3FCEA

Crystal structure of bacillus cereus d-alanyl carrier protein ligase dlta in complex with atp: implications for adenylation mechanism
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
504
structure length
500
Chain Sequence
MKLLEQIEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRIVSEDNLKDIFFTHKGNTPNPEHAVKGDENFYIIYTSGPKGVQITYNCLVSFTKWAVEDFNLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARPKDLFASLEQSDIQVWTSTPSFAEMCLMEASFSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEATVAVTGIHVTEEVLDQYKSLPVGYCKSDCRLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAFTMIDGERAYKTGDAGYVENGLLFYNGRLDFQIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSEVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-alanine--poly(phosphoribitol) ligase subunit 1
publication title Crystal structure of Bacillus cereus D-alanyl carrier protein ligase (DltA) in complex with ATP.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Ligase
total genus 150
structure length 500
sequence length 504
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3fceA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fceA01
5BSVA 2QW0X 4GR5A 3E7WA 3E53A 3C5EA 1LCIA 4OXIA 3NYRA 5KYTA 3FCCA 3CW8X 4E5DA 4RLFA 3DHVA 3PBKA 1T5HX 4G36A 4D4HA 5BSWA 3E7XA 4IZ6A 3ITEA 2V7BA 4RVNA 3VNSA 2D1SA 4DG8A 3IESA 2P2FA 4ISBA 4D57A 2Y4NA 3IEPA 3G7SA 4R0MA 5D6NA 5BSMA 4U5YD 4FUTA 5BURA 2QVXX 3LAXA 3R44A 3NYQA 3IPLA 3TSYA 3O83A 4G37A 4RM2A 3VNRA 3FCEA 4R1MA 1T5DX 1RY2A 3KXWA 2QVZX 3O82A 3QYAA 3ETCA 5DV9A 5BSUA 4D4IA 4R1LA 3VNQA 4FUQA 1MDFA 5BUSA 4M46A 5E7QA 2P2BA 1ULTA 3U16A 3L8CA 5K8FA 1MD9A 2VZEA 4D56A 1PG3A 2D1RA 3WV4A 2D1TA 3B7WA 3WVNA 4D4GA 3A9VA 1V25A 3T5CA 5KYVA 4RLQA 3U17A 3LGXA 3EQ6A 2P2JA 3IVRA 2VSQA 1YJ7A 4RMNA 3DLPX 5K85A 3A9UA 3DAYA 4LGCA 4EATA 2P20A 4WV3A 4RVOA 4PZPA 4ZJZA 1AMUA 2Y4OA 3IERA 5JRHA 2P2MA 2QVYX 5BUQA 5BSRA 5KEIA 4W8OA 4GXQA 3RG2A 3T5AA 4GXRA 3O84A 1V26A 3LNVA 4DG9A 3RIXA 5BSTA 3CW9A 3WV5A 4GR4A 2P2QA 5GTDA 2D1QA 1PG4A 2Y27A 4GS5A 5IFIA 3GPCA 3NI2A 3T5BA 5DWVA 1MDBA 4IR7A 1BA3A 4RM3A 4OYCA 2WD9A
chains in the Genus database with same CATH superfamily
4Z3KA 1NP3A 2SCUB 2YY6A 2JVJA 3J7AC 4U7WA 3GRYA 4K9NA 3P9SA 1DSSG 5NULA 2H2FA 2QSZA 4FB4A 2EFYA 3HPQA 5AVKA 5U4QA 3QI2A 4OX9C 3OOHA 1R00A 2MSCB 4QSMA 2R6JA 1SRRA 4X6YA 5JH7B 1DI0A 1JZQA 1N6LA 2DVMA 2IOYA 2RG1A 3EWIA 3N87A 1AMOA 1TJNA 2EAUA 2R8OA 2XTJA 4BGIA 5HTKA 4D6YA 2ODAA 4EARA 1H4SA 4NCAA 1PL7A 3WRXC 4CTOA 3WGKA 3ZHXA 5LXTB 4BP1A 1C80A 2FPMA 2QP3A 3DHNA 3JZMA 1SQGA 3P9KA 1KAHA 2GR9A 3LO8A 2CBXA 1DWOA 3KT3A 3R3VA 4M0PA 1DC4A 1JI0A 2ORIA 3SBOA 2WWFA 1FFWA 1WDTA 3OA2A 3JY6A 1SCQA 2XADA 3OLCX 4US1R 2PX5A 1P8AA 2PWBA 2JRLA 3AOEC 2H92A 4HLUC 4AM8A 4EG4A 2V9PA 1OWNA 3VPCA 1FDTA 4YCLA 1SMKA 4D3XA 5IDXA 2D5CA 1SZCA 1EUYA 2OG1A 3GJXC 1RXSA 2ZZKA 3NGMA 2O0JA 2HBZA 4TTJA 2CXRA 2AJDA 5TGTA 4BRZA 3BMNA 1K9VF 3OI7A 5JS6A 1NXWA 4JOCA 1E2JA 1VHWA 3KT6A 1I7LA 2BSAA 3PKJA 4AY6A 2Q4DA 1EB9A 3OVMA 2R8ZA 4KXQA 3W06A 1I4EB 3JRXA 3BWCA 2CZQA 1LZLA 3FGNA 4B47A 3GW8A 1JLHA 1A5TA 3FSRA 1UJNA 4X3OA 1WUTA 1GQFA 3LY9A 2BP7A 4ZOQI 1GT6A 5EJ7A 4MRMA 1ADFA 2FB9A 3OQNA 3H65A 1UIRA 3NV9A 2Z51A 1PAUA 2GAIA 2JGMA 4INPA 4QATA 2FN9A 3T5CA 1ATIA 4LVCA 1QOPB 2EVWX 2IDZA 2P2SA 3DE5X 1E2EA 4MJ3A 1EDDA 1RYFA 2BBTA 2GVDC 4NDAA 2PBZA 1KQNA 4EY7A 4GM4A 2X3FA 1NC1A 2HKIA 2Q5LA 2RAFA 5G3YA 1JSCA 2PRIA 3NFYA 2R7AA 3E15A 4KIJA 2R6GA 1T3ZA 2HY7A 3LWBA 3UAXA 4GI5A 4C1BA 3B20A 3V5NA 4N0QA 5KNCA 5KJCA 3TW0A 4JSRA 4MQEB 4ZGWA 2VQFC 3THOA 1NQWA 1D2AA 3AUSA 4D4JA 2YN0A 4HSEA 3VJRA 4TS1A 3ZG6A 4A73A 1RLIA 2O48X 1PS9A 2A33A 3C85A 3F9RA 3HN7A 1N33B 4UAUA 1TB4A 3TG8A 1ZCAA 4BQIA 4PG4A 4RIFA 5E1OA 2EJVA 3I6ZA 4D9EA 4V38A 2VF2A 5BW8A 1TK3A 3C3DA 2Q6IA 3MYYA 2PU7A 1F14A 1OLOA 3KK0A 1H69A 2PR7A 1DJLA 1EFCA 1YRWA 1JIQA 1U9ZA 1K6MA 2C59A 1OR8A 2Y1LA 3CISA 1CT9A 3L7OA 4FT2A 4TQ9A 4Z2AA 3GFFA 4HXGA 1SU7A 2AJTA 2OFOA 4LBZA 1OXVA 2UVQA 1I24A 4RTLA 3RYFA 3PEEA 1Z0FA 1CJCA 1J2YA 3GU3A 1MO5A 2G6BA 3DCJA 1XKLA 2BSQA 4MI3A 1ZWKA 1P4JA 3HDQA 3QMVA 1MXAA 1TCAA 3LP6A 4JFRA 4QECA 2EFHB 2P9JA 4NG5A 1E1QD 3N8KA 3SGLA 4MLPA 1QH8B 3VJLA 4C0QC 2M6LA 5L3QA 1A3CA 4E31A 2OFPA 1PD1A 2DHDA 1U11A 2Q7XA 1YQEA 4ZT7A 3MJDA 2D7CA 4FR2A 4QEDA 1GZ7A 3K0EA 2JGEA 4ACAA 3WTCA 3TLJA 3P2MA 4BP3A 1UKCA 4RFSA 4W5NA 1ATZA 1KA9H 1XOIA 3RS7A 5KYUB 1H0RA 1DBPA 4RHCA 2O5VA 2VPZA 2IBSA 1M6VB 2JAHA 2ZBVA 2PT7G 5K4AA 5K4GA 1ZL0A 3KYDB 4P7BA 1T9HA 2CLCX 2H5IA 1T8TA 2W2LA 3GDGA 1P39A 4EW6A 2IITA 3ZZNA 1DKNA 2P35A 3L79A 1CNMA 4FIZA 421PA 1UJ2A 2ZAGA 1H6AA 1M2HA 2HXGA 1OVMA 3FCOA 4AMZA 1YBMA 2OHHA 1P31A 3SJ7A 1KWGA 1N77A 5E6UB 3UXHA 1R4MB 3BTUA 3R6GA 5AKXA 3B3FA 4FBMA 1I5EA 1T1SA 3D3KA 1NY6A 3TSWA 2Q1UA 3TTSA 3ZHBA 5KOJB 5A7FA 2Y0PA 5JCJD 2YXPX 3F7TA 1I7SB 4K1XA 4CEJB 3DZJA 1OE0A 4RNCA 5BN3B 1U4NA 4WKPA 1D7OA 2GBIA 1OZGA 2ZCVA 2J9FB 5I4IA 2BGIA 5FJJA 1N0VC 1SUWA 4UTOA 4EAQA 1JLLB 4LDZA 3RRJA 2XUIA 1M0TA 3L82B 5J4VA 3Q87B 2Y1OA 4BB6A 2XE6A 4YRAA 5CLQA 5LZ4A 3ZDAA 3K70B 4RTMA 1DC6A 2AKYA 2QJFA 4PNZA 1U8ZA 1WUKS 1E66A 2VCYA 1QM4A 2HEGA 3MMZA 1FEZA 3QX8A 2OEPA 1DJMA 3KQYA 1E32A 1VHLA 3HBNA 4E1AA 5KYWB 1TAGA 4O25A 1PG2A 1NVFA 4QC2A 2B21A 3PA8A 4XDZA 3CURA 5H82A 1GPJA 4NSNA 1NN1A 1SBZA 3WGTA 2IYSA 4W1RA 5EAIA 1TZKA 4RTPA 1XEAA 1QCDA 2IW3A 2ZJAA 4EHFA 2ZOSA 1QFJA 1T10A 4WNIA 1TJ4A 1UBCA 2GJAA 2ZBDA 4M0CA 4QDOA 4TTQA 1F0NA 3ETGA 4LQ4A 3ONEA 3U7JA 4COKA 1EIWA 4EVQA 1KZ9A 4S0XA 3TDNA 2EJBA 2HHHC 2CXCA 4HNGA 3AR4A 3U56A 1LD3A 5G0WA 3EUEA 4FDMA 5SYNA 1DOAA 5BSRA 1NJ8A 2H1OA 3UAGA 2JD1A 2C31A 4K9KA 4UE6A 3TX6A 1LFDB 2X9QA 4DG9A 2R2GA 3OJEA 3KAJA 1ISPA 5BQXA 4M98A 1XKXA 2OHVA 1BEUB 3E4CA 1A9PA 3EW7A 2I7TA 1SKUA 2D1QA 3NM6B 4RW0A 2VTBA 1RJGA 2BGTA 1EVEA 1XK7A 2DTDA 3W8EA 3HSKA 1IE3A 4AVYA 1XYGA 3WYFA 1JU3A 2O3QA 1GY8A 4JMLA 1K7XB 3BMCA 2XOEA 4L4QA 3HFRA 3G8DA 4IQ4A 3LTNC 1G6OA 1Y6FA 3DVSX 4X1IA 2GK7A 1W2WB 1CR2A 1TZ2A 3NUZA 2ZUSA 3Q7TA 4OBBA 4XM1A 3K1JA 2BMFA 4G41A 4F3TA 1GNVA 1WBDA 4MHOA 1YZQA 4O2AB 4Y0AA 3S44A 5IWCA 2VF4X 3S81A 3TX2A 1X7WA 3PJGA 4FW8A 1E7YA 4BNZA 4CKYA 1KVRA 2M5OA 1M6EX 4H7IA 4YAFA 3JTEA 3DULA 3V00A 2HRCA 2BFFB 1FFSA 1XLWA 1IN4A 3N54B 3V8PA 1Q1EA 4NJEA 4GFDA 3TRKA 3JAMA 1NP7A 1UEJA 1I2DA 2N9UA 4FWIB 4MLCA 3HM9A 2BYTA 2GZHA 4PSCA 3O9MA 4EI2A 2A9VA 3K92A 5AJYA 4ENWA 4WJZA 1GZ3A 2BKUA 4YWJA 3VRHA 1KK1A 5DVZA 2ZWIA 4CR6A 1HE1C 1RRPA 1T1GA 1PT5A 5KDOA 4Y7DA 1V5GA 4KHPC 2QOEA 4R8SA 1F06A 2EGHA 2QUHA 2WTBA 5IC5A 4B87A 4EYSA 1HSOA 5F9FA 1S4MA 2IYQA 1CZUA 3TL3A 3ETCA 2G83A 2GMWA 3RO7A 2IZ7A 1IXKA 4TLEA 4ER7A 1IBSA 3HN2A 3OZCA 1ST3A 4Y9TA 3OMXA 5GJWC 2NSYA 1Q0UA 2PRSA 1FSPA 3QLTA 1KDYA 4GW3A 1EFVB 2ONYA 2QRLA 2BEUB 2J3EA 3G0OA 5IDYA 5JMTA 1EWTA 3GGDA 4WBNB 6YASA 3WLMA 2Q9UA 3Q7EA 2H4WA 2E8FA 3H4IA 3QG5A 2QMHA 4TS9A 5L7YA 3U0VA 3KVYA 2WJGA 2AGVA 4KXNA 1GTZA 5G0VA 1Y7PA 1LGYA 4ZMSA 5JVDA 4N7JA 1SB9A 1D09A 5NLLA 1K68A 1VYVA 1WCV1 3HCRA 2F90A 2ZUTA 4H7HA 2NO7A 2ZATA 4HPXB 4XASA 4X1KA 3B82A 2WKWA 1V2GA 3IGFA 4JI3C 3VDXA 1E69A 1G5QA 2ZIAA 2EL7A 2OA0A 1I3NA 4PZEA 4LQLA 3V2HA 4BKPA 5BW6B 3BJZA 1UT6A 2OBLA 4WOJA 3HKDB 4ER5A 1IN7A 1O95C 4R9RA 3DBHA 5T8KC 2JFUA 3M5WA 1MGPA 2M32A 5JATA 2J5RA 4M9RA 1QU3A 2GGSA 5CT9A 1JBQA 3S2EA 1Y8ZA 1XCMA 4ZPJA 4DF3A 3U4QB 3DBIA 3K0BA 4EA8A 1V6AA 3U3KA 1H22A 4CQMD 3DEYX 3ONVA 3U48A 3BWBA 2I2WA 1KDRA 4NRDA 1Z7GA 1A2OA 3TMAA 3ZS8A 5HKKA 4ZCTA 1PKEA 2A7QA 2G9RA 1SIBE 3CF4G 4PZZA 4UE3S 2WFZA 3UZ0A 3BBLA 4PLWA 3QKRB 5KSOA 5C0OE 2JLXA 3PPWA 3GJZA 2CW5A 5HR5A 2ST1A 2Z6QA 4CNQA 1YFKA 4XVQA 2JJ2D 1WZ2A 4WADA 3LRTA 5A5FA 1ZJ5A 4P81A 4I1YA 2DBQA 4U2BA 3BXXA 1KJJA 1LZKA 1D1TA 4LXXA 2WJ6A 2B82A 3QQ5A 3K4QA 2BFNA 3GT4A 4AS2A 4RVHA 1J1ZA 3T7AA 1XJQA 4C43A 1IY0A 3C5EA 2XB8A 2C4NA 4FYKA 2ZSIA 3L1VA 4NZMA 2IPXA 4OJNA 5JNVA 2AQKA 2WG1A 4Y2XA 1HR0B 1JE1A 1KARA 4KJZA 3K6SA 1MHPA 2XXAB 3VKFA 2ZM5A 3KJHA 3KL4A 4RC9A 4AZ0B 1FYEA 1OWLA 2QTZA 4DQDA 4PN7A 3THYA 1MX9A 5DXFA 1L5VA 4HYYA 1OIXA 3CR8A 5FR2A 1WW2A 4P4NA 4RA6B 4L8YA 4EHLA 5CYFA 1KR2A 1WSAA 4EDFA 2QF7A 3OZIA 2GJKA 4KFSA 1W29A 1YACA 4NLLA 4EUFA 5HUQA 1N2GA 1U7PA 3IR6A 5CNMA 1PS0A 2C2WA 3I83A 2IEAA 3N3BC 2E4AA 1U02A 1FFHA 1P1HA 2JC3A 2AZXA 2X8WA 3BF8A 3QMWA 1M7HA 4MNTA 1E2HA 3V80A 2Z5GA 3VOTA 1CZOA 3AL0C 1WHTA 2IV2X 4G5RA 1HMYA 1T2VA 3QW2A 4FFPA 2XT9A 2BEVA 4IFIA 2CN1A 1RD4A 1ZRNA 2A0UA 4UUNA 4Y2JA 1L6RA 2NGRA 5HSGA 2X6TA 3MLBA 3I5AA 2A9KA 4IVPA 2JS7A 4M21A 3MD9A 3WL7A 1KFBB 3FGOA 2VP2A 3KB2A 2QMEA 4Q37A 2XWPA 4LF4C 4CQJA 1FFYA 1O8CA 1BEZA 4DLWA 2VAMA 3R7BA 2F43B 4XIFA 3PGVA 4MS3A 1RYNA 3GT3A 5K0JA 2OV6A 5ED0A 1DO8A 3SF0A 1JMYA 3H1EA 3LC0A 1U1GA 2GX6A 5FQNA 4D02A 1N2BA 4P4SB 3NHFA 1PTJA 5TX7A 4DLTA 2H4XA 3B60A 3DC2A 2P2GA 2WA1A 2Z56A 4Q3OA 4AUMA 2HU2A 2ZTSA 3DOFA 5AKIA 4MEAA 1DRJA 1E7WA 3CLKA 4YP6A 3KAQA 5JAHA 1O58A 2WHEA 1I4TD 1TH5A 1B15A 3CRZA 3D5QA 4ZAYA 1MR3F 1F0YA 1FE8A 3EGXB 4LQCA 3ZHZA 4K0KB 2DECA 3GFVA 1S5PA 3H2SA 2K7FA 4NZOA 3M6FA 5JU6A 2WNIA 3NDBB 2WYOA 3L6RA 4XFJA 1Z8NA 3IEXA 2JJ1A 1TTHA 2DR0A 3OHPA 4L28A 1BMFA 2I6UA 3B9PA 5BNWA 3ERCA 1LS6A 1YCFA 3HU5A 2NUTA 1NBME 2XA9A 4UMFA 5CFMA 3LA6A 4KEAA 3L8GA 4PG7A 4LBYA 2PQ6A 4H7PA 3C15C 1V16A 4R40A 1DQPA 1EM8B 1GFSA 5JXGA 1P3JA 5AKHA 5HMLA 3INRA 2AWOA 3ANYB 4NKRA 4O8ZA 4L8FA 2H2GA 4CZ2A 1UBGA 1EXDA 2XGGA 1D8TA 1F8UA 3W4KA 5FWYA 5K3SA 4RD3A 4M8LA 4HVTA 2NACA 1T4BA 2V65A 2GPNA 1FS5A 4MYCA 1NVVR 2WJIA 3HYNA 4MR7A 2VKQA 5I9BA 2CNKA 2IQ5A 3KVRA 4A03A 4E32A 2WWXA 3DUFA 3HJCA 3Q9UA 4JOQA 2WU0A 4TYWA 3WRYC 4QAQA 2I7VA 5AE1A 4EF6A 3RTDA 3IQGX 3STVA 3C1UA 3DPIA 4MDFA 4UTXA 1XZQA 1Z5WA 2R62A 2P62A 4AG5A 3RBVA 1EP2B 2OB1A 4TVBA 4CDGA 3FLEA 3F8SA 5T8TA 1S01A 4WACA 2XMCA 5JS7A 1T8UA 1X7GA 3MBOA 3ISJA 2VH1A 4NPCA 3ZYZA 3KJZA 3ETDA 1JFVA 1TF2A 4XARA 5JSUA 1GU1A 1RLTA 4KYVA 2GD2A 1Z0DA 3GJTA 3KJIA 2QPAA 3HUEA 3FYCA 4IOLA 4URFA 3ZXUB 2YWBA 2OKCA 3B13B 1HNXC 1WO8A 2NT3A 5EWMA 1FW6A 3DXXA 3ZVLA 2H2DA 4YXWD 2JF0A 2PMFA 1JKXA 2Q1YA 3F90A 3IAM1 4D1YA 5GONB 1YJXA 1CUDA 1UL1X 3BICA 3B89A 1PA4A 3FJ1A 4HWGA 4Q1VA 5DK4A 3G3EA 3OZSA 5GONF 7MHTA 4MYTA 4R41A 3GCGA 1I4DD 4QU9A 1YHYA 2L82A 2Y2VA 4JT2A 1NZJA 4TV9B 5D6NA 3RARA 4UQOA 5F52A 3WO1A 1XLUA 4IDGA 4WKNA 5K3FB 1Z8HA 3O1HB 5FFFA 4EJSC 4N03A 2PGAA 5AJXA 4X6UA 4CMAA 1JWLA 2DSTA 5FTJA 3DP7A 2M9MA 1UZMA 3KKPA 3M9WA 1IJEA 1GSOA 2AKAB 2R5NA 2ZI6A 2ABWA 2IS4A 2QYSA 1E2BA 4UMEA 1FDUA 3ZK7A 4U9HS 2HK6A 4WHMA 3GLRA 2X1LA 4GF5A 2ATEA 1VL6A 2TRSB 3Q7IA 3CC8A 3DFMA 2ADOA 3AQIA 2EG9A 2J87A 3MUOA 4L9AA 3T9EA 4B2YA 2H3EA 4N3GA 1FMTA 2VI5A 4BNVA 5J58A 4X0EA 5A6SB 1TQ6A 3M4NA 3CQ9A 1LF5A 1EXWA 3WRXA 5HQJA 3UCXA 4AKEA 4CG2A 4XIGS 5DHSA 2FUNB 4HWPA 1OPXA 4JOBA 1Z6GA 4LCJA 1YRYE 3W34A 1USUA 3OCYA 3H17A 1JAIA 2Q5IA 3WFIA 1E6EA 1SVOA 4DLZA 3NHMA 2XDYA 3VO2A 1GGFA 2EEPA 1RM0A 1CQPA 2I2DA 3NIGB 3R8FA 2YIVX 1XQ1A 3NMUF 1G4HA 1K92A 1ODSA 2RB5A 3I9NA 1K8YB 4TLBA 3GJSA 1QO9A 3F71A 4IF6A 1CUCA 1GFIA 5BWCA 3QSGA 5KWVA 5IW8A 5C4IA 5K85A 4HLUA 5TQ0A 2Y99A 2FUKA 2C84A 3RYHB 4HX5A 3DL4A 3WC4A 1BKYA 3A6JA 4AKIA 1BIFA 5T6MA 1XVVA 1E60A 2CKDA 5K6AC 1XGKA 3FOCA 3CE6A 2QT9A 3PDWA 4MVJH 3UKJA 4EFKA 2EP5A 3QXHA 1DBWA 2JEYA 3TLBA 1RYDA 3ZH2A 4B4KA 1C1DA 2H2IA 2H31A 2A4MA 1VE7A 821PA 4TMFA 2FMTA 3N5CA 1BHJA 3K9WA 4UM7A 4DRXB 4TKVA 2ASVA 4W63A 2X0EA 1XCGB 4J9VA 4GC5A 2A5YB 3RDPA 4EHNA 3BGDA 3QV2A 2WAOA 1QB8A 3Q8KA 1KC1A 4QO7A 4AWXA 1U0FA 1GGEA 5GINE 1ZRMA 3ZV6A 3BWVA 1V11B 2X5NA 4B84A 4BQNA 2XOKA 2XRFA 4MQBA 1B1AA 2B0JA 3B9RA 1JF8A 1FPQA 4UEKA 5AUPB 2ZCUA 1HLDA 3HFJA 5EG5A 4FQ5A 1BN7A 1OXBB 3SJAA 1HKUA 1AHPA 1U9CA 2QPLA 2WFLA 5DCUA 1PW7A 2QQEA 4H7FA 3SR0A 1JDNA 1KC3A 3KYIB 3LUPA 4YQFA 1R0BA 3MCAA 1DAPA 5IAKA 2O8BA 5LKRA 3L0DA 4IDBA 4QARA 5JCZA 4QXRA 3VTFA 3CJEA 3FDZB 1MRZA 1YO6A 1NQAO 3F5FA 3L5OA 4EHKA 4ARAA 3I32A 3K9NA 1GAWA 1DAMA 3UMRA 4RVNA 4EJMA 2PS9A 2CVOA 3QXJA 1KOJA 4M3NA 1QV9A 4YCJA 4FFBB 4EGCB 3ZU5A 4POOA 3C5HA 2ZR0A 3P20A 4UOQA 4KCGA 4C3UA 4MZDA 3WADA 1HMPA 1JDVA 1Z0SA 3CE9A 3Q40A 4IV0A 5KC9A 2RK4A 1TYBE 3PDIA 3QF7A 4XX2A 1PTKA 1T6BY 3N5KA 4ZT5A 1RXWA 3DTVD 1R8XA 3QYPA 1Z5UA 2PVSA 3KZ1E 1GAQA 5EINA 1LVHA 4OK3A 3RV2A 2EKPA 4B3BA 1HNWC 3IQIX 4ZXFA 4XYEA 1ZKMA 5KNBD 4OA8A 2JLUA 2H1HA 4DR1C 1KKUA 1OBFO 1NWHA 2X2PA 4IDOA 3N2YA 3OLYA 4IXMA 1T29A 1QHHA 3O8OA 4JUDX 2IKQA 2Q1WA 2FW9A 3GHYA 5AJTA 3WISA 1EEXB 3L9XA 3QUSA 4EG1A 2JLYA 3AEZA 4MPPA 1VJGA 3BSSA 3KR2A 1R8JA 4D4IA 2AS0A 4JSTA 5A2GA 3M2TA 1B26A 4G81A 4HBZA 3GZJA 2IIQA 2Q5JA 1NL3A 3H9EO 1LY1A 1QQ5A 3CS3A 2PSEA 2DSNA 1HXHA 4JGIA 4ZALA 3SIXA 2XMPA 3P94A 5CP8A 2A88A 2G67A 2JCBA 3FRJA 4TTPA 4OK6A 1BO6A 2PTGA 3MJHA 1WNFA 2W98A 2AD5A 4Z8XA 1DUVG 2X5OA 3LHIA 5A5DA 2AXEA 2OVBA 3OZWA 3LWNA 3M6LA 5JOQA 2ZRLA 3OIUA 4BQQA 4YRIA 1PZEA 3O4FA 1BW9A 2B0CA 4NFSA 2E1PA 2FE1A 3PT9A 5JSFA 2QN6A 2VR1A 3O1JC 4RK1A 3A9VA 3MGGA 3GA0A 2EYQA 2ZB8A 3OPYI 4XUDA 4P7FA 4TRNA 3SE7A 4I8IA 3UJ3X 2HQSA 4URXR 2A92A 1O90A 4DV3C 2I7DA 4JYMA 3S8MA 2PNFA 2WJZB 1EE2A 1Q2UA 3CZ5A 3IVRA 5TARA 4DMFA 4C21A 2JARA 5KTSA 2YMQA 3PX7A 5D84A 4NU5A 5EPUA 1KI1A 2V98A 1W36D 3LLUA 3DDHA 4I1PA 1SELA 4V03A 5A04A 4FDUA 1NT2A 4LRWA 4TVKA 4E1BA 4AK9A 4Y6PA 3F98A 3G5AA 4YAUA 1SVKA 1RCTE 2QORA 1ILEA 1WZEA 3A3KA 1UP6A 2QSJA 3FNQA 3IA7A 3N07A 2Z95A 5EGNA 2EZ8A 2LW7A 4ANFA 1YFJA 2IU6A 3D3WB 1GVNB 1YK0A 4WSOA 1OI3A 1TQDA 1LQUA 4GQAA 2BKEA 2JCYA 2P67A 4F9GA 5C1BA 1Z39A 2PBRA 5KNDH 1LVUA 1W59A 3E1KA 1XRCA 4GR4A 1CJMA 4Q4JA 3ZNPA 2NVWA 5JI2E 4DR6B 4IJ5A 1PN3A 3PD0A 1B8UA 4MV5A 1SXJD 2R1UA 3PDUA 1X7YA 1FNNA 2JEOA 1C0KA 1HETA 3PS9A 3VPDA 2I65A 2Y67A 3O7MA 2O2GA 3GROA 2PZKA 3HU2A 4RUKA 4BSZA 1ZOIA 5IUJC 4FHFA 5K0ZA 4OH1A 4RDIA 2PK3A 4OB8A 1S2NA 4JAVC 1RQ2A 4FIDA 3OPQA 2CFRA 4Q0MA 1CBUA 1Q20A 1T5BA 2O0KA 4NHOA 1DLJA 4F5YA 4ZTUB 4FHZA 4M7PA 5G1PA 1B93A 4LFCC 1FW8A 3RLIA 2XUKA 2JNVA 3NIWA 1RWXA 4EY4A 3EWSA 3VMMA 2YJ6A 1R6VA 2V0NA 3H83A 3N7UA 2F64A 3M3PA 4NBSA 5FL7D 3SHVA 1RAAA 4YQYA 5DEIA 2PEYA 4FU0A 1IM5A 3LV8A 3HDGA 1PJ3A 3KPYA 2CJWB 2PA3A 3R24A 2PJRA 3F8WA 3DKVA 3CY6A 2XVXA 2QTNA 5G0TA 3U7FB 3OZXA 4L5AA 5F76A 1S8OA 4KQHA 1HFEL 3IH5A 2WLSA 4Y2PA 5U4XA 721PA 3ILHA 3D6VA 1XS3A 2ZJBA 2LDXA 1MBZA 5EJIA 1Z0ZA 3REQA 2ZSDA 4A1FA 3NBYC 3LL7A 4Y9UA 4U5YD 4H3VA 4M88A 1L4BA 4BAZA 1S3GA 4A1OA 5JW6A 1F8YA 1MF7A 2LKCA 4BB9A 1D1SA 4DPMA 2DLCX 3ADPA 2BFWA 3RTAA 3WKEA 3REFA 4YHHC 2OQRA 4WNYA 2E7ZA 5TRTA 4DVJA 2GCNA 2MSWA 4I4TF 4HJXA 1U9YA 2PS1A 1CRZA 5LCXA 1SVWA 1QP4A 1XZEA 1JPJA 1MW8X 1OXMA 3SBXA 5C51B 3MPUA 2P2DA 1JKFA 4IUCS 2EEZA 4MRVA 2WPNA 4X8LA 3RFCA 1HDCA 4WASA 3H18A 2DX7A 1EUCA 1KEWA 1RADA 3OICA 1XCJA 1ZVMA 2J31A 3GD5A 3OQVA 3PNBA 4PUIA 3KQKA 2AF4C 1E9SA 1M34A 5JMWA 5E0OA 4KOEC 3PZBA 3EXFB 3UMMA 3UJAA 3D4BA 3WY9A 5LSAA 2VJKA 2XNHA 4JDUA 4OGFA 4ONEA 1XIVA 1XZPA 3RRZA 2G4CA 4BZZA 2ZBRA 2QI9C 4FHDA 4XDYA 2JFBA 1Z73A 3GLVA 4N3BA 3ZWOA 2VT6A 3QHPA 2FA9A 2Y6VA 5CVDA 1WCYA 1PS8A 5EJ8A 4A8PA 4A36A 3MGCA 4B17A 7GPBA 3A0RB 1I32A 3ETNA 4WDQA 1TMGE 3ZYCA 2VJLA 3A2LA 3A9UA 2AG8A 4M9QA 4OU4A 1RKQA 1BXGA 4YCDA 1DKQA 5JDCC 4BTVA 4F72A 1Z82A 2V0CA 1COWD 1DG3A 2H0QA 2ZS9A 3DMGA 3OZEA 4LHWA 5AOAA 5FBQB 5K3BA 5ADHA 4DR2B 3T9DA 1XFAA 2QJTA 4EGJA 2B83A 3IODA 4IPTA 1B0UA 1GTMA 5H16A 3RVNA 4DVGA 2C5LA 4TZ6A 1K0FA 1R1DA 2RJOA 5HQ3B 2HLDD 4U39A 1QRAA 1VHTA 4HR7A 3SKXA 4YI3A 2UVPB 5DX0A 3QJYA 1K7SN 3FNGA 1Q57A 1RXUA 4WE3A 1RLUA 5CTJA 1EJ0A 3EH2A 1G7RA 3EPKA 3TW8A 1LTQA 4NATA 4DL9A 5AK4A 3UT0A 3QSYA 2NSDA 3PXAA 2E3JA 4YEDA 4F1KA 4MIEA 2FZ4A 1Y9JA 1JEEA 1VI5A 2X4LA 1YJCA 3KCNA 4MWOA 3WMXA 1NVDA 3O4RA 1NKTA 2JCSA 4AJEA 2BH2A 3GJYA 3E7WA 1KERA 2CE2X 3B1JA 3R6TA 3HY4A 4D80A 3ICQB 2VQ6A 4HQNA 1LX6A 2H18A 5KYTA 1O95A 4U2GA 1W7AA 4X91A 4M0KA 3ZWAA 3W2GA 1NQXA 3CLTC 1UC4B 4HNHA 4OQQA 3T0GA 4IG4A 1H9BA 1DARA 2H8GA 1GG2A 4LYFA 4D99A 3HRHA 4D9CA 4E33A 3ZIUA 2VRCA 3HDYA 3U4IA 2G8NA 2YN4A 2PXCA 2H5LA 2A57A 4YUVA 5D5PA 2E6UX 1P6XA 3F49S 2I8CA 2WF6A 4LFBB 4W7IA 3VYVA 3AVPA 3H6GA 3IQDB 4JBGA 4QU0A 3ELDA 5BV0A 2GPJA 1FFCA 4E09A 4F6RB 1CVRA 3AY7A 1FFXB 1NXOA 3LX8A 4EPXA 1RE0A 3U7HB 5DP2A 3DEAA 4E2WA 4WESA 1YR2A 2C7GA 4D8XA 1KO4A 3MT9A 2EARA 2HSWA 2WAMA 2OYCA 1ML8A 5E3JA 3T52A 4KR2A 3OU7A 1Q1BA 2QN8A 5TQVA 3BL6A 1THMA 3P9XA 5MFZA 2BKAA 1KYVA 3IURA 1L6IA 2FMUA 4TL6A 4Y9DA 2YVQA 4X54A 4L78A 5FBLB 3V4LA 3B52X 3Q3HA 2IZOA 3X1MA 2C0QA 1H2XA 3CEJA 1XPJA 4MHSA 5SY6A 4TL8A 4PR3A 1K3FA 3AVTA 1CQIA 1CY7A 1Z12A 4JI4C 5K2OA 3EZNA 3BKWA 3EQZA 4JQYA 1LK7A 3OC6A 4JLWA 1ILWA 4R8KA 3H87A 2NNWB 2OILA 3L41A 4YCBA 5AVOA 5A62A 4TWJA 1S2MA 4Q1CA 1IMOA 1YC5A 1H2BA 4K0BA 3C48A 5EJFA 5HGXA 3CNEA 2X1MA 3OG9A 3TOSA 2B94A 1NDHA 3ET5A 1KY2A 3E58A 4HADA 4LJLA 1AF7A 3DBVO 4FZVA 4QUDA 2DJIA 4WTOA 5IBQA 1L7EA 2C7OA 3QEJA 3IBCA 2AL7A 1A1VA 4RADA 1WA5A 1DEOA 4DQUA 4J0DA 2ZRHA 3VYUB 2TECE 3NEYA 3NKVA 1Q3HA 3U4HA 3HN6A 4BMDA 4JI8B 4Y6RA 3N28A 5KJFA 5KVSA 2HIGA 2N42A 3RVLA 2JVKA 2QQFA 4IG9A 3D8HA 1U04A 3IOMA 4HX2A 4MH0R 3QVSA 5IFKA 3CLHA 4MUGA 1VBFA 4IL5A 3Q8MA 1CUWA 4ZAVA 5A2QA 2UKDA 5LP6F 1NPDA 2ZSBA 3BMNB 5BV2P 1AGPA 3WFJA 1NF8A 3LXMA 1NI3A 2Z2YA 3MRTA 4Q7EA 4CM9A 2XCRB 1IBKB 2RH8A 5KSWB 1VSVA 3IDSA 3WIEA 3ZW8A 1JFTA 2J3LA 2XX3A 1MB3A 1JSXA 3QXCA 4GHWA 4M1OA 5EHQA 3R41A 1NMQA 4FKBA 2UUBB 3SX2A 1V0JA 1NZFA 2BP7B 3IHWA 4NZ9A 4OBXA 4BMYA 1DKOA 4MRMB 1RMYA 3QFHA 4J7UA 5C7LO 2FAXA 3DA8A 1E6MA 2D1YA 3KXIA 4KL8S 1ZESA 1WU7A 4CKXA 4ZV4A 2VDOB 1T3GA 1TAUA 1XTSA 3WYEA 1RC0A 2G77B 4HGPA 5CDSA 2BOVA 5M34A 1FNSA 3RD5A 5BMVB 1O7JA 3UJ7A 1UZNA 3VDMA 1V3VA 1N5IA 4UTZA 1YR1A 1ZIYA 5DHQA 2RI6A 4MV3A 4WBSA 1JIIA 3RKSA 1F2TA 2QNRA 3IE1A 4IJVA 4DA8A 4I50F 5IJWA 1S2LA 4XWAA 3RJZA 2IUYA 1U0RA 1I4LD 3EPPA 1JR3A 1O87A 1YS2X 1JHPA 1AGRA 3EVBA 4OI1A 2FQWA 1OA1A 4IDDA 3GP8A 4MW5A 3U5TA 1F5NA 1BSVA 1ANKA 1EFTA 2VLBA 2PL9A 4EI8A 3RS3A 3THXA 4LXGA 1MX3A 3ZHOA 2CLLB 2Q3BA 2FN8A 3KSMA 1IRXA 1JQDA 1TEVA 4J49A 2ONCA 3UCFA 4MRNA 4XVCA 3IHLA 2WDZA 1H2EA 1QH1A 4ALLA 2C4MA 2X4IA 2ZM6C 3NVMB 2MJLA 2YDYA 2IS2A 3NC4A 2NX2A 4BAUA 4YALA 1IEVA 2P1ZA 2W6ZA 1IAQA 4FMCF 3JYOA 1TGYA 2FW0A 1EHYA 2WOJA 3D8TA 3RYFB 1O9GA 1ONSA 3NOXA 5ALNA 3VOSA 4JC4A 3SHQA 2QVZX 3LIIA 1SY7A 3O82A 1Z4KA 2J0UA 3G13A 5EWLA 3ZQJA 1USPA 1ETHA 1J39A 1QYCA 3NWJA 4YP0A 1GKKA 1F6DA 3VV3A 5L3QB 4ZJYA 1FRVA 4YUYA 4Y2TA 4YLYA 1MW9X 5A7GA 4JSYA 1TT7A 1NMYA 4B74A 5IBRA 2GAJA 4PSUA 1QQTA 4KPUA 4EB0A 2OKGA 3AU8A 3OLXA 4LZAA 1HL3A 1Y98A 3KBBA 1IQPA 2XD4A 3KVOA 3A26A 1AZTA 3HCNA 1BS2A 3V3TA 4QZVA 2ONKA 1HDOA 4RFSB 4XB2A 5KTNA 1ZO8A 2G7MC 4DLSA 2JLCA 5KDLA 5IT5A 2F8LA 3G9UA 4DDVA 3KWJA 2HCRA 4RFLA 2CLMB 3U49A 3DLAA 1GD1O 2IHZA 1J2RA 4YAOA 4LMAA 4EJSA 2E82A 2CK3D 1VBKA 2O2ZA 5I7AA 3RC3A 1Q7RA 2ZJ7A 4GQIA 2RIRA 3K70D 1HDYA 1HTWA 4OA5A 2IOFA 2H52A 4P34A 3OFKA 3VMFA 3D0KA 4JLBA 621PA 4PC7A 1OXXK 2IVFA 1G5TA 1GJRA 3VHXA 3CH5A 4KMSA 4MR8A 1QSGA 5JAOA 1Z4MA 3C6XA 2QY6A 3LQ4A 3FUCA 5DOZA 3L0YA 1N5OX 3WBKA 3OA0A 1Z2CA 4PU0A 1EWKA 1M10A 3R5FA 1WR8A 5AKYA 4GE3A 1XG5A 4UUAA 5IBPA 3ZCTA 3PUYA 2EFCB 4QFCA 4FOPA 3ZS9A 4BGDA 3RQSA 5LQMA 1WDMA 1K5PA 2G08A 4LJ5A 2IY7A 2XEXA 1CF9A 2XQGA 3NH6A 4J07A 5DLPA 4BJ3A 3NWBA 3RODA 4LY0A 2H2AA 3W5CA 4P8RA 1JJBA 2VXCA 3ESDA 4YRRA 3BXHA 1GLNA 1EVKA 1GPNA 4UM8B 4PIPA 4DEXA 4GSKA 3ZQ6A 2YCBA 1OHHA 2BDUA 3CTMA 3H2KA 1XZMA 3DZKA 1CR1A 3OIWA 4HAZA 4IJQA 4L5YA 4UD2A 1M6HA 4YJ2F 5BSVA 1JXMA 1GPKA 4MKIA 1OTXA 1EU1A 1HI9A 3EXEA 4DV1C 2BJWA 3EZ9A 3MCZA 2ZJ5A 4MVXA 3JYNA 4URVR 3ZDCA 1HY3A 1PK7A 2FLKA 2FOLA 4BN4A 1IIBA 2V6FA 1ZMBA 2QWXA 3C41J 4P9NA 1YDMA 5M2QA 1S7CA 5C5DA 1VMKA 4ZCSA 3VR1A 7ADHA 4IGFA 4W1PA 3PTAA 5LZ2A 3T7JA 1G42A 1UANA 1CY8A 1XHEA 1A8QA 3L93A 4PIMA 1P19A 1NLUA 1UAYA 5DMXA 2E0GA 3DLIA 4OHXA 4DR5B 3AI1A 4B3GA 5AW7A 4NXMB 3IVGA 1VC2A 2VYVD 3BMOA 4HY3A 4NJMA 4TPKA 3IXQA 4GSLA 4R4JA 3U3XA 5DYNA 4B79A 4C4XA 3MSXA 1O94D 2J9YB 1R6XA 4H15A 4EPVA 2NCLA 1O54A 2R6AA 2QJWA 1Z3IX 1GWNA 4M76B 2J33A 4OSPA 2VTBB 5JZSA 3ZLVA 1HT0A 5D3ZA 4E5VA 3P9PA 5EVJA 1CUYA 3ILVA 4FFWA 4L8WB 1Q14A 2K6GA 3QOWA 5M5BA 5E2BA 4LI0A 1X13A 4RORA 2IHVA 4NZYA 3ENVA 3A2MA 3N8NA 1SBCA 2MDTA 3BMCB 4K6MA 3HFGA 1A69A 1Z2NX 5M7EA 2ZIUB 3DD1A 5J1TB 1MXBA 4X1IB 1BOOA 1JA1A 3IUNA 5KQLA 2CXUA 3DWIA 3KHUA 2HA7A 4OFXA 2W6NA 1NVMB 1PJ8A 1XDWA 2GEUA 1X7WB 3KYCA 2XMRA 1Z06A 2J5BA 4BECA 1Z62A 1D6NA 1DE0A 2HDNB 3TSCA 4B6FA 5C52B 4ALKA 4DCNA 5AI8A 1JXOA 1NGSA 2AFHE 1VGRA 2OBMA 3CF0A 1V3UA 4RHYA 4BO1A 1G59A 3L4EA 4HPVA 2JDIA 2IZZA 2FK8A 2G1UA 1YKFA 4NJEB 2BF4A 3IBGA 3QFTA 5TC4A 1JEOA 2O05A 1XMSA 3Q5EA 2FEOA 3EQ2A 2GA9A 2RHMA 2J4CA 2ZPTX 2M6KA 3W7VA 3WGUA 1SGWA 2QZ9A 5B7QA 1LKZA 3ELWA 2J07A 4L4YA 3BBPA 3ROZA 4WDRA 2I80A 1NBOA 4I5GA 3ZU4A 4KTTA 1P9RA 3NPDA 1EWQA 4TWAA 4Z4CA 2O1XA 1SEVA 2IOHA 5EZYF 3OE5A 3LQYA 2QV0A 3B3AA 1VYTA 3PUHA 4TMZA 1QYXA 2F4VC 4UBKA 5E4FA 5EOVA 4BC0A 5CFLA 2JZCA 1A7AA 4HRAA 2D2IA 1SCNE 5DNYB 1QH0A 2OO3A 3BXOA 3EPRA 3R3XA 2XE8A 4G01B 2G5PA 3RJ9A 1RQGA 4ND7A 2ZWPA 3PC4A 1TO6A 3OQ1A 1TT5A 3QU7A 4A6DA 1NULA 2GSWA 1V95A 3ADBA 1A97A 4GU5A 3PUWA 4QGFA 4HNUA 1XDBA 1T9DA 3LQFA 2G5TA 3ZVKA 2W4MA 4NH0A 4KKVA 4W7SA 2ZBUA 1HTTA 2A9OA 2EIXA 1XA3A 4S0ZA 2RCNA 1N25A 1G1AA 1ZIOA 1PV2A 3DZGA 3N0WA 4FZRA 3BDIA 2WYWA 4H0FA 1TK2A 3VR2A 3FI0A 3R3UA 1I3KA 3KOYA 3ZZMA 2HYIC 1MNQA 3IO3A 3JYPA 3PX3A 1WWKA 3D3JA 4L4UA 5JVDB 5BYJA 4H77A 4WK0B 4IR7A 1G8YA 2XNDD 4JH0A 4P5DA 1ONPA 5E9QA 1LRLA 3K94A 4UBIA 4IWXA 3TOZA 1UINA 3BGOS 4GR5A 2QR3A 2WSBA 1K97A 4XX0A 3C6MA 2QRZA 1DIOB 2V7UA 3RUHA 5JNUA 3LUCA 1YTUA 4DA7A 3CNBA 3HJBA 4TUYA 1NFQA 3WQQA 2BCJQ 4LI3X 4XWKA 1G5IA 1P5ZB 3ANNA 1X2BA 3DBHB 5FUYA 4DWVA 4O3FA 1BYUA 2WHPA 2E85A 1J99A 2ZW9A 3W05A 3ITEA 3QU5A 3ZDQA 1DTWA 1TF5A 5AMXA 1BTOA 1XHFA 4G1EB 2WJ3A 4B81A 3CBQA 2XE4A 1W48A 4C7BA 1QPZA 4AQ7A 1R5OA 2HR1A 2I99A 2PKQO 2IEDA 2PGOA 3IHTA 3R40A 5ADZA 1CNEA 1EUDA 2VUTA 3QWBA 4JIMA 4K81B 1VPVA 2P41A 3ADKA 4MPDA 4HDCA 1CC1S 2AFHB 5C1IA 1OFIA 1O77A 2DJ5A 2EKDA 1C4OA 3BRSA 1M83A 4RV9A 4U00A 3FVRA 2P7HA 3HL4A 3QKSA 5ELXA 1QVRA 3LK6A 1J9EA 5JC8A 2NUBA 1E2IA 4E46A 3L4BC 3KQLA 2FWJA 3VNRA 2QG4A 3N2KA 1NE7A 3KQVA 3KZCA 1JQKA 2IHUA 2ZAYA 3UJ6A 5BSEA 4GXNA 2Z4TA 1PWHA 2XQJA 3OF2A 4J2HA 4DSOA 5E7QA 2YY5A 5H70A 2JH9A 3K6SB 2DHEA 2E4ZA 1BE1A 2ERCA 3L8YA 3ND6A 1J5EB 1YMQA 1XL0A 3V8MA 2QRQA 4WK6A 1EZ4A 3THYB 3DE3X 4YJGA 3PLAE 4K6OA 4QXOA 1Q83A 4HV4A 3OJFA 5B4UA 1WSDA 1VKNA 1HDIA 3E22A 3ZXXA 4UDOA 1KJIA 3PCRB 1JZSA 4A3SA 4JI0C 4QVKA 3SG0A 4CMJA 3EIOA 3NBXX 3FNIA 4NNOA 5C8DA 3SYNA 5C4MA 5AVSA 1EA7A 1EINA 4AZ3A 3PNKA 3TRJA 2QR2A 1TIPA 1YBFA 2YXEA 3MW8A 5CFNA 2K2QB 1P2UA 2Q62A 5B3KA 5IZCC 5MF6A 1WHTB 2BEVB 2ZYTX 1GPH1 1XZIA 5CUQA 1YKGA 4QJBA 1KH1A 3AF4A 3AERB 4N5IX 5FI1B 5HA5A 5JV5A 4R5HA 1FNCA 7AT1A 1FMCA 3IBFA 2IDKA 2PZAA 3VQTA 1TUGA 4YDHB 4FVTA 4DV4B 1XR3A 4MVJF 3V8QA 3H5NA 1T24A 1HSZA 3PDJA 2IHKA 2UZ3A 4HZIA 4ZKEA 1Z25A 4JJGA 4JJKA 3GUCA 1YI0A 2C9CA 3A8TA 3N0RA 4MS3B 4YT5A 4GM1A 3ABQB 4X71A 3T3NA 2RB4A 1DJOA 3C4JA 1Y82A 4YRJA 1RAIA 3KLOA 4B3XA 5EUBA 5EXEA 2WHYA 4UEQA 1ODCA 3ZNNA 1IXZA 1RWVA 5DSZA 2R85A 4QOHA 2L42A 4HUJA 4DXHA 1PYDA 3ROXA 3PGJA 1DRKA 4PXYA 1JKMA 3BTOA 3CXRA 4PX9A 1ORVA 3COZA 1N7IA 2W6CX 1ZD9A 1XAJA 3ST7A 4N0PA 3NX4A 1M3SA 4B4WA 1C3JA 1K08A 2VJMA 4L0CA 2JEZA 3ZQKA 1QIIA 1ZXLA 5JDCA 2KYRA 2NUTB 4BYGA 5LQCA 4GGMX 3O2NA 3ONNA 3D4LA 4KTVE 1DJPA 1V16B 1MC5A 2ZTVA 3UJBA 1HOTA 2ZRIA 1KNXA 1V5FA 3DMRA 3IDZA 3VR4H 1X87A 2OFFA 3W78A 3T1HB 4I66A 1VIYA 1JNYA 1ZJ6A 2VSOA 2XJ4A 3EQ8A 5JCOA 2C8VA 3V1NA 1WBJB 5FWYB 1B23P 1XNGA 2X2EA 5KINB 1GHTA 1FDSA 1LLCA 3V2GA 4E2ZA 2WWYA 3KOZA 8LDHA 4A23A 2FQXA 3ESBA 4MR7B 1E99A 2DF8A 3F5SA 4L75A 4LJ8A 4PVDA 3AUJB 4GI2A 4WZBA 1KMQA 4PROC 1RYZA 2ZWAA 3DUFB 4DIBA 3EPJA 4YGYA 4N41A 2D28C 4W7HA 3IFSA 1LNSA 2EKQA 4M7OA 4JLNA 2W2XA 2CUTA 1YIAA 4E22A 2WJYA 4L51A 1NRJB 1W5FA 3TVYA 4YMTA 5DT2A 3TUFA 1UK7A 5BO5A 3GVPA 3NTUA 5DLYA 1PEAA 4QBIA 5JTUA 4I36A 1Y1LA 2BMDA 4XD7A 2WIFA 3MBIA 1A5AB 4EW3A 3QQPA 1F0PA 3HNPA 5JO0A 3NONA 2D0DA 1EEHA 2Z4SA 1XQ6A 1SD2A 3EERA 1PR2A 2YWRA 4NCNA 4KG7A 4NZNA 1II9A 1WPXA 2VDRB 3IDFA 5EQTA 3ZNOA 1G3MA 1AV6A 5EWMB 3CG4A 1A8UA 2J7PA 1NBMD 5HKOA 2GAFA 3FYUC 3O91A 1DBVO 1Y5RA 3T3OA 1KQPA 2IYUA 1ECJA 5A19A 1QG4A 3P97A 3FUVA 4TM7A 2ONZA 2PUJA 1ZQ9A 5GGXA 5JBQA 2FFAA 3CVOA 4IFEA 4F3KA 4D4GA 1LX7A 3HDTA 3IYLW 4DDMA 1C3VA 3EVEA 4DR3C 2X6RA 3JQGA 4KODA 5JALA 4CNBA 1T8PA 1FLVA 3H2GA 4V2UA 4Z4FA 2GXUA 3GXOA 2BBSA 5KQMA 4B35A 4E15A 5IJXA 4EGQA 1VI2A 1J7KA 2WZCA 4F5ZA 4FFRA 4AURA 5H4GA 1QRDA 2JHAA 1N8NA 1P7CA 4PQGA 3U4AA 1CY1A 4J0GA 4BVFA 4H7EA 4F93B 3IAUA 5LYJA 3NAGA 1JNXX 2G0NA 3T9CA 4R2IA 4AU1A 4DGQA 5BWLA 3DDUA 2CXPA 3MJTA 4G5OA 4OG2A 1JDPA 4OAPA 1TVKA 3WSTA 3PJEA 2RHCA 2J85A 1E2FA 2NT4A 5A4AA 1Z0JA 1TKAA 2GO7A 2RGXA 3PGXA 4JQCA 3VV2A 3WGIA 1FTGA 2QZSA 3I30X 3QWHA 3ASZA 1AZSC 1QLHA 4IVNA 2V6MA 3AKDA 3VAAA 2HH9A 3QHQA 4REOA 4BNJA 4QVGA 3D4PA 4A0HA 2R4QA 4YMUA 1C9KA 1Y4UA 3V8VA 4RA9A 2B1IA 2FETA 2IEYA 4QU5A 5ETJA 2YHIA 2OL4A 1G8AA 1SULA 1CTQA 2GPYA 2ADMA 4L95C 4GOND 3EXG1 5F2NA 1JX6A 5JAIA 2PKXA 1JDUA 3OCJA 4RPJA 3GR0A 1LNZA 2D3TA 3QXGA 4KN8A 3ER9A 1KRHA 2QRVA 3CZQA 4K9LA 3DS8A 1FQOA 1ZA1A 3VBEA 1XRPA 1CU1A 3VC1A 5TQ0B 1Z4OA 3AYZB 1TCUA 4ND4A 5EERA 2FR1A 1QFXA 1JLKA 1FUGA 1EGVB 1U4OA 2CC2A 3EXG2 2SECE 3QUAA 3RVRA 1M1YA 1XVUA 3WMEA 4QQNA 3ZXYA 2O2XA 2WKPA 1F17A 2PSHA 2C9YA 5ALTA 2YJ5A 1JAYA 3R7FA 5IJAA 2D2FA 5ADWA 2QN1A 5J9FA 4E08A 1ZONA 1H4TA 4R9SA 1WZUA 5LWQA 1KH3A 4RABA 5TJHA 3QELA 1C1DB 2LGJA 1PJTA 2BKXA 1F4PA 4IEIA 4BFUA 4CR8A 3FCYA 3ABIA 2DWQA 1NBAA 5HW0A 4WKCA 1SUPA 4KR7A 1YU9A 2M6SA 3N6XA 3G17A 4PZCA 5KNLA 5TY0A 2Z6UA 4K40A 2FH5B 2RAUA 3K0AA 3DXFA 2PBFA 4QXAA 5A06A 4PUGA 4P83A 4F92B 3JSAA 1HNNA 3PD7A 4XH9B 1L5OA 2D54A 3AFNA 3DFIA 4G37A 1UKAA 1RAFA 4DQXA 1MG5A 3GNTA 4XCVA 3OAAD 2PLNA 1YB4A 4XA8A 4MWEA 4H17A 4P3KA 5JANA 2VPXA 5C35A 1MAAA 3BWEA 2GA8A 4ZOAA 1CIPA 1FU8A 1NJ2A 2WFLB 5LB4A 1E77A 1R4NA 3PPXA 4KDRA 1JKIA 2O8BB 1T25A 4KK4A 1V9CA 2CB9A 4Q7LA 2BUAA 4WK2B 1NLFA 3TW4A 4MTLA 3I2FA 2G9QA 4ESOA 3H05A 4ZGBA 2VQFB 4JUCA 2ATXA 3P8ZA 3ROPA 1Y7IA 3HGQA 3WL6A 3PFGA 3KJEA 1VG9B 2YXBA 1WXQA 2H7CA 3I6IA 1PSWA 4OYYA 5HFJA 3LP5A 3WOHA 3ADCA 2PMWB 4CF5A 3WGVA 1AIPA 4YT2A 4MCJA 5HKBA 1LI4A 4LF9C 5KYVA 3Q41A 2JLQA 1XZFA 3OTQA 3KX2A 3ESRA 5IF9A 5L6MB 1NVAA 3SJUA 3RYCA 3KXPA 3MQFA 4JASB 1IUNA 3I9V1 1MC1A 1YSCA 2LCIA 3I34X 4OV6B 4TYPA 2FF5A 3WDKA 4DMRA 3I39X 2Q0HA 1IU9A 2JHGA 5IK2D 4KRFA 1T4DA 4J2OA 1NQUA 1QHHB 3O8OB 1IEQA 3W6UA 2DHMA 5L4SA 2A59A 1FDVA 1C9JA 2WU8A 3SQOA 3WA6A 5F64A 2XT0A 5ALJA 2B7BA 2WJAA 5KEIA 3THRA 5CNJA 1QYDA 4EZBA 4DR4B 2JAXA 1DDIA 4P08A 4LFAC 2XTNA 3N2ZB 3ISTA 4OD0A 4YRQA 3VYRB 4BFCA 1FXWF 1G60A 4C2BA 4DIOA 1G20A 4UDNA 3GLGA 1L4LA 2FPPA 1I36A 3FPCA 2W6JD 2XVZA 1ZNZA 4FGSA 3WP1B 1BW9B 4OL9A 5BQ3A 1LBTA 4WY5A 3CVXA 4WLFA 2VTDA 2XZDA 4LYJA 1XCLA 1YQDA 4G89A 1ULAA 3HJHA 3PIIA 2MSEB 3QLUC 4UNRA 3RTCA 2JLVA 4AS3A 3X2SA 4OQZA 1J2TA 4R1TA 1QP7A 3ENWA 4NBKA 3KLPX 2PRJA 2HQRA 3BRWD 4L2IA 4X8MA 2DERA 1KZHA 4PC6A 4I46A 3FUUA 1SCUA 1Z34A 3KPUA 4Y2SA 1YS6A 2Q2WA 1T2FA 2VSXA 4YMLA 1KEPA 3EJWA 1ZNWA 2BPOA 2XIJA 2BJOA 2A5LA 2HXSA 4RD4A 4Y2RA 4WWHA 4J3JA 1NVWQ 2WUVA 1M67A 2WIJA 1T36A 1MOQA 1V71A 4L7QA 3IPCA 1E2NA 3ZDFA 1IN8A 5JNTA 1IN1A 1QYVA 2PFKA 3OOSA 2CHEA 1RKVA 2A6PA 2GHIA 2JFGA 4TTRA 1D2EA 3X0DA 1X0VA 1M34E 4TN1A 1RRVA 5AJHA 1XU9A 1FIUA 4JLKA 1CK4A 1QV6A 2RBEA 3DTYA 3PXCX 4FCCA 1PRYA 3EF0A 3OX4A 2ZE8A 4IMJB 4IOJA 4DAOA 2VFAA 3DD5A 3E8MA 2ZJ6A 2HM7A 4MI1A 3HO6A 4ND1A 2W6MA 4Q4JB 1AU9A 4BO8A 2Y1FA 3H16A 3ZGVA 1X7YB 4GM0A 2HI0A 5BR1A 3RC8A 3CO5A 4B44A 1GAJA 2HXYA 1OGJA 2WIGA 3E03A 1NXSA 5BQ5A 3T9FA 2XECA 4N3AA 4OKIA 3WGJA 1PI3A 4PPGA 4Q1EA 4XJSA 4D97A 5CITA 3LDUA 1N2CA 3D0QA 3AWDA 2R9VA 1IM2A 1G55A 4KH0A 1B0AA 2IOFK 4LYEA 4U1RA 3PQ8A 5LBUA 3SC4A 1F0KA 2G28A 1VBNA 4DLUA 4FJ0A 4TL9A 2XWJI 2J1LA 5IYZA 3LOPA 3RABA 1HF3A 5A3QA 3W8DA 3AUKA 4V24A 1OTYA 4UU7A 5EQJB 1T43A 4LC9A 2ONJA 3N74A 3U1VA 4LAFA 2V7WA 2HHHB 2FEAA 2J0SA 3QVLA 4DNOA 4LDRA 3D1VA 4QM7A 5GMOA 2Z98A 3RF6A 1E3WB 3EGEA 1QM5A 4EBFA 5ALKA 2O0MA 1ZN7A 3JZDA 3WTBA 2YWDA 3GRCA 4H27A 3MGAA 1ARZA 3N6RA 3REQB 3H9QA 3RREA 1KJZA 3CNLA 4OMFG 4YRLA 4TV8F 1M8PA 4C2AA 5KYXA 1J0AA 2RHJA 3W3AA 2E1RA 4JX8A 5LN1A 2AYYA 1HFJA 2IVZA 2MOKA 5T4EA 3F2VA 1YBHA 4LJKA 4AJ9A 4KU4A 1P7YA 2HRDA 2IXDA 3RAGA 3WNBA 2O7QA 1IXSB 2HPHA 3HJRA 4R0VA 3J81k 1S8AA 4LCEA 3KQUA 4CG0A 4EATA 1WF6A 5EJ6A 5CX1A 5ILQA 4DXDA 1B0PA 2VT7A 1WUJS 4BUCA 1P5HA 1M1ZA 3AHJA 3RH0A 2QPTA 4IUDS 2PXHA 5MN4A 5JI3E 1O6BA 3V48A 3ZVNA 1ZN2A 1W5BA 5KYGA 5DTQA 1E96A 1K8XB 4JITA 4W99A 2F48A 4L0QA 4C29A 2QTGA 2ZS7A 1EUCB 1QFYA 2J45A 3M81A 4ND6A 4XYBA 3TNYA 3W5DA 2EBHX 2FSVC 4XGIA 4U7GA 5ICFA 4PAGA 1M34B 3U4MA 4BN5A 2RGRA 1U3UA 1W44A 2JANA 1TLTA 3ZGOA 4A2PA 2J6BA 2ADFA 1GGJA 2JA1A 1C29B 5IKMA 1RTTA 2P4QA 3NRBA 1J9ZA 1JHVA 4FNAA 1KJ9A 1KSJA 3VPFA 1DC7A 1HE2A 4GEGA 4DCCA 4G3XA 3NGXA 1J25A 1CZLA 2E0IA 1X7XA 3GVXA 1MORA 3R76A 3QVVA 1J22A 3FRIA 2CJYA 1SCJA 3AU9A 4HFJA 4QBFA 3UW1A 4DCOA 1IOVA 1BA2A 2B36A 2FQQA 1N4DA 2WHXA 3CLSD 2BCGY 2YHBA 3P2KA 4LNUA 3RBZA 9LDBA 4KHPB 3L7JA 3G7UA 1BXGB 4V1CA 4NXNB 4P5PA 2IYOA 3I2JA 4QXPA 4Y2UA 3V7UA 1JJVA 2XB9A 4ZK6A 4KQCA 3G9XA 4J1NA 5DK6A 2PT9A 1YZGA 2Q5QA 1OH7A 5EHZA 4IUYA 5JJBA 4A2CA 2BFAA 3BXGA 1EBUA 2R6HA 2WMOB 4FWTA 3OURA 4UOZA 1NXVA 4L22A 3OOWA 3AVQA 4Y6QA 4QNRA 1JEYA 2E37A 2O0HA 2NXJA 3WBBA 5AESA 4HLNA 3UC9A 2IPAB 2WUDA 3FMGA 1SG0A 5IEBA 4EYQA 3TW8B 3C70A 3BL8A 5A4IS 2QSYA 4Y1FA 1NW3A 5EKSA 4C22A 1M2KA 3E3NA 4OJKA 2J30A 3QBEA 4RD2A 1Q44A 2VPIA 4JI3B 3OPYA 1RPAA 1FK8A 3LPDA 3RANA 3TL2A 5BSUA 3H3XA 4FE7A 4ZQCB 4CFZA 4OLAA 2H1FA 3GARA 4KXMA 4CFYA 4ZEMA 2CV0A 2R2AA 1QCCA 3TPZA 4YRMA 1VRVA 1X6VA 2IS1A 3NTQA 4RCZA 3ZWCA 1FNBA 4FFDA 4QRHA 4XGKA 3HB1A 2GBGA 2MT9A 3I1YA 3OY7A 3SIWA 3VDRA 5D01A 3AUUA 3ZHQA 2FDXA 4Q1BA 4DZZA 4UQLA 1QRSA 2OXFA 4ARCA 1IZ0A 1TJ5A 3C45A 4HTFA 3NBKA 4KGZA 3RFXA 1NPYA 2ZDGA 3O93A 2DFPA 4U63A 3SS8A 5DIZA 1WETA 1CYEA 3KWMA 3EG5A 1UDAA 1V5WA 1W1UA 1QONA 4YAWA 3HA2A 2XDQA 3TKYA 3U7QA 4YRGA 2BJVA 1P17A 3SCZA 1DP4A 1Y9ZA 5T57A 2VOJA 1LI7A 4OLJA 4WESB 7REQB 3FLMA 1VJ5A 1NDQA 3L4BA 5CXSA 4ON9A 2WG0A 3T9AA 4AO6A 4AXBA 1SZJG 3LUJA 1EFDN 4TM8A 4WVFA 4ZKDA 2H1LA 2F1HA 3CZAA 2WWTA 4JUBA 5CLJA 1ND6A 4LEIA 4YV7A 1N3LA 4X90A 1R0SA 1VKHA 4LGCA 1QLWA 1V9SA 2GM9A 2IF0A 3H8SA 5C7IO 2RGEA 3GPBA 3RAEC 4QODA 1JR3E 2YOHA 3A6GA 1NRXA 1ABFA 1T26A 4KZKA 3V2UA 3F5QA 3R5TA 1CQIB 2J08A 2O2EA 1SCKA 2BW0A 2Q6TA 4DIUA 4UNQA 2NYRA 4NIMA 4NK4A 2GYYA 3FOFC 1LI5A 3HV0A 3KFXA 3UUWA 3DV9A 3QOXA 1MJHA 4CTNA 3BIWA 1G21A 4G09A 2ORVA 4PAOA 1OASA 3IS3A 3KUKA 3RSFA 5GZ3A 2V7GA 4YUAA 4D9MA 2OK8A 5AI9A 4Q4HA 3G2MA 5EHGA 3PV0A 3S40A 3PE3A 1G64A 1J9GA 1EVIA 3CVVA 2VTKA 3CEPB 3FHJA 3N8GA 3R6DA 1EQAA 5DB4A 3RBXA 3V42A 3CTPA 1D0VA 1OGIA 2VPQA 1X94A 3LA8A 3OKAA 2V7EA 2JGRA 1U6IA 2P6MA 1LCIA 1T9KA 3FIJA 5B1IA 5F3WB 4Q93A 5ERXA 3SSNA 1MXHA 4JVMA 1ZK1A 3A27A 3H4TA 3VPHA 1BX3A 4IO0A 1W34A 4ZCMA 2LD4A 2QT0A 5AKLA 4ZV7A 5JHHB 3IP5A 4IIUA 4HQOA 2UV8A 5KSYA 4OHYA 4IKEA 1Q1GA 4ZYUA 3FWPA 1QX4A 2XLBA 5AKEA 1IUPA 1LDMA 1C7JA 4LF4B 5CVVA 5ILGA 2X58A 3QRWA 4QFMA 2Z0MA 1E6LA 5CM2Z 5B3AA 4X84A 5CYGA 1U0TA 1FFDA 2DBZA 4HAXA 4KWTA 5EMMA 5KJEA 4CYMA 2RMKA 3WZMA 6NULA 1E3JA 1SU8A 5EEGA 2IZ6A 3ORHA 4W9NC 3FPJA 4Y3UA 5HRCA 1WF3A 1KYYA 4MULA 5BY2A 5KNCD 1GQRA 4L02A 5J63A 2R68A 4TRJA 4JKOA 5ED4A 2L19A 1ZXBA 4LXUA 3T7CA 1PFWA 1X2EA 2CFTA 2HHCA 1Y9AA 2QRNA 4IH1A 1ZPDA 3LG2A 1EK6A 2EBFX 5JAMA 3JS5A 2YWEA 1JHDA 4HCJA 5CDUA 3GELA 4AMVA 1MEJA 4RJTA 4MSUA 4P1ZA 3WKAA 2PV7A 1ODJA 2I6GA 3PXXA 5FLKA 5AW5A 3I01A 3Q6NA 3VYSB 1PFVA 5CCXA 4L5IA 2OR3A 1JS1X 5KWSA 4TYYA 3FBWA 4C78A 1WZCA 4RPHA 4I08A 1F2TB 1L4GA 2CHUA 2RGAA 2O9JA 4FFOA 4K0RA 3WB0A 5JZVA 2DE0X 3LHSA 1GGKA 3B5EA 1IG3A 5F7OA 4BMXA 5LBTA 1X7HA 4F96A 3FSJX 1MVNA 4WXRA 2YOFA 2Y1WA 2Z2KA 3ILXA 5AOVA 4AECA 2XSZD 3EIWA 3Q7QA 4TYNA 3NHJA 4RTRA 5CVEA 2VDMB 2HMTA 3FOAA 3THXB 1JFRA 1EX7A 4I5DA 3F78A 4JL6A 2O54A 4HEJA 2YIJA 1J24A 4ZOLF 1QUEA 2R6R1 1ZDMA 1J0CA 4M1QA 4BTEA 7MDHA 2NO9A 2PX3A 2JZOA 1QH1B 5COAA 1C5KA 3N2EA 2YHSA 2JBHA 4DY6A 1QANA 1YB7A 2ZIVB 3ETOA 4AWAA 4BNLA 1Y1PA 2D0PB 5LPNA 3PC7A 5KHAA 4IRXA 4BVJA 3A6ZA 2HLHA 2W2LD 1NRIA 3LVRE 4S24A 4PANA 1DTEA 1KPIA 1IQRA 2VJAA 1UXJA 3ETHA 5DZSA 2J0UB 2FFJA 1K9SA 5IUNC 2BN4A 5EWLB 1USPB 3K0HA 4BQPA 5JE8A 1E5TA 4F4FA 1S02A 4NH4A 3BFPA 3PUKA 3QTTA 1RCFA 2BMWA 2FZKA 4M87A 1Y7TA 5JXIA 5LMCA 3D2CA 4KPUB 1KETA 1I6LA 2GHTA 3IR5A 2NAPA 4C6SA 5FLEX 4ZRMA 3FYUA 3Q0TA 1P3DA 2DFKB 3GR6A 2UUCC 1AC5A 2DULA 4P2GA 2XCQA 2GRUA 4BO6A 1QFMA 1ZGHA 2CLSA 1WP9A 3OQBA 3FCSB 3NOVA 4F3CA 2ZSHA 4IIJF 3ZX5A 4R6WA 2OD2A 3ZE1B 5ALGA 4EHBA 2DOKA 3TLKA 4EJSB 2HX1A 4H59A 1ZN9A 1FLOA 2VDQB 1GQQA 1N3BA 2XNKA 3GRUA 3I1IA 1QHFA 3AHDA 1LPPA 1SD5A 3OU6A 4R2XA 3GOQA 5DN6A 4B7UA 2NZWA 4B7CA 3TIIA 3VHXB 3LPMA 4MR8B 1W52X 3TVDA 1U3DA 2FZEA 4QIHA 1VCNA 2HREA 2J9ZB 3JARA 4NAUA 4KQIA 4CM7A 4EG0A 3DE0X 4FILA 2NU7A 4J4HA 1XTKA 4D8UA 3H8WA 4QUIA 5KX5F 4NCHA 4BVBA 2F1IA 1GILA 4M89A 1XAGA 1DG1G 2PZBA 1ISJA 1KIAA 2YV2A 3PI7A 4LF8C 3DB1A 1Q1QA 1UBMS 3MWDA 2MSNA 4MA5A 4E5PA 2BTOA 2N75A 2XBMA 3HCAA 1N0HA 3AG6A 4R1UA 3JRWA 2Q3MA 2PZMA 1RWOA 1AKVA 3F2IA 2ZYUX 1UBFA 2QVCA 1L1EA 2KI5A 4FBGA 3IEVA 1LWOA 2IXBA 3FCEA 1MZVA 5DHAA 4AJNA 4KTTE 4RZQA 4OGKA 1J8QA 1UBLS 4MIKA 2AOUA 1O97D 2MSLA 3EXEB 5JPIA 3ZHUA 4ROTA 4TQGA 4F91B 3V4ZA 1DEXA 1V43A 4IBOA 2ACKA 1KKMA 2BFPA 1GO2A 5JARA 5KTPA 2XZLA 1Q3TA 2OCKA 3BRQA 3HO8A 3PDCA 2FU5C 4F3NA 1PNQA 4GP6A 4KVAA 2M1XA 1NNLA 2OLKA 1OC4A 4LYDA 2NYAA 2WABA 1M2VA 1IPEA 3CCBA 5HF9A 2R60A 1U5AA 3F7MA 3OWXA 1U0HC 2BEWA 1Y1KE 2I03A 3TSOA 1YIOA 3F3YA 2HF7A 3BMOB 3QHAA 3PK0A 4NJMB 1KZGB 4US0R 1ECCA 4ARUA 4BMZA 4HC4A 2YFYA 5JO9A 1XZLA 2B4YA 5ITSA 3BHJA 1OSNA 2XUAA 3CLRD 3WOVA 1H0HA 3Q8LA 3GIWA 4TKUA 2P2JA 5E6SA 1U0GA 2IP1A 5ES4B 3DZDA 3HDVA 3VR6H 4DIMA 1P2BA 4MB0A 3H5TA 1FFBA 5AE2A 2EG5A 1U1DA 2QJRA 3F6SA 4RKRA 2WSLA 4LC1A 1I5RA 4CEIA 1C1YA 1VLJA 2F59A 2OWEA 2PBLA 2QL9A 4MAMA 5AHOA 4BLSA 3DC7A 1SUFA 1W85A 4ASUD 1DC5A 3IALA 5DNDA 4CIDA 1CS0A 5DGCA 3MMNA 3B53X 1U2RA 1N57A 5GM2A 3IOYA 4G1BA 5ERGB 1YUBA 1WXDA 4MCAA 3OOJA 5JJIA 2P2MA 4A26A 121PA 4FR5A 3LC7O 1O5TA 1QAOA 2UZ1A 2X2FA 4J0QA 4ZDKA 1QHYA 1C30A 1YA4A 3GMIA 4FHGA 2LPMA 1P0FA 1R15A 1TYDE 2VZ9A 3P26A 4C2UA 1NVKA 1R6BX 3KYCB 4EMSA 4CMBA 3OLWA 1JYFA 2EP7A 2DWOA 4UEOA 1MTOA 4P5EA 2V9ZA 3R0JA 4PEVA 3KR9A 4W1QA 4XGQA 4Q9LA 4P7KA 1UBHS 1VSBA 4WPGA 5EMNA 3KAKA 3G88A 5G2OA 1W73A 1IDN1 3X1ZA 1L8LA 1VJRA 3M6AA 3FMIA 2PNJA 3QVTA 3T5MA 1G8GA 4FOSA 1BDJA 2D27A 2UYYA 2OV8A 3ABZA 4M4SA 3T8YA 4XWOA 1HNWB 4MGZR 4L3OA 3NYRA 2WU4A 1BVUA 3IJRA 2Z1DA 4AZSA 1YS7A 3TG2A 4FS8A 4KE6A 4EJFA 3EZGA 1QHNA 2DEUA 4QTZA 3QBJA 1UC9A 5LQJA 1UJ4A 3C3BA 3UUFA 1H2FA 4R81A 2GM4A 3E70C 2V59A 1W88A 2A0XA 5KAPA 3FNBA 2W2VA 5AH0A 3TR6A 3T1OA 3MCTA 4Z6KA 3R7AA 3NKLA 4YQZA 3UH1A 4EHAA 1TT5B 2P2FA 4PINA 1U2DC 2VT2A 3UV7A 4DLNA 2DWCA 1CHNA 1PBTA 1ZMRA 4RF3A 5KOIA 1C8KA 3JPWA 4C4YA 5JASA 1HE8B 1ZINA 2M6RA 2WE7A 3OFNA 4UREA 5DW3A 5AP9A 4B31A 4X24A 3FMFA 3BRCA 3FYHA 4FUTA 4KC0A 1SPXA 4IV5A 1XTRA 4M2LA 1H6DA 1AUXA 4YACA 1MG0A 3CUEF 3NTOA 4KOAA 4L15A 2IPLA 3F96A 1KEZA 4MUJA 5HKKD 4PVCA 3NYQA 1FS6A 1WSBA 5LB2A 3WO0A 2GXSA 2WF9A 3M8KA 3UKOA 5EE9A 3ZNQA 3QLUA 4TRRA 4DV3B 4XPIA 4F2GA 3KXWA 5A0FA 3K3PA 3SVZA 1SHZA 1DLIA 1I2AA 4G2NA 5HM6A 5K7SA 4XX0B 4AQYB 1ID8A 4EKNB 4OQLA 4OI2A 4AF6A 4AZWA 4C2TA 4IZIA 4TUYB 4NHEA 4HZGA 4KFRA 5EP3A 3RBAA 2VDPB 2F1OA 4LJ4A 1RC8A 1XD8A 3P27A 3PD1A 1TECE 1RHRA 2J67A 2B1GA 5JJ5A 1JAHA 1U8YA 3C3WA 1MCZA 1DTWB 2BE7A 2Z8YM 3IDOA 2MSDB 4XB6B 2C0PA 3VU1A 4X1YA 2BZ1A 2V45A 2ZVDA 4OQFA 2PUDA 3S2UA 1L4HA 2XYPA 1FTYA 3KSZO 4E5MA 4CM6A 2GKSA 1G63A 3EPHA 3H9JA 1EUDB 2C83A 2VBFA 4R6XA 2X76A 2C2GA 3C8HA 4A82A 2OSVA 4L0DA 2Y1XA 3EIUA 2A1IA 1QWIA 1SOMA 2PANA 1K4KA 4I3FA 4C03A 3FXAA 4R71A 5CXUA 1YJ7A 3CB2A 1J0EA 3GEDA 2NTEA 3RIMA 3GUVA 3QKSB 1L5WA 3L7LA 2JH3A 5G0SA 5B12A 1J4AA 1D1QA 1LLFA 2HA0A 2P1DA 3MB5A 5H80A 1XLVA 1Z15A 1Z6AA 3OZGA 4AN4A 4DFDA 4N48A 1S2OA 3N2KB 5KTRA 1PR3A 2YC2C 4LY6A 4M38A 1GZ6A 4GP7A 1RJDA 5HP4A 1E0JA 1K4MA 2FMXA 2JIDA 4JC0A 2CL7X 2YYSA 3DAPA 4LFCB 1ZVQA 1UADA 1ZC4A 2X6QA 3WNCA 2VAWA 3VR5A 3U6KA 5D3MA 4BNIA 3BMXA 3G8BA 3LC2O 3OTIA 2WPDA 2H00A 1WXHA 4J2TA 5J2TA 2DG2A 1TM7E 4YJGB 3G2OA 3N76A 4W82A 2OGZA 3ZW9A 5F3RA 5FO0A 3E22B 3WB1A 2Z1NA 1YONA 2VA9A 3NNDA 4DJJA 5TF4A 2JGAA 3C3PA 4MVYA 3P0FA 4G1MB 3GFGA 1NVTA 3GN1A 3T5BA 1C3LA 4ND2A 2NADA 4KH1A 4AZ3B 2DU8A 2YQ5A 1EFAA 3DR3A 1QP8A 4R0NA 2PRKA 4ZQFA 4IHJA 4DT1A 2IUEA 3EWNA 4CF4A 5IHXA 2W5UA 1H5NA 3TQFA 1JDZA 4G2TA 3LKZA 5AJWA 4WUTA 3GB9A 1ZR4A 3LE8A 1FS4A 1Z4LA 1I0IA 4G0ZA 4XFKA 1BJRE 4FYMA 2ZUEA 4L5CA 1UC5B 3BZBA 4X1OA 5C46F 4RLFA 2ZI5A 3OPMA 5DTIA 4QPNA 4LIPD 2Q3DA 4LNHA 4NBTA 3TLYA 3M82A 3ZD9A 4TTVA 2NSHA 1Z9BA 4ENUA 3W5HA 5HZHA 2ALJA 5KCMA 1YIDA 4RVUA 2JJ1D 3ODGA 1AQ6A 5FI3A 2OC4A 1BMFD 3L77A 2BI4A 1OBCA 3HJUA 3LSYA 1X86B 2HMSA 2YY7A 2JIZA 4RK6A 4X45A 5EI5A 5A9SA 5DU2A 5DYWA 3NP7A 3RS5A 3A4LA 1OQAA 4R2MA 2J0QA 2FSVA 5CH5A 3GFQA 3ZBQA 1MQSA 1UK9A 2J5XA 2BAGA 2YRFA 4EY6A 3BUSA 4HAUA 3B2NA 1XMIA 3MT0A 4IYRA 4LY3A 4FDAA 4DM7A 1PNOA 3K6KA 4MDYA 1KI8A 1U9JA 3NTLA 4OMUA 3C97A 2JNWA 2GESA 5BPHA 5JADA 5F33A 2ZUFA 2CUZA 3PXUA 3RKUA 3ZC3A 4S04A 3WWEA 1E7QA 3FYTA 1FBTA 2W93A 5JS8A 1E4VA 3NS7A 4KO1S 3DWEX 5TGDA 3S70A 4CKCB 5C1DA 3VHLB 2A1TS 4RKYA 1EG2A 3TZCA 2VJMB 4WS9A 1C2YA 3BVPA 2R47A 3B7GA 1FP2A 2H6EA 1MXCA 3I23A 4PLVA 3FJOA 3RI3A 4L85A 2OK7A 2HHLA 3OO0A 1EFHA 2GD6A 1OUMA 5KWJA 2FR8C 4G0UA 3I92A 5BRJA 1UFQA 3G7NA 2AI1A 3ESAA 3I8XA 3MELA 5I9NA 1M1XB 1MC8A 4M49A 2GFIA 4LV8B 3M4JA 2P6PA 2IL1A 3QE3A 1ZP6A 1GFZA 2ZIEA 3OEWA 4X63A 1S7GA 5U1PA 1AUVA 5IH7A 2MMCA 4R1NA 5EPOA 5PNTA 5TPZA 3QX3A 4JVOA 4BQOA 4U4AA 4EABA 5FWAA 3V4FA 1G66A 4B3CA 4WZBB 3DO6A 1ZUD1 4J91A 2B98A 1UBSB 3TL6A 2Q8PA 2G9ZA 5JY6A 1WEKA 4ZVSA 1BKDR 4O6VA 5HMMA 3H2IA 5EIBD 3IEKA 1C9NA 1E59A 3L6EA 2R66A 5HUHA 2NU9A 4OH7A 2ETXA 3FYSA 1M1YE 2CT8A 3TNFA 3D3QA 1YC2A 1GNPA 5TQJA 5B64A 3L18A 4BFLA 3L7AA 2C2XA 4YRCA 2VLIA 1WSWA 5T5QA 1T9BA 1T4CA 4TZ0A 4MWTA 4O4IA 3WS7A 4G0WA 1K1EA 3L7DA 2BMEA 4JJAA 1L7PA 2BKLA 2CSXA 1THTA 3CQ3A 1RYBA 2ENWA 2GRAA 4FCVA 3RJMA 3CF2A 4PYJA 1YQTA 2RHTA 3DKPA 4QULA 4LWOA 1K7FB 2WJVA 2XWSA 3T1NA 3MWLA 1QHGA 1YJ8A 2XGOA 3HYSA 3NFRA 1PVOA 3V1LA 4L27A 4L2ZA 1PZNA 3AZOA 2L18A 4O2LA 5FOQA 4P0PB 3RCBA 1DINA 3WNQA 2NLOA 3DGEC 2FSHA 3JQGB 1MEEA 3DT9A 4RKWA 2G82A 5FA6A 5KMGB 5KCZA 3LBYA 2AFIA 5A5GA 1R9GA 2FMIA 3GDWA 1T0IA 3TXYA 3ZGYA 1EJ2A 1VG1A 3N75A 4O1MA 5L3SA 2O3JA 1TVEA 3P2IA 3IMKA 2YQZA 1QIJA 3NC1C 4P7GA 4UATA 3KE9A 2OZEA 3KQTA 3OO1A 1AKNA 3VKGA 1Z7WA 2GDZA 2Z2XA 2YASA 3MUNA 1N2FA 3VJMA 5LYJB 1E64A 2ZJ2A 1L0BA 3A3PA 4FEYA 4G0OA 4A92A 4Z1OA 1DS6A 1UKEA 4X66C 2YN2A 1RP7A 1TVKB 1NSYA 2F3PA 3EGVA 3JQDA 4I1RA 5EHNA 4D8TA 4BJHB 2HJGA 1GQOA 1TKCA 2PX0A 4ISBA 1U2ZA 4CF6A 2OECA 2N47A 1PJAA 1P18A 1SA0A 2R7LA 2OV2A 2H4JA 5LDDC 2GZMA 1W4CA 1GOTA 2X0IA 3AJ9A 4HWKA 1ISIA 2W0SA 4DR7C 3EOBI 4RA9B 2A0YA 5KOYA 2PH5A 5BYBA 4OXRA 2YHIB 3V4RA 3MZ0A 4UMDA 4D3YA 3DAFA 3BH0A 2XBLA 3CUVA 4CIXA 5IULC 3WA7A 2CWWA 4Y1EA 4ZOBA 3AR6A 1L4UA 5TMBA 2QRVB 3O75A 4CM8A 5ALMA 3QFSA 3B5JA 3GMDA 2J5KA 2NN3C 4I1OA 4L8LA 4YNBA 1L8AA 3L07A 3QNUA 3U31A 4L8GA 4C1NA 4EYOA 5CA0F 3O8BA 4R05A 3E9ZA 2CXHA 3NTXA 4QUBA 5HJ2A 4B3DA 5EIEA 1WPGA 5BV1A 4XIJA 1J1IA 1M1YB 4EGSA 1EJBA 1GDHA 1Z56C 4RQAA 1SEPA 5BRNA 4BFWA 4FEGA 5FNZA 2VNKA 5EC8A 1J5XA 3G2IA 3ZV7A 1GKLA 1L7OA 1F48A 2X5XA 4OY3A 5AVVA 1MXFA 3FZNA 2ZE7A 1UAAA 5D5QA 3C2QA 3QENA 2AMLA 1V35A 1LS1A 2YFKA 1DZ3A 1KVUA 1WZIA 4IFBA 5A1IA 1G20E 4MYUA 3SQNA 3LFUA 3W04A 1OLXA 2GJ8A 3BGWA 1L7DA 2ORWA 4I9HA 4R8LA 3H5LA 2WWGA 4A16A 1WXIA 3K0AB 4P0TA 4WT7A 2P2LA 1HZZC 4MH4A 1BCSA 2WVAA 2ZI9A 5FTMA 3RS0A 3T94A 3C87A 4AD8A 4EPRA 1H65A 2P11A 5GVRA 3LNCA 3LO5A 3X1XA 1DV2A 4LZWA 4HFMA 4CM4B 2Z6AA 2FPXA 3KALA 1JBKA 5K0FA 2VPPA 1F20A 2ERYA 3LBHA 4PRLA 4HH0A 2XRZA 1VE9A 1YQXA 2GO1A 4KBYA 2N1MA 1WXWA 4P22A 3SFZA 3WJ1A 3ZBPA 4F04A 5BXYA 2R87A 3JQQA 1IDOA 2F6RA 2FJ0A 1R4NB 3HVUA 3O5AA 3PNLA 5F1YA 3TE6A 4UPEA 3RTEA 5B30A 1JG7A 1X1QA 2XITA 3PHJA 2E4WA 3RC9A 3MVEA 4JJ8A 3SAJA 4LK2A 3U7IA 4MJLA 4JEIA 4EH1A 4O4LF 2V55B 1WKBA 4XGNA 4V0KA 3UVEA 5HKAA 2QIOA 5E95A 4UHJA 2KHZA 1IB8A 1CY6A 5MGBA 1Q15A 1MB4A 4GOKA 1VCIA 1OXTA 1G3RA 5AXAA 5DPMA 3MFQA 1AGXA 2BM8A 3CT4A 4XM2A 1I6MA 3SHFA 5H8WA 1DJQA 3F6PA 2FSFA 3ZU3A 5E2AA 2APJA 2ZSFA 4QDKA 4ME6A 5T3YA 1ZOLA 3A9TA 2WB2A 1XRMA 2ZM6B 2B92A 3WLKX 1A72A 5TGZA 1SFRA 2B8JA 2GJ4A 5EUMA 3DFFA 3TINA 2WB4A 4PC3A 5KTOA 4CMCA 1GVHA 4B3JA 3RYCB 4EY3A 2Q7OE 2J3HA 4IOMA 2FWIA 5H68A 5I3CA 3K8QA 3CNNA 3MMXA 1RKBA 2DPGA 2PGJA 4LHVA 3TPCA 1ZIXA 1JBEA 5DWQA 1WV1A 3R3SA 2XHZA 5TMPA 3A11A 1E7RA 1CDEA 2H06A 1DEAA 2ID4A 2SKEA 1EVQA 5P21A 3I9KA 4F86A 3S28A 4AKGA 4DV6C 1VHJA 3IIJA 4DDKA 4C89A 5F23A 3GGSA 2Z09A 1CPYA 2PXAA 2B1RA 3GQBA 4LZPA 5AW1A 1E8NA 3GP5A 3L8FA 1X9IA 1VCOA 3K72B 1MOSA 3F73A 1E58A 4BMCA 2LZ0A 1SXHA 2IYEA 3CXUA 4ODJA 2GWHA 1KP2A 5GV8A 2JJ8A 3GRVA 4HMPA 1MPTA 1G20B 1RRKA 4EEXA 4DWOA 5JR3A 1X15A 1X8JA 2FPPB 3GDOA 4WY8A 3ZWBA 3NNNA 1W9MA 1XPRA 3WIOA 4EELA 2P0YA 3FB4A 1NC3A 4LDNA 3L40A 5EXPA 2C3OA 2W2QA 3J7TA 4FC7A 4QNNA 2ZK7A 4IIEA 1QJ4A 1T9ZA 1XTBA 4L2IB 1X8LA 4CT4B 5AI4A 3UENA 1VLAA 1SCUB 3O8QA 4PQFA 4LNAA 5CBPA 1B16A 3W2EA 5DTJA 2BZGA 2FW1A 2ZIXA 3UYKA 1ODFA 2SICE 1I2MA 4L9RA 3PT5A 4GPEA 3WWDA 2X0DA 3ZGLA 1T36B 3G2KA 1DCKA 2ECQA 3D2BA 4KLZA 3WLRA 2WA2A 1X77A 1YZKA 3R7LA 1DBRA 1SN7A 4CI0B 1KY4A 3CIOA 1DKLA 3DNMA 4BV8A 3A25A 1D2NA 1J97A 1PSDA 1U3WA 2I29A 2NIPA 1HQDA 2ORYA 3B12A 3KYDA 5CPBA 5DNCA