA 1GADO 2AG1A 2Q7OE 3WXBA 3EXG2 4V0RA 1Z6ZA 4Q82A 4MIEA 4ZU6X 3WRXA 3QK7A 1QDEA 2QJFA 4CMHA 5F3RA 3CEHA 3HCFA 1WZ2A 3F4KA 1OLXA 2GA8A 3CCBA 1NJ1A 1KMMA 1LGYA 3HWSA 1YV9A 2NUAB 1J9ZA 3SE0A 3AIMA 3I6BA 4DBZA 3HBLA 3LFTA 3U4DA 1W52X 1EM6A 1NZFA 4L9AA 4YS6A 4WNAB 3AETB 1KVRA 2D62A 1J8FA 3T7EA 5IH3A 1NFQA 1PR3A 3O2QB 4AY3A 2H5IA 4K6KA 4S12A 4LVUA 4EEKA 3Q3JB 3UAGA 1CERA 1FS4A 2WWHA 4G89A 1CZLA 4MKZA 5DISB 5BSRA 4FS8A 2FTKE 2UVQA 3UUFA 1XKLA 4UBOA 4MPJA 2IPLA 5EKTA 3MJFA 5I48A 2F62A 2C7GA 3E84A 1T91A 3UNXA 1WIWA 1Y0BA 3I12A 4HWRA 3RG2A 4LXQA 1SCUA 1PEAA 2Q9UA 3ONNA 3GA5A 3IPRA 2POCA 1KK0A 4EB6A 3K8ZA 4A82A 3O3NB 2QRNA 2QLLA 4ONEA 1YE8A 2GAAA 3SYLA 2I8CA 2DY1A 5B1EA 4LDQA 5BSVA 1G5PA 3AVWA 4XPIB 3GJ6A 2RGWA 1HLDA 2PH1A 1U9CA 4FU0A 5SZJA 4EY8A 3NDBB 4F4DA 1USKA 1QO9A 1L0BA 3MEQA 1XTSA 1LS6A 1MBZA 3WLMA 3ZNNA 4S1TA 4AN4A 3IHTA 2V9ZA 4LJYA 4YMSA 3ENVA 1I7QB 4IWYA 1HDEA 3FDZB 1JB9A 1M6YA 3ZZ0A 2ATCA 3MNFA 3SE7A 3HJUA 3G85A 1HLGA 3EF0A 5AH0A 1NP3A 5JCOC 4IKOA 4Y8VA 2YZKA 2DH5A 3IUQA 4JC4A 1T9BA 2DWQA 5KHLB 4CM4A 2BF7A 2PWBA 2B2CA 3G02A 4PCAA 3E0XA 3MGAA 1VE1A 2Z3ZA 1OILA 1NVUQ 3DOFA 1PGJA 1RXCA 3N5KA 4YDQA 4DWVA 1RFGE 3EQ9A 2A1TR 2DT8A 3QTLA 2D2XA 5EWJB 4BNMA 1TEZA 4PZYA 3ONWA 3N8NA 3A26A 4QBTA 5H68A 4EHNA 2VK1A 4KWCA 5LXTF 5KTPA 2IW1A 5F2NA 4X44A 1L4FA 1ZDMA 4HB3A 5BWOA 2W2KA 1RKXA 2VJMB 3M6VA 4F97A 1VJRA 1B8PA 2ZDQA 3HHPA 5EQTA 4DR4B 1RYYA 1Z6GA 1FF9A 2YVAA 1XZHA 5KNDH 1Q0QA 4J1TC 4JLAA 2YQZA 5COQA 4KO8A 3RT1A 4D6YA 3AEXA 3DEHA 1MNAA 2EJUA 2GRJA 3HU2A 3BK1A 4ASUD 4CKWA 1HM5A 2Q28A 3FPLA 4HWTA 3V1UA 1BSVA 1NXPA 2IUYA 3LUJA 4M55A 4RABA 2QRVA 4ZEWA 1TLFA 3JYQA 4Z9FA 4CT0A 2JCSA 4HP8A 4BFXA 5HP4A 5JTTA 2GESA 5IDYA 2CLMB 2Z83A 3RJ5A 2PE5A 3QHPA 3FKQA 1TVEA 2AUMA 1OIXA 4GM0A 3WKCA 4DR2B 3GFTA 3R09A 1IY2A 4IJVA 5WRFA 4AB1A 4AO7A 4PPQA 5DYYA 1F4VA 3ZHRA 3OZUA 1LQ2A 2Q5EA 4OQLA 1VSQA 2ZDGA 4MLDA 5CYGA 5CCEA 1CUZA 3HVJA 3A6KA 4Y2GA 1DRKA 2HPHA 4NYJR 4F6RB 1IUNA 4IMPA 1M6VA 2PH3A 4ED9A 4O2RA 4WIAA 2QUIA 3L06A 1E0KA 3PD1A 2OYSA 3B1ZA 1KMQA 1AS3A 1YB7A 2RK4A 3LJKA 3R5HA 5H02A 4AG3A 3HDYA 3C3PA 4NOKA 1MQAA 1NE2A 2W2OA 3WBKA 4RVFA 4DMHA 2J9YB 3OZRA 1UAAA 3SK0A 1YJAA 3GH3A 4P6VF 3QE9Y 1Y34E 4M8NE 2P5UA 4G01B 1BHQ1 3NOOA 4RS4A 4PX2A 2DU8A 4I50F 4LGYA 2FMKA 2G3YA 4RL6A 1KMHA 1FK8A 2I7VA 3E8SA 4TMFA 4TSFD 3LI2A 4R6XA 4UMDA 1RBQA 3AY0A 3HR8A 4OHUA 3W8FA 1F1JA 3O03A 4RLFA 4YASA 1X0XA 4RYLA 1ZCFA 3KXPA 1YIAA 5BO5A 1KKLA 2C9BA 1QG0A 2C07A 1HLPA 3KTFA 4WKCA 3MG9A 5B37A 2AVNA 1I0IA 2GGSA 3LRPA 3W6UA 3ZVKA 2GN8A 3BTUA 3G1WA 4J0EA 1WB4A 2XEDA 3PL1A 2SNIE 1TCCA 2FXVA 1ZVVA 4WK6A 2RHRA 2EW2A 3N5CA 5HF9A 4DT1A 1ECGA 4LRSB 4M7OA 1VLMA 3PD0A 1NW8A 2OC4A 1C1YA 2FN4A 1YJ5A 2JBHA 1T8SA 3U4QB 4PU0A 4UASA 4NE7A 3C0KA 1RZRD 2IEAA 5TPZD 4NLLA 3RRYA 2BZGA 1JBEA 4EI7A 3JZDA 3CNOA 5A5FA 2HRCA 4JBWA 3BB1A 1ZY2A 2CBZA 1ULAA 1SK8A 2JW5A 2P35A 3OM9A 3P2OA 4HGZA 1ODFA 3CG0A 4NJEA 5TQVA 4WBNF 1BE6A 4Z1MD 3ZQ6A 2VC2B 5EIEA 1WPRA 3QFRA 3ZK7A 5I47A 1IJEA 1Y1LA 2GZDA 2J6HA 3JQCA 3IMEA 2HU7A 2H7YA 1W49A 5BMVB 5LJIA 3EUFA 1D5WA 1N1MA 1FP4B 2VRCA 2Y4OA 2ATXA 2GWHA 4MI9A 8ABPA 3K0BA 1FCJA 2X6QA 1U7DA 2P77A 2Y67A 3OX4A 1E2QA 3X1KA 4R98A 3L40A 1WW8A 3HU1A 4XGNA 1YK1A 5D3MB 1CG6A 1NJ8A 1TC1A 2IYSA 1AUOA 4ROSA 3ZD7A 5LFAA 1K7EB 1IQ0A 1QP8A 1W76A 3LHIA 1DBVO 4WN9B 3SIXA 5CG1A 4F91B 3QWBA 2AF4C 3FCYA 2JBWA 3M82A 3QVOA 1P9OA 4FNGA 4ILKA 4GGOA 4LWOA 4BNWA 1J8MF 1EXNA 1GG9A 4MW5A 4GVXA 2O8NA 3VPAA 2WJ3A 1LH0A 1MJ5A 2IT1A 4QUDA 3S6JA 1VSUA 4ZN6A 4MOWA 2D1QA 1TYCA 4NESA 2EARA 4WQMA 3KSAC 2A94A 1Z0FA 2NQ8A 2PLWA 4AWAA 2V7WA 5HJ5A 2GARA 1K92A 1OU4A 1P0IA 2IXTA 4ZODA 1WPQA 3T06B 5G2OA 4Q9JA 5JSQA 1BQEA 5K6AA 2Q4OA 3MWLA 1Z5VA 1VHWA 4KQFA 4DCNA 1XVLA 5F5LA 5DYNA 3PDCA 3F2IA 4N9QA 2RHWA 2WWFA 1BHSA 2L18A 2AG8A 4MPPA 3RU7A 4ZFNA 5HUHA 2VQ6A 2JH3A 2WWVD 3JASA 4DIFA 1L3IA 2R86A 2BV3A 4EY4A 2Y66A 1YR9A 1AO3A 2CLFB 3LPMA 5KOJA 3GVIA 4HQ6A 5TDHA 3CSSA 2VSYA 4O1MA 5D01A 3ZR4B 3NTUA 1KH3A 2XKBA 1R10A 1SD1A 4LBWA 3U44A 4WXHA 2V4UA 2OGSA 4OB6A 1PW7A 2AC2A 3FF4A 3OKFA 5FA8A 3LCJA 3VXKA 2B36A 1L5FA 2D1SA 1JLRA 2AFHA 2BC9A 3DDSA 2HJVA 4GXRA 1J1UA 2HWUA 2N46A 3THWB 1J0EA 3U37A 4M7PA 1SWWA 3D5QA 4HAVA 4TWZA 2MR6A 4PLGA 2TYSB 2Q1XA 2QAJA 3WNVA 1P5RA 1FFDA 1S4QA 3H1TA 4N5LA 1YZFA 2GD1O 1WX1A 2J3MA 3EG9B 4MV4A 5CA0F 2WIFA 4R7TA 2PANA 3M6MD 4DMGA 4OK5A 5B53A 3UQZA 4QC2A 3MS4A 4R9RA 3KDAA 3HGQA 1G21B 5A3QA 1MOQA 2FPXA 4BASA 4C07A 3I37X 1QK5A 1SK9A 3MAAC 3RIYA 1KF0A 1PYDA 1TF7A 1TK9A 2WVJA 3PQ6A 2P1RA 2IXAA 3MWFA 3AI2A 4YRFA 4Z9XA 4EKDA 4EY7A 1M0SA 1A1SA 4M1KA 2HT6A 3ROZA 3MF4A 3TCKA 2QNIA 4Z6KA 2XMDA 3ZGXA 1ONPA 3V5NA 1CUJA 1NBMD 1V9LA 1J25A 1GRCA 3ONFA 5LQSA 1SBZA 3JQDA 4RNCA 1UZLA 5AI8A 1JKMA 2PDAA 3U7HB 4XX0B 2YMLA 2XXBA 3PQ4A 3DBLB 3PXGA 5A5GA 1YONA 4DV5B 1VPVA 2XE6A 2ZB4A 4BJ3A 3G9ZA 5DZSA 2FK8A 3C5VA 4PV7A 5CX4A 1NMQA 3K9NA 5AW4A 3T7IA 5IKMA 3JTMA 1BX0A 3AP2A 3BHJA 4ZIRA 3BGWA 2E85A 3JAWA 4DRXB 1COZA 2F9FA 2RSLA 4YTEA 3M7IA 1FX0A 2PG3A 1I8TA 1W0KA 4G1CA 1JKJA 1NRXA 2XCOA 4MWSA 5E7IA 3U3XA 3VHXB 2XZLA 4G5QA 2H11A 3G8CA 4KTTE 5FNVB 1EFKA 1K0UA 1MNQA 4D80A 1FSFA 4E51A 3F7TA 1N5MA 3AP1A 3QF4A 2V4ZA 4TSKA 1BKYA 1W48A 3UMBA 2E6KA 3P2EA 4XVQA 4BAGA 4GW3A 1GDHA 4DNPA 2UYQA 3SGLA 3O8OA 2PR7A 3KSUA 3VSCA 1NR7A 5FPTA 3TDKA 4B7AA 4C6TA 4ESEA 4Q21A 1W88B 3HGMA 2OFWA 3D4BA 1XA4A 4HS9A 1UFRA 2A8YA 3CUEF 4QZVA 1JYFA 3DWGA 1MTZA 2J07A 3IPCA 3DVSX 1ZBQA 1OAOC 3TRKA 3U9TA 3CVWA 2G5TA 4H7FA 1TUBB 4M1MA 4X7PA 3V8PA 4Z4IA 2XMPA 3KWFA 4LJSA 2OBMA 4ZCTA 5TGTA 5ALPA 1FUKA 1J1IA 2ST1A 1G8PA 1Q1GA 4FMCF 3Q12A 3W1WA 4OP1A 1OXVA 1RRVA 2O3JA 1P31A 3FRJA 2BT4A 2GEBA 1NBWB 1MZVA 3P9CA 4FBMA 1NXQA 1C4OA 3TPCA 4FLEA 4HTFB 3LIPA 1J1ZA 3DVRX 1IEQA 4OAQA 2WSBA 3NBKA 3NXKA 4OHXA 2ZS8A 3ICWA 4DWOA 3DOHA 3OJEA 4E2XA 2O4CA 5A62A 4LTMA 1WB6A 5IEJA 4M60A 3K1JA 4R2KA 2Q7XA 3RVOA 3SIRA 1BWSA 3NCHA 4F3NA 1PVOA 1KEVA 5F35A 5ALMA 3AUTA 4YXFA 5JMWA 3F71A 4MVJM 3FNRA 4BL5A 1SZJG 4BJ5A 1M75A 5D5QA 2Q6IA 1V5WA 2COEA 2HMUA 5FYDA 4Q1BA 1WY5A 3EODA 5D6OA 2VF5X 3GROA 4E5NA 2X7HA 3IBYA 2IUFA 1RYFA 4BO3A 4AZTA 1GHTA 5H9VA 5GPBA 2FDXA 4H6XA 2H7CA 2ZU6A 3A1TA 5T4BA 4CEJB 5CBPB 1EA5A 4RANA 1GSAA 2VDQB 4FGUA 1KQNA 4O1IA 2PFSA 1LV7A 2A3RA 4MNTA 2BFMA 1TW2A 4GECA 1P4RA 3SBDA 1DPFA 3T41A 5HW0A 2OSVA 3KJXA 1YRHA 5I7SA 1YGPA 2R68A 1AQUA 3A37A 3R3ZA 4X1YB 2NVWA 4YACA 1NQXA 3BVPA 4HR7A 4I55F 1OWOA 1Z33A 4YYEA 3R44A 3BMXA 1QDUA 3FWKA 5E9AA 4DUZB 2G5GX 121PA 1JR6A 4I1RA 3JRNA 1R4MB 2BFFA 4G85A 5LA6B 1Q50A 2FAXA 3MN1A 1OFGA 2GCPA 3T3DA 3ZX5A 4AMBA 1NVDA 3PR3A 4GLJA 1P5ZB 4LKRA 2WY2D 1TKCA 1JPUA 4WJLA 1AE1A 4IXNA 1RBZA 4EY3A 2UXDB 2NTNA 2WOOA 2X1LA 4KLCA 4J0GA 3EC2A 1IAQA 1U6JA 4J7XA 2JIRA 2X41A 3KU1A 3REQB 4RZ2A 5KX5B 4YBRA 5A9SB 1WB9A 1HC7A 4CIVA 1BFUA 4PIPA 4BFUA 4ILEA 3Q7RA 4WX2B 5B55A 1OF1A 1ZX1A 4QYMA 4KE9A 3MUEA 2PLNA 1K1EA 2AG6A 2WKPA 4J1QA 4PZDA 3BMNA 5HRCA 1EVKA 1ONBA 3P5BA 4P4SB 5DLYA 5GIPE 1QMGA 2G67A 1DCMA 3OQNA 2Y1GA 1VHQA 1U8TA 3NANA 1HO3A 4TV8A 4DA9A 3OUTA 2IP2A 4BZZA 4RE6A 2DXIA 3VKGA 2IDMA 4ZMBA 4MZXA 3TLGA 2IPMA 4C0WA 3MHTA 2PZLA 1D8AA 1ZCBA 1JU4A 4MH0R 5GP1A 2ADMA 1HNXB 2BFEB 4J0IA 2WNSA 2BEJA 3X44A 1XTJA 3LL4A 3HJBA 3L1UA 4NMHA 5THKA 3FOFC 1FYFA 2UU9B 3FVQA 5FTKA 3QEBZ 3CF0A 1VL0A 5SYAA 4Q3LA 2UZIR 3FMOB 1PTKA 3H04A 3ZLBA 4Y98A 5BP7A 1U2SA 2NPOA 4KX5A 1PKEA 4L9WA 1TJPB 4OQFA 5TMDA 1FQKA 3TQSA 1Q15A 1X1BA 4TQ9A 4DARA 2RIRA 3FB4A 3BHMA 3DWFA 2ICAA 1V3QE 2NVUA 2W2MA 4JQZA 5DX8A 4YDHB 1E66A 1W6RA 3HP7A 5E8JA 6ABPA 1P29A 4QECA 2WJGA 1E3SA 1AF4A 2B4AA 3U17A 1SN7A 1DHTA 1DKQA 1USVA 3C16C 1CZHA 2G40A 4CV0A 3KS9A 1IL0A 1EZ1A 3EC7A 1KR5A 3HYCA 1IQRA 4FFBA 2IIBA 4GSLA 1FRFS 1PR0A 4P82A 4GOKA 4PE5B 4R05A 2IY8A 5SV2A 3DG9A 5IYZF 1KMIY 2R25B 2X86A 2PMEA 1Z82A 2GEVA 3PGXA 3AF3A 4G8DA 4PO1A 7ADHA 2C42A 4UQPA 3KQHA 5JIBA 1X1TA 4F8EA 2REOA 3STXA 1KL7A 1M2JA 1IEXA 3Q6MA 2P4EA 2J0VA 3MTJA 1KAGA 1TCBA 3MK31 1NFFA 1H8HA 3C6MA 2V6FA 1YJ8A 3L6RA 5IT5A 2QX8A 1JFLA 3RTBA 3HVHA 1RRGA 4QJ4A 3HFJA 4C03A 5KREA 3L0ZA 1ULHA 2ET6A 4N3NA 1DG9A 4RK5A 3UC9A 3GXOA 3UHFA 4C3ZA 4BWGA 1T3GA 5AK4A 4DFDA 3I5AA 4F2GA 4ZGGA 2NO0A 1DXQA 3RUIA 4F85A 3S27A 4JXJA 4GPEA 4HGNA 2HIGA 2B4KA 2FLVA 2O7VA 5EJFA 3TX2A 1FSSA 1QHHB 1YRYE 1Y63A 3PDIA 2GBPA 2LD4A 5DNYB 3QLJA 4M4SA 3CRRA 5FOXA 3UUGA 4QREA 1GXSB 4F38A 3AR2A 5DGTA 1KDPA 2QWXA 4OFXA 3W4IA 3ZD6A 5JC1A 5IJ0A 3WZ2A 3M6UA 1ECPA 4YDSA 5E2IA 1A7KA 1QONA 4NBRA 2PSDA 2VLBA 2YOHA 3FMVA 4UXHA 3RVQA 2O5VA 2DPGA 1S8AA 4RD3A 1D1PA 3FA2A 1X1EA 2D06A 2WHPA 3HNPA 3KAPA 4LNUA 4FHDA 1SCNE 1YR7A 4TRRA 2GJAA 5D5PA 2QTFA 2N0SA 2D00A 4GMKA 3GEEA 3TM5A 3U3KA 1APBA 2FP4B 2OAP1 1JMYA 1VTKA 2QVBA 4ERNA 2QMQA 5HEKA 4ID9A 2F67A 2J08A 2WNIA 1ZUNA 3DPUA 1PJCA 3SI7A 4Q34A 4W8GA 1YKGA 2A6PA 1TECE 1JIVA 2PX0A 2RGUA 1XXHB 3G9XA 4G9GA 1PG0A 3MYRA 1UFVA 3EUAA 4EABA 4ZO8A 3X43A 5DSTA 1Z88A 1YFJA 3QIVA 9MHTA 1U4OA 1VHLA 5T8KC 2FZ5A 5B1HA 1Q3TA 3L0YA 3WLFA 4B31A 5H8WA 1FVFA 1YS2X 2O20A 2N42A 2PQ2A 3R7AA 4AXBA 3EIFA 1D2MA 5H80A 3CNHA 5EIHA 1GGNA 1KFJB 2VKTA 3G2JA 2OCYC 4IIDA 4OH7A 4PZ0A 1KDYA 1DZ3A 1OFIA 1L3CA 1KZ1A 4RJLA 5JAMA 5K8IA 4M7RA 2P7IA 5SY4A 3VV3A 4PBSA 3BTOA 2X8JA 3BH0A 3AR8A 3VYTB 1NW9B 1NF3A 1ADYA 1FDUA 3LHDA 4AF7A 5DCYA 5U9CA 2GUGA 4ZYVA 3AIOA 4IH1A 2B9EA 3KYJB 1PS9A 1RP7A 3CZMA 3X1ZA 1CEYA 3HKEA 2XEXA 5EKSA 5BV7A 1AK2A 4BUJA 5FLYA 2G9RA 2O2JA 4R1LA 5SZHB 4DDMA 5BPHA 2HSWA 4JVSB 1TCUA 3KPYA 1RTKA 1D0IA 1AKEA 2RI1A 3PU6A 4UTZA 3TW0A 1MP0A 1I2DA 1GNLA 4BLTA 4XVUA 4XUGB 5AYVA 1NR5A 5T8KA 5IS2A 2XIQA 4O4HB 3ZKAA 4OSPA 3Q1LA 2VAPA 1F0KA 2XKAA 3F96A 2I99A 4LZOA 5JAQA 2PL5A 3TRIA 2LXNA 5DYWA 3CE9A 1PEKE 4DPLA 5IZCC 1ECLA 5LWHA 1X7XA 2ERCA 3AWIA 5IUKC 3K0SA 3BD7A 5HKKD 3OCWA 4UAGA 3KYDA 4CMGA 5EQDA 4F3KA 2XE4A 4CL8A 4CYMA 5A4JA 3F5FA 2BZ0A 1U2EA 3N8IA 4BIIA 1T8UA 3WYCA 4QXRA 1Y4DE 2WNHA 3H1AA 1GRRA 2GPJA 4L5YA 3N86A 2ASEA 2Y0CA 4GBMA 1XYGA 2DWOA 1MAHA 1ODCA 1FVOA 5HG0A 4AICA 3AL2A 3A4VA 4UVIA 3VNVA 3IUNA 4REMA 3GLGB 3FCCA 2P11A 3GVPA 4M1OA 5IJXA 4DIDA 5FI1B 2HR1A 1NVVQ 2ZI4A 3KXDA 3EH1A 3JS5A 5C31A 2LUOA 5FWYA 2ZYUX 1PV4A 4X97A 2EBHX 2PMDA 3EIQA 1JT2A 1ZM7A 1CZRA 3KAKA 2GBCA 1IUOA 1R3DA 2QD4A 3FWPA 2UUBB 3LC2O 1LXCA 2DBZA 1XU4A 2FMHA 2J9GA 4L85A 2JGJA 5LL6P 1BDJA 4TZ6A 4TV9A 3LGXA 2HNKA 4MVJG 2AWOA 4JNKA 3JQBA 3MXTA 5EZQA 4W1SA 4V02A 1RVDA 1ZM4A 1XYYA 2GAIA 1DL5A 2DHRA 3WJ1A 2VRWA 2IY7A 3EVZA 3NWBA 1L5YA 4QUJA 1EB8A 1JSLA 1AT1A 4UKDA 4X1KB 1GP2A 3H5IA 1Q44A 4CWAA 3GUHA 3ZS8A 4PFKA 3S8YA 3Q7QA 2JC3A 5E7MA 4FMBB 2O4UX 4QICA 1SRRA 1XZQA 1A82A 4GM4A 4W5RA 1T2UA 5EJAA 1BXRA 1CR6A 2VTKA 4C0JA 4ER5A 1EK0A 1SG6A 2FDRA 2Z2YA 2XUKA 4NBUA 4N41A 2QZZA 4RCYA 3EVAA 2R4QA 5JO9A 2BRUC 2V98A 3TR6A 3O8LA 3ISTA 1H4QA 1BGVA 1DAIA 1EQAA 2GBLA 4XARA 4YCNA 3HVIA 1O5IA 3TQTA 4B6PA 2HA7A 1NUQA 1F5SA 1KA9H 5JH7F 2CK3D 4D5GA 3RWMB 1YBVA 2R60A 2PCJA 3TN7A 4JI3B 1WXIA 1E2EA 4IIFA 4I7EA 3WMEA 4ZOEA 2IOYA 1SCKA 2EFJA 1TT5B 5FBKA 4D3SA 2CLHB 1TRHA 2YJ3A 2D2IA 2ZCUA 1P7WA 3QU7A 1ISGA 4R1NA 4DQLA 4E1BA 1UIRA 3BL8A 4LHZA 4PG8A 5E6UA 3PC6A 3H4IA 4HYTA 3P0FA 3R6GA 4EJSC 2DHQA 3DUFB 2JIZD 3AFIA 2X2PA 3ASUA 1KERA 3QW2A 4PRKA 1FMTA 1SOWA 2WZDA 1YVUA 2CUZA 3GNSA 4UHBA 3S8EA 3I34X 2PL3A 5EHIA 4K6CA 3Q7IA 5LZ8A 1N7GA 1VA5A 2HQOA 2P9QA 2GDJA 2Y1FA 1EKXA 5BMVF 1PR2A 3FCAA 2C29D 2JZNA 2LIPA 4YN3A 4W1RA 1UXJA 4NECA 1PK8A 2Z6UA 2QL6A 4JLVA 4P3NA 5CLGA 1G8FA 3E1SA 1CB0A 10MHA 2C77A 1CIVA 2Y1OA 2QY9A 3OCYA 4BQFA 2CLSA 1NQWA 1HTWA 1NBIA 3K15A 4EQZA 1GEGA 3LPDA 3QFCA 2VT2A 1EAYA 3P0JA 4LISA 3VPXA 3BZUA 4FOOA 1P74A 2V9PA 3A06A 2WVGA 3T99A 2RKBA 3VRHA 4HDKB 3TUJC 3KKOA 4B8ZA 4K3VA 1SZPA 2OBLA 1Q19A 4UVEA 4YRNA 5IC5A 4R9UC 3TG8A 1TC2A 5AVQA 1W9HA 2HA3A 3TZCA 4DR1B 4KMOA 2BFDA 4C21A 2UXBB 4PC3A 1XMVA 2ZKIA 1EX7A 1RMYA 2ZM6B 3C8ZA 4F9TA 1UM9B 4JVNA 3MXOA 2V7QD 2QZJA 2I3GA 2VYCA 3UOAB 5AW3A 1Z8NA 1NFRA 821PA 4D9FA 1WEKA 3GGSA 3C1TA 4EVQA 3REGA 4BO4A 1GNVA 4TTVA 4Y9UA 3UMRA 3EAFA 3ZHZA 3R3JA 5EIXA 4GOMD 4UCWA 1QK4A 4A0RA 3K20A 2CXRA 3QELA 3U3RA 3I73A 1Z68A 5F23A 2AN4A 3OJWA 3ZJUA 2O8DA 1II9A 3RC7A 2DLCX 3SMQA 1OOEA 2OO5C 1ZVQA 3D64A 3TQQA 3LV8A 3EDOA 1QRSA 2UYOA 1RI1A 1U3DA 1QYXA 3EMBA 4EHIA 3PJGA 2FR8A 2HJHA 2IE0A 2B7LA 3B20A 2F1KA 4Q1CA 3DPIA 1YUMA 1JJFA 5CM8B 2DGDA 1CDOA 3FHCB 4MI3A 1JHRA 1YWGO 2J3HA 4KO2S 4DTCA 1TD9A 2X4IA 4YAKA 2J4CA 5A9TA 3WBFA 4BFLA 4ZYLA 3EK2A 4ETIA 1CULC 1RBMA 3DL4A 4D8VA 4OXIA 1PJAA 4D92A 4C7OA 1GA6A 1X80B 1XELA 4L8YA 4IUYA 1PLLA 1JILA 1V16A 1XJCA 2AFRA 2GF0A 1THTA 3CF2A 3LXMA 3HSSA 1NZDA 2PLFA 3OY2A 3QOFA 2VYQA 2EW1A 3GEIA 4JLPA 3RAPR 4AJOA 5LQRA 4BXOB 4JB0A 2NO1A 2F8TA 4PSVA 1QG4A 3LBYA 4HLUC 2B7CA 4B82A 4S2EA 4L4UA 5ICFA 2WU0A 2Y68A 1SUSA 2AYZA 4GD3Q 2ADFA 4UQOA 4D4LA 1K9SA 2REQB 4EJMA 2J41A 1G8YA 1WDWB 1ZNWA 2XYQA 2SKDA 1V47A 3D2CA 4HG2A 4TTPA 3T8YA 2CB0A 3SXUA 1YDFA 2LTAA 3WK7A 2CHFA 1JL3A 3BBLA 4PLFA 4PXAA 3T3IA 3CVVA 2BFCB 4TWIA 5J1TB 2AOUA 2X9NA 3QKSA 3PUJA 4C89A 4OUDB 5IUJC 1VPTA 1X7WA 1XTPA 1NX9A 4OI0A 1RWMA 2C9OA 3QXHA 4H7PA 3U81A 3E3MA 3PNKA 5ENZA 2YJNA 3QLEA 5EP2A 1WUYA 5I9NA 1ZM9A 2IYQA 2C3OA 2RCNA 2HDOA 1GA4A 2EKDA 3LUAA 3FPSA 1UZNA 5FNVF 4ECEA 4L2IB 4NCBA 5IEBA 4ZVTA 1W85B 4AJ1A 1NI5A 1A72A 2V96A 1FPQA 3I04M 2PWYA 3VZBA 1LY1A 2Q6KA 4GG1A 3EZ7A 4YUYA 3ZW8A 3EG5A 4CIDA 2G8LA 3VTKA 3B60A 2F59A 3C6YA 4Q1AA 2DTXA 3G8YA 2AFVA 1P60A 5JCJD 2GM5A 4PW0A 3FFBA 4HFMA 3EA4A 1OW3B 2ZT7A 4JDUA 4WWHA 3GGOA 4EF4A 3N74A 3TCNA 3LQFA 1U2TA 3CZCA 4HH4A 4KWEA 3BQMB 2J48A 2A5GA 4WKOA 3OZTA 1F8GA 2YWFA 3ILSA 4NWIA 5TGDA 4N6GA 1M73E 2CY0A 4US0R 3RQSA 3ST7A 1RHRA 5K2MA 4ENTA 1Q1EA 3WTCA 3RSHA 4Z0NA 3FE2A 2PO7A 4QT0A 3GGPA 2DHDA 3S29A 1O57A 3F3YA 1T5BA 2XMBA 3KSZO 5JVDB 3RROA 2GEFA 3VH3A 3VISA 1QGZA 4CGYA 1JAHA 3NRCA 1GU0A 3MIZA 3H97A 4R7ZA 1EP1B 1EE1A 1L8AA 3KB6A 3TOSA 1NNSA 2VRNA 3N2GB 3JAKA 3KEGA 4GU5A 5MN4A 1RR6A 5IJ9A 4Q3AA 1WVIA 3BK7A 2NN3C 2XODA 3KT3A 2KYRA 4XEHA 1B0AA 3A4TA 1KEZA 1ETUA 3PE6A 1SC6A 5LMUB 2N3ZA 1G4HA 2QTRA 2VJOA 1WMBA 4YCJA 1ZIXA 4P4GA 5GM1A 3BHNA 3MWDA 4B76A 2B2NA 2AEMA 5HK8A 4P22A 5C8YB 1DMRA 4LHYA 5FHRA 3ETJA 5THQA 4QHSA 4IZHA 2WUWE 2BUAA 4WCFC 1CY6A 3PQEA 3BAFA 4NMMA 3MMNA 3IELA 1QH8A 4G86A 4HGQA 2Y9MB 4JWKA 3D3JA 1HSOA 1TZJA 1E4YA 1YKSA 4G0MA 2ZUUA 4K88A 1LF0A 1PL8A 5D00A 1QFXA 3DHYA 4BJ1A 4MWEA 2KWIA 3NWOA 3ZWBA 2WUDA 1JIXA 2Z4RA 4AKEA 4BMZA 2GXUA 4RDHA 2G5PA 4N6OA 4MI6A 1S0UA 2R4TA 1OYOA 1PL6A 1T1RA 2XT9A 1KQOA 2WK1A 1FDSA 2XV1A 1GVNB 1TFUA 2FUCA 2GKOA 4HAXA 1K89A 4LK3A 2V97A 2ZTSA 1HKUA 2ZRIA 3HXPA 2D8AA 3A27A 3BRCA 1S9HA 3PWSA 3U4AA 3TZEA 4OQEA 4CF7A 3HGTA 4K28A 3EBOA 3N2KA 1NG9A 2F8SA 4HN4B 2WPDD 4I5EA 4HD8A 3RUCA 2E7ZA 4KZKA 4Y1FA 3KLBA 2JLYA 2IA5A 5LA6F 3TOVA 2BEKA 5TJ9A 2IQIA 3Q3IA 1C9EA 5I45A 5IDWA 4MVYA 4HADA 1X7HA 1JSXA 4KCGA 5KQSA 2C5HA 4PSAA 3RJMA 3SF0A 3SOZA 5EAIA 5LCXA 2XD4A 2C9MA 1Q11A 4HEA6 1RCFA 4OGKA 2VPIA 5EJEA 5KX5F 3O4VA 3DLHA 3B7PA 3TD9A 2XA1A 1YZLA 5D51S 2AI2A 4PZ9A 4UNRA 2IS2A 2I22A 4I5FA 4JCCA 2JDIA 1U2DA 2ODNA 4H31A 4UMVA 521PA 4BTVA 1CBUA 3GLIE 5E95A 2HWYA 3JQ7A 1MLDA 4C08A 4KFRA 5F21A 5GM2A 4S05A 2BH9A 4HZUA 4LXGA 3HCNA 4U63A 1A9XA 1PT6A 5HFJA 2JD2A 7MHTA 2FWPA 3GJ7A 2KLHA 3UEOA 3CU5A 3E3LA 1QGUB 3DE1X 3G7NA 4RHFA 4RO0A 5HIIA 4OX9B 2HCTA 3N76A 1OH8A 2EKPA 4LMBA 3SJBA 1JLKA 1X7YB 4MJ7A 1JI0A 1VLVA 4I6EA 5J3JA 2ZFUA 4HUJA 4QTZA 1Q74A 1U94A 3EVNA 2WJWA 1PV2A 2FX5A 1O4VA 4GRIA 2AIRA 5AI5A 2LIVA 4CLRB 3DZIA 4GNRA 1FSZA 1OV4A 2B78A 1EXWA 1C7RA 1K6IA 3QUCA 3Q5DA 1EBUA 3ONEA 4L08A 1C3VA 2VQEB 4AAYA 4C2UA 3VSDA 2GLXA 1PS8A 3PB3A 3EJWA 3U3DA 1SGWA 4J0QA 2J7PA 3UA4A 1MTOA 2ZJ3A 3R9IA 1SG9A 1RWOA 1NW4A 1SULA 1RRMA 1U2GA 1BO6A 2X9QA 3CPSA 3DUWA 5J5AA 4YMIA 3VDRA 2HMTA 3L6DA 3H5TA 2YX1A 5FX2A 4LVNA 3GLHB 4IEFB 4DB2A 2ZSKA 3JD3A 1OFHA 3EZ6A 2YC2C 4DXAA 3K16A 1AUPA 4FHEA 2VJCA 4CR7A 1IOVA 4A10A 1GPH1 4E7PA 2G9UA 2YOGA 3GDGA 2WC1A 1DC7A 2P6RA 4OYYA 3UJPA 1XZIA 4M89A 1NX6A 1ZIOA 1MEJA 4M87A 5EXXA 3OZWA 3RVBA 4GBJA 2C4UA 3A1FA 2OORC 2Y77A 4OPMA 4YAEA 4INAA 3RV3A 1O03A 5DEOA 4KLAA 1THZA 5DHTA 4J49A 4PZUA 4LXIA 5COBA 1XAGA 1C4WA 1YQEA 5CJ2A 3KPJA 2XAUA 1O6CA 3EGXA 4KVFA 5DSZA 2GKSA 1YCHA 2YWXA 3WGKA 4BO8A 2G1PA 1AUVA 3KB8A 1UKBA 3RRBA 1AZTA 4NE2A 2NUPB 3D4OA 3M4JA 3F6PA 3DT6A 5ALFA 1A97A 4YRSA 3T95A 2DPHA 2I2FA 2IQ5A 2A57A 3QSGA 2IYLD 4RTOA 1XBTA 1DBPA 2G4VA 2P8JA 3AQ4A 3H5WA 2JAPA 4RK0A 4C4YA 1X9IA 3FPBA 3WGYA 4ALNA 2R8RA 1JPNA 5LNK1 4BNKA 4P54A 1L4EA 1N2CA 1KSGA 4RDXA 4EG0A 3COJA 4JX8A 2FOLA 2PLRA 2WINI 4QM7A 4LJ5A 4PEVA 1IN8A 3IOEA 2Q2NA 1SWVA 4O2BA 2L19A 2MYPA 4R1UA 4WA7A 1WXGA 1IY1A 2JKYA 2BMVA 3QTBA 2AW5A 5B3JC 1OLSB 2E87A 4CEHA 1F20A 2N47A 5L51A 2YBEA 4MJXA 2EV9A 3LOQA 4CQLB 4MVJA 1FE8A 3NAZA 4CEIA 3IODA 3A6DA 2PTGA 5DEIA 4KQ9A 1EDOA 5CB8A 5ALJA 1UC4B 3GG9A 4MA4A 2B21A 4D9MA 4ZHQA 4WXYB 4F2PA 3TW8A 2J46A 2FSGA 2C7PA 2Y2VA 3OJFA 4V0OA 2XUAA 3FDJA 1QBGA 4FQ8A 2OD9A 3COYA 5BRJA 4S2UA 4ARZA 4BWVA 2W8ZA 2OORA 5T4EA 4EPYA 4H1VA 4BS9A 3DBIA 1EP9A 3OLZA 1PP4A 4RPKA 3NS7A 1ND6A 2BGRA 5I9BA 2ODTX 3UWOA 1RWPA 4U2BA 2XT0A 4U6QA 3W06A 3AHIA 3ZN2A 3A6LA 1TYDE 1M1NA 3JRWA 4S1PA 3SEFA 2XXAA 1MJGM 3ZQKA 4NC9A 2B6HA 3GVHA 3L9XA 1JLHA 1LK5A 4TKVB 3V32A 3CNBA 1JQ5A 1EBFA 3SQLA 1RWVA 4E21A 5C35A 2Q8QA 5I6DA 5ITSA 1QGOA 2P3LA 3DE6X 4QPCA 4OSEA 3IDOA 1R7RA 4IUDS 1H1LB 1WSAA 4INPA 1Q83A 3RS0A 5F52A 3SHFA 2IBSA 1G2QA 4Q15A 4UBLA 4AF8A 1KS9A 3ZXXA 3VKUA 1RXVA 3IEUA 3OIFA 2PBZA 5KIAA 3NWPA 2FPUA 1SCDA 1L7NA 4FDLA 2RAFA 1CY4A 2X5XA 3P0HA 3DD1A 4UZFA 2AB0A 3JQEA 3NT2A 4I8IA 4XJSA 1VGVA 4JUBA 4AKHA 1BD4A 4QBHA 4MUAA 4O4HF 4OOEA 4D9NA 2G77B 2DRIA 4G6ZA 1Y8RB 1JE0A 2PS9A 3SX2A 1KEPA 1E1NA 2YDYA 3FMFA 5IU6A 3MJRA 1JKIA 3SMVA 2XNCA 3VAAA 2BTOA 5EUQB 2VSQA 2LDBA 5HF6A 4IQFA 4KYIB 3D6TB 3KKPA 4NABA 1E6MA 5L3RA 4KO1S 1E1QD 1E1DA 1UPCA 3ZJ5A 3I05A 5BN3B 4PYOA 1IXKA 1GV1A 2LW7A 4QGGA 1CSEE 2A78A 4FZJA 1JEQB 2ZIWB 3M70A 4WVLA 5JZ9A 2GPTA 5KBYA 3OT4A 2MT9A 4OI4A 3RH0A 1LPBB 1CVRA 1G7RA 3IILA 3P0EA 1E6LA 1LLDA 1NBOA 2I8LA 4PYNA 4WFQA 3TZQA 3ZV5A 3GB9A 4U39A 4V1CI 4FGZA 1QVVA 3AKYA 2NTYC 2YWRA 1XVIA 4YY3B 2PSJA 4IM7A 4B43A 2ZE7A 1U0SY 1VIDA 1EIWA 1OC2A 5IT4A 4PC6A 3EXEB 3C3EA 4KFCA 3RC1A 1NYLA 3HO6A 1VE7A 2FSVC 4F72A 3SVLA 4K0RA 1EFRA 1XUOA 1DEXA 4MRAA 3COPA 4I1PA 2CLOB 1M7GA 4JXKA 4QUHA 4N7MA 3RRJA 1XD2A 4URUR 1XLTC 1EUCB 3OPQA 2HSGA 3SDZA 2CVZA 3QOXA 4KN6A 5JMPA 3D0OA 1UC9A 1P0PA 2XCIA 2PUHA 4HAYA 3SVZA 3SLGA 2QUHA 1T5OA 5EJ2A 4KFUA 1E1RA 4I4LA 5J5VA 2ON6A 2YVLA 3F7MA 1IY9A 2ZPTX 1CQIA 2JHAA 3GLKA 3GJZA 4BVFA 3MJHA 1RQRA 3CUSA 3D6NB 1GPAA 3FCUB 3KELA 3OD1A 3R5XA 3A14A 5EXTA 2OB2A 5KNBA 1YR2A 3PHLA 3L4JA 1IOLA 3OMWA 4ZXPA 4KGDA 2JLUA 1OTYA 5E6SA 3V1MA 4RENA 4Q48A 5BPFA 5I7UA 2D2EA 5CU7A 4JENA 3T1QA 2FPGA 1H2FA 4Q3OA 4M38A 2VQDA 2OM2A 3V7WA 3AKEA 1HGXA 3ACBA 4KPEC 2PYDA 1Y6GA 4YJ2B 3KD2A 5IANA 4DCVA 5JXHA 3OFND 3AMVA 1ML3A 1PK7A 4C29A 3NAGA 4IJKA 1XRSB 4LFCB 5DBFA 2XCTB 3NPAA 2E1PA 4BNYA 6ADHA 1U04A 3P26A 4ZVMA 4AF6A 1E5DA 5IARA 2AFHE 3CNNA 1M8PA 3OT1B 1L5HA 1LW6E 3TE6A 1BHJA 2VLIA 3ODGA 5CRIA 1YH3A 1E3DA 3D1JA 1MGPA 3T12A 4B3CA 3ZVMA 2PMCA 1VRWA 4UHFA 3CUWA 1XCLA 3Q8WA 3L79A 4RC9A 3ZDQA 1BFDA 1UJ5A 1JFFB 3RTAA 5HZMA 1KJNA 3GNTA 2HSJA 5TMPA 13PKA 4CE6A 2O0JA 2ZYDA 2JGMA 1CFZA 3I4LA 1QC5B 1OLUA 2AKAB 2E49A 3P9YA 5AKKA 3SOPA 2C88A 3I9OA 1IM5A 2P40A 2IY9A 1N2BA 5IF9A 1BA2A 1EVZA 2OV1A 2WUEA 3QNUA 5FPYA 3TFOA 2ZITA 4TWRA 1XR3A 4F93B 2WWRA 2QR3A 4MKXA 1XDWA 2HHLA 2JEOA 2C2KA 3ECAA 3MCTA 2J6CA 4X3PA 4CMEC 1QIDA 3D9QX 3MW8A 2AUNA 5EE5B 1NU6A 3KOWA 4FYXA 1M2NA 4L0DA 1HQDA 3L7IA 3WFIA 2DERA 5I5GA 4CFZA 4IDEA 2GK6A 1ITZA 3U0VA 4YV0A 1NE7A 2OG2A 1G7TA 1T1EA 3BD6A 3I4FA 3ANLA 3HO8A 3Q3HA 4QFDA 1CQWA 2IHZA 4R01A 5B36A 2FSPA 3WQQA 3NB0A 3B1JA 1A8PA 2B1QA 3NNDA 3PJFA 4R1TA 3SBOA 3U7RA 2EZ4A 2YXNA 3LMKA 4U2EA 5JDIC 2V8OA 1QVRA 5DT2A 4ENQA 2VVTA 2JAHA 3JCZA 1UMBB 4W82A 3HV0A 1UXHA 4JLMA 2YFKA 5BORA 4PHGA 1ZK0A 1WHTA 5CMLA 1CRLA 1IPFA 1K8ZB 1MO2A 1MX1A 1PX2A 2ZRLA 3A9RA 2VJNA 3R0QA 3WOHA 1DS6A 1KQGA 3DOEA 1ZKDA 4I1VA 3KALA 3RG8A 1BGWA 3VR4A 4I3FA 3WKAA 3IKVA 3ROEA 3U0BA 2NWQA 4AZ3B 4QQKA 2ZE5A 3A1NA 3CRZA 4Q05A 4RADA 1WCIB 5T57A 1KZ9A 1QB8A 1YDEA 2JLSA 2W22A 3NBAA 1F17A 1G3MA 2C96A 3VFDA 2NU8B 4XB1A 3B2QA 1R0ZA 1VJ0A 2ZJ6A 4FFOA 4YRPA 4DR5B 4UM7A 3ANNA 1PI3A 3L4BC 1A8UA 2QVYX 2WIJA 4WNIA 4HB0A 1QCYA 2O8EB 5K6TA 2O1SA 1DAKA 2UVDA 1A9TA 1LQTA 2IXDA 1KRXA 2ALJA 4ND8A 1IY0A 1D2GA 5CA1A 4TKMA 5KVCA 1O95C 4V38A 1AN9A 2ORYA 4V3CA 4CETA 4FB4A 5EFOA 3L4EA 3CURA 3K2BA 1U1FA 1XN4A 1ZESA 2JZOA 3D02A 3GVXA 4INOA 3W04A 3WDSA 4DC0A 3UK2A 2PX4A 4J2OA 1DJOA 2HSDA 3BPSA 4JT8A 4NOLA 4NZZA 5AKGA 5EZ6B 1K9VF 4WK0B 3PIIA 4D4JA 2JH8A 2W8BB 3CRW1 2HBQA 2R00C 2WFAA 4HLNA 4OHZA 3O83A 3B6EA 3FTDA 1KI9A 4NFYA 5A6VA 3PNVA 1XEWY 2XYVA 2PUGA 3E4CA 3DVAA 1XJWA 4DNQA 3UUWA 1U6KA 3FR8A 5LP6A 1Z15A 3LQ1A 4UNIA 1WUJS 3K1TA 5KCZA 4UE3S 5DCUA 4W5WA 3INNA 1V4NA 3JQPA 1EXMA 1I3MA 4JC0A 3V2UA 5JDIA 1ZMOA 2GCOA 4DRZA 4BCDA 2AEFA 5FUYA 1MV8A 3DCNA 1R0XA 1T3HA 4BP9A 3D8SA 3KLNA 4KR7A 3V48A 2Z2ZA 2BFAA 4U00A 4B40A 3L49A 4WNYA 4P3OA 2NZWA 3QFFA 3R3UA 3WKEA 1GARA 1NASA 4FIDA 5FOVA 2I3BA 3H7IA 3K8QA 2YW9A 3L5OA 3WLAA 1KYTA 3UENA 3LC1O 1IONA 2QHXA 3LECA 5BOSA 4HWOA 3UAXA 2GI4A 3L8CA 4C2BA 3LBNA 1QFZA 2QVXX 4OFWA 4BNDA 4HTAA 3P20A 5LDGA 5FR1A 1GGHA 2H1CA 4HL6A 4NCJA 4XWYA 4ZO9A 2PCLA 3KSBC 5EMNA 1ZD2P 1KYQA 3AB8A 2O3UA 2VHEA 2C7BA 4J0HA 4F60A 1T15A 2JATA 4U7JA 3SS9X 2EG5A 2P9BA 1PJQA 3ZI0A 3OTIA 1H5QA 4YGYA 4Z9AA 5B7GA 2X4DA 4D46A 1NQ5A 3SQWA 1KEEA 1DBWA 1B1CA 4HFJA 5KHOC 5IABA 4LECA 5KAPA 3HM9A 4RMNA 2CZQA 4V0QA 2FDCA 2O0LA 2ZRMA 1NXOA 3ROFA 3G5LA 2YIJA 2CFCA 4U7PB 5FNZA 5LQUA 1AK9A 2CLIB 3F78A 4DLAA 4NXMB 4W9MC 3QVVA 5KNBH 1G3IA 3NATA 3FYDA 4H1UA 2Q99A 2ZIUB 4JLJA 4GWGA 4YUVA 1KI6A 5K2OA 1MENA 2A35A 1OREA 1A2QA 1PWZA 5J2UA 5C7IO 3COWA 2W2VA 4YP1A 4B5LA 2ZYIA 3ZLTA 5CNKA 4ZKEA 3VTAA 4CXMA 4RY2A 2NSHA 4A2WA 4G0PA 3BWDD 3JYNA 3UXHA 4U3JB 1L7EA 2Q4BA 1HYGA 4MQUA 1F2DA 1YDMA 2AF3C 2ZWAA 3CXRA 3P5SA 4G0QA 2GPBA 2ZK7A 3O90A 1VYUA 5JADA 5JAUA 3MOSA 3WRYA 1WU7A 5JNLA 1DIRA 1R6UA 4OIMA 1WP4A 1AKTA 4DZZA 3TQCA 1QU2A 1FUUA 3AJ9A 2XF8A 3E9DA 1I14A 1XQWA 1DKOA 4OHVA 5FBVB 2I4LA 4DC9A 1ZQ1A 5DNUA 5F77A 5FWNA 3ANYB 1M2WA 1Q16A 2YH2A 4ZO6A 2PXHA 4R0MA 1H0RA 3Q0TA 4GC5A 1D04A 3HB0A 4RZXA 2QPLA 4LNHA 2H06A 3JTEA 1DCFA 3I42A 1AF7A 4IIVA 1BDMA 3DBRB 4EDFA 3IUBA 2ACVA 4KDRA 2NQ2C 5TQ0B 3A6JA 4IMIB 2ZUVA 5ESWA 3ZE1B 2JAXA 9ABPA 1LVGA 3M49A 4ZT5A 1DTEA 3OAAD 4OO3A 4RSGA 5DI3A 3VDQA 5C8YF 3CXUA 3B3GA 4AG5A 1L4YA 3SVTA 3Q9SA 4G67A 1P44A 4HPJB 4LYJA 1NVTA 3CVJA 3ZGVA 2VHZA 2CNLA 1POXA 2ZZNA 3LTNC 4MQEB 3P9XA 2FP3A 1LI7A 4BN5A 3GLQA 2NADA 3G2PA 3NETA 4II3A 3UJDA 4QBFA 4E30A 4M53A 1SUWA 5FUMA 1RM0A 1IVNA 1G64A 4ETMA 2OV4A 1A8SA 3N2ZB 4W8HA 5CXXA 4C9BA 4XAQA 4K6OA 1GQ2A 2FUNB 4URZR 4N7RA 5CFMA 1LU9A 1AZWA 4B33A 1LNQA 3CKYA 3S40A 2BZ1A 2NU6B 1MH9A 3GPIA 2NAFA 4HH1A 4F0JA 4RGYA 4K6GA 1RHKA 3VR4H 2PUWA 1U28A 3GRAA 4HAIA 4MDYA 1CX9B 1Q7RA 3VVLA 2JLBA 4MWGA 1WXWA 3R20A 3RIMA 4XR4A 4C0BA 1OBHA 2VUTA 3P71T 2I7XA 3PJEA 4WY8A 3VA7A 3WP0A 5FADA 4L5CA 2DSNA 2JAUA 1I3NA 1CZNA 4IUCS 1EZ4A 3SIPA 1BEUB 2PGIA 3OQPA 1RE0A 1VCIA 1E2DA 2VPQA 3CNEA 5DNDA 5FJIA 3TVYA 1OXUA 4NSNA 4C0KA 4EF5A 3KQUA 3PDWA 2P2SA 4OH1A 1QZ3A 3IAHA 1ADJA 3M3DA 2WIAA 4U6NA 2GX6A 3A32A 3E05A 3M4XA 1CFJA 3UFXB 5BQ5A 2KI5A 2FPIB 5D6NA 5B58T 1AKRA 4JOSA 4K6MA 5LOVF 3GT0A 3O8DA 3EXHB 4UEWA 1E2KA 1GT91 1T4MA 2MSKA 1P1HA 4RLHA 1AQIA 4LPKA 4QQ8A 4YAFA 4EA7A 1W0JD 2J0UB 4CLXA 4IOJA 1I1NA 3G82C 1ZWKA 1ZVKA 2HPAA 1YB6A 4MV5A 3BRQA 4OA5A 3D4IA 3EXAA 1UC8A 3PUWA 3T3MB 4Q0MA 4MVJP 5EKXA 3ZIUA 1EG2A 1AUXA 1H2HA 1QAOA 3EAQA 1FFSA 2JRCA 1BXGB 3HKBA 1KEKA 1HT0A 1TAGA 1M9NA 4PZEA 5MFZA 1HNNA 1TUGA 4U7DA 2GD6A 2QN2A 4KAFA 2OK8A 4RHEA 1J20A 5T6MA 2DUWA 3RTCA 2FMTA 3AKZA 3A6HA 2I67A 3H83A 2O06A 4JEMA 3ZCXA 2IU0A 4IQ4A 2H4FA 4E15A 4LF7B 4OJKA 1XCJA 4CDNA 1QO7A 3HEMA 1FNSA 2Z4TA 1JE1A 2MWMA 1OA0A 2H1HA 1I3CA 1I24A 4IS2A 4Q39A 5AJHA 4E6EA 4EYKA 4GP6A 4FHGA 2B82A 2ZRHA 4EKGA 1Z6PA 4BUCA 4ER6A 1R9GA 2PZAA 1L9KA 3L18A 1Y8QB 1TA0A 5B1SA 4PQGA 3UCEA 3ADOA 1I9CA 4CMIB 4CKBA 4DR7B 2QYOA 4IG4A 4X54A 3EVBA 4QU9A 1KU0A 1ODJA 1Q7BA 2PKWA 3PENA 1E7SA 1GG5A 1ZCAA 2ZG6A 3VZQA 2FW6A 5M04A 4CM3A 2M98A 3AR9A 3DNPA 1NDUA 4B09A 4WLOA 9LDTA 1C2YA 5HS4A 1I1HA 5J4YA 1THGA 5KTOA 2H4WA 3IUEA 3M8KA 5HE9A 1SHUX 3O8QB 1SBYA 5F1YA 2R6FA 1J24A 2REBA 2RGAA 2G70A 2WE7A 4HAOA 4PAOA 3AINA 4NHOA 5JSFA 1E9BA 1IUPA 4Y2PA 5EWMA 5AW6A 5C7YA 2OAEA 1QOPB 1ILWA 1XV5A 3UAVA 1Z4JA 1D2EA 3QKUA 4ZT7A 4B4WA 1USUA 4FJ1A 5ALTA 1CWUA 1PSDA 3HLKA 1X7ZB 1Z16A 3AV0B 4A27A 5EYPA 5AQ1A 1Y48E 1IN4A 2BEUB 5KCMA 5A5DA 3DWIA 1Y4UA 3UTDA 1EG7A 3OQIA 1SCQA 5AKJA 1PGPA 2OCKA 1B43A 1DO2A 2HBRA 4GF5A 2BR3A 3BMOA 4GM1A 1L5LA 3WNCA 2ISQA 5JI2E 3FX2A 3K70C 4RX1A 2QRLA 3N0XA 1LLUA 1N2HA 2H2FA 3EQ6A 2R62A 1MQSA 1YHYA 2C8KA 4UAJA 5E4FA 4GPBA 3WNBA 4DAOA 4LE0A 3LBFA 4MGKR 1JIUA 2QVCA 3ORHA 4TKLA 4D6PA 1E2MA 2HJWA 3I45A 3OPVA 3X1YA 2OY0A 3NGLA 5HCNA 1T6ZA 4MGYR 4NZPA 3FIUA 4NY1A 3E18A 3N6VA 4HX9A 1EA7A 1V0JA 1V95A 2H1VA 4MRVA 4O4IA 4URYR 1KAQA 3THXB 4EFKA 3VHRA 1CYEA 3HYSA 3GRKA 1Q7CA 2FR1A 3AKDA 3I9MA 5AKXA 1G20B 5KINB 4Y18A 5K09A 1E7YA 1KK1A 1O77A 2JJYA 5HE8A 2RHDA 2YJTD 1H2AS 1TO2E 1UMCA 3Q85A 3TIGA 2GYVA 5FAXA 4BU0A 1PQPA 4R1OA 1IJFA 4CQNA 4I5DA 2WOJA 3SFVA 2VYVD 3D7KA 1EESA 4X6XA 3N70A 2PUAA 3UKJA 3GRCA 3D4PA 3TD6A 4NXNB 1YQQA 1Z4QA 5JQGA 3O82A 3L0BA 4YIKA 1BWQA 1C3OA 5AKHA 5G1OA 5CFRA 5KJ6A 3UCXA 2I6TA 5EIOA 5JAZA 3PD7A 2BEWB 2R8ZA 3GGGA 4WBSA 3LCRA 3KSRA 5CUQA 3UWSA 1WMEA 3ZIAA 1IXRC 1PNQA 2C9YA 3GUCA 3KZNA 2J85A 4D9KA 2AN3A 3TQRA 1D2CA 3R40A 1CUBA 3RC8A 4DQXA 2JG3A 3GEMA 4P08A 1OT3A 4XDZA 1AS0A 1D2RA 4BVEA 1S3SA 1B93A 2J1LA 1TVKA 3SX0A 5LYJA 4QPJC 5DSXA 2GAJA 1DTWB 2AE1A 1T1JA 5BR7A 4G97A 2MYNA 1YVEI 4TKUB 3RVLA 4X93A 3K73O 2DBVO 3E4DA 4J16A 1EFDN 4F2HA 1T4CA 2XVXA 3GP8A 1GUAA 4KRYA 4QPPA 4GPZA 2ZJYA 1VCNA 2XNHA 2VCEA 3H0EA 4RA9A 3ZLJA 4MS4A 1ZN7A 1NLMA 3H1FA 4TL8A 1VI2A 5IF3A 3QSYA 4DMRA 3ZWNA 3G0DA 2JIQA 4NICA 4EPTA 2CXOA 2BKAA 2RHCA 3Q3CA 4KDFA 5LDDC 1H4SA 3EY9A 2V0CA 3I6ZA 4W5HA 5AK6A 5BSWA 2VR1A 3IAEA 1XEFA 1Y5IA 3AONB 1D6MA 3OE7A 4EGJA 3G2QA 5LZ2A 4UZSA 2B5VA 2GCNA 1FDIA 1EHYA 4EMSA 3DL2A 1E0JA 3RWBA 2WSIA 1RE1A 2MSDB 1CRPA 4M6WA 3IKTA 3C7KA 3H2HA 2XUZA 4OAOA 3SBEA 4UUQA 4AQYB 1M1YA 1IWBB 4UNPA 1CUDA 1L7OA 4QOJA 3C3MA 3HUFA 3O93A 3G0OA 5ESDA 5JYCA 4F3TA 3KVVA 2LWIA 1UK9A 2GPNA 4NAUA 2ANCA 4OJQA 1U5CA 3DW1X 2ZWPA 3FJOA 2ZS9A 3NW9A 2JI7A 1EAMA 1RI5A 5GJVC 4NNPA 5ALHA 2WJHA 3KM0A 3T7JA 3UT5B 1YB5A 1ZH6A 1TGVA 3RJ9A 3THYB 4A15A 3SQXA 3B3JA 3CT6A 3TM4A 2X1VA 1RLOA 3WZMA 1RAEA 5ICEA 4MWCA 2HD4A 3TTVA 3DE5X 3KB1A 4IJMA 2C4HA 1DEKA 2NAPA 3AUKA 4X7MA 4K9QA 2R6AA 4R2JA 2NP6A 1SRQA 1ZD5A 4NTZA 1Z5OA 1A4XA 4YDRA 2O8FA 3CEJA 5G1NA 3LUCA 2XRMA 3RLIA 4M36A 1RHJA 3L8ZA 4BLSA 3H9QA 2PQ6A 4UVDA 5EKDA 4P0QB 5DTMA 1NKSA 4O08A 3FVVA 4IDBA 3HCPA 4JNCA 4LAFA 5AJTA 2QX4A 2YS7A 3RDPA 3RHTA 3O3OB 1E1LA 3D2LA 3GWZA 1IHUA 2Z1NA 3HBJA 3KPWA 4U1RA 5EIBC 4A4DA 3CCCA 3G6KA 4MUYA 1QRDA 3K1YA 4X65B 3HA7A 3ID6C 3GAMA 2A67A 1QX4A 1MFZA 2QJTA 3FY4A 3CC8A 2R6HA 3T9AA 1RJFA 4YJ2F 5C5IA 3R7NA 4R9NA 3ZHCA 3OZSA 1NUSA 3Q11A 3EXIB 1ZAKA 4Q93A 5ALQA 4WAUA 1W1IA 4E4TA 1PWYE 4YMHA 4BV9A 3IV6A 3R24A 5K01A 1V43A 4RXMA 1WMSA 1TM4E 1U8XX 1B76A 5EE0A 1KZ7B 1R4NB 1ZR2A 2ZXUA 1G8HA 4PGMA 1RAFA 1YDGA 4D8WA 1N9GA 2WSMA 1JR3D 3GCZA 4PZZA 3ZWCA 3STWA 5KYYA 2D7DA 1NVBA 2FX3A 3HRKA 4LF8B 2F3UA 5AXBA 2TMKA 2XNJA 3MZ0A 2AGVA 4WZAA 3PSAA 4KV9A 2ZJ7A 1A2OA 1NOIA 2GXQA 2ZBGA 3ZWXA 2J0EA 4BBJA 3AEQA 3OZAA 2EIXA 4MWOA 1XK7A 5M34A 2QAIA 1Z56C 2AXPA 1D0SA 3GL9A 4J7AA 2WB2A 2ZTHA 3BTSA 1P2FA 1O1YA 1X0VA 1E64A 3PUKA 3QV1A 4HX2A 2ECPA 2QMUA 3QX7A 4JQOA 1YIOA 4TS1A 1H6DA 2PV7A 5AJYA 3MOIA 1NHWA 1Q14A 1G2IA 1X2BA 1VBKA 4EFMA 2FOXA 1ZH4A 3OPXA 4BVHA 2E4YA 4J75A 1SA0A 1C1XB 2EWMA 1KEWA 1UKEA 4QEDA 2GFIA 2X40A 3PQFA 4XQGA 5KHAA 3W5DA 4WGGA 3FNHA 4IZOA 4NU0A 1ZD9A 4OCZA 3V4RA 3KC2A 1A2KC 1FU7A 5TT0A 3AVUA 2W6CX 4O4JA 2ZIAA 4CKCA 5JS6A 5IH7A 2XGJA 1C0EA 3W6OA 1G19A 4EYQA 4PXYA 5A02A 1TYAE 4RORA 4EGQA 4HYYA 3LS2A 1OH5A 1ZKMA 5G0WA 3LPCA 2ZIXA 3IJPA 2VEDA 4AC9A 3Q5EA 2PGJA 3K0CC 3NIBA 1Z5ZA 4I66A 5IC4A 1OR8A 2WJZB 2XA2A 3HU3A 5ITZA 1NXXA 4OYRA 3VTZA 1W4BA 1HQCA 2J9FA 4HAUA 3GI1A 1ZJ4A 3PGJA 2AC4A 2VXBA 3SYRA 4YP7A 3T9CA 3Q2OA 2FZWA 4KXLA 3FTEA 4GBGA 4L51A 2WAMA 1Y7HA 4A2QA 1KI1A 4XFJA 4A6XA 1X87A 1B8NA 4WCFB 4LOHA 4ZVNA 2W58A 3L0DA 1V1RB 1A8HA 3QBVA 3IAUA 4GX2A 4TUYB 4DJ5X 1ZOIA 4CF4A 1ZNYA 2SHKA 1YQGA 3PC2A 5DE3A 4D4KA 2HT1A 4IYRA 3LQYA 2PZGA 1I4EB 3EISA 4EG8A 2WRZA 3K6KA 4YCAA 3IGFA 3BZWA 1RXIA 2XJ9A 1L4NA 2XRFA 4AMUA 4Q4AA 1DIGA 2B3TA 4RA6B 3E35A 2V3WA 4FNMA 2B9VA 1M8GA 1DAHA 1F6DA 4FC6A 3M2PA 5JZOA 3LIIA 3RPEA 2BMJA 5BV8A 2E4WA 3I01M 2QTWB 3ZY2A 1AKMA 2HB6A 3HKCA 2GN2A 3QU2A 1FJGB 3K9HA 4FJ2A 1BW9A 3CCFA 4C7KA 5K6RA 1GYPA 1MU0A 2IRWA 1X1CA 2NUTB 2F2TA 3OH8A 4RF2A 2VNJA 1ESZA 2W6IA 4DDUA 2X2EA 4GYKA 4B3MB 3NC1C 5LQKA 4EG1A 3B6IA 3PGMA 5F7ZA 4FGJA 3ZBQA 2WT8A 4R69A 1GL9B 2J5QA 3ORSA 1TUEA 5KYTA 1FJXA 3DO5A 1Y4AE 2JLCA 4LMAA 4N3BA 4JI4B 3U4MA 1AU9A 3O6VA 3UHAA 4Y6RA 3TXXA 2ZAGA 1NSYA 1UMDA 2DFNA 3FN4A 2J3DA 1RWXA 4DVJA 4ODIA 5M5BA 4MMZB 1SVKA 5ED4A 1RQ2A 4BQNA 4A6EA 3H1BA 4I9NA 1HTTA 1R66A 4RH1A 5JARA 1EJ0A 1ENOA 1NUAA 3EIOA 4L5JA 3ECCA 4RZUA 1M83A 2GJSA 3SSOA 3KFVA 5AHKA 1P18A 1ZGCA 3O92A 2AVDA 1PWXA 3AOEC 4IIGA 4Y1RB 1PFUA 5AK3A 2HUPA 3FKJA 2WHQA 3FMPB 3VR5D 5K0CA 4QPDA 1E2HA 2JS7A 5HSGA 3FSEA 3OM0A 4CQMD 4L8LA 2C98A 3JYHA 4NV3A 4IHAA 1UDCA 1VL8A 4Z86A 1B4DA 3U49A 1ZITA 1E89A 3L0OA 3NHUA 5ARDA 3WK9A 4C88A 1V71A 4M7WA 4Q9KA 1JIJA 2H1OA 1LNZA 2RHLA 3HLYA 3I32A 2PXAA 2Q21A 2CT8A 5FR2A 1FFGA 3ZI7A 4JB8A 1Q57A 4HF7A 2GF9A 5KVQA 1SCIA 4QOSA 4FEEA 5EJGA 1IB6A 1T8TA 1C3XA 3EQZA 1UJ4A 3CF4G 3F8SA 4CM8B 1N7HA 1W44A 3F7OA 5E4YA 2XBUA 1JZSA 1ISMA 3S7TA 2A58A 4MDFA 5T6BA 4XASA 4RIFA 4C6HA 4ES6A 3PA8A 4MCJA 1FXUA 1JQBA 1D4ZA 1DEOA 2QTHA 5DDIP 3S3TA 1TF2A 2P6PA 4CQMB 1UEJA 5KOYA 3ZH9B 3LP6A 3R76A 1SCBA 3NJ8A 1UQTA 3O1IC 3SWWA 2W2LA 2IP4A 1G16A 2GLUA 3FFAA 1EMDA 5K9ZA 1DHRA 2AD5A 5CCBA 1OH6A 2Y0EA 2Q3FA 5LBUA 1T36A 3FUWA 2G88A 1K5PA 1JG4A 2J9XB 3HY3A 4J0DA 3DFFA 1SHLA 4MRNA 3O8CA 2ZBDA 1Y3FE 3ENKA 5TQ2B 2ZPUA 3D6AA 4RPHA 1F5NA 2R87A 1FSPA 4DNOA 3A4YA 4FUQA 3WXMA 3MTQA 2XUOA 2INGX 3SDBA 4BQQA 2G17A 1JVSA 1SVSA 2WMNB 5BVGB 4ITVA 3SLKA 5ILOA 1JFTA 3QTTA 3HYTA 1E3WA 4DBVO 4HS4A 3MVEA 2WHYA 2UDPA 1D2NA 3E9QA 4RD2A 1V5IA 1OI3A 2ATIA 3PI7A 3DMTC 3ECSA 4QM6A 1B00A 2Q4DA 3SYKA 1WKBA 1XKTA 2VQSA 1E7RA 4NAHA 1KTIA 4DV6B 3N6RA 3WAKA 4HRAA 5C1OA 3KQWA 1YVDA 1V11A 1GNSA 2I66A 2R6DA 3MWJA 2JB9A 4JKYA 1P91A 4YJHA 1QKKA 4HPWA 5TNXA 1BCRB 3SBXA 4FOSA 4XD7D 1YGYA 2HLDD 1V9SA 1CY7A 1DBSA 5IHPA 3O7WA 4A6PA 3DBHB 4ITRC 3RYCA 4ADSG 5JUWA 3U5ZB 1KOGA 5U4XA 2BFPA 1F06A 1I2CA 1TI7A 1USWA 2XWSA 3NBFA 3W2GA 3HM2A 5B57C 1GGFA 4ETWA 1U3WA 1BH2A 2EDAA 4O2AB 4BEBA 4BNTA 3JX9A 1GQYA 5ALGA 3OQHA 4P7BA 1NWCA 2X5OA 1G5IA 1FSGA 4H59A 4KXXA 1P1CA 4MYHA 5SICE 4BEJA 1WUIS 1NVVR 2YJZA 6PFKA 1R0LA 3E8MA 4JP1A 1R64A 2ZQYA 4YREA 3IUYA 3LH5A 2RGNA 1NI4A 5EEHA 5FO1A 3Q9LA 3FGOA 1Q0ZA 3UK7A 5E4TA 1TZCA 3H6GA 2BONA 1BN7A 1U2ZA 3ELBA 4ITUA 4H60A 3FHOA 2FSSA 3PR2B 4CBVA 5KNDD 1B41A 2WM2A 3LQKA 5C37A 1G9SA 4AJLA 3TRFA 1FA9A 1XFDA 2XMSA 4X3CA 3FWZA 1R4AA 1A5BB 2C78A 1Y9JA 4L07A 1U8UA 2HPVA 3VR3D 5IM4A 1IK4A 5HK9A 1FYDA 4FR5A 1MC8A 3UAYA 2HZBA 4L3VA 1HR0B 5DKFA 1A27A 3ZJVA 3GHYA 2P3OA 3BD8A 3P4YA 4O0MA 3BAZA 5FP0A 3BCRA 3OJCA 3EVFA 3DFIA 3LY7A 4E12A 3VVBA 5E3JA 4G5FA 2R11A 2Z0MA 5LUBA 3OC0A 2XB4A 2I2XB 2C20A 1PJLA 3MB8A 4OXKA 2M6KA 3E9ZA 2GHIA 4YT4A 1QKIA 1A9PA 1DWPA 1LTQA 1N7JA 2WM3A 3EWSA 3LYAA 5KOHA 1F8FA 3G9UA 1CY8A 2IYZA 1U0FA 2Q3EA 1Y1QA 4HZGA 1ZN2A 2F48A 3CZ4A 3ZHOA 3J81k 1QBKC 2IHUA 3IPLA 3L7KA 2IEYA 1D5CA 4I4TB 2NZ8A 1G8KA 4YH1A 3PVSA 3BB3A 1M2OA 1J5PA 2G82A 3LT2A 2X3FA 4J0JA 4ER0A 4BBZA 2ID7A 1DKMA 3KVOA 2HA2A 2R44A 3PBKA 3JQ8A 4MVJE 3B48A 2BCEA 2QN9A 3H1EA 1EK1A 1XROA 4PC1A 1Z0KA 4UFNA 1B16A 5BRNA 2CD7A 2VQFB 3DDZX 3QU9A 2P30A 4DUYB 3G0HA 3U7QB 2PX2A 1QIEA 4MQFB 4NV1A 1CP2A 3EMKA 4GXNA 5G4KB 5KYUB 3AEUA 2I4NA 3K94A 4R51A 3M89A 3NBQA 3R8CA 3B51X 4R9SA 3WIOA 3GFOA 3I3SR 2O8BA 2XOKA 3IDFA 5B3AA 4BO2A 2F43A 1K6EA 4YALA 2W0MA 4FVTA 1C9NA 4DWWA 1Q7EA 1D7AA 2WI8A 3H3FA 3JQGA 1X9GA 5DW3A 2WWYA 3VPBA 4LV8B 5KWVA 4C87A 3EGVA 4POAA 1EM8A 1OI4A 3E9RA 3TEFA 1QQBA 2ZXEA 4BX0A 1N2SA 1KZYC 4IDAA 1I7LA 3CONA 4E5DA 4BFYA 3AFHA 4TT8A 2FE4A 4J1NA 3ZNQA 4LF4B 1K2WA 1Q1ZA 1QHEA 5D85A 4LSGA 2R0QC 3VR2D 2NMVA 2NXWA 4CHGA 1ZN8A 3VU9B 3BILA 1EFPB 2E5LB 2XCSB 1ZUWA 1EVEA 2ID4A 2WWWA 3URMA 1EVJA 1FNBA 3CUTA 4D9JA 4DYDA 2O8VA 2PEYA 4QGBA 4BNZA 2B8EA 4HRYA 4BNVA