3FCEA

Crystal structure of bacillus cereus d-alanyl carrier protein ligase dlta in complex with atp: implications for adenylation mechanism
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
504
structure length
500
Chain Sequence
MKLLEQIEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRIVSEDNLKDIFFTHKGNTPNPEHAVKGDENFYIIYTSGPKGVQITYNCLVSFTKWAVEDFNLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARPKDLFASLEQSDIQVWTSTPSFAEMCLMEASFSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEATVAVTGIHVTEEVLDQYKSLPVGYCKSDCRLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAFTMIDGERAYKTGDAGYVENGLLFYNGRLDFQIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSEVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-alanine--poly(phosphoribitol) ligase subunit 1
publication title Crystal structure of Bacillus cereus D-alanyl carrier protein ligase (DltA) in complex with ATP.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Ligase
total genus 150
structure length 500
sequence length 504
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3fceA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fceA01
3C5EA 3DLPX 3B7WA 4RM2A 2D1RA 4PZPA 3T5CA 4U5YD 3R44A 1LCIA 1MDFA 1V25A 3LGXA 3IEPA 1MDBA 4G36A 3QYAA 1T5HX 2P2QA 5IFIA 1AMUA 3WVNA 5K85A 4GR4A 3T5AA 4RM3A 1MD9A 5DWVA 3ETCA 1YJ7A 5KYVA 4LGCA 1V26A 4R1LA 3O82A 2P2FA 5BSMA 4RVNA 3VNQA 3E7XA 4M46A 1PG4A 4D57A 3CW8X 3RG2A 3G7SA 4IR7A 4RVOA 3NI2A 4E5DA 3WV4A 4GXRA 3FCCA 5E7QA 2QVZX 3U17A 3O84A 2P20A 4D4GA 4RLQA 4D4IA 2V7BA 3A9UA 4OYCA 1ULTA 3L8CA 4G37A 3DHVA 4GR5A 3EQ6A 3PBKA 3KXWA 5K8FA 5D6NA 2P2MA 2VZEA 5KYTA 2D1TA 2VSQA 5BSRA 5BURA 5BSWA 1BA3A 2D1SA 4D56A 2Y27A 2Y4NA 3LAXA 5GTDA 4WV3A 4R1MA 3CW9A 4ZJZA 3NYRA 2P2JA 3IVRA 4FUQA 3IERA 2QVXX 3WV5A 1T5DX 4W8OA 1PG3A 3E53A 5KEIA 3ITEA 4EATA 2WD9A 3U16A 4FUTA 5JRHA 3RIXA 4GXQA 5BUSA 2QVYX 4RLFA 3DAYA 2D1QA 4OXIA 4ISBA 5BSTA 3VNSA 3IESA 3O83A 5BSVA 2P2BA 3T5BA 3E7WA 3LNVA 4GS5A 5DV9A 1RY2A 5BSUA 4D4HA 4IZ6A 3TSYA 4R0MA 3GPCA 3NYQA 4DG9A 4RMNA 2QW0X 2Y4OA 3FCEA 4DG8A 3IPLA 5BUQA 3A9VA 3VNRA
chains in the Genus database with same CATH superfamily
4FCWA 4WZBB 3UUGA 3L8GA 5EJ5A 3RODA 1N6KA 3G0IA 2FSIA 3ROFA 1BXRA 2JEOA 3M89A 1SK8A 5HFNA 3A6DA 4HLCA 1JAXA 4RY9A 2H7CA 3IBSA 3B2EA 5K0ZA 4YTEA 2Q1SA 2PSDA 2PZAA 2FWPA 1CJCA 2X19A 4YHHB 2A59A 3B1KA 1A8UA 3GDOA 1N9GA 4H6XA 4JNKA 1PW5A 4JLJA 1WXGA 1VKNA 3CRVA 4NEHB 5K8UA 2IYLD 5IM4F 3YASA 1E7SA 5JJLA 5JXJA 3ZS8A 2CHVA 1P45A 3C8MA 5AK6A 4BJ3A 2WJIA 3WYAA 4KO3S 1C30A 1C9YA 1YL7A 1PUXA 2HHCA 1EBBA 2BZGA 2KE5A 3L02A 3OLCX 3PFKA 4M46A 2FDXA 1L7AA 2LWIA 3FFAA 1GL6A 4OYHA 4W7HA 4BLWA 2XYVA 3ESDA 3CPSA 2QY6A 5JNSA 1YULA 1AJEA 5F21A 4Y9UA 4DCPA 4IHJB 2G08A 3H97A 5DTJA 3U44A 1ETUA 1QB8A 1S8OA 2FWJA 1SCIA 3PF9A 5EE0A 3TQCA 5IJ9A 3FPJA 3F90A 3MG9A 1ML8A 2O7VA 4I9NA 1MC8A 3LMKA 1NDHA 2Q99A 4P98A 3TL2A 4BAZA 1YTLA 5IHXA 1UXGA 3RIMA 4REQB 3D3EA 4PRKA 1OH6A 2X5XA 2J7KA 3KWMA 3P9RA 3ZZTA 2GDJA 4KAFA 4PG8A 3D4PA 3LKZA 3N07A 2OO7A 1YOVA 1YVDA 5AM4A 3C5VA 4D4JA 3Q5GA 4BLUA 2PROA 5B7PA 3VYUB 1TKCA 1FZTA 1JBKA 1A50B 3ZBPA 3QVTA 4DLLA 1PWHA 2NN3C 4P32A 4FWTA 1UZAA 2IYRA 3E3LA 2GHIA 2GCIA 2IF0A 2JHFA 4DRYA 1S2NA 3PC2A 4KV7A 2X6TA 4IJWA 1QGED 2E4WA 2IEZA 1B0PA 5LQUA 3AMVA 3R6LA 4LFBB 1CJSA 1R8XA 2AX4A 3DV9A 3E48A 3WL7A 5CM2Z 4AJ4A 4MS3A 4PUGA 4W8GA 4MQLA 1JYEA 2ZKIA 2JGKA 3GRPA 1UP4A 4C21A 1NOJA 4MWGA 2BEWA 3BK1A 3BWMA 1KEEB 1Y4ZA 3ETDA 2J3QA 4MV0A 3EXEA 3UV7A 4C7BA 1I7PA 1LVHA 3DQPA 4DMFA 2OK8A 2CMGA 4GKJB 2HEIA 1PFQA 1XDWA 3NYWA 1JAIA 2IHKA 4CCAA 4RZ2A 3QUSA 4DNFA 1NTOA 4ICIA 4L5BA 4X20A 3A7DA 4B4UA 5L3SB 4KFCA 2BGRA 1JA1A 3FJOA 3EERA 3NWBA 2P1DA 3IKTA 4B3TB 1J1ZA 2I9PA 1SXJE 2YBDA 5DM1A 1Z0AA 3DGFC 2QPTA 4FW9A 1NYRA 4HS4A 4C6SA 2V7WA 2ZBFA 4EGAA 4XPZA 4YVFA 5ANRB 7AT1A 1E5VA 1M2VB 1S9DA 3WWOA 2ODNA 2IZ6A 2XSZD 4FJ1A 3RVSA 3Q3HA 1Y6ZA 3ZVKA 2PN2A 2YBEA 3OCWA 1I51A 2QENA 3QE0A 3BHNA 1PO7A 2XCUA 1WPGA 2E1PA 3QLJA 3R2JA 1HNXC 3HUFA 5ADHA 2F55A 5M29A 1GG5A 3TOSA 5BUZA 2HMAA 3WIEA 1S3IA 1PLLA 3FCEA 4OLHA 3RSZA 3V3KA 4OHMA 4LOKA 1DKUA 5DW3A 3GAZA 4F5WA 5BWLA 2HNAA 4RVFA 2MWMA 1SQ6A 1ZH2A 2IYWA 5I7HA 2H2GA 3SS7X 3TKYA 3KXKA 4GBED 3TQIA 1DC6A 3T9CA 1VL6A 5PGMA 3IMCA 3W5BA 3CX3A 4CTOA 3QLUA 4HWTA 3HKDA 2QX4A 5FO0A 1TFUA 4ETNA 4XX2A 2AFIB 1NXPA 3NHSA 5KDOA 4AP9A 5KJFA 1E79A 2W43A 5BNTA 2H07A 3OZAA 1G6Q1 1Z4QA 3BRWA 4KX3A 1K97A 1Z3CA 3DE0X 5A5FA 4UTOA 3ADPA 3DDZX 4RM3A 1VA4A 4LJ5A 2Q2VA 2OCLA 4NFSA 1RJGA 2JS7A 2W48A 4BRZA 2QRLA 1GPLA 2IPAB 3FPBA 3MD9A 2ZJ4A 1W0CA 3IUPA 4BMZA 3B2NA 1NZJA 3HA2A 4AUEA 3FGZA 3L0DA 2OQRA 5CGZA 2IT1A 4RANA 1V2HE 3EDMA 1BRTA 1XA4A 3UEBA 1CEXA 1H2ZA 2YQ4A 2YZMA 1KYYA 2Y99A 3I39X 5TT1A 5IWAB 1SFRA 5G1OA 1JPUA 1XCMA 2CVHA 2JEYA 1G4AE 2I67A 3ONWA 4LTNA 3CC8A 3DLHA 1QFMA 4PGAA 4Z7JA 4Y30A 5JCOC 3LBAA 1U1IA 1GUYA 2QD4A 1FEZA 1A27A 2LGJA 4IV0A 4LISA 4I4TB 3H9UA 2CXCA 3EXAA 1OVMA 3DOEA 1WMEA 1OAOC 2QXTA 4L50A 4PFQA 5A3RA 2EZUA 4MKIA 5A9TA 1QGDA 4KQWA 5FIUA 1JFSA 2QZJA 4R2XA 2IUYA 4FMCB 3HY4A 1ZD4A 4NBWA 5FA6A 2PGDA 4NY1A 3W2IA 2WM2A 1SCBA 3FYHA 4P0TA 4Q3OA 1PQYA 3CVUA 5IC4A 1A4RA 1SVOA 1T8TA 1WZCA 1SEPA 2GPTA 2PEYA 5H4HA 3A2LA 1PGQA 1XQVA 2MJLA 4GNRA 4NOLA 3URMA 2UUAC 1WLSA 2F1OA 1C3EA 3M5WA 4G5RA 4I3HA 1L7NA 2XT0A 5FAXA 1SKQA 3DQQA 3DWEX 5HIKA 3HB5X 2XGSA 3TRFA 3CRRA 2QX9A 3I52A 5C1BA 4BHTA 2P2JA 2FJPA 4UM9D 4KQCA 2ATVA 2PT9A 3RAGA 3BBPA 3IR6A 1PTJA 1YBVA 1D0SA 3WG9A 4C7MA 3EVEA 4MIOA 1UXIA 1CZKA 1JPJA 3GMIA 5A9SB 2V3CC 1TK2A 1VEHA 4AKTA 3M2TA 5EIHA 3ZIAA 4K0RA 4IS2A 3FM9A 2PGIA 3L92A 5DGXA 5ALVA 2W4QA 4YRTA 4CM6A 2B2NA 4XEHA 3UICA 2V7GA 5AKGA 4QBHA 3DFUA 5E1BA 4GBGA 5ED4A 2A35A 2QU7A 2YOFA 2Z5VA 2IPMA 3F96A 5ALJA 1C1XB 2IBTA 2KLHA 3UY4A 3G7UA 1CLUA 3MJEA 1LV7A 5SY9A 2B6HA 4M83A 1UK8A 2YOHA 1SD2A 1V39A 1VBKA 2XB8A 4LX0A 1IBKC 3PE4A 4WXPA 4P7GA 3SK0A 4UXHA 2CYBA 1MQ9A 3P0RA 2JVJA 1ZUNA 2VDLB 3MN1A 4J0IA 3QIVA 3G6WA 2Y4OA 2R00C 2W00A 1EI9A 1YDEA 4G4SP 2VXYA 1TZ2A 4IOMA 2CMHA 4DBZA 4XQGA 2WA2A 2WC1A 2AR7A 4V0SA 3AFIA 3FCUB 3CNLA 1GU0A 1T3SA 1J0DA 3K1ZA 1L4HA 1IHDA 3TNDA 1NVWQ 5JH7B 1U0TA 3KR1A 5FWAA 4NS1A 1IMOA 2ZE7A 4AJEA 3W5HA 1FJGB 2DERA 4AUKA 3LPDA 1EK2A 2X8JA 2W6QA 2BMVA 1RLUA 1U0SY 2ALJA 3SR4A 2C4WA 2P2QA 1XQXA 4GH5A 4XWKA 1WUTA 3O8BA 3EIWA 4PO3X 5ALUA 4BFXA 4S1VA 4YT2A 2KQUA 4MO9A 1KQOA 3V4LA 2V7UA 4IINA 2BEUA 3RSHA 4TTIA 4JLPA 1W5TA 1SCQA 3AF3A 5GJCA 2RHHA 4C7XA 5F77A 2G0NA 3AEZA 2YJZA 3RW9A 1LLFA 1PEDA 3Q8LA 4OH7A 3TUZC 4MO2A 2B5VA 2RJ3A 2ATIA 1TF7A 4QU5A 3MMNA 1B6GA 4FNOA 5I5EA 1XV5A 1D6MA 1HNNA 4EG4A 2E55A 1I3NA 2XCRB 1L4MA 1KR5A 3HJUA 3OESA 3PJEA 1J24A 4RLHA 2YYZA 2E8EA 3IULA 1MNQA 4PO9A 5B58C 1U9YA 1IC6A 4HYQA 4MNTA 4EEXA 5BMVB 1VMIA 4D0LB 1T8RA 3PU6A 3CNHA 3NRBA 1OXVA 3RD5A 3W3ZB 3ELWA 1MW9X 3OT4A 2IKQA 1E1LA 2R7AA 2X77A 4DJEC 2IUFA 1JEDA 1EK1A 2WJJA 2EJVA 3JAMD 4UNNA 4JOQA 3FDXA 5COQA 2NPFA 1QZXA 1CF4A 1Y5LA 1VFNA 5EINA 4Y1GA 3R9XB 1OFIA 4MRRA 4R8SA 2IZOA 1KI4A 1Y9JA 3HNPA 1LY1A 4FYXA 2QROA 5DK4A 1NHGA 3L01A 3WWYA 1N9KA 1DC5A 2QAGA 1GAWA 3D7RA 2UXCB 2ZTVA 3HKCA 1FUEA 1EDDA 1JX6A 5K3BA 1DBRA 4R3NA 3UAWA 5IZCC 1AHHA 1DPGA 3AJ9A 1E9AA 3D8NA 4RH1A 4WFKA 4JBWA 4KAJA 3SQOA 4ENQA 3TDEA 2C9CA 1P5HA 1DHRA 2Q9AA 3I4LA 2CYCA 4AL4A 4U2KA 3Q6MA 3AK4A 4KNVA 3SX4A 1IM2A 1VHQA 2EL7A 5CYFA 5B1SA 4ZEXA 4BFCA 2CD7A 2R7LA 1H0HA 3HSSA 2GLTA 5F2KA 1YI8A 3LVQE 1X80B 1KFCB 3IMKA 2ZRNA 4ETMA 1FMLA 1ZJ5A 2B4KA 4K86A 1G8GA 1NY5A 1QGOA 2C2BA 3O0DA 1EA7A 4O1IA 1ZXBA 3MB8A 3MXTA 3X3HA 3DTVB 1KVSA 3JVVA 5HZGA 4BMPB 4AFNA 1W4BA 4WIAA 1CUDA 1UOOA 2EJCA 2J33A 4HGZA 5ECWA 3KETA 1CRPA 4GAEA 2OO5A 1P4EA 1FFDA 2BFNA 4UXJA 2WMDA 3HM2A 4JUBA 2QMZA 3PHCA 3UYKA 4ISBA 4DF3A 5IXJA 1VSUA 1XLVA 1UL1X 3DLIA 4LJAA 2D5CA 1NLYA 3A36A 1BXGA 4INOA 3RQIA 3HZRA 5FTMA 2XCTB 4FTWA 3WLPA 4IYRA 3RFUA 1NLFA 1PFUA 2OBNA 4C2UA 3EHEA 1OTXA 1SXGA 4JJ7A 3A6PC 3DPSA 1T9BA 3C70A 4EGFA 3JASA 4QUGA 2YASA 3CLUC 2HC9A 3LLUA 5CJPA 3BSYA 2AI3A 4PYQA 1WY5A 1ZRMA 1E7MA 2GEBA 2Q0HA 2DQKA 1ZK1A 4LXHA 5DNDA 5CCXA 1XU7A 2WUWE 2WF8A 4R2WA 1JI3A 2Z9BA 1JIJA 4M0KA 4Q0MA 2B34A 1CUCA 1U0HC 4I14A 2O5RA 1J09A 2PX6A 2C7BA 1BVHA 5JAZA 4YRAA 4BLPA 4U2EA 4G36A 1BRMA 1MX9A 1RJFA 4PIMA 1KKGA 3BILA 3IUYA 3VOBA 4E03A 4XUEA 5KDLA 4ALNA 2OLJA 5FR1A 1U7UA 2Q41A 5CVDA 2PL9A 3I6QA 1H8EA 4KTTA 2J0UA 3GROA 4BC7A 4J49A 2VHXA 1C8KA 3OPXA 1H3FA 1JP7A 5AUQA 3GRZA 4HX2A 2X9LA 3FFXA 1JPVA 5DP2A 4YCMA 1YBFA 2HF8A 4DCVA 2XDAA 3I01A 5EIAA 2JGLA 3E7XA 3E7FA 2PVPA 4OGLA 5EVCA 1M10A 1U6KA 3CT6A 4LRYA 5KU7A 1L7RA 3Q9NA 4LWQA 2DTDA 3S8YA 1E89A 4WKBA 3OZCA 5TX7A 4JXKA 5DSXA 2B61A 4LJ7A 1ZCAA 1AM4D 2MYNA 1BWQA 1OV6A 3AF0A 4Q4HA 3ZU6A 3RKUA 1YCGA 1DQRA 3QEJA 4LDPA 4WACA 1RR6A 1RVV1 3OQJA 4W8HA 1VL8A 4Q9JA 2C98A 4R1TA 4KR7A 1NNLA 3RT9A 2J7PD 3HDVA 1WW8A 3FMGA 2OXEA 3FNHA 3MT0A 4MGHA 1WSWA 2RBKA 3U17A 1KERA 3UB2A 1ZHOA 2PZKA 2ZDHA 3K1JA 2CFTA 2OC9A 4AXXA 4D9FA 2X7XA 5AM1A 5GGXA 1IPHA 1G42A 1RWNA 3L8MA 2G1PA 1ENZA 4GRIA 5BNWA 5FWNA 3MVEA 2IXBA 1RLJA 2BUAA 3AI3A 4L76A 1G63A 2ZYHA 4HR7A 4MUAA 5GWXA 1DC3A 1YZFA 1BHO1 1DAEA 2CB0A 3KEQA 3B85A 4LJ8A 4OIMA 4D5GA 3U7QA 4L75A 3VKFA 2H65A 3KAPA 5CTAA 3THYB 2VF7A 3S6JA 2H5IA 2YZGA 2P6RA 3OQ6A 4BGVA 3BA6A 1HA3A 4WECA 3OX3A 3RS7A 1DFGA 4FI3F 2P9CA 1GA4A 1QZZA 3SFTA 4AJPA 4OI0A 4PUHA 5BURA 4LHZA 4Q19A 2AWNA 2DFKB 4ZI7B 4A8JC 4WCVA 1C0KA 4MUNA 4KKVA 4RDIA 5LQJA 3GA0A 4CIWA 1E4YA 1NR7A 4Y2RA 4G0NA 4OXNA 1DOAA 3K9FC 1MNAA 3IOEA 1PZHA 4EI9A 2LCFA 4X3OA 4J2TA 4ZCLA 5LKAA 2FX2A 1PU2A 1X7ZB 1E2GA 4CMEC 4G0VA 4LC1A 4M3NA 4RK7A 3TYXA 1A3CA 3F3KA 3FFWA 4G0OA 1Z2OX 2QRVB 5CX1B 3ZNOA 5GZ3A 3RANA 2FRDC 5CCBA 2P91A 1AQLA 3BRCA 4OK6A 5JQWA 4JJIA 2EFEB 3N5CA 4FOSA 5KSOA 4MS1B 4YS6A 1R6XA 1W46A 1IB8A 4IMRA 5CA0F 3G5AA 1GGNA 1IBMC 4DLWA 3K70D 5CFPA 5LLSA 3CSDA 2EYUA 2J3MA 3SKYA 4DLBA 3GFTA 2E18A 2Y66A 2AOTB 4OH1A 3ADBA 1LX6A 1USUA 3BL8A 4R5MA 4R0MA 4YJDA 3ZDRA 1ZJWA 2AUMA 4EWLA 4ZYUA 5BN1A 3HFRA 1BVUA 3RKSA 4AM8A 2HCRA 2V5AA 2V7QA 4MSUA 2C4NA 4HEHA 2GTHA 1Y3HA 1YB4A 1I7DA 5GONB 5G3YA 1M1NB 4FEYA 4RY2A 1KPIA 2WUEA 3DO8A 4IYJA 3U19A 4US1R 2QJRA 3R44A 4MQ5A 1LLDA 2B1IA 2HK6A 5AT1A 4B6SA 1H1DA 4ZDKA 2PGNA 1M1UA 1QQ7A 1KH3A 1XEWX 2QMOA 3IXLA 4AKEA 3A9RA 2WWIA 3LP5A 3C87A 4BDTA 3TLGB 5ESXA 3WVNA 1I36A 1XIVA 2VNIA 3MF4A 1XQWA 3BG5A 3THWB 4RA9A 1IHYA 1R4NB 2YQ5A 3VTZA 5B55A 2YMQA 3IE1A 3DQZA 3E4DA 2E3JA 3PPXA 4IDQA 3NAZA 1L9XA 4LZZA 5HRUA 1YRYE 2P2CA 3QV1A 1LU9A 4M0MA 3SPXA 4BMYA 3DOJA 2BUCA 4YPOA 4X3PA 5FBVB 4OU4A 5IT9D 4MVJG 1I3MA 2XUJA 1JWLA 2RHJA 4TKMA 1XDSA 2DCUA 4DCGA 1NBAA 1X19A 4KLCA 2XGGA 3ZCRA 3K0AB 2B0CA 2GNPA 1AQ6A 5DASA 4BJHB 3K5IA 4KTVE 3M4ZA 3V6MA 5AW7A 4DMRA 4YECA 4OLBA 3TTYA 3G2NA 3GNLA 3QJ5A 1RPNA 2GSDA 4NE7A 1S2MA 5I5GA 1DJMA 4HRYA 4KHPB 4J2OA 1CFJA 3BAZA 4YXWA 4CTJA 4DE5A 3AHDA 2FDRA 4TL9A 1T1GA 3T3PB 2ZULA 5IT0A 3REGA 4PLCA 5D7NA 2LVBA 1XRSB 1TW3A 1V0JA 4R9UC 1XTIA 5DYTA 3RGWS 3QWAA 1M6XC 2C3PA 3BE4A 5ITSA 2CUKA 1KI6A 1K7EB 3ZHZA 2GBIA 2VZEA 1SCJA 1VPEA 3DGEC 3REOA 1O95A 5JMTA 1XAGA 1Q0HA 4DKXA 1E99A 4O2AF 4RL6A 2YY7A 1HFEL 2PUAA 2FK7A 1QS0A 3O31A 1B0ZA 1RLIA 3TTUA 1QHXA 4XTRA 1AA6A 4LF4B 1JNYA 2ZRPA 3E03A 1C4XA 3SFVA 1B0UA 4K9QA 4EKEA 4CM9A 1S9HA 1XZMA 4OJMX 5C7YA 1O93A 1X6VA 1EB8A 3G0DA 1AKQA 2A92A 4ATNA 4MVJA 4WESB 4BMSA 4ZDIA 1MB2A 1WDMA 4ZAXA 3WADA 2G25A 1CY6A 2VF2A 3FUTA 1J7JA 1HO3A 3W8DA 1JSLA 2OO4A 1N2OA 2A88A 4P3YA 3PPVA 2WJ3A 3IDFA 2D27A 1LRJA 1ZQ9A 2HO4A 3U1BA 5JPCA 5TJHA 3R0ZA 4MUFA 1XPOA 2V98A 5FPSA 3H0KA 5LWHA 3CTMA 3MRXA 4G65A 1OLSB 4Q9KA 1MMFB 4CFYA 1MA3A 1JHMA 1Z56C 3B13B 3R3HA 2WR8A 2ZQYA 5JE8A 3QYPA 2B7BA 3AM5A 1V8PA 1FDOA 2I6SA 5K20A 4PHTA 4ZOLB 3SJ7A 5DX0A 4YAGA 1W9HA 4BRWA 3JQFA 3C1UA 5JMOA 2J9FB 2OHGA 1RKVA 2BEKA 2IU4A 3HWX1 3KKQA 3RC9A 4O33A 4MWEA 4EECA 2I4LA 3NTLA 5F1PA 1I33A 2ZAIA 4EJSC 1IK4A 3EDRA 3CV3A 4PZZA 5COBA 3BCRA 1NX6A 2ZJ5A 3LL7A 3OQIA 3M1YA 2NUPA 3EZXA 2W6PA 1O8CA 2EBHX 3I34X 4Q3EA 4H3HB 1GM5A 4X7RA 4KREA 2ORIA 5TQ0A 1HDOA 1NE2A 1AUXA 2VYVD 3KEOA 2HCFA 3F4KA 1X92A 3LE8A 1IOZA 4JLMA 3W7VA 2RE8A 4V38A 2QLJA 5M04A 1XNQC 4WN9A 1ZEMA 3UK6A 1NBHA 4W1RA 2I2WA 4XIYA 3CVYA 1K6XA 2VA8A 4DMLA 3LDHA 4LFCB 1RYYA 3ZCVA 3ZWWA 1UPAA 1S8NA 2ENWA 2L2QA 2G06A 1V26A 1N0VC 2V7VA 2O2SA 4U5XA 4AYWA 1Y4SA 3OZGA 2PGAA 2XUGA 3QVJA 4HGRA 2ECKA 4RKRA 1L7OA 4YYZA 1NLZA 1GGEA 3KYDA 3AEKA 4UUAA 7REQB 2HJRA 4WY8A 4UATA 1YA4A 2SBTA 3KJZA 5TS3A 4OHKA 3TD6A 4E5DA 3RSLA 1PDWA 1ZGHA 2XQVA 3K6JA 4ZEMA 2X4DA 3C3BA 2IYQA 3PC6A 1VJ5A 5HMLA 4N18A 5HX7A 2VWPA 1F1JA 1F2UB 1FUYB 4YWHA 2QTHA 1HLDA 3ON5A 4X61A 1T9HA 2WHPB 2A5YB 1K9SA 2NIPA 1FVFA 4JI4B 4CG1A 3O3OB 4G5HA 4KRGA 1DBSA 4MIEA 4BO2A 3WICA 1IULA 1M2NA 2AG1A 3P9YA 4RABA 4BBPA 4DR3B 2DUMA 2F1KA 1ZU5A 3ICVA 1KMHB 3BMOA 3MUFA 1ELOA 2WKWA 5EHIA 2ID4A 2O5VA 5EPEA 3NETA 4K9PA 1A9PA 1NN0A 3M4XA 5ICGA 1CY1A 2D1TA 2ERXA 1NVEA 1JLLA 4Z8YA 2PRJA 2AE2A 4G26A 3URKA 1D4FA 4CKEA 1ILEA 1JJAA 3PZRA 5AM5A 1EP9A 2Z8YA 1ENOA 3H1PA 4BZZA 3CLSC 2EQBA 5JUWA 2R6JA 4ZT5A 2Z09A 3NBQA 3LHIA 2OPHA 1UXJA 3DOCA 4EGCB 5JYEA 1HLPA 1AU9A 1IEXA 2JVIA 3IJPA 1UEXC 2PLAA 1YDFA 2NZ8A 1C1HA 2H92A 3MTAA 5U4XA 5LPNA 3DE7X 1O7JA 2PTGA 4LXGA 3W8EA 3K9CA 3VC1A 1DBVO 3L2OB 3WJ7A 3GRKA 5HKBA 3VR4A 4DWOA 3OF3A 1DDGA 2CZQA 2PUJA 3PQDA 1TZBA 4FNGA 3T9AA 4BO4A 1WBBA 1U2PA 4JXZA 1XCPA 2FPGB 5CW2A 4BJ6A 2QD3A 4YV7A 2R1VA 1LNQA 1XVAA 2A5JA 3OFNA 5EMLA 4NS4A 4FMDF 4AY2A 3NUZA 1ZL2A 1F17A 1T3LA 2ZREA 2GF0A 4YI3A 1TK9A 3AHIA 3ZV3A 4DLAA 4N6GA 4LF5C 5J63A 2Z1MA 3EVBA 3GZNA 3NDPA 4IKPA 4KQ9A 4XCQA 1ZA2A 4YH1A 3INRA 2G9NA 5JO9A 4R9SA 2JD0A 3NVDA 1HTTA 2E9SA 3JYQA 1DPFA 1UP6A 4NOKA 4U5QA 2OO3A 2PVCA 1LTKA 4IVRA 4M53A 4DW8A 1G21A 2R751 2RH8A 4GOND 1VL0A 4ZTUB 4XM2A 3RC1A 1X1TA 4IQGA 3PQ2A 3V7NA 2EF1A 3CRMA 3FB4A 3FMPB 3KRTA 3N58A 4HAWA 1VCOA 4ZU1X 4OAQA 821PA 4PLTA 4E4TA 2BM8A 3KXLA 1OBFO 1C1YA 1TKRA 1U9JA 1RI3A 1WZIA 2EBFX 4NSNA 5HE9A 4BC1A 2H1WA 5BT9A 4GX1A 5E7IA 2IH5A 1LK5A 1UUFA 4R6WA 1TYDE 3O90A 5EUQB 2G9QA 1QQ6A 2ZSBA 3MZ0A 1MDBA 1I80A 4JI3C 2J3JA 3BGVA 2ZJ0A 3ITKA 3K5PA 3PEUA 3ZX5A 1CS0A 4MHTA 4NFHA 5A62A 4G67A 1BU8A 4C7OA 1P29A 2R3SA 3ETCA 2NG1A 1ORTA 2HK7A 3QY0A 4C3VA 5DX1A 1QH1A 1YJQA 4H4CA 2QJWA 2JAQA 4RVNA 4X64B 1I2MA 4UOEA 3SZOA 1JDBB 1HWYA 3A6FA 4ER6A 4JUAA 2PZEA 1CZOA 4BMOB 1N32C 4L3OA 4NYMQ 1Q92A 2EW8A 1JR6A 5J1TB 4YAJA 2OBYA 1GL3A 1SHZA 5A5EA 3R4CA 3VTFA 2AVDA 4QWMA 4Q66C 4RTLA 5K4AA 4CG0A 3OA0A 3SF8A 1G8HA 2IPXA 4HWGA 1EEXB 1X38A 1W1UA 3NCTA 3P9IA 3DF9A 2JFUA 2ZRFA 4HPXB 3WSVA 2IYEA 4WRRA 3OPNA 4HQOA 1AS2A 4MLZA 4DCSA 2SKDA 3GO4A 3TKAA 4LDAA 2CDNA 4Y9RA 5LZ7A 4GZ3A 1OHHD 1U28A 2ADMA 2NU7A 3CH4B 2OFOA 4G97A 4QBTA 1ZJJA 2YIVX 4MKRA 1IY2A 4CV2A 1QSGA 5EY5B 4P80A 5FWYA 1YRLA 3ZGLA 1RJDA 2DKNA 3EGEA 4H0CA 4WUVA 3UAYA 3DBHB 2J85A 2WINI 3LIIA 3ZU3A 1XDGA 4D41A 3PEFA 4V0MA 1J70A 1F8FA 2DZDA 2LPMA 4BNYA 3QNUA 1AHNA 2YNMC 3LP6A 4MICA 1W1IA 3AY0A 2J4FA 1ZLXA 4B48A 1OR8A 3DMFA 3PDJA 1N1DA 4HAXA 3ESXA 4R05A 3TNFA 1S96A 5DE3A 1O3YA 2REBA 3B38A 1XTVA 4X7MA 1SRRA 4KN9S 3ZQ4A 3IMLA 4XLZA 2HU2A 2DSTA 1ES9A 3UWOA 3H5OA 2ZT6A 1II0A 1VJ1A 1II8B 2YVAA 3Q8XB 5FKJA 4K03A 1RCUA 4DQVA 1ONNA 1A2OA 4D6PA 2AEMA 3R3WA 3HXKA 3KB6A 2NU9B 5AJVB 1UAAA 4DFDA 1BS2A 4U2DA 4YP0A 4ML3A 1OZ0A 4S3MA 4CDMA 1UDCA 1KWKA 3PC3A 5LD2B 1RWOA 4BNKA 4KLRA 5KZMB 4LXIA 3Q7IA 3UHPA 3JZMA 2DFPA 1I0LA 1UBSB 3PX7A 2CHGA 2YRXA 5SY4A 3HY6A 2JCVA 2OG1A 4S0XA 2JK0A 1CP2A 2LNDA 4MV4A 4KSBA 4NZOA 2F3RA 5D6OA 1EXDA 3P2KA 4TKZA 1JAHA 2ZZKA 4N01A 2TMDA 5HYVA 1RWMA 3P97A 3S68A 4EJMA 2H29A 5CPBA 1KDOA 1ISJA 3Q3VA 2HF9A 1CQJA 3FFTA 1N8SA 2GN4A 3ZGNA 1YRBA 5IUNC 1A5ZA 1BFDA 1Q77A 3UAXA 1CIJA 1D1SA 4J0DA 2J67A 1EGVB 5KVAA 1SG0A 2X1HA 4DR7C 5BXQC 2RCNA 2Q6IA 1RHRA 3FYUA 1S6YA 2JH3A 1K0RA 2H8KA 3NB0A 2Y1WA 3LPCA 2GZAA 4ASUA 4L02A 1N2JA 4AWAA 5FO1A 2CV0A 1W4RA 3I5AA 1SIBE 1VE5A 3ZGOA 2QPOA 4AO7A 2H54A 3A6JA 3M5PA 2P0YA 3HCOA 1RLOA 3OD5A 5FFFA 5GVRA 3IOCA 5AW5A 5I6DA 1M6VB 1GL9B 1YZNA 8ATCA 4JLAA 1TUEA 2NV2B 4AT1A 1KMCA 1QKJA 1RC8A 1GZ3A 2R1UA 4P8RA 4QUAA 5EJMA 1N5KA 3HN7A 1NX9A 5C4GB 3TQSA 2XMPA 3KUCA 3KEFA 3NEAA 3WRXC 3IA7A 4QT4A 2AZDA 1IWPB 3T1HC 1NMQA 3KZ1E 4COKA 3L0YA 1PGPA 2R6R1 3AI1A 3GY0A 1W48A 3I53A 2EEPA 3SXUA 3K0KA 3ZBTA 1XZDA 4M8SA 4ZOCA 3GA5A 2GXSA 3AJRA 2OB1A 3L43A 3RG2A 3AF6A 1OROA 2WDPA 1IRXA 3PV0A 4Y2SA 4O3FA 1SIUA 1AVTA 3IPRA 4I6JA 4DMMA 2VDWB 4EUSA 1DCTA 2ZI9A 4KO1S 4ECAA 3RK1A 3GLFB 1S1CA 4XVRA 3FTFA 2IGBA 2G5TA 3U4QB 4PU0A 3RIYA 1U2QA 3CN7A 3JTMA 4FWIB 3REFA 1FP7A 4BB0A 1RW4A 1XZAA 2ODQA 3P5BA 3EEFA 1I10A 4EJ6A 4Q3AA 4HN4B 2K4MA 2ZR8A 4GGMX 1OYVA 1XMSA 5CB4B 2GHTA 1X7WA 2HA6A 3WOVA 4TWBA 4D5EA 1NSFA 2XZTA 4XYEA 1SUEA 1I6WA 3DBRA 2XZDA 2HM7A 1VHJA 1PG0A 4WLEA 4EW6A 2NV6A 2EQ5A 2GYYA 4DR2C 4KFTA 5EKDA 4ZU3A 1T5TA 4Y2YA 1RHMA 1ZC3A 3ZV7A 3BPSA 4NAUA 4BQNA 4F3CA 4MA4A 3REQA 2JHCA 2F1IA 5ISMA 1QLHA 4QKQA 3DT9A 2HMSA 1HI9A 4Q4LA 5INTA 1DWQA 1VLLA 3KV3O 1KF0A 2WD7A 4J2HA 4F4DA 1E6KA 2XCOA 1N33C 3D5TA 4JLNA 1BW9A 1EXWA 2JFVA 2R79A 2WEKA 4LXYA 2E5LC 3NH9A 3O8OB 3NTOA 2O7QA 3BHJA 1VLAA 1BFKA 3AL3A 2AYAA 4M88A 4TKLA 1X9HA 4WGFA 5AHXA 2F48A 1SHTX 5DHQA 1EWVA 4CJXA 2ZB2A 3K5HA 4N6OA 2NAPA 2XF8A 5IKEA 1F2TB 5MFZA 3F98A 4G1BA 4J7XA 5T67A 3VR3A 2XVMA 2BSQA 1JSXA 1EM8B 1KAGA 3RIXA 4YMVA 4F93B 2QM0A 3Q0TA 5FOQA 2RMKA 2GO1A 1ECLA 4KODA 5TMBA 1P7VA 1CRQA 1KEUA 3ICOA 2RK6A 3L6OO 3MJTA 1IN8A 3F7MA 3IILA 3PR2B 2C4HA 5KTSA 1T4CA 5DGHA 4IHAA 4ZDJA 4RZIA 5CX4A 2F3TA 3PA8A 4D4KA 1M6NA 2XWJI 4KSYA 5AVXA 1BTOA 3G2KA 3MAAC 4K2AA 1NI4B 1MAUA 3ENWA 3WSWA 2DPMA 1F6BA 3AL2A 1MOPA 2VUIB 1OB5A 5JS2A 1EGAA 3BX1A 1CUFA 4RZ3A 1GZ6A 3RJ9A 3PUZA 1DKRA 5KOIA 5H4GA 1F48A 1ZOIA 3RC3A 2IUSA 1GKUB 1X77A 2UZ0A 1QU3A 1WDTA 3WI7A 2OFFA 1W4ZA 4ITRC 3EXHA 5CDTA 4S2EA 1FNDA 1VGQA 5A71A 2CGEA 2O1EA 3EXG2 1XVLA 3EAQA 4OX9B 2XE4A 4MITA 5F78A 2WLTA 3QYAA 4IKOA 1D6SA 2EZTA 2Z57A 3LDFA 4MRAA 4BNXA 3OAAD 4M76B 2BMEA 1E3QA 1OAKA 1W52X 4OXYA 2CT8A 1T35A 3O75A 1SXJB 4PNEA 4LE2A 3BBLA 4MULA 3R7LA 1QM4A 1XQYA 3AVPA 1XZEA 1EP2B 1RC0A 1TO6A 1KVTA 2FEXA 2QVGA 3I9FA 4TVBA 2FPPA 5G4LA 3TDKA 5F7XA 2PMKA 1Y8RA 3G7SA 2CDBA 4OFZA 3LBNA 4X60A 2PXXA 1VB5A 1RI5A 5HJ5A 3W05A 5HUHA 4G0MA 1G20B 1SWWA 3K0HA 1FJHA 2XCQA 1CE8B 1FYFA 1VHTA 3L9WA 4HPJB 4HUJA 4JDPA 4KTTE 4PX5A 5TPWB 1VG8A 3HJNA 2I4RA 1VRWA 2H7VA 5H59A 3K1YA 3KAQA 1XMQC 1UODA 1FSFA 4ZZ0A 3WGHA 1FDUA 3HXMA 2XWPA 2W6IA 2IK8A 3I1YA 4KB5A 1QFSA 5LA6B 4DUGA 3JQBC 3H3XA 4P7KA 1P4GA 4AVYA 5A1IA 3OWHA 5FPPA 1YDMA 4L7QA 5FL7D 4GECA 2UKDA 3L8CA 3PKIA 1ZP6A 1T2UA 1WL8A 2GLUA 5KVSA 2XBLA 1NXXA 3TECE 2Y0PA 2QUIA 4OA5A 4JB8A 2FP4A 2CWWA 3PJRA 3IJRA 3NP7A 10MHA 2POQX 3NAQA 3ULKA 4DC9A 1PR1A 4PS0A 1HDIA 3C6MA 4Z4IA 4RAOA 3VSEA 3JQCA 2IOYA 1G18A 3ETGA 1XHLA 2VUSA 2VWHA 3OZSA 3AUYA 3QFFA 1VZ2A 4DV7B 3GLGB 3BCHA 2PR2A 2B7LA 4G2NA 3RYIB 1US8B 1YQGA 2PRIA 1P3DA 1UDAA 4NJMB 1R27A 1X1BA 3SJCA 2W6ZA 1TAQA 5JHHB 3OC6A 1OFGA 4IDPA 4MUBA 3SF0A 2JC3A 2WQ7A 3IERA 3D43A 3BE5A 1V6AA 3TBHA 1O58A 2D7CA 3ZWYA 4FN5A 1EFRD 1Q50A 3MFQA 3U4IA 3C45A 2FSUA 4OHXA 4UPEA 1YRWA 3OKFA 2AN1A 4G4SO 2IY7A 1E4EA 3C8DA 1V3VA 3HP1A 2V0NA 1T3HA 5K0NA 3OE1A 4ARVA 1CUIA 2IOQA 2E8FA 4OGFA 2AMLA 2VNJA 3QRWA 4KR3A 1RZ3A 4JA0A 1VCHA 4NYIQ 3COSA 3PXEA 3E7PA 1B6RA 4H3KB 3K0FB 4H3SA 5BVGB 2V74B 1OD6A 3WBBA 1D1PA 4JHXA 3NVKI 2ZYTX 3HU1A 3P26A 1F0KA 1OXMA 3RIEA 1JFRA 2E48A 1I7QB 1R12A 1JBEA 1Q2XA 1ATZA 4RJTA 1HV8A 2D3TA 1A9ZA 3NJRA 2O3JA 1K7SN 4OI1A 3NHRA 2IL1A 3WLRA 2A0KA 4NZZA 3B5IA 2W71A 4NARA 3TRDA 3FB1A 3OWXA 3ZY2A 3C7TA 2E5WA 3QOYA 4X3CA 3QENA 4RVGA 5AKJA 1QGUA 4ZQCB 5IFIA 3DVAB 1KI9A 2C5LA 1FLAA 1UPTA 5HE8A 1KVRA 3THOA 3USZA 4K3UA 4BWYA 3IP8A 3AVOA 1R16A 2EGGA 5F7JA 4ZYYA 3CQ2A 5GVSA 4OVKA 4R9RA 4LE5A 1SELA 2DHEA 4IL5A 4KMOA 4CLRB 3EGWA 2VI5A 3VMMA 4CLEA 3FSJX 4WAUA 2QNRA 5BQOA 3T9FA 2B94A 1S7GA 3WYGA 3R77A 3ZI4A 4D97A 4K0KB 1PJQA 3SY8A 2RBEA 3ZQKA 1KJIA 1UK6A 4K9MA 1ISHA 4MV8A 2HDHA 3T7TA 3U49A 3V9AA 1XRRA 3L8YA 3STUA 2UUOA 1MGPA 4QRDA 5CDGA 4JKYA 4FFWA 4IDGA 3UXMA 4CM5A 4EFKA 5AFSA 3K9QO 4DHWA 4JZKA 5G4KB 3O3NB 3UKDA 3KJFA 1L5LA 1KTVA 2GSWA 4CKCA 1H23A 1SKYE 3H1TA 5LB4A 5FXMA 1Q20A 4HLUC 1I3CA 2F59A 1WSBA 5DIFA 2H2DA 4BV3A 3SMVA 4OX9Y 1P1BA 3Q0IA 1SQGA 2C94A 4CM8B 1MW8X 2JA2A 3QXXA 4WSOA 4TN1A 3WL8A 2EP5A 5K3OA 3L7CA 2IHJA 2Z0MA 3ZHSA 1Z15A 4PLZA 3GJTA 1XCJA 3EIXA 3KU4A 1GIAA 2PZFA 3N3AC 4HZUA 2FXIA 2QL9A 2QUZA 1E0DA 2I1WA 2HL6A 3E61A 2C82A 1I2BA 3I3OA 4AN4A 2EAUA 4GSKA 4LQCA 2F43B 1Y3BE 2V8OA 2HMVA 1E0SA 1OWLA 1TYAE 2M6KA 1BROA 4KN8A 1QHYA 3JD0A 1JR2A 4RPHA 4XM1A 1EWRA 3U5ZB 2C1ZA 2NU8B 1W36C 4I9FA 1EFCA 1NJFA 2JIBA 2RFLA 5B3KA 4NFLA 3C6YA 4GPAA 4AQ7A 4BLRA 2SKEA 1RXVA 5IX8A 1MRSA 3FYCA 5KYWA 2OP1A 3EXFB 4R6XA 5TPZD 1IEWA 2WICA 4D6XA 1TVEA 2WHYA 1ARZA 2C1EA 2HF2A 5CJ2A 5K8JB 4BCBA 1GDTA 1J23A 3IP9A 3LBIA 6ADHA 1UEIA 3SKVA 3DCIA 2YJTD 4URWR 1K0FA 5MHTA 3K31A 3Q7EA 3FPKA 5F9FA 2FFRA 5AHOA 3SZ3A 1VKHA 3MT7A 2V45A 5B2FA 5AI5A 5JAUA 1KQGA 2HRBA 2ZANA 1OWPA 4KMMA 5EE5B 4ZMBA 1FTGA 4MVJE 1E1QD 5CU7A 2WJAA 1N8TA 2JCSA 2R1ZA 1UOPA 3KSUA 1ZONA 4O25A 2J0EA 3VVLA 3HP4A 3FNRA 1X14A 4AKSA 4ZLPA 2B25A 1CULC 1DFIA 2XLBA 2XQJA 1OKKA 2QI9F 2R68A 4JZYA 3GRRA 5CDFA 4KPYA 4AYTA 3C8UA 3F6BX 1ISGA 2HF7A 4MPRA 1WJGA 2I29A 2K7ZA 3H8JA 4RTJA 4UBKA 2HLDA 3U39A 2XUFA 5AW1A 4RV4A 1FY2A 1M76A 3J7TA 1CF9A 4L85A 1P0CA 2H4WA 2J7PA 3FHLA 1DWOA 3Q3GE 4M54A 1RLTA 2VP4A 1LCIA 1H5NA 3F78A 1O4VA 1YRAA 2FEOA 4WOBA 1GTL1 2VOJA 3ADDA 2VQ6A 5B37A 2JI8A 1UEJA 2AC7A 3MTBA 2QUKA 2FOXA 4C7KA 1M8PA 1O8BA 1SUFA 4IDFA 4EI8A 4F4UA 2E49A 3OZXA 4DC0A 1Z12A 3HGQA 1YR6A 1XD8A 1NW4A 1SWVA 1NC1A 1LK0A 1Z6YA 1I4TD 1ZD1A 2VRCA 3CE6A 3LKBA 4LRSB 4XIFA 4Y2VA 5HA5A 3EY4A 4P1ZA 5K7SA 1BWSA 2C03A 3KL2A 1JDTA 3WGYA 1N6RA 1UFKA 3PC8A 4DC1A 4A36A 1XELA 5H9WA 4AX4A 4RVSA 4ZEWA 4EX6A 1FNNA 4B3SC 3CJQA 1QVWA 3GLIB 1MGOA 2J3IA 5FWXB 4ZCMA 4YCCA 4R71A 1G7RA 1XYVA 1X1SA 3CJTA 3JATB 1PVOA 1C14A 4WERA 3SI7A 1E62A 1LX7A 3DEHA 1E61A 4F3TA 1WTCA 1H1LA 2CCKA 3STHA 1DAHA 5I47A 3A1NA 2FUEA 3H9EO 4PCUA 4ZVTA 2YL2A 1A72A 3EUEA 2ORWA 4BFTA 5YASA 1G5PA 2C5SA 3BXHA 3KZKA 4BRSA 1AHIA 1KQ3A 1OLUB 2GFIA 3OU2A 5AE3A 2JAUA 3RM3A 3DEAA 2W0MA 4YCSA 1TA0A 1ZQ1A 4TYPA 4CTKA 1R0RE 1LDGA 3O4FA 2BFBA 1GPAA 5H70A 4O4IA 5JV5A 4KYIB 3LCVB 4V0NA 2XOEA 4N5HX 1XRQA 2P9FA 1I5OA 2YN2A 5HDQA 4GR5A 1K63A 5EKUA 3ETEA 3ZXXA 3EGDB 1ZGBA 2IE0A 4MWOA 1R7RA 2IEIA 2R96A 5E7MA 5G1PA 1ZR2A 1WCWA 1BEUB 4GM1A 4JOCA 4YDSA 1ATIA 1V5WA 3L49A 4IJUA 2OXTA 4A0FA 1QV9A 3T4PA 5FQOA 2Z04A 1BA3A 5JJCA 3SIPA 3I12A 1GDDA 3CLTD 2AW5A 2W90A 4LRQA 1B4DA 4M0CA 1R0WA 3L8FA 3UW3A 4M1QA 3AFNA 1RBMA 1CTQA 2EJUA 1YJBA 2O2YA 4FILA 1FTSA 5C4MA 3H1GA 4LMAA 8OHMA 1P7WA 3AILA 3JCZA 1HLGA 1KPHA 3OPYB 4XI9A 1O03A 3IUEA 4Y2GA 4BEVA 4DN6A 1OW3B 2BZSA 1WNTA 3RTGA 4DRXB 4KN6A 1G8FA 4D45A 4YJ2B 3TX6A 1NUAA 5DN6A 1VDMA 4ZCIA 3T61A 2NVBA 1E5LA 3CURA 1NF3A 1XT6A 2A57A 1RQXA 2HLNA 2RCYA 3OJOA 4H7FA 2GPWA 5JSFA 4OJNA 5ADWA 3LT2A 4P86A 5DVZA 1M3SA 2Q5IA 3ZXUB 2Q0QA 3UMBA 4AZ0A 1AGNA 4MYHA 5THXA 2MYPA 5F3DA 4RQBA 4HAZA 2NUTA 4ZQEA 4WLNA 1UINA 3EEIA 3FYTA 2ZB8A 1FQWA 1DRWA 2GBGA 2ZK7A 3JZAA 2B3DA 4FEAA 4L6CA 2DT5A 4NEGA 1WTAA 1YS1X 2OCPA 4TS4A 3FA2A 5SZJA 3M33A 2PN1A 4LV5B 5IT9A 1OB2A 4G5OA 3T7AA 1D07A 3BFPA 4CMKA 4QPJC 2JJMA 3QHAA 1B8NA 4QXPA 4A23A 4PAWA 1F9EA 1JU4A 4YAIA 2GILA 4RD4A 1ZNYA 2JNWA 3QXCA 4TTPA 1I1QB 3HY3A 5LXTF 1VLVA 4CCYA 1EESA 4OHFA 5HK9A 2QTRA 2YWDA 5FA8A 1ZDMA 1QE5A 2Y1LA 2FSHA 2YIJA 5AXDA 1F9AA 1AXEA 1SVNA 1UADA 3T5CA 4KXLA 2IU6A 4ZAZA 3ZWMA 5A9RA 2Y92A 5A2QA 5JZSA 5TIIA 1A5SB 3BFKA 2B4AA 4HXFB 4LECA 4DEYA 3LECA 2YRFA 3O91A 1U99A 1G21E 3HMQA 3I9V1 3KVYA 1L7XA 2TS1A 1W5BA 4NWIA 4Q4JA 2A0FA 4MIKA 2WU0A 4R7ZA 5DCLA 5LUAA 3CWCA 3DE4X 4KC0A 2PX5A 1NI3A 1RRCA 4HVCA 5KWVA 2CNDA 1KAQA 2DWPA 3K05A 5D3MB 1T0HB 1LA2A 1JEQB 4ND4A 1V1JA 4IRUB 1E9SA 2QLLA 4UZFA 5ER9A 1OH5A 2HD4A 2IPLA 2HTEA 2CZGA 4I50B 5ALSA 5DT9A 3SZRA 4DARA 2RB4A 5AD1A 5LQMA 4B83A 2XNDD 2DF8A 3A05A 4JMPA 2NX2A 4FS3A 1T9ZA 3VQTA 3PQ7A 4R01A 2Y0BA 2ZUWA 5IJAA 4Q9LA 2VTEA 1K5DA 4TLBA 5J4VA 3P19A 1QYDA 4QDUA 2FX3A 1C4OA 3H2IA 3NVAA 4FLEA 3OSUA 3GLTA 1X3LA 5GP1A 1NC3A 3CZRA 1C5KA 5KMGA 1Z5WA 4PX9A 3R7WB 4QG3A 3RU7A 3G9UA 4BVJA 2OB2A 4MQ4A 4JR2A 1XGKA 1WP4A 3EGIA 3F6PA 4GPTA 2ESRA 4NECA 3SHOA 5IT5A 1B43A 3TFQA 3DEYX 1L7QA 3BREA 3MWDB 3ZC3A 2Q5JA 4N7JA 1CF2O 4JEIA 3TLMA 3T5PA 3G9ZA 3QEMB 1SIOA 3FTCA 1SBHA 2AB0A 2X0NA 4LUCA 2FMKA 2DECA 3NDBB 3KELA 3AR5A 4HQNA 4OK5A 1O5TA 3ILHA 3MTDA 4R0NA 4M1EA 2AT1A 3U3DA 2P75A 3B82A 4I99A 2DR3A 2CLSA 4OCZA 2R65A 3E9MA 3HA3A 3F46A 1OFHA 2OD7A 4DV3B 1OH8A 1YI0A 1KXJA 2Q8QA 1PK7A 1TLFA 3AFMA 3ISJA 4EKIA 4F04A 6NULA 3TR3A 3CNOA 4CQMA 4OJQA 1KJWA 5DLEA 1N36C 2EZ8A 2H1VA 2IODA 1M0SA 2PFSA 2R8YA 2CFIA 4Q3NA 2Y4NA 2VDJA 3QPCA 4WT7A 4YJKA 4KLNA 2AC2A 1HT3A 3QU7A 2XMBA 1T13A 4L4RA 4PLYA 1DINA 3G5UA 1I4DD 4BNDB 4YV1A 4V0ME 1F8XA 1FS4A 1N2XA 3E05A 3TCNA 4ZI3A 4OFXA 1BU5A 4YO7A 3HCPA 1ITZA 1FDIA 2C29D 5HILA 1X1AA 3GMTA 3IAM1 4XIIA 3B3GA 2AMYA 2JKVA 3NMUF 2DM6A 4PYNA 4EELA 5EZSA 4AZSA 3ZQ6A 4KPUB 5D3QA 1NOIA 5JSZB 4MUIA 1N6IA 5BUSA 1T5IA 4AO8A 1A7AA 1NXQA 2C88A 2O2XA 4WVLA 3HDHA 2NZYA 5BSTA 2COKA 2J9GA 4WKPA 3WIDA 5FTLA 1Y6GA 3WKEA 1EK0A 4PQGA 4F8YA 4G0QA 1GA1A 2Y2VA 4AK9A 1HPLA 1E2HA 4UU0A 1UKYA 3DE6X 3QXGA 4S12A 4E13A 1RYEA 4R7TA 1QCZA 4DLTA 4DDHA 4BXOB 3FLAA 1DWPA 4KQGA 2XY4A 3NU1A 3WRYC 4QULA 3DOOA 3HCRA 3D7SA 2P1RA 1L2FA 5HW0A 4DMHA 4I55F 4KV9A 3JVEA 5DX8A 2W70A 4ZCTA 4I1YA 5BXYA 3EHDA 2QQEA 1GRQA 3ZK7A 2P3QA 1IBCA 4YAWA 1WA5A 9LDTA 1UKCA 2ACWA 3TZCA 4F4CA 3DEIA 2IX9A 3OEEA 3WRVA 3GBPA 1AV6A 1DJOA 2C5HA 3PT9A 3OCXA 1I94C 1IOVA 1JXMA 1RWKA 2F00A 2J3LA 3C5HA 3D5QA 3HJCA 3WY9A 4AMYA 4BFLA 3HWSA 4DVJA 3LT1A 3DR5A 4BU1A 1VLJA 3D2LA 4HDSB 1U65A 6Q21A 1SB8A 3P71T 3A9WA 3GLRA 3QNWA 3B20A 4BNVA 2VT3A 4PM4A 1DAPA 3A27A 3AESA 4XSGA 3AHJA 1Z08A 2PU7A 4DDTA 5FUMA 3DZFA 2BHSA 2O3QA 2Z56A 4DUZC 3GPIA 3QE3A 4NATA 4P35A 5WRFA 1CVIA 3OKCA 3CO0S 1F3OA 2M5OA 2QXUA 1E3MA 2HCTA 1E6EA 2CDAA 5EZ5A 3DSRA 1P72A 3F5SA 4DL9A 4OBWA 4Y2TA 5C37A 4YJ3B 1F0NA 1K88A 5H7XA 5CXXA 1KKLA 2WKSA 4HQ6A 4ZVKA 2JVKA 2B20A 4IMPA 5AO9A 2RK3A 4FE7A 4D9JA 3NTQA 1CKEA 1U0RA 1LFDB 2BD0A 3UAOA 5JAOA 4B6GA 2Z30A 2B8EA 1ULTA 2ZS9A 1QU2A 2UU9C 1HDRA 2EKLA 2WWRA 1M2WA 2HBQA 2RKBA 2HPHA 1AGXA 3HUEA 2X1MA 3ZWNA 1GTG1 1COZA 1RHKA 2AXNA 2N0SA 3M6WA 1H69A 4Q6WA 3HTXA 4UHDA 2QJTA 3NM6B 3KPUA 1G2OA 4IJVA 2WSLA 4HPWA 1WOMA 3SSAA 3ODPA 5AIAA 4D2IA 5J3JA 3R5SA 2P4QA 1UP7A 4Y1RA 1TK3A 1WO8A 3B1ZA 4K6MA 4UNRA 3EAFA 3IT1A 3O47A 3JZIA 3PB3A 4URZR 2HH9A 1H4QA 1NFQA 1DXOA 1LUAA 2E0IA 2E4ZA 5H3CA 1Z2DA 5HIIA 1E66A 5HTOA 3BTSA 2JLZA 3I62A 3RHSA 1NUHA 2O0JA 3M82A 3VR2A 3JAKA 4CM3A 2WW8A 1N9GB 3AG5A 4TL8A 2C2GA 3QP9A 3CUUA 3I58A 1CUZA 1XJQA 1IHUA 3RVDA 3T3HA 3WGTA 2BN4A 3JQ7A 4KDRA 1O90A 3DUFA 4U63A 4AROA 3M6XA 1RQNA 4J0FA 1GG2A 3DM9B 3OHMA 3I61A 4EB3A 1B26A 3G9TA 1N5IA 3WE7A 3FZNA 3EB9A 1G8SA 1Y5RA 4MQ6A 2QTAA 3RS9A 1ODKA 2JIOA 2Q3MA 5JISA 5I9MA 1CJUC 4C4TA 3DKKA 2FVYA 3DAGA 4KACA 2VHEA 1AO0A 2FLVA 3MNFA 5B3AA 1JU9A 2G4VA 4MUJA 3THXA 3DOFA 4HLQB 3U44B 1OT5A 2VNKA 3IAS6 1R0LA 1FTYA 2V6MA 1JJ7A 1W5EA 4FN4A 2XB2A 2MINA 4C03A 1O57A 1DMRA 2X1VA 1TD1A 2YWJA 4B9AA 1P4HA 4YACA 1LPOA 1E5DA 4HB0A 5F76A 3WLHA 2P62A 5B6JA 4MKGA 2A0YA 2B30A 4DJAA 2X1LA 4H1VA 4WASA 2XRZA 1J9ZA 1KZHA 1DTSA 4GKAA 2OBXA 2P6UA 3KUXA 1HDEA 1UZMA 2VHYA 4MQMA 1AUPA 4HYYA 4TKVA 1KJ8A 3DF7A 3NUGA 1BX0A 5FF9A 1VYVA 1DQSA 1KK3A 1P17A 2G70A 3GNSA 4LHVA 3NHJA 4Q15A 4ZC1A 3UUEA 4QM7A 3F74A 2QLFA 5BV8A 1IN1A 2DT8A 2OV8A 3R3XA 1C2TA 1M6EX 2J8ZA 2QM7A 1WQ4A 3IEIA 5M34A 2JAPA 3WJ1A 4GVPA 1C8LA 1Q0SA 2WILA 1NKVA 3AIIA 4LYFA 1JIVA 3ROKA 5I9IA 4R1UA 2GFHA 4Z9FA 1XXHA 3R41A 4LV6A 2GBLA 3U1TA 4GZ6A 3JWPA 4BVKA 5B36A 1J0EA 2BEWB 3O3MB 2RHRA 4B3HA 5ICMA 3WLTA 3EXEB 2OPLA 4FOOA 1A8HA 3KJQA 4H7JA 3G1TA 4LZOA 1LGYA 1HQDA 5FBRB 1WCXA 4LBVA 1N5MA 1ISMA 1R1DA 1M6HA 2GA8A 3OTOB 2RG1A 4NG4A 5LXTA 4LFAB 2SHKA 5U9CA 4AJKA 1TEXA 1X7HA 4R40A 3CVOA 4TYWA 4GXRA 4RA6B 4N82A 4HHEA 1ZK0A 2DFLA 3CR7A 3VPFA 5JDIA 4D25A 3MGKA 5FADA 3LTNC 1Z82A 1D09A 3T6KA 2PL1A 5CFLA 1F6WA 5IJ0A 4L4YA 1P9OA 2A9VA 2W83A 4TMTA 2J07A 1QRUA 1NG1A 4BQSA 4E31A 1TEZA 2IDMA 4QSHA 2AFVA 3LBFA 2HZ7A 3L8ZA 3K32A 1Q0PA 2GF2A 5CA1F 1U8XX 3ND8A 4C0KA 1YA6A 2ZAGA 3QG5A 3VMFA 2OGUA 1H42A 2I34A 4IIXA 4O2RA 3ZDDA 5A7FA 1Q3TA 4UBNA 4DGSA 2AK3A 1Z8NA 1FU8A 3LRXA 1A9SA 3MERA 2V6GA 4GYJA 3DFZA 2QAGC 4O02B 3IV7A 4IRXA 2VK2A 4FFBA 5MGBA 4D3FA 1HNZB 4DQXA 3IE2A 2QX6A 1JECA 1JTVA 2A7XA 2WHEA 1AXRA 4NYJR 5AKHA 1POWA 2VSNA 4RF4A 4NCXA 1PSZA 4DJTA 4WOPA 4WJLA 1VFPA 4IG4A 3GPLA 3EBOA 5EFOA 1TF5A 3DWIA 4DA7A 1PA4A 3IXQA 3AGPA 4H18A 3H5TA 4PYKA 3UJDA 4I7EA 4MI3A 4I1PA 3AF5A 1D2EA 3E5MA 2NXCA 1KQNA 4DMUB 3O5AA 3MINA 3RQSA 1SC1A 1D5WA 4RLSA 1Z2PX 4LDQA 2ZIEA 3V34A 4DR5B 2VHVA 2HYDA 2R2GA 2GZMA 2A67A 1FXSA 2QW8A 3GUCA 3W5DA 2Y1DA 4J0KA 1RKXA 4F6RA 3IHKA 4PSCA 1DKOA 4BWVA 4ZAFA 1Z3IX 1ZCZA 1RRVA 2UYGA 1KBZA 1HKHA 1L1EA 3HBNA 4A6PA 3QX8A 4GM0A 2QZPA 1NYLA 3EA0A 4JC5A 1AS3A 4C6RA 4PPQA 4G07A 4X65C 3U62A 1FRFS 3PJFA 4PWYA 3PDHA 4BRUA 2QJOA 3BIJA 2XYPA 3HCBA 3KZVA 3V7UA 3TGPA 4V0KA 3TUFA 3C74A 3D2AA 4BKOA 3QV2A 1YQDA 2PKRA 3OQVA 3K15A 3UVEA 4S0ZA 1XZCA 3F5DA 4OHOA 2P9EA 1IXKA 1RXWA 3KD2A 4KR6A 1CCWA 4MKFA 2MSCB 3EVZA 3OIDA 4P3PA 1ISIA 3MCZA 5JNTA 4IIDA 3UOWA 3DP9A 4YRQA 1M5RA 3SM3A 3QUBA 4D8UA 4D79A 1ZUIA 2HBZA 3IFSA 2VCHA 4Q37A 2B2XA 4B6OA 4YXFA 4R81A 4MW9A 3FKJA 1K92A 1MXBA 3V2HA 4PLFA 1EFPB 2IYAA 1GNRA 2D6FA 2I55A 3T5DA 4CMCA 3IIKA 5HOEA 4HAIA 4PTYA 3B36A 1QIDA 4PLPA 4Y2UA 5KVVA 4YREA 2EWMA 1OX6A 3JARA 3LWDA 4XD7D 3U4MA 3GBVA 3VDRA 5HZMA 3RAJA 2WMYA 1XI2A 1RJWA 4AY5A 3L1UA 2HMWA 3M4JA 4BV9A 1N77A 3QMPA 4EQ6A 1X7XA 2WTXA 3HO8A 2DQZA 4P08A 5JAQA 4KFRA 4RZUA 1AZTA 4IZHA 5AVZA 2QLNA 3B1JA 3L1KA 2PZMA 2A1TR 4WLOA 4N76A 4UW9A 4G0UA 1KJZA 2FWRA 2W6JD 4DSZA 1C7RA 4ZO7A 5JECA 5AKYA 3ZOZA 1P0QA 2NO4A 3H2YA 1HC7A 3L8EA 4WX2B 1U0EA 5K8TA 4AG6A 1AUQA 4IO1A 1G3RA 2OKCA 3MCTA 3UJHA 3OE5A 2YN0A 4M6WA 4HNGA 5ITVA 2MR6A 3ZVMA 4BB9A 2GAJA 1G19A 1OXKB 2CLMB 3CCFA 3H1BA 2Y68A 1YIDA 1W1WA 1MOZA 1OLXB 1LVGA 1YS2X 3ELYA 4JWKA 3A1WA 1MZVA 3IA2A 4G1IA 5LLDA 1YO6A 2I3GA 3AP2A 5T8SA 1T36B 4G0XA 3V8VA 3HVIA 2AOXA 3NHMA 3B3AA 5L7YA 2VWGA 4FYPA 1UBFA 2LBPA 3WK4A 4BYMA 3ZKWA 1CXZA 2EP8A 2W8BA 2X8JB 1X94A 1XC7A 2GKOA 2ZQ5A 4I6GA 4UHEA 5EHNA 2VJNA 3S8MA 2XXAB 3W5VA 1ZIDA 2D2XA 2IYUA 5DCWA 3B53X 5AVUA 1RXCA 3R6WA 4FFVA 3QVLA 3MOGA 3QKRA 4QU0A 2WFMA 1A1SA 2D5BA 2NNWB 1J9GA 3NKFA 4GZLA 4M8NE 5IAAA 3ER8A 1ABEA 4NPAA 1J39A 4Q1VA 3F4LA 1R6UA 4MPJA 3ITDA 3T7DA 1C80A 1N92A 3G59A 5FHQA 4P0PB 2RI1A 3H1FA 3IMGA 5ALPA 4KQMA 5AMXA 4JR1A 4E6EA 2E4YA 4OBEA 2FF7A 3OCVA 2B83A 2NYRA 2HMTA 2AJCA 3IDZA 5LLTA 3HJAA 3B9RA 4QOSA 5LDGA 1G6OA 1NN5A 2O0LA 2QM8A 1UT5A 2RARA 3LUCA 3NC4A 2RKOA 5BR1A 4N41A 1LTHR 1UBEA 2PE5A 1PLJA 1QO0D 1S8AA 4C4SA 5H0IA 4OB7A 3ZR4B 1DKMA 3P5SA 4A8JA 3JD4A 2DE0X 1BEEA 2H7XA 4TS9A 1BCRB 3PP8A 3UH1A 4YP6A 5BUQA 1HYQA 5B1DA 4ZEVA 2OC4A 3D4LA 3DDWA 3KTOA 5A5GA 2NU6B 4F60A 4G23A 2ID7A 1RQ2A 1YFZA 1JKIA 1TNDA 3GG9A 4O2BA 4UXIA 4ZCRA 4LF6B 1N2HA 2DETA 4IWXA 1J56A 5DB4A 3RU3A 4C7JA 1D1TA 5IMBA 4IOJA 1VECA 4DAOA 1O5OA 1C1DB 5KU1A 3IPXA 5HEKA 5F1OA 4YRGA 2JHGA 4QJBA 3J81k 1BDJA 4OQMA 5CDFE 2J46A 4MK4A 1UJMA 1V1RB 1UM9A 6REQA 1ZK4A 1XU9A 2IYVA 1CY0A 2CF6A 3WGJA 1YR9A 4PBSA 4G8CA 4E5UA 4UTVA 1L5QA 4M8KA 1BEZA 3GFPA 2AJBA 1NP3A 4AF6A 1L4EA 2ICAA 4HSEA 1YONA 3BIXA 4QAJA 1N4DA 5BUCA 4U8HA 3S2GA 2FUKA 5ECYA 3BDIA 3WA6A 1R4ZA 4BQEA 4YCBA 2IYXA 5LQAA 2VF8A 5F7OA 4O08A 2P5SA 4XKJA 1XMPA 3ND7A 4I6EA 3OOEA 4BVLA 3QELA 4CYMA 4DV1C 3IS3A 4ARZA 4B4KA 4MW0A 3KUDA 1GZUA 4FZ5A 3DAHA 1O0SA 3ZGXA 2C4TA 2W6CX 2BRUC 4FWBA 5L6MB 4QXMA 4Q1CA 1EFRA 2OFPA 1FNCA 5HG0A 1XN1A 4G89A 5GOZA 2Z2XA 2CKDA 4ND1A 4O1MA 5DNAA 3JASB 4G3XA 1U4NA 1U9IA 3I30X 2DX7A 3SNHA 3WMXA 2VRWA 4IGIA 3QG1A 5CDYA 3W8RA 1NXVA 5T8TA 5K8FA 1DJPA 1JR3D 2WF5A 2Z2YA 2EGUA 1W29A 4I8XA 4N0DA 5TF0A 2Y0DA 4CKBA 3BIOA 4DB2A 3DW1X 4JBLA 1Y98A 2WIBA 3COWA 4FW8A 2DBYA 5GOTA 3TMKA 3WISA 2RKWA 2Y3IA 1OJ7A 5FTNA 2O2DA 3TQFA 2BFEA 2QL7A 2BEVB 3TW6A 2ZRMA 1Y9EA 3I3SR 2VG8A 1KORA 1K3FA 5LMNC 3PFHA 4OKNA 3RFFA 4Z0PA 2J9XB 3A3KA 1QIEA 4WKNA 2V9PA 1AK1A 4P3XA 2PPVA 1QO9A 2NSJA 4RC9A 2FPMA 5KTRA 3H6KA 2WP0A 1X0XA 2JDIA 3FRHA 3K4PA 3H99A 4NV3A 4P3KA 1ZBQA 4L8VA 2ZR9A 2SKCA 1N3YA 3H9QA 1ZG3A 3KB8A 4Y1EA 4D8TA 4W6QA 3TLXA 3FOFC 3VU1A 5CA1A 3W8FA 2IPOA 3JX9A 4RACA 2IPNA 3TEMA 4BZPA 5KMGB 5CD1A 2D62A 4DYHA 2HYIC 2VUTA 4JDUA 4ZT4A 2H4ZA 4F5DA 3Q5EA 4I9UA 3FOCA 4UFOA 4ZTBA 3TM5A 5CMLA 4CR8A 2D00A 1CNFA 4ZQBA 1X2BA 1ESMA 2O05A 3GFVA 4JLSA 1RZRD 4LHSA 1YJAA 1T1JA 2AD5A 3CEMA 2BY4A 3V8MA 5E6UA 3SBDA 3HDQA 3R8CA 3JQFC 4KJZA 3ET4A 4FR0A 3JWGA 2UVDA 2FRXA 1IVYA 1VMEA 2G9ZA 3QU5A 4YHBA 2FPUA 4B34A 1SVMA 2JZCA 4ALMA 1GUDA 3OIGA 3TRJA 1D0IA 3IRUA 2CMKA 3JD3A 4DR4B 3NBZC 4WCFA 2DH5A 3FDIA 3LD9A 4M4SA 4M1YA 1DX4A 1NXSA 3TTTA 2R4UA 4XGQA 3IHLA 3VOAA 3DO6A 3IEPA 2FQWA 2LKCA 4NXNC 4L1KA 4J6EA 1P18A 2C77A 1PBTA 4HQKA 4L2ZA 1COWD 3B7GA 3KQTA 4NI5A 1SUWA 2FHPA 2ZR7A 1XTKA 4B5LA 3KSZO 3C7DB 1IXYA 2EX0A 3G0OA 5CB8A 2OE2A 3F6CA 4G5YA 4RTSA 1P4JA 2AN3A 2BEJA 4GR9A 2PDAA 4REMA 4Q05A 3EEYA 1UMBA 2ROQA 4RE6A 4ZHQA 1E3TA 1JT2A 5BVHB 4EFMA 3QVXA 5DBIA 3IEMA 1G60A 2OQIA 3GVPA 1O9GA 1YC2A 4RVDA 3AL0C 3B1WA 1YMQA 3E82A 3OOSA 3U7JA 3NM5A 4AY4A 1PJSA 3ENZA 4Q9DA 1T29A 2HK9A 3ZH2A 4CF7A 5KAPA 2J48A 3T0IA 3AHGA 4D81A 5CXQA 3ZCUA 1TVKB 4EABA 3FIUA 1HSOA 2CVQA 5CJJA 2K2QB 4ZVLA 4HJXA 4R8LA 3LVBA 3QQ5A 5CR9A 3SOPA 2X6RA 3I5YA 3EARA 2O20A 3SLKA 1DSSG 3KYJB 3AJDA 4P22A 4BQRA 3ZDCA 3O8QB 3U7IA 5AI4A 3Q2KA 2V6BA 4BO3A 4IX9A 2PIAA 1DG9A 2J3HA 3QXSA 1R8QA 5E9QA 1QX4A 3RVQA 4JGGA 4LCBA 4G8DA 2EERA 4QLBA 4R5HA 1RNLA 1X8LA 2GPAA 4UZEA 1E1QA 5ABPA 2RIRA 2EP7A 5JI2E 3G0GA 3G5LA 4C1NA 2W2TA 2VPTA 3OU6A 2BGKA 4FDLA 1QONA 4C0AC 4EM6A 3SGLA 4CKWA 5CDHA 5FOTA 5JFOA 3ZHTA 2O3TA 4FXOA 4TQUS 3SKXA 1KKMA 2XUDA 2IHNA 3M0EA 1AZWA 2A0UA 1RWBA 3BSSA 2BKAA 1XRAA 4FT2A 2FH5B 3KT0A 4K9KA 3MJHA 4Y7DA 5AQ1A 1W19A 1P4RA 4MW2A 3H4VA 5E95A 2JARA 4BLVA 1U2EA 2NXEA 1GUBA 4X94A 4FR5A 2OZLA 4BO5A 4NKRA 4KMRA 4TZTA 5G3ZA 4ZZIA 3CINA 2AQHA 1KK0A 4YCJA 4U7JA 1UPXA 3MEQA 1GG9A 1TAGA 4U7WA 3LUFA 1HRDA 3E53A 3ZD6A 1OBHA 1FRNA 1R6VA 4H6VA 2ONKA 2OYCA 4QXRA 3KLNA 3O9VA 4Z4QA 1L5FA 3LQ1A 1FC0A 1C7FA 2K5UA 1NVTA 1F38A 5IAKA 3OQHA 2COEA 4HCJA 5EZQA 2OBBA 1GGMA 3NIDB 1ACJA 4IIJA 5AQEA 1W9MA 1Y7PA 4RLFA 1XROA 3RUEA 4A0RA 2QPLA 2WU3A 3KKPA 4AJ1A 3ZDAA 1YUNA 3D3WA 2BLNA 1JG6A 4BUJA 2I4OA 3EA5A 1FLNA 4U02A 3ZCSA 4WDQA 2NUAA 5G0UA 3TK1A 4KDCA 2IIVA 4LYAA 1Z0FA 4TV9A 3EPJA 1OJLA 3LG2A 1WXXA 2XT6A 2RDMA 3AUAA 4PSAA 1NPTO 4D9CA 1JDPA 4MWZA 4C4OA 1I9CA 1RWPA 2XNCA 1U3VA 5DYGA 1BMTA 1KDRA 1UBRS 3TBKA 5ALWA 4XUGB 3U13A 1GXSB 3ST7A 1DX6A 1AC5A 1GQSA 4BBYA 5F7ZA 1FBTA 3TPCA 3FOBA 4Z1MD 5LZ4A 2HQSA 1OAOA 4A9AA 1SCNE 2H16A 4ILEA 3ILSA 4YR7A 2AFRA 1EFUA 1L1RA 4M7PA 3R5TA 5JW6A 1MAAA 5LU8A 1M2GA 3RU2A 3L4KA 2JGDB 3B1FA 2B92A 2YUIA 1DKPA 1T0PA 1T5LA 3ZHCA 4H1WA 3VBCA 3DXFA 3IURA 4L3VA 2J0SA 3NBYC 4BKUA 2HPVA 2WAYA 3WBJA 3TOXA 2WZCA 3B1XA 5JT1A 5CB6A 3A4VA 3TB6A 3NTRA 1GADO 1GKLA 2FPOA 3IAEA 3VH4A 5KYGA 3OU7A 1EVJA 2MMAB 2BV3A 2JFHA 2D54A 1SBQA 2ZR0A 3EASA 2G4LA 3F47A 4HXYA 2WE8A 4IDDA 1UJBA 4CEIB 1Z45A 4OA8A 4OXQA 2X40A 4ZI5A 4TROA 3R9IA 3PRHA 3RLIA 4EAAA 4HWOA 2ECFA 4RPJA 2PT6A 1PG5A 4MHOA 3LU1A 1KOJA 2G04A 4LAFA 3X44A 4F84A 3IB3A 4HWRA 2JLVA 1IN5A 2OCDA 1H4SA 3DL2A 2FOIA 4RD2A 4CETA 3DBIA 4MUHA 4AY3A 2VOEA 1J2JA 4R8MA 2WTNA 4D44A 3O95A 2GN8A 4K9SA 4OKIA 1TB4A 3QVGA 4BY9E 1E8DA 1QVZA 3I72A 1Z75A 1H1TA 4ARAA 1EIZA 4EW1A 3WMGA 1K5PA 3BERA 4RKWA 4BJ1A 4WA7A 1U28C 2Z83A 1NJ6A 4IWYA 3PBKA 4KYUA 4NCHA 1ISFA 3RLFA 3QLVA 1P33A 1PT5A 2CE7A 4JLKA 4U39A 3LBYA 4RVCA 1OY1A 2XQFA 3USES 2O2IA 1EVZA 2WAMA 4HGOA 3IBGA 3PYMA 1E2PA 5T3YA 2P0AA 2JH8A 2XLCA 4PR0A 3UMRA 3W4IA 1Z9BA 2PJZA 2DTEA 5LCIA 2HNKA 3KSRA 1RBZA 3HYRA 2MTBA 3TDNA 1XVIA 3EH1A 1HEIA 1AKRA 2MYTA 3MQ2A 2WU8A 3HI6A 1VI2A 2WK1A 1A9OA 2ZCUA 4FGUA 4B0OA 1V7PC 1B6SA 1CR6A 2GS9A 2QTWB 3IO3A 4MW6A 4WE3A 3RBAA 1QAOA 2ZE6A 3HEBA 4EL0A 4PZCA 2C2YA 3Q9UA 2ECOA 5JYCA 5HHTA 4KH1A 4TYMA 3UJ3X 3L4SO 5JS1A 2F8MA 5JU6A 2GN6A 3CGGA 3MT9A 4L28A 5JWOA 2NUBA 2ZAYA 4IXMA 3BGIA 3VSAA 3LQ4A 1ECPA 3AEKB 5I8WA 1BQ3A 2N46A 2C5GA 4QVGA 4CZ2A 1VPTA 4KQHA 1IQRA 2CNKA 2R2AA 4X62B 3T1QA 3R7NA 2EBWA 3NH6A 2P65A 2VIIA 3FPAA 4CMGA 3JYOA 1IBSA 3LL4A 5AVRA 2H1CA 4DDUA 1HE1C 3GGJA 1NLUA 4JUDX 4QPZA 3H87A 4G56A 3GNQA 4NR0A 1GFIA 4ADSG 3UGQA 2Q3BA 3TZHA 2ZWOA 2IEGA 4YI5A 5J4KA 1W85A 4DJ5X 2O1XA 3OQOA 4R83A 1XWIA 4LZJA 5JC8A 3A9VA 2BJOA 2I2BA 2QD1A 4PZLA 3TVYA 3TRKA 2BM9A 2ZDGA 3H4MA 1MJFA 2AJTA 5FI1B 2DVMA 3BMOB 2YW2A 3NGXA 3FYUC 4LJ6A 2FEKA 5EIBD 1Y9ZA 2DLNA 2HCBA 4OQQA 3FZQA 3GAFA 4CIXA 5B5SA 1NVBA 1P9NA 2BPOA 5FNZA 1R3UA 2Q62A 3ROQA 4B09A 2PS3A 2FWAA 4R68A 2WJPA 1FQKA 2WIDA 4RTNA 5BR8B 5CBPA 4GOLD 1HDYA 1K06A 3HGMA 4PW0A 3TSZA 2XBUA 3KB2A 4OV6B 2QTVA 2XHEA 2CXHA 3UA3A 5TRTA 1AMNA 2F8TA 2PCJA 4G41A 4OP3A 4PEVA 4R1LA 2ZVJA 5IZCA 2ZS8A 5KWSA 1NVGA 4IQFA 1V37A 1I2ZA 1XZNA 3K8QA 1NMSA 4D8VA 1QYXA 1Z47A 2NCLA 5DNCA 1YF3A 2R11A 1QKIA 2VHZA 4PTZA 5DHPA 4EVSA 2QIOA 2R1VB 1XXHE 2CVOA 1M0EA 2OSBA 5KOHA 5A4MS 1L8AA 1JF8A 1R8JA 3NTXA 1XK6A 4RQAA 2ZITA 4YMGA 3PVSA 5EUMA 5ELXA 2FF5A 3GZNB 4Z53A 4I5FA 3CRQA 2ZJ8A 4URFA 4X1OA 5DK6A 3SJUA 2DHMA 5BWCA 3RYTC 1W0JA 1YBHA 1ZKMA 2I1VB 4GQIA 3OZDA 3H7IA 2VZ9A 2OCKA 3QYJA 3BHMA 4AZ3A 5DHUA 1MV8A 2GPBA 3UEOA 5JPDA 4JI2C 4PUIA 3LUKA 3O1HB 2PQ2A 1AB6A 4M2LA 4L74A 1Z8FA 2PS1A 1CERA 3NV7A 3OX4A 3OZ7A 2GZ1A 1B3BA 3KYCA 3EZLA 1AIPA 1CK4A 3QKTA 4N3CA 3N7UA 4XUDA 2NO9A 4C4XA 2QV7A 2ZYVX 5LIRA 4JV5B 1QCYA 5TVKA 1VKOA 4JB2A 1G9XA 1YU6A 4FFLA 5EQTA 4DIEA 1PJLA 3L6BA 3NOXA 3E3OA 1HDCA 4LSWA 3UOGA 2P40A 1TT5A 2Q6LA 2GCOA 1SQ5A 2JAOA 3AINA 3ORRA 3QVVA 3RJTA 4C7OB 2C42A 4OHUA 2C7VA 5CA0B 3AXTA 1ZXXA 4URXR 3NG1A 1XB2A 4J3JA 4UM7A 3OMXA 4WBNF 2SICE 3ZLBA 1QH1B 1UCFA 1PR5A 1CRLA 1MJGA 3O2QB 1WZUA 1O5IA 3D4OA 2Z6UA 4BLOA 3JWEA 3MYRA 4NH0A 1HR0C 2PKYX 1UC4B 4DUPA 2YCLA 2UUBB 3OEWA 4JP3A 3VNUA 5JRHA 3QNMA 2GPSA 4PRZA 3TUJC 4GF5A 3VPBA 2CC2A 1WRBA 4MP3A 5B57C 1PIWA 3C6BA 5KYNA 1CV2A 4GO1A 3HHEA 4H0NA 4QGAA 4FS8A 1G41A 1M2OB 3C3MA 3LXXA 2AXQA 4E32A 3MWJA 4Q7MB 2WV9A 1QANA 2PZGA 1ESEA 3N0XA 4A91A 3MPUA 2P68A 1SVWA 3NALA 2HA2A 2CXTA 3MJRA 4X66B 4ND3A 4O4HF 2X42A 2CY1A 3CZMA 1P62B 4DG8A 1CQXA 1GGHA 1H0KA 4UU7A 4E5SA 2GD0A 5ADUS 2VTBB 3D8HA 4G8JA 1Z4OA 5FWYB 3SC6A 4RKQA 3A6HA 4RM2A 4X45A 2IBMA 1MABA 4PSUA 3LCJA 2HA0A 1UFRA 1YASA 1HT0A 3H2TA 3LUHA 2CJWA 1QYRA 1JG4A 1C9NA 4L95C 3NHWA 2J87A 1TH5A 3GEMA 1VHLA 3EMKA 1HYGA 3AONB 2V55B 4UEWA 3L82B 4KEAA 5IVDA 3VR6D 2R6AA 3EOZA 3AKDA 4OLJA 5EKSA 3OY7A 3NDJA 5KKAA 4J1TC 1NBMD 4ZCSA 1USWA 2G5GX 4IGAA 4W5HA 2PS9A 4CG3A 4XDZA 5KNCD 1N9ZA 1NU6A 1XRLA 2Q7DA 3HHPA 3I04M 2FPWA 1BWRA 3PUHA 3K3PA 1J2TA 2RIPA 3L3BA 1A2KC 3P0HA 3H5VA 1N6LA 1OWOA 1YZUA 3HRKA 2RD2A 4PVCA 4DJFC 3RRMA 1AHPA 3G2MA 3DOUA 4GKKC 3NANA 4G9EA 4ZARA 5GAJA 3IBCA 5IK2D 3QY9A 3W04A 4DJJA 2O8EA 2NQTA 4HZGA 2FPIA 2ZBVA 3EIFA 3D3KA 2ZUFA 1WQ1R 2QTZA 1W36B 4IGFA 1MQAA 2AI2A 1QQTA 1YI1A 4O2AB 3VPXA 4ZFNA 3ZD7A 2W9XA 1RFGE 4F71A 3LA8A 2FWIA 2V7BA 2M9MA 2XDQA 4XOIA 5KNLA 2FRDA 3X43A 1FU7A 1GGVA 2XT9A 3L9XA 1TZKA 4I1UA 2WPNA 4N3GA 4DSNA 3FAZA 1IBLB 2PXHA 2G76A 3UBMA 3KZXA 5CURA 1OASA 3KCNA 4EVIA 1SUSA 1GPH1 1VJGA 1ZNQO 4JB3A 2HWXA 1VC2A 3TTSA 3N74A 4DCUA 4LVNA 1BMDA 4F4HA 2XWSA 3NONA 4RD0A 4B0PA 4CEIA 1MX3A 4B17A 2ZUDA 2ZBQA 3OKAA 1A7JA 5C1DA 2IXFA 4S1TA 5CIQA 2C95A 2DWCA 2V7EA 3BMQA 2P9JA 3KIPA 5DKFA 2C07A 1DXQA 1XDDA 2Y67A 3EFOB 4JT2A 4MJXA 4HV4A 1YK0A 4J8PA 3I8SA 1V9SA 2VEOA 1P7YA 4MUYA 3Q7QA 1P6XA 3DBLA 2H4JA 2QN1A 4DRZA 2J3DA 2OCYC 2ZIVB 3A1EA 4RSRA 3RNLA 3OUTA 2DP4E 1ETHA 1VCMA 2ADOA 4WLVA 4EF5A 5ALGA 1L7BA 4YUAA 1X8KA 3FPHA 4W5TA 4J4TA 4KO4S 5HQ3A 2NXNA 1FUKA 1QG4A 1GV0A 1PWEA 2RGEA 2WVGA 3DV2A 5EG5A 3SHFA 2I03A 3SXUB 2X3UA 2ZB3A 5DU2A 1ID1A 1FLOA 3QEBZ 1W2HA 3L7LA 2H1OA 4EA8A 1YBMA 3Q0EA 2JK1A 2PR7A 4IH9A 5ILGA 4EKDA 3ZJUA 4JLUA 4LDZA 2P90A 3SIXA 2DHQA 3LQRA 5EHGA 3QX3A 3RV3A 1WKBA 3FWZA 1Q5PA 4KBYA 4HZIA 2IUTA 3HB0A 1M0TA 3AW8A 1MN6A 1RBYA 1TA4A 2GETA 4RBNA 3VNBA 1VE1A 2P4SA 2VLBA 3HSKA 3OFJA 4IO0A 3GR1A 3DV0B 1A9XA 1DUIA 2A9RA 3MUNA 2BCGY 4NEQA 3M3PA 1Q0TA 2PLWA 1SHKA 4Q3DA 2RGYA 2WMOB 5KDDA 2BFMA 3N05A 3K35A 4G24A 4HB2A 4JI1B 5JRDS 1X7WB 3RTDA 4F4FA 2RG7A 3IDOA 1J90A 2IYTA 1UDXA 4PS1A 1AKNA 1JB1A 1U0LA 1FJ2A 2HHHC 1RI1A 2BGUA 4B9EA 5AP9A 1YR2A 3ZLTA 2ZAMA 3GMDA 4FONA 4XLTA 4F2PA 4O6VA 4QLOA 4ZO9A 5AUOB 5I7OA 2O8CB 2JRCA 1FXWA 3REQB 1EX9A 1XQ9A 1DO2A 1IATA 1QAQA 4XWTA 3L07A 4LY6A 3TDMA 4AJHA 1V11B 1QTIA 2FMXA 5A4FS 1CJMA 2FSVA 2WD7B 5K85A 5AK3A 1J0BA 5BW6B 1M6XA 3GGSA 5ELMA 4D9GA 4ZV4A 4LYJA 3C14C 3TS1A 3QH4A 1Z63A 5CAEA 1W88A 1SUDA 1QJ4A 1T15A 1Q7CA 2BJWA 4AN0A 4FYYA 2QQFA 4B4OA 4G01B 3C98A 1IB6A 3C4QA 4I9HA 5EP2A 3RCBA 5CM8B 1N8KA 4N6NA 5DEOA 1N6OA 2PK3A 3DCNA 4QUIA 2Q45A 4A0GA 2PGLA 4OB8A 1T8UA 2IUUA 1DG3A 4C7VA 2BT4A 4EGQA 2GFQA 3HB7A 4LG1A 4R41A 3GKUA 2GAOA 1Q57A 1R5NA 1D2CA 3GUZA 3RC7A 3CCCA 3OPQA 3K1TA 3NWEA 2IHZA 1LKZA 3RWBA 4RLQA 3IALA 2JBAA 1ZMRA 2CMFA 2CJPA 2KYRA 2ZJYA 3P4UA 3GJ4A 2FN9A 2H2FA 1Z83A 2DG2A 2HWKA 2A3RA 4YK7A 1XN4A 1XTPA 2C20A 2Q1UA 2B82A 2OV3A 5LBIA 4P4SA 4QDJA 1UBCA 5JFTA 1GZHB 3R5XA 3GQBB 4PR3A 1KXZA 1U3FA 4FQ8A 5AJWA 2Z5GA 3RSSA 3C7KA 1D9XA 2QMQA 3E22B 5AE1A 1X7GA 1P0FA 3HCAA 2IV3A 2IZ7A 3H84A 1AZSC 4IJMA 1PL0A 2QP9X