3FCEA

Crystal structure of bacillus cereus d-alanyl carrier protein ligase dlta in complex with atp: implications for adenylation mechanism
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
504
structure length
500
Chain Sequence
MKLLEQIEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRIVSEDNLKDIFFTHKGNTPNPEHAVKGDENFYIIYTSGPKGVQITYNCLVSFTKWAVEDFNLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARPKDLFASLEQSDIQVWTSTPSFAEMCLMEASFSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEATVAVTGIHVTEEVLDQYKSLPVGYCKSDCRLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAFTMIDGERAYKTGDAGYVENGLLFYNGRLDFQIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSEVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Bacillus cereus D-alanyl carrier protein ligase (DltA) in complex with ATP.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Ligase
molecule keywords D-alanine--poly(phosphoribitol) ligase subunit 1
total genus 150
structure length 500
sequence length 504
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3fceA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fceA01
4IR7A 5JRHA 3IVRA 3T5AA 4RLQA 1LCIA 1MDBA 3GPCA 4G37A 4M46A 3WV4A 1T5DX 3O82A 4GR4A 4OXIA 3VNSA 3A9UA 5D6NA 5K8FA 3A9VA 2QVZX 5KEIA 3IESA 4GXRA 2D1QA 5DV9A 4GR5A 3NYRA 3FCCA 3CW9A 1V25A 4FUQA 1MDFA 3T5BA 4EATA 2D1SA 3IPLA 3FCEA 4R0MA 4D4HA 3CW8X 3ETCA 2P20A 3DAYA 2P2JA 3G7SA 2Y4OA 3LGXA 2VZEA 3NI2A 2Y27A 3DLPX 3PBKA 2P2QA 4OYCA 5IFIA 3WVNA 4W8OA 4RLFA 4GS5A 4ZJZA 3O84A 1ULTA 1BA3A 3O83A 1MD9A 4E5DA 4RM3A 4PZPA 2VSQA 2QVYX 4RMNA 3L8CA 3C5EA 4DG8A 3EQ6A 1PG4A 5BSUA 5BUQA 4ISBA 4U5YD 3E53A 3ITEA 5BUSA 4D4IA 3E7WA 3U17A 2QVXX 3U16A 4DG9A 1T5HX 5BSMA 3VNQA 3LNVA 3LAXA 4LGCA 4D56A 3T5CA 4G36A 3R44A 4GXQA 3IERA 2P2BA 2P2MA 2WD9A 3DHVA 1AMUA 4WV3A 5BSTA 1PG3A 4D57A 5BSWA 5BURA 2Y4NA 5KYTA 5DWVA 4D4GA 4RVNA 2D1RA 5E7QA 5KYVA 1V26A 4R1LA 4RM2A 5BSVA 4RVOA 3KXWA 2P2FA 2QW0X 3B7WA 3VNRA 4IZ6A 4FUTA 1RY2A 1YJ7A 5BSRA 3NYQA 3QYAA 3E7XA 2V7BA 4R1MA 3RG2A 3TSYA 3IEPA 3RIXA 3WV5A 5GTDA 2D1TA 5K85A
chains in the Genus database with same CATH superfamily
2BR3A 2LXNA 3ACCA 5FPKA 1SQ0A 1Z73A 2B2NA 4YRZA 2WM9B 3DUFB 1X9GA 4KQ9A 5C53B 4IHJA 3EC7A 2BHRA 4HKTA 1WR8A 2J45A 1W0CA 5DNDA 1JMYA 4L07A 4UOQA 3C5CA 3EQ9A 3NBYC 1O6ZA 4KVAA 1JDSA 1H3NA 3ZHZA 4TKVA 2WTUA 1HYBA 3GX1A 1MPTA 1Z18A 1YS7A 2QQFA 2QUBA 2YN0A 3LGSA 3N3AC 4UFPA 2GN4A 1E1QA 2D0PB 1OWPA 1WHSA 4ZCRA 5FBVB 2XT9A 5BXYA 3OQBA 3HVUA 3NHSA 3W8EA 3LOQA 1AS3A 1JDUA 5E7JA 1XZQA 4D81A 1M2VB 4BXOA 4ENQA 4AYXA 3K15A 3JSXA 1M6XA 1UFVA 3GLVA 2VNHA 5D3MB 4YMVA 5CAEA 2DECA 3GVHA 1KO8A 3VR5D 4N1AA 1RC0A 2YMLA 4NYMR 3WZLA 4C29A 3S2FA 1PQPA 3I2GA 3UG6A 4BFLA 1YQUA 4XX0B 3W9YA 1CD5A 3C6ZA 3C3EA 2G0NA 5EWLA 1N3IA 3O2EA 4G2TA 4IVPA 5ADUS 1PNTA 2CLIB 5IVPA 4M0MA 1KYWA 5ES3A 3CM0A 3V1KA 2ZS8A 2OZPA 3HJBA 4HV4A 2R6FA 5DM70 1Y34E 3WLEA 3FCOA 3RSLA 3B89A 3JTEA 1VSUA 2FLWA 2PEZA 4MUNA 4G3XA 3S70A 2P2GA 4W4TA 4ALKA 1BW9B 4AMYA 2CUZA 4JI1C 2BEKA 1RRFA 1ZK3A 3K9BA 3VPSA 1J8QA 3UH0A 3W9UA 2Z8YA 4ZYVA 1I7QB 1YE8A 5LLSA 2XZPA 2MOKA 4GL4A 3ICVA 5F7JA 5IARA 2JI7A 1Z37A 3AHCA 4ENRA 3EEBA 2IOHA 1BHO1 4IIGA 3DTTA 2FUKA 5D86A 5I4BA 1J8VA 1XZGA 3SE0A 3ZHRA 4GRIA 4C7XA 2ODPA 2IC5A 2WTXA 1E69A 4RTNA 4XARA 1BJTA 4BZZA 4PYRA 4W5RA 4IM7A 1Y6GA 1DRWA 3E53A 3B3JA 1L8AA 1YCDA 4RVUA 2Q2VA 4WTOA 1N7IA 2OFPA 3DE4X 1Q77A 2ATIA 3H3XA 3L4EA 3MGAA 1XQVA 2C8KA 2X15A 2XE8A 3R0ZA 4UDNA 2E4WA 1MOSA 3HBFA 3WQSB 1EVJA 1G1AA 1FNMA 3ONWA 4FMDF 1GT91 1NY5A 2QD2A 5J4KA 1OAOA 4TLMB 1ZVVA 2I7XA 4NMMA 4XPIA 3SFZA 1XHFA 3NBQA 3PFFA 4EFLA 5DU2A 5BYJA 5H70A 4E1AA 3V8NA 1JG2A 1PX0A 2PNFA 4NVRA 4X92A 3PE4A 5FBKA 4ZQFA 1GAJA 1RWBA 1W88B 1V2GA 4ZYUA 5FPSA 3FYDA 4TKMA 1Z5VA 1AQYA 2E18A 1L5FA 2RHLA 1BDBA 4N5HX 4J43A 2OTCA 5DGCA 3AVYA 3QH4A 2OVBA 1GYQA 4P31A 4MQ6A 4BLVA 2VZ9A 3RTGA 3VNUA 3AU9A 1E2QA 1JAIA 1G64A 1CY1A 1LTKA 2B3TA 3IE2A 3RUHA 3FTFA 2OV6A 2VZ0A 3QNWA 3OCXA 2C7RA 2FPLA 1SIOA 3CNHA 1ZMOA 2FG7C 3M1YA 2F4VC 4B6OA 5DLPA 3KR0A 2OLKA 4A16A 4BVEA 4C06A 3TB6A 2BV3A 5FRDA 5AK4A 2IS2A 4EUNA 1ZJYA 1N6RA 3N8KA 5JRHA 3O4GA 4RVSA 1JYEA 1LGYA 5ITSA 5CZXA 3TLEA 1O08A 1GEGA 2QSYA 4K2HA 4EEZA 4FN5A 2JIDA 2H5IA 5A05A 5D5HA 4HOYA 2YV3A 1L7DA 4QQNA 4PLWA 1SURA 4FYWA 3BXEA 1HMYA 3UOWA 1UOEA 2DTXA 5TGTA 3KHUA 1OZHA 1VA5A 3AFMA 3EZ6A 3H87A 3KJFA 2BMWA 5JJ5A 1XPRA 5FCDA 7ADHA 1XTUA 1Y81A 2XWPA 1HKHA 1MGPA 2X6RA 4GSLA 4HB4A 2W7TA 3V8EA 3GP3A 3H84A 5AM5A 5EJMA 5IP5A 4BZXA 4H1VA 3THRA 4YJHB 1M7GA 4HB3A 2ZSUA 3IIJA 4HD8A 4XR4A 1Q0UA 3JCZA 4CIBA 1H42A 2X8JB 4AJHA 3D54D 2V45A 1Q83A 2CL7X 4HPJB 4PGMA 4QECA 1DOAA 4Y9RA 2TMDA 3W5SA 1QP0A 1TF5A 3G9UA 3U37A 4AJEA 1SZDA 10MHA 4DCVA 5F23A 1LSSA 3ZE9A 1KYVA 4MEJA 3T1YB 2BZ0A 1G21B 1NHWA 2OEPA 3U7QB 2RBKA 3CNNA 4PYNA 5IDQA 2O3JA 1TLLA 3DE0X 1SKYB 3EH2A 8OHMA 4O4HB 3UUGA 5ELXA 4MLPA 3ZXIA 2Q99A 1TH5A 1ATZA 1S3SA 4XH9B 3RS2A 5LA6F 2I3ZA 3N86A 1K08A 2E82A 3Q41A 4GIBA 3CYFA 4FYKA 4Q4JB 3CWCA 3LV8A 2QI9C 4Y98A 2WKQA 3H2SA 4TLAA 5EKUA 1CX9B 2HNAA 1CW2B 5BWMA 2M32A 1P7WA 5LIPA 2Q2WA 1BN7A 2IY7A 1UK7A 4HXEB 4CUKA 2OOSA 2OG1A 4YV7A 1L5OA 3X2EA 3EFOA 4D74A 1U3VA 1ZOSA 4BNYA 5LU8A 3G02A 1QHYA 4MS4A 5KU7A 2BSQA 4X62C 1TCCA 3G2MA 3TD2A 4I36A 1BSVA 2V0CA 3KOMA 4L6CA 1CQZA 1ZB8A 1FLVA 3CR7A 3OZGA 3VPBA 1Z7WA 3OCWA 3WSTA 3O26A 3BIOA 5BSFA 2V5AA 4TS3A 2ODWA 5KYYA 1TTQB 1C30B 1V35A 1CP3A 1V1RB 1ODJA 2HHAA 3T15A 1CJUC 5ITWA 5IVHA 2L42A 1E9FA 2W8ZA 4J2OA 3E27A 3VBEA 5CVCA 3BL5A 1IHYA 2I4NA 2R7LA 3M5DA 4MP8A 1IULA 4ESEA 4LMPA 1AUQA 3O2SB 2HA4A 3TI7A 1CDDA 5JZVA 3DLBA 1GTJ1 2RONA 4B79A 4NYIQ 4ARIA 4MWDA 3KTDA 4GEGA 3DCIA 4OSPA 5KREA 5C5DA 4KNYA 2Z9CA 3EG9A 3EUFA 4A82A 1JF8A 3FZNA 2EXXA 3QTBA 5EHQA 3TTVA 2W6QA 2ZJBA 1V26A 1JPUA 4MI6A 3SWWA 3K7EA 1UDAA 1XMQC 4UNRA 1YB6A 1Z0FA 3C3XA 4FWTA 2IU3A 1T5OA 3V9PA 1E2PA 1YI8A 4Y9TA 4EG8A 1Z8HA 3EIFA 4G1FA 1J99A 1BVUA 3HKCB 3UAZA 2ZJFA 1OASA 1VKJA 3K1AA 4Z9AA 2P5UA 2ZDGA 1NT2A 1TU0A 2XCRB 4BVLA 4LC9A 2NV6A 5KHAA 1EK0A 1GCAA 1LZLA 1Y1SA 1N5DA 1XJWA 1ZK0A 4X8MA 1GPMA 4OL0A 2XQFA 4XGQA 1B0AA 1VL1A 2AN3A 3U1BA 1TM4E 3WGMA 3TUFA 5IJ0B 1JSXA 4ZQGA 3FTDA 1ULZA 3U61B 1LS6A 1P5RA 2FPRA 1GTL1 1H6BA 3CUVA 3LW8A 3T4UA 3ZHTA 2OR3A 3KSBC 1RZRD 1WZUA 3RF7A 3NOXA 3TLCA 2FF7A 1HDRA 4LVUA 5GPBA 2AUTA 1KVSA 5JAUA 3A25A 1MOZA 2PX4A 4UW9A 4AROA 1U04A 3EZFA 4TSRA 5BRAA 1M1UA 3FHOA 5C81A 2D5CA 2GFHA 2QP9X 3GCDA 1DJLA 2WJGA 3E3AA 1DX4A 1QCZA 1Y1LA 2ZK7A 3BIXA 1OREA 4LSGA 1VPWA 1W76A 4YQFA 2P0EA 4Y3UA 3W79A 1CZLA 2ZRMA 1C3XA 3R23A 821PA 5JASA 3OJFA 2PSSA 1EX1A 2Y1GA 4FNGA 4LX0A 4E22A 1U8AA 1VMDA 1AHNA 4N0EA 5EYPB 5TPWA 4H3HB 1KF0A 3RYCB 1I7SB 2GPWA 1CPYA 2WMNB 3LDAA 3V7YA 2P6RA 4UZSA 1KR5A 3V8QA 1QHEA 3RWMB 5DSXA 3ZQJA 1OXXK 5BWOA 3D3WA 3C15C 1PNOA 3WL6A 2HHJA 3IFSA 1R5NA 3LXRA 1TM2A 5DDIP 4J0QA 2DX7A 2UKDA 4B2LA 4K88A 2BGUA 2J30A 4BLPA 4LYFA 1Z8FA 1NN0A 4F9TA 3LHFA 4OHPA 4FI3F 3TNFA 4P0QB 2HREA 2CBXA 2M5HA 5K3CA 1DG1G 2ZJ0A 1Z7BA 3JWPA 3WWDA 1BA2A 3DULA 2JFOA 3C70A 4CF4A 1XZEA 2AXQA 2ZWVA 3B2NA 5JSYA 2OPHA 4EZIA 3UT5A 1Z0KA 3DDHA 3CLUD 2W2KB 2CY0A 4WSOA 4DIEA 2CVFA 3SQNA 2ZATA 3BYZA 4PSVA 1MB9A 4YAJA 3QIAA 4PX2A 2XI4A 2DERA 1KFBB 1SA0A 1IN8A 3KHSA 5EKSA 4BVFA 1BOFA 5FUWA 3ETNA 3D9QX 3QGMA 4MS3A 3VX4A 1VLHA 1QTQA 3ROFA 5DTMA 2A9VA 1VMIA 2PD3A 2ODEA 1IJKA 3DT8A 4WXHA 1GQRA 4ZWNA 4RKYA 3R7NA 2MYTA 1C9MA 3S1AB 3V1LA 4TGLA 2LCIA 2X0IA 1QH8B 2GAAA 4M9ZA 2JCYA 3PYMA 2R4UA 3HO8A 2FSUA 3C14C 3RHSA 4DA8A 1QOZA 2G9NA 4L95C 1XWFA 2E5WA 4XLLA 4TTRA 5JQGB 1EFCA 4PIMA 4QUGA 2I8LA 1GUBA 1I5RA 3O8CA 1N1DA 2WV9A 2G06A 1U0LA 3BJZA 4V39A 5AXAA 4V1CI 1TZKA 2Y0PA 2LP4Y 3KLOA 4B7ZA 1L7MA 1QF7A 4C1BA 2CNWA 1DWUA 2ADOA 2ZYTX 5K3FB 4ZP1A 4YX9A 1BTOA 3OCZA 3NS7A 3EUAA 2JJ8A 3EULA 4E09A 3AOGA 3DR3A 3M4XA 2IZZA 3FVRA 5B57C 5LPNA 4MJ3A 1IG3A 4FM9A 3CH7A 5JEDA 4J03A 1VYUA 4F5WA 1YB4A 4XQEA 1VG9B 5E0OA 2C0CA 1T8SA 3Q7RA 1A98A 2HEGA 4DR1B 1WQ4A 4TSFD 5JFGA 3LDGA 5E6UA 5B3JC 3L41A 4NBTA 1KQOA 5FIUA 5TQ0B 4J1SA 1SZPA 3ZCXA 3AUTA 4EIWA 5IFLA 1G20A 2C9ZA 2Q6VA 2X1LA 3ZE1B 1YRQA 4BATA 1SXJE 4U3JA 3K4PA 4JT2A 4C7VA 4Q3NA 3VSEA 3W0LB 5IVDA 3KEMA 1YFLA 2W2TA 4U8GA 1PR1A 3UMFA 2W2KA 4BO6A 1NMQA 3D0QA 2NO9A 2IDMA 2BEVB 4RTSA 4BX3A 3IL2A 3EZ7A 1P4RA 1BXRB 2FI1A 3D0KA 4N9WA 1X7WA 2QUAA 1FC0A 3IUBA 1Q22A 2DHEA 5C4GB 5CVEA 5CDUA 3L0IB 3V4OA 4E4RA 4FCVA 2A94A 2OFOA 3DMTC 2AZTA 2R85A 3CW8X 1DDOA 1DTSA 1C8KA 1F60A 3PHHA 5EXSA 4A0GA 4E46A 1KJZA 5CLHA 2X2PA 3E0QA 4KP7A 1ISGA 1EP9A 4RXUA 3WYDA 2QJFA 2RCYA 3C3BA 1QM4A 1KEUA 3Q7TA 3RC3A 4C9BA 1XMQB 2NV0A 2ETXA 1HLFA 3WK7A 4R54A 1MO3A 1KMHB 4TZ0A 4PG7A 2A4KA 2Q7DA 3NHRA 3IT0A 1WLSA 3HFGA 3RYCA 1P2SA 4N5LA 4Q9DA 4TX1A 3SOZA 5EHXA 4B3MB 1YUBA 1WTCA 2O19A 1WU8A 4O4IA 1UK9A 1PTJA 3A9TA 3JWEA 3NNNA 1I01A 3FNQA 1QIGA 1G98A 1XWIA 4AJPA 5L53A 1X7HA 3ADKA 5DLYA 5C5EA 3GJTA 5JECA 1SN7A 4PYIA 2I6XA 2WLSA 3DUWA 1JKJA 1K27A 1NC1A 2VUTA 1FVHA 2TMYA 1GLNA 2UU9C 1E89A 2ZRGA 4Q21A 2AQHA 4DWVA 2BFPA 5GADl 4ZAFA 1V8DA 1P2VA 4FZ5A 2CZQA 3ZU2A 5MN5A 1YJAA 1SXJC 2VEDA 1HKUA 1BFDA 3ORFA 4R7ZA 2HIGA 4BLWA 1YDMA 1GARA 1EQAA 2QN8A 3E1GA 3K96A 4YAUA 5ICSA 4JUCA 1ZGCA 1EA5A 4YRNA 1DRUA 4QPZA 3IMEA 1QC5A 1OWMA 5BVHA 2OAEA 5TPZD 5E1MA 3NO4A 4PGAA 3DQZA 3BK2A 4LNHA 4B40A 2I2AA 4JEUA 3PHGA 4BV9A 1AQNA 3AYZB 1P31A 1P7CA 1BVYF 1NM5A 1P0QA 1UMDB 3H8SA 5JVDF 1JQLB 1Q0HA 3F9CA 5D85A 1KSJA 4M2LA 4MQFA 4YP9A 3WIBA 4MWTA 3ZCPA 3M1LA 4Q4CA 1IJEA 2I2DA 2XUAA 2DG2A 3AHEA 4IZOA 5CU7A 3RIHA 4KXQA 5T8KA 2P9YA 2JIZA 2XJ9A 5F1PA 4XUEA 3VUEA 2E7GA 3KOWA 3ND9A 4H6PA 1L4FA 4RIEA 4CN9A 3CSDA 3PB3A 1NHGA 4UTNA 3JQ7A 3VZDA 2GEFA 1QO9A 4K9RA 4P81A 4YQYA 5IH3A 3T9CA 3TLBA 2G0AA 4NRDA 4H08A 1HQKA 4U0KA 1E3LA 4GKBA 1FDSA 1YAJA 4HB0A 2ZWAA 4A8HA 1T4CB 3RK0A 3UMVA 1TVCA 3TQSA 1CZRA 3FPHA 2D27A 4IAOA 1FL9A 1V41E 4BWYA 5B7NA 3PITA 5LWHA 5TGZA 1TQHA 1GGMA 2B5OA 2PT7A 2F1RA 1VJDA 2OSVA 4F5ZA 1EHCA 2JLSA 5BN3B 1SM4A 4Y1RB 5KCZA 5GINE 2WWGA 4G1CA 3Q72A 3GFRA 4NH4A 5DSZA 2BGKA 2Q1XA 3LYLA 3DOEA 1E2UA 2C1ZA 3LHDA 3WWPA 3ZLBA 2FQYA 4F6CA 2C54A 3K32A 4K3UA 4ZD6A 1UFKA 1HR0B 2C77A 3TG8A 1KP2A 1YMUA 5JAOA 5I47A 5KQPA 3L0SA 2OESA 4CQJA 2ZKIA 2QDXA 3LCCA 5IC5A 1G5FA 4ZVVA 1PL7A 3RT1A 3T34A 2VK8A 4LNAA 1S2IA 2O3UA 4RANA 4CR8A 4XZ3A 4E2FA 2N1BA 3CKKA 2WHEA 4CR6A 3D8TA 2DLCX 1A1SA 1ZOLA 5HZKA 5K8VA 5AK3A 3BEDA 1H4SA 1Q1NA 3PGVA 4ZZ1A 3VKGA 3TR0A 5CNKA 4AY5A 2CHFA 5A5DA 2B8NA 4JJ4A 4PG5A 3ROMA 1EEHA 4JLMA 3PUWA 1YQXA 3WMEA 1E3WA 1W35A 1F06A 1G2PA 2UZAA 4UTPA 4BNUA 1E20A 5K0GA 1G19A 3M4JA 3WNQA 1TF7A 2RIPA 4ON9A 4GS5A 4Y6SA 5E6UB 1SG6A 4CM4B 3PFKA 4PONA 3FLBA 5B7QA 5IX8A 2YICA 5CA1F 3GR6A 5CGQB 3T7IA 4WGFA 1U8ZA 1N5RA 1J56A 1QRDA 2D4AA 3UPDA 4D6XA 5D01A 1O95A 3FUCA 3IV9A 3OJLA 4IRMA 5GV7A 4K9KA 4YT8A 3B5IA 3P2YA 2JCSA 4N8SA 1W4AA 2KW5A 3KKKA 1KEKA 2XKKA 1IVSA 2IQIA 1KH1A 4K81B 1YB7A 2C4MA 1E77A 5DN6A 1O9GA 3Q2KA 1NSTA 2P9TA 4R41A 3AR5A 3T7CA 2R96A 1L5WA 3MTIA 3QSYA 2ILTA 3BF7A 1P9OA 2VH1A 1L7XA 1JQJC 1ZN9A 5G53C 4CKEB 4CT0A 2EF0A 2KS6A 1PQ4A 3ANTA 3W5JA 4EJSC 5AVXA 4DBLE 1R3UA 4FSXA 1CUGA 3B2EA 4BJHB 3CVUA 1LRJA 3CUWA 5AR1A 2NVBA 2WPNA 2VNSA 4LXXA 4ARBA 1Y1RA 5DTQA 2AEMA 1Z28A 2FGKA 1FQWA 3QOYA 1IZ9A 4K6CA 4LTDA 3SI7A 1Q6YA 2DY0A 1OX6A 2Q21A 2XHEA 2OD9A 3IERA 2REOA 3O7MA 1J1ZA 1WVIA 2WE8A 4GX0A 4IDFA 4B75A 3PJRA 5CDHA 3Q8MA 1P77A 4H7EA 1KYXA 3UCFA 1LLFA 3EIOA 3PWTA 3NCHA 1R8JA 1RU3A 2NUPB 1GKIA 1C7ZA 2X23A 4D96A 1JW9B 4UHKA 1JIJA 3QELA 3C6MA 3QF4B 1SVOA 4B8WA 3O6VA 1TQ6A 1JNXX 3QVGB 4U9UA 3VVCA 5K4GA 3K4HA 2PH3A 3ABRB 3IO5A 3IRVA 5M2QA 1QRUA 3KKMA 2RGEA 2A9OA 4NBRA 2IRWA 5B3AA 3WOHA 2CD9A 5IJAA 3RC9A 4BX0A 3OCYA 4E5NA 2ZQZA 4U0JA 4RE6A 1GQYA 2FSGA 2Y99A 4Y6PA 1JQKA 1ZPDA 4OHBA 1RVV1 2B83A 1A27A 1ZK4A 3OETA 2ZU6A 3EDCA 2FN3A 1FA9A 2ZYVX 3GXBA 3V7UA 3PL1A 1ODTC 5EHGA 3IAS1 3QLJA 2FXVA 1C1HA 1Z5OA 3GB9A 4ER7A 4XLZA 1JE0A 2VF8A 3DHWC 4N0PA 3D4IA 4RV9A 1C9DB 4UNQA 4WFKA 4D8XA 2D0IA 1E7RA 2ZLBA 2P9GA 2PUWA 1VB5A 1N2CE 2Z1DA 1E63A 2V1UA 2UXCB 1ZG3A 1YB2A 5T5QA 3SQOA 1UANA 3RG8A 4Z4CA 3G6KA 2YZGA 3Q9NA 3K53A 2B8EA 1MVLA 4FNAA 3ROGA 1NL3A 2AA3A 3TTXA 1EDZA 5DN6D 3AEKB 1VYVA 2PU5A 3I34X 3P5BA 4GVPA 2Q6KA 3RVMA 1FTQA 4PNEA 5FWXA 4MA5A 2YX1A 1ADFA 3GFPA 3HJNA 2BCGY 3RIMA 5H8WA 2JH9A 2AMYA 4J7CA 2E8CA 1XNRC 3CF0A 2CXTA 3IKLA 3IXMA 3OZWA 4RY8A 3LO5A 1HFKA 2FVYA 4JSYA 3LHKA 4M4SA 2RHRA 5JMPA 5CA1A 2ERXA 4B8ZA 1N9ZA 2JAQA 2JLWA 5IAJA 2OFWA 5IAGA 1ANKA 3GT0A 3T7TA 3DMFA 5ALOA 1QG0A 2P4UA 2E87A 2CZCA 2IGTA 2Y77A 2O3RA 2X58A 4N3BA 3EZLA 1G5QA 2DHCA 1ISRA 1BYUA 4OYCA 3L82B 3P2MA 1ZK1A 2MSNA 3QUBA 3ZNOA 4R71A 4ZFNA 2DUMA 1MP0A 5IT4A 3E22B 4GGMX 5AK6A 1RCTE 1I3OA 1RADA 4KFSA 2J4CA 3FGZA 5DM2A 3UB3A 1Q74A 4C6TB 2RE8A 3NHZA 2BGGA 4AY6A 2DWCA 3T1HB 3QF4A 2PO7A 3HYSA 1Z6QA 4MLZA 4V0LA 1YDWA 4C7OA 3UENA 1C9JA 3ASYA 2AW5A 1Z88A 3FWPA 4DL9A 7GPBA 2P1RA 5KWVA 3W5UA 2BSXA 4Y1EA 1KI9A 4C6RA 4IWNA 4ZU3A 3Q3HA 3IB6A 4I6JA 4U2BA 1EWVA 2XJ4A 5ALVA 3L8DA 5EJ9A 1FTYA 3WRXC 3PS9A 2ZM5A 3KQPA 1W0KD 5T6MA 1LA2A 2W2MA 5DLEA 2VF5X 4NZOA 5AP9A 5IU6A 1Z4PX 2FR1A 1Q21A 1FFXA 1XCMA 1Q57A 3DSRA 4DR3C 2H4HA 3L7AA 1SGWA 4GWKA 2CDBA 2JB9A 5A1TA 3S8MA 2HKIA 2RKOA 2XWQA 2H1FA 4TZ6A 1OHHA 2O7VA 2HRRA 2MYUA 3KEOA 5E4TA 4EI7A 5FX2A 4G36A 1W85A 2FOIA 1R5OA 3FUWA 4ODIA 4IFBA 5HFNA 4BZQA 2IGBA 4Q3LA 1KI8A 2P1ZA 5ALLA 4CTMA 1SWVA 2C9OA 2VRBA 1JA1A 4PQGA 3ANXA 2JATA 1ZIOA 3QU4A 2CLLB 2BFWA 3QTTA 3FPCA 1N2GA 4D4GA 2AE1A 2GZSA 5HKLA 5A4MS 1LVHA 1OROA 4RKRA 3ETLA 3NVKI 3ABSB 3MF4A 1F17A 3OJWA 1L5HB 2V7QD 1C29B 1FS6A 2GVNA 3OCUA 3KYCB 1PBTA 3DXXA 4V0SA 4YRLA 3LP5A 4JI4C 2IXBA 2VAXA 4F86A 3NTUA 3EH1A 3H8WA 5U4QA 1TMGE 3I5MA 1BDMA 2HHLA 3WKCA 3KKNA 4PZLA 2PD6A 4Q9LA 1GADO 4J16A 1ADCA 4BNJA 2A59A 3DNFA 5KQSA 1H2BA 2AT1A 1YBHA 2DPYA 2NXCA 2JHGA 4LDZA 4NMXB 5EEGA 2ISCA 2HR1A 1IN4A 3HGMA 4B5KA 2WOOA 1XZBA 4PCLA 2JFHA 3U39A 5JSZA 2RGGA 2R79A 4JFAA 1BU5A 1F51E 5GIPE 4ZAXA 4ILKA 3GVXA 4CVNA 5AW0A 3P20A 5IKPA 4G0PA 1R0WA 3ETGA 4BE9A 2GBLA 4JA2A 1R6VA 1REQA 2WB4A 1X7YB 1G9XA 1OXVA 3JQBC 3HRIA 3I1FA 5ITVA 2F62A 1TNDA 4DTCA 5JSQA 4RTQA 1ACLA 4OHOA 3NVMB 3SZGA 2DHDA 4EF5A 3LU1A 4WUVA 1HNXC 4YV2A 1BZYA 1RRMA 1YZHA 2DAPA 3TIXB 6AT1A 1Z0UA 2O8BB 2X3FA 3GH3A 3GIDA 1P1FA 3I8XA 4BECA 1N6HA 4E15A 1CUDA 2Q8PA 1OGIA 4W1QA 1PFQA 1YHYA 2RB5A 2D1SA 1P1KA 4MKZA 3VBCA 3RAPR 2HDOA 2FWNA 5GONB 4LPSA 5FQNA 3AW8A 3PQ2A 4X5OA 4FZRA 3T52A 2NXEA 1Z4NA 4CM8B 1X0XA 1Y8RB 3P9ZA 4OHUA 1H2ZA 1E59A 3AC0A 4JQSA 3TAXA 2HF7A 3DV0B 3ADCA 5DM60 1C1DB 2I2WA 1RTTA 1X94A 1PEYA 2K4MA 5FL3A 4JJGA 4BMXA 3O95A 4HN9A 4TT3D 2PSFA 1GHTA 2H1RA 2QVGA 4FFPA 3U3DA 5I7FA 2AD5A 5I51A 4IL5A 2JLZA 5BSEA 5HFAA 5JYDA 2BEWB 3B1KA 5HS4A 1DUSA 4B35A 1P8AA 1GL9B 3CLSD 5K09A 1US8A 2X0RA 3HCCA 1EFKA 1PHRA 4JI5B 4XVUA 3PNSA 2XVAA 5DW0A 4HNAA 4ESOA 5KWEA 3KLBA 2Q3EA 3DJFA 1J0XO 4URZR 4EAAA 5HKKA 2CL0X 3I9FA 4ZANA 5LP6B 1IEWA 3LVQE 4HNHA 3JVEA 1CSEE 1E9AA 3F2IA 3GLTA 4EKEA 1EQUA 3P19A 5B2EA 1V5FA 3P9QA 2QVXX 2VBIA 3AHHA 4I4TF 4PICA 1S2LA 3QENA 4KZPA 3GLGA 3WLHA 4YR7A 1FUEA 2G77B 3ZLJA 3WSVA 5B4UA 3A9RA 4WQMA 2H4JA 3EVZA 3ADBA 1JDVA 1RD4A 3FX2A 1PTKA 2IYTA 4YHHC 4G5GA 4NK4A 5JDCA 3SIWA 521PA 3FSGD 2R8BA 1MXHA 3K73O 1IPHA 2GZHA 4H3VA 5AJXA 3PD7A 1A4RA 5C35A 1GPJA 1GJRA 2HIAA 5DWVA 4TL7A 4MI1A 4OMFG 4UU1A 5LQUA 1Z07A 1SKUA 4MUHA 1L3CA 1VPLA 1YHZA 5IANA 1GA4A 1H2EA 4KQWA 1KQFA 4RBNA 1TQ2A 4MCAA 5KTMA 3VKHA 1L2TA 4HQOA 1F4LA 3OPQA 5BQPA 4F2PA 1T2AA 4ZZ2A 3LSYA 3PEEA 5BMVB 1EK6A 2QZ4A 1D0VA 2LDBA 4XWKA 4G81A 4H59A 2H1LA 2VUSA 3F74A 4MH0R 3DAHA 2XOKA 2CMFA 3CQ1A 3G49A 1C4OA 1MENA 3KOOA 1ULAA 4QASA 3UEOA 4BO3A 5MGNA 2ZBDA 3IE0A 1L3BA 1M8PA 3C8MA 3HACA 2XTMA 4UCQA 1VI5A 3PJDA 4L2IB 5GGYA 3T3HA 5KOJB 5JTTA 1D4AA 4G5YA 2O8BA 4YT2A 1AMNA 1VMKA 2NGRA 4IJWA 2E5FA 3VV2A 5EJ5A 3ZJ4A 1Y80A 1D9ZA 5AVSA 3IMFA 2OORC 4D2IA 1PJSA 1QKJA 2LVBA 2WSYB 1V5EA 1NVDA 3GNLA 1RRPA 1HDIA 1PFGA 1SKQA 3U44A 3VC7A 3IR5A 4ATNA 4AS2A 5JJIA 1VJGA 2VR1A 4O4LB 4DRXA 4Q3EA 2IXDA 1UIRA 1JJFA 2HC9A 1HLPA 3AR8A 4LZLA 2WP0A 4IXNA 3PUJA 1PZNA 1H66A 3O91A 1KO4A 4GZMA 2QXUA 4TMFA 5ALPA 5SYNA 3NYRA 2PJDA 3R7AA 3STXA 5EMHA 1H2FA 3NUZA 1NAIA 1G6HA 3KEFA 4H0FA 4UMEA 3VVBA 1NMSA 1JDBB 1WO8A 2J6BA 3LC1O 3WMGA 4UATA 4B4UA 3OE4A 4BNWA 4YCCA 1NP3A 3N2NA 3AHIA 1QNLA 1S8AA 1XRLA 4HX2A 4A92A 3IUMA 1BCSA 5I48A 1KFCB 1R18A 5JNWA 1YIDA 5BR1A 5KAPA 1YCFA 1KPGA 1ZEJA 2JGKA 3BWXA 3PHCA 1L8OA 1OLUB 4QYXA 5KYUB 3D1LA 4RELA 2GARA 3QKSB 5AQ1A 3PE6A 5LP6A 3OM8A 1PGPA 4ECAA 1NGSA 3KYBA 4PXYA 4EGQA 4MDEA 3V6MA 2ZT6A 5FL7D 3X1MA 1XSEA 1L4LA 3G68A 1B3RA 2C57A 3OSZA 2WW8A 4U7GA 5F9MA 4DUYC 4XD7D 2VDRB 2D28C 2ZKLA 3N0RA 2ZR8A 3PUVA 4V1CA 3F5DA 2QDKA 3CCFA 1TL7C 4QKQA 1KBZA 1A2BA 1H4VB 2C3UA 4QULA 1CK4A 4HX5A 1JAYA 3TW4A 5CBPA 4WXEA 3E35A 3ONDA 3A06A 1GPH1 1F0NA 3STTA 3IOEA 3A6ZA 2EIXA 1YXMA 3DZJA 3TUIC 4AO8A 4DMKA 3F8SA 3VNQA 1T9KA 3K71B 4ALMA 4BAUA 1OWOA 2GBFA 2SNIE 1UDRA 1BGWA 3FYSA 3KFVA 4MDHA 5HRCA 2C4HA 5ICMA 1GCIA 2JIZD 5CA0B 2GZ1A 3LNCA 1M2OB 1BIFA 1T9GR 3G0CA 4HS9A 1E9BA 2D13A 3QK7A 4Y1GA 3NDBB 5EI5A 3U3KA 1PW5A 3PNBA 1NVAA 4O2BB 3GJ8A 1RI1A 1MAVA 1O03A 1TPZA 1ZIXA 4WXPA 5BURA 2BTOA 3LM8A 1C3OB 1E6KA 3LZ6A 3BD7A 1X39A 4QICA 4Z0HO 3ET4A 1OVGA 4HLDA 2XHZA 3WGJA 2DB3A 4D25A 2COUA 1NF8A 1ND6A 3BGVA 1F9EA 4OX9C 1E3TA 3M1AA 3L0CA 1PV2A 3BE4A 2IHYA 4BNHA 4JVMA 1TTTA 3D7LA 3DMNA 4CIDA 4N76A 4AYTA 2CFTA 3RV4A 4PCAA 1NQAO 3IILA 4MPDA 1ZIDA 4BJ1A 2BC9A 1B43A 4BLRA 3GUUA 4NNPA 4UU0A 2WMYA 2YFQA 4OMCA 4P4TA 5LBIA 2P6PA 5DYYA 1GPUA 2D2EA 2I4TA 2XVYA 3NHKA 3HUUA 1P9NA 3WLTA 2XXBA 4PTZA 4DCCA 2KWIA 2WHXA 3UF0A 5BPFA 2B7CA 4NBNA 1BC5A 2P2YA 3EAFA 3IHLA 4PAOA 4UTOA 2B7LA 2C8JA 2HWXA 2F3UA 3ZY5A 4KREA 4RZ2A 1ODKA 4NHEA 1FB5A 5CVUA 5CX1B 1MIHA 4CODB 2P4QA 3UHJA 5KNCA 2XCUA 3AI3A 5H9VA 2IYXA 3CH4B 2BISA 2BONA 2D0OB 3KZVA 3UO8B 1FS4A 3DZGA 5CNJA 3WLAA 1SCAA 3QX3A 5KVAA 2QVLA 3CZMA 4HWGA 4JUDX 1PJZA 2P11A 4IQFA 3UANA 3TJRA 4BNDA 4PLZA 4DLPA 4S0ZA 2MU1A 1T2UA 4M87A 3I83A 3FCCA 3SZUA 1UINA 3ZD6A 4LYYA 1NSYA 1V0JA 1VJTA 3ES9A 3H6HA 3SR0A 5K8TA 3CVVA 3DDNA 4TMYA 3RHFA 1TJNA 1JH8A 1PS0A 3W6OA 5K0BA 4QODA 3ANLA 1P62B 4XM0A 3ZY4A 2IHBA 4MWOA 2MSCB 1Z5GA 3B3AA 5G0TA 5AVTA 4UBIA 2C78A 5FD8A 1MCZA 1UXGA 4EBFA 2CXPA 3GGSA 3KV1A 2VSOA 3GCGA 2GHQA 4EITA 3REQA 2EKQA 1KSFX 1K0UA 3PT9A 3EUWA 5KJEA 2QPOA 1N2ZA 3IO3A 4KLNA 4KRXA 3GYBA 3U0BA 5JHGB 1VBMA 4YHHB 1YVDA 1N36B 4QPPA 4Z4GA 1CUHA 4FYXA 1GZVA 2LV8A 2X86A 3TLGA 1FNBA 3U4DA 1M1YA 1PZHA 2FPIA 2PXXA 3I6ZA 3VDNB 1EAMA 3E9YA 3L05A 4MXDA 4NZ9A 3ZWAA 5C7YA 4MRVA 1EK1A 5EHZA 3KYDB 3BD6A 1G8FA 4P82A 3DOHA 1ULHA 1QGYA 4RZHA 4IDNA 2Q5IA 4X8OA 2VBGA 4O1IA 5FOTA 3OTHA 4Q3BA 1SCNE 4O2AB 3TN7A 2EKBA 5HOEA 4KLCA 4MQLA 4EY3A 1NF3A 2A7QA 2YASA 3BSWA 1RKBA 2X0NA 1ZN7A 5G0SA 4HAUA 3KE9A 3HYLA 4P58A 2VTBA 4E32A 2Q28A 4C7MA 5LXTB 5G0UA 5A4FS 4RL4A 2XYQA 1HBJA 4BO0A 2Z5LA 1OFUA 2PGOA 4EUEA 1FJXA 1X1AA 2C97A 1K7EB 3MMXA 4E11A 4G24A 4FCWA 1QAMA 4GD3Q 1IATA 4DVGA 2JFUA 4LFBB 3WP1B 3BMCA 2W2OA 3OZSA 4NDNA 1ABFA 1F8GA 3L40A 1JXOA 1ZWKA 2J1LA 5JTUA 1ZUD1 2ZB7A 2HDNB 5IDVA 3NBKA 5TPZA 5LYYA 2C29D 4YCJA 1ZJZA 1CJVC 3F3SA 3V8RA 3WE7A 3WLRA 5F64A 2BUCA 3HU2A 3RC8A 3L7OA 1W44A 3GHYA 4X93A 5AJHA 2MINA 5FYQA 4CKCA 4ZN6A 2CLHB 2VDLB 2ZE8A 4DMRA 1L4HA 3ILXA 2E4YA 4KQKA 3E84A 3VAAA 5IT0A 1XKLA 1DELA 4XYMA 5CFLA 4US0R 1YVRA 1RJWA 1I0IA 3BFVA 2XNDA 3IAM1 3ZC3A 2HD4A 4EQZA 1TGYA 2FJPA 3MMZA 1W2GA 4ZYTA 5J3JA 2FW9A 4KYUA 5KYYB 4DKJA 4CQLB 5JRJA 2AV6A 2HHCA 1F6BA 2HMWA 2V4ZA 4OP1A 5BSKA 3KVNA 3TLAA 4BN4A 4HMPA 1KJYA 4GUAA 5HPYB 4Y2PA 1ULBA 1O8BA 3UMJA 3N54B 2JJYA 1HXHA 1TT5A 2AFVA 1FYVA 2I7VA 3FFTA 4GWLA 1E6EA 3OQ6A 1UBCA 2P6UA 3ND8A 3NP9A 4NE2A 4X8LA 1ZESA 5HIKA 3OT1A 3NBAA 2Y71A 4RKEA 3H5WA 1KIFA 1QE0A 2UYCA 2Q50A 2W6PA 5AIAA 4HWSA 4DR5C 4A4DA 5DCWA 1QZZA 3T0GA 5FV7A 4FLFA 5K45A 1VA4A 3AP3A 3SDZA 4AQ7A 1GU7A 4XX1A 4ZA2A 4ZVNA 3QLTA 4A8JB 4EVQA 2H48A 3TB4A 3LYHA 2MMGA 2HMYB 5T41A 1FTGA 4B3MC 2J0VA 4LQLA 4JI8C 4HCJA 3BMXA 5JZOA 4CM7A 3KKPA 3K1YA 1DC7A 3BFPA 3IDSA 1XCGB 3ZWQA 2C9MA 4Q34A 1KVTA 3WBBA 3TRDA 2XNJA 3NAGA 4GX2A 4WH0A 1Z5ZA 4AZTA 3PFHA 4IXTA 3WY9A 1E5DA 1TZ2A 1RRVA 4CMEC 1Z68A 2BM0A 2XRFA 3GNSA 4H1UA 4BVAA 4CUJA 4Q4JA 2WYUA 4P2GA 2OXRA 4XDZA 5HF9A 1FYFA 4F6RA 2EZUA 1YOBA 3U4GA 5E9QA 5AESA 3PBKA 5TEVA 5LKAA 3WAJA 5IS2A 1AX9A 1V71A 2QUHA 3L06A 3T3EA 1I3LA 2J5XA 3LUCA 4HVAA 1EXVA 4GC5A 2XDWA 3LX5A 4D98A 3T0IA 2CMGA 1UT6A 2CLOB 2EL7A 2XKAA 1SK9A 3J7TA 4XB1A 1FXUA 1ISHA 2EZ4A 1E2DA 1CB0A 3B1ZA 1X15A 2B6HA 2EC5A 4QTXA 4R1SA 4XQCA 2X0EA 4RD2A 1RKXA 3V1UA 5K0ZA 1OMOA 3CZQA 3GR1A 1IBCA 3GAZA 1SK8A 1Z29A 4CDRA 5AXBA 1CE8B 2M2IA 2LDXA 1K8RA 2JGMA 3AR2A 1NKSA 3L9WA 4DG8A 3FWZA 3ISJA 1H69A 4V38A 1OTHA 1PT6A 2VC2B 3ITDA 5IH7A 1NQUA 1VSVA 2X4DA 4ZVRA 3JXEA 4EQ6B 4B2PA 2WF8A 3FROA 4QATA 2JBAA 3O4FA 3GG9A 1QK3A 4P33A 3WMFA 4KR3A 1MUUA 1V1MB 3ORHA 3S27A 5KNDD 5FOSA 5SV2A 5C8YA 3DJYA 3MYYA 3OO1A 4PLGA 4TXHA 3WKDA 3MWKA 1KDOA 4NE7A 1UMDA 3PQ7A 2Z83A 4KQHA 2JAUA 1RWKA 1T13A 1GV0A 3B6JA 4URHA 3REQB 3V00A 4YPVA 1W0JA 1GQSA 1F0YA 1VCNA 1VYTA 3ECAA 3HN6A 3UJ9A 4KUGA 1MXAA 4R51A 5A6VA 3HP4A 4NENA 1W2HA 3FAKA 4P8RA 3S1LA 1EB8A 3ME5A 5CB0A 3O4RA 2JGDA 2Z3WA 1HA3A 2NAFA 2WFLA 3NM4A 3GO4A 1UFQA 4TQGA 4CTJA 3AWIA 2BMDA 3P7MA 4FCTA 5AOVA 3PEYA 2CMHA 5D84A 5JXWA 1GG8A 3ETDA 3PWZA 3N70A 1WHSB 2AXEA 2JGLA 2J9RA 3EY9A 5ESWA 1NLZA 3UGKA 3PA6A 4R1UA 2G9UA 5IAEA 3U5ZB 1X0VA 2Z8XA 3P9CA 1P6UA 1D9XA 1T2VA 2NSYA 4KFCA 5CDFA 3ERCA 4GE3A 4FE7A 2VWQA 3FYUA 3JVUA 4QOHA 4QUKA 4RF3A 1KYIA 3I4CA 3RUEA 1Q14A 5CDGA 1XAJA 3LFTA 4MIOA 4R1PA 3CX3A 2ZUSA 6ADHA 3AJRA 3DOUA 1KY3A 4IX9A 4DF3A 4ZQEA 3ZUGA 4DRZA 2PZBA 1JLLA 4IYJA 4FS8A 2Q5FA 1SU7A 2F00A 3PNOA 1OXTA 3IDOA 3D6HA 2QQGA 1T29A 2SKDA 4GI1A 3V8VA 2EZTA 4QSHA 3KQHA 2I6QA 2QPLA 4BFCA 1KI1A 1S1MA 4CRWB 1N2FA 3GDHA 1JFFB 4BE4A 4MUYA 4MVJM 5EZ5A 4WVLA 2P0AA 4ZVPA 3UXEA 1EVEA 1DEXA 5EUCA 4OQYA 4EHNA 2AVNA 4F3CA 2V3WA 3GGGA 3O73A 1ZA1A 2CE7A 2R65A 2Y66A 4WCFB 5HBGA 4EPTA 1XTVA 1ZI9A 3C3DA 2JARA 4KPEC 4KQFA 2JLRA 3B60A 1SRQA 2XD4A 1K89A 2CXOA 1K4KA 1U8CB 4DV4C 2Q0SA 5EIBC 2EATA 2YHIB 4F93B 1I6LA 4KE8A 2Y1LA 2JIMA 4FKMA 1NWCA 4B83A 1YC5A 1M67A 3PDWA 2ASBA 1ABEA 1D6NA 1NVKA 1EQ2A 1U9JA 1JB9A 1P2TA 2ZJ5A 3AUXA 3DDSA 2I1LA 3L1VA 4HUJA 1WZEA 2I1WA 4MVJG 4ZC8A 3RVNA 3AO0B 2SCUB 4WD3A 4NULA 1KEEA 3MGCA 2IYWA 4MP6A 3PROC 1ORHA 5JAQA 1RYFA 1F5SA 5T64A 3SBDA 1E6LA 1SAYA 1E2HA 3JZIA 3SHTA 1QJ4A 3AXSA 3H6KA 1JKXA 1P1JA 4RD3A 3BC1A 3BTSA 4HZUB 4C03A 1OI2A 1IAQA 1DWPA 1PYGA 1XTPA 2H8KA 3JQ8A 2FEMA 1CY4A 3EIQA 3NHAA 1GN9A 5JJBA 2QE7D 4M76B 4TLCA 2AEEA 4BKRA 5IULC 1W4BA 2B61A 3IQZA 4V24A 5F9FA 1JTFA 3NOOA 1II9A 2HFJA 3TXAA 1TA4A 1PDVA 2RG1A 3ZPXA 4HDOB 1EFPA 3GFVA 3CVWA 1N33B 3SGLA 2OCLA 4GM4A 5F77A 1Q0TA 3COSA 2HHHC 4RWEA 1WSWA 1A5AB 2ILVA 4PQRA 1NI3A 1HY3A 1WAMA 3BN3A 5JRDS 3I08A 3F5QA 1PR9A 2QR3A 1NVXQ 3ZW8A 2YFKA 4BFTA 2JBAB 3NM6B 4OQPA 3OU7A 4CMAA 4J7AA 4GSKA 4IQ8A 2VT2A 1ZRMA 4NCHA 5BQ5A 3JWJA 3VU9B 3R4VA 4PZEA 2QV7A 5DF1A 1E9RA 3DHVA 2MTBA 4RF4A 3TOZA 4MB2A 5CDYA 3LBYA 1C1XA 4LISA 1A76A 4I5DA 2WTBA 4MVJI 2FMKA 1E7WA 3O38A 1UJ5A 3LX8A 2DFDA 2VSYA 1Z5UA 1DE0A 1IOZA 1M2VA 3GRKA 1CR1A 2WIAA 3V4ZA 4F8YA 1YBFA 1EHIA 1NX9A 1WA5A 4PW0A 2QTTA 2QY6A 1U7XA 4ZEOA 3IUYA 4UQPA 1AGXA 3D6NB 4HO1X 4UBJA 1CUJA 4H27A 2Z1NA 3WWZA 5A2GA 5BVGA 2Q0QA 2GK6A 2XE4A 3O0TA 4OJQA 5K0NA 5BXQC 4Y2UA 1P18A 4GLLA 1NPYA 3TGLA 4G9EA 1USGA 4ZICA 1II8A 3H9BA 4S24A 4MEBA 4EKNB 3R9WA 1Z4OA 2GJSA 5CPFA 4CLOB 3R5HA 3N75A 1NDUA 5F3WB 5JSUA 2X2OA 3L1KA 4LBWA 4AJJA 3H8VA 4YUWA 1SULA 2L19A 4DRYA 1DCFA 2E85A 1JHMA 1B41A 5DXFA 2QRJA 1W96A 3GFOA 4XSGA 3DDOA 3R41A 4I1OA 5EERA 4Z0TA 1USPB 1WY5A 4PZZA 1WB6A 1Z63A 2FW6A 2A1UB 4JL5A 2WPDD 4RZIA 4UM8B 4RFSA 3C8UA 5J4VA 1Y9JA 4QYIA 2WHYA 1VLMA 2HO4A 3DB1A 4IHAA 2BH1X 1ZIYA 2O1EA 2PMFA 4FS3A 2OD7A 2Q3FA 5HCUA 3SIPA 3VR6H 2VHUA 1O95D 4EHAA 1B8NA 1PR4A 1PZFA 2HBRA 2LUOA 3MQ4A 3IA7A 3HXPA 1U1DA 3M4ZA 1NI4A 4QWMA 3K6KA 1W5EA 3NXSA 4IHJB 3SJ7A 5GWXA 2NPOA 2PWZA 3CO5A 3FCEA 5B1DA 4PAMA 4X1KB 4D1YA 2XW6A 4E21A 4DBVO 3HZHA 3C7AA 1OFIA 1AQ6A 3X1YA 1EFRA 1R6BX 1OB2A 1ID8A 5L3ZA 5FO0A 1ZRNA 3MJRA 3DHYA 2XMZA 4EHHA 1NUHA 2FNAA 2P3QA 2BKVA 4UBKA 3RTEA 1PL8A 3N5CA 4X1KA 3SSAA 2WY2D 4W9NA 1UMBA 2D62A 4I50A 1QK5A 2IKSA 3RHZA 5KOHB 3P4XA 2ZS9A 4P3XA 2X5KO 3KEGA 4NU0A 1PK7A 2ZBUA 1YS2X 5JCJD 2R48A 3K70C 5F1YA 4C0KA 5JYEA 3MAGA 2ZTSA 5H9UA 1JE1A 1W52X 2XVMA 2DQZA 4MQBA 2F55A 3OZ7A 2YW9A 4GPTA 1OJ7A 2WD8A 4KGDA 2H54A 4ZYYA 3PLNA 1TCVA 2NTYC 1TUIA 3HKDB 1JB1A 2H8GA 1HF3A 1R0BA 4DCSA 1QBGA 4X3PA 1MEEA 4W5HA 3U62A 4ARZA 2AXPA 1XZKA 3DC7A 421PA 1Y3IA 3GJQA 1BDIA 4Y2YA 3U0VA 5LOVF 2NZYA 4HDRB 3TZHA 1KGSA 2PGNA 3AY7A 1SEVA 3AUAA 4IGKA 5A7HA 5JISA 1RFGE 3UOGA 5EGSA 1XD8A 4WN3A 5ADHA 3IHKA 1J4AA 1P29A 2HO5A 4PLHA 3IUEA 4Z7NB 1OI3A 3ZTWA 4BU1A 4DMFA 3JRXA 5B58T 1U0RA 1RLTA 1Y8RA 1VHTA 4N5MA 2Z4RA 3EXIA 3R7BA 1TPYA 2YOHA 3L7JA 1P1BA 1F0KA 3DE3X 5ITZB 4EG6A 4J3JA 1TYZA 3EEIA 1MGOA 4LFBC 1TO6A 1W30A 4LCEA 1VGRA 4ZVMA 2OC9A 4PSUA 1LU9A 5J58A 3HZOA 2ZPUA 4JI3C 1IG0A 3G5LA 1QHNA 3NGMA 4BCDA 1J0CA 1BMTA 1YOVA 2F1OA 2FFRA 3NHPA 2FFHA 1RBMA 4I81A 4JU9A 2I34A 4XWTA 2J9XB 3IURA 2FUCA 2VDVE 4X94A 2ZJZA 5HRAA 2F9MA 2OO3A 4FT2A 1ZM7A 1XLVA 3SVTA 2QMOA 4CIAA 3VNRA 2PX2A 4ES6A 5JD4A 4M1MA 3MBIA 4A27A 5DB4A 3PUYA 5K3AA 5C8YF 3B6IA 4MKRA 3F7OA 3KLMX 4CV0A 4PZCA 3GLRA 2D1YA 1B76A 2DLNA 2ENWA 4B9EA 4JS0A 2QW8A 1UZNA 1CQJB 2WWRA 3MN1A 3M6UA 3HC7A 5KQMA 4HMOA 3FF4A 2J33A 4BKUA 4KVGA 1X7XA 1Z25A 4FEGA 2OV4A 2PH1A 4RD0A 1WXIA 1ZUIA 1KMQA 2G88A 3UJAA 5DHSA 3TRKA 4LN1A 1CJMA 4DQKA 4S05A 1W5FA 5T8KC 4L73A 3ZLVA 4D9JA 1S0UA 2R87A 1X74A 2CN1A 1VBKA 1U3DA 3O47A 3P0RA 9ATCA 4BUZA 4PLTA 1L8QA 5BR8C 1KEWA 2D7CA 4RZUA 3BGIA 1XR3A 2BGJA 3HKDA 1ZITA 3AM5A 2EFYA 4DDKA 5JCXA 2PWPA 2EDCA 5JZMA 5DV9A 1CWUA 2Q5EA 1N2EA 1T43A 2Z0MA 2QNBA 5BV2P 2RC6A 3IDZA 5FH9A 2P4HX 4C4ZA 2FH5B 4A0SA 5CBPB 3HP1A 3IDQA 4KMOA 3OA2A 1IBKC 4AKGA 1EBUA 3EYAA 1NI5A 1RRGA 2IYPA 3LT1A 3MLBA 4LKRA 4MV7A 3CH6A 4KXFB 4K05A 2P9FA 3NZEA 2FW8A 3FUUA 3KR2A 3D02A 4V0RA 1Y42X 2PYIA 4R8LA 3TTTA 2GFQA 3VVLA 3P2KA 1PLLA 3LLVA 2JFYA 2VZEA 3OKFA 2AN5A 4WZBE 3RBAA 5AFSA 2ODTX 1UKZA 5CB4A 2G25A 5KTNA 5JCOC 5KDOA 3AR7A 5CXSA 3QWFA 3AY6A 4LS3A 1Z3CA 4MYRA 2GS9A 2AXNA 4BGEA 1EESA 4YPOA 1U2PA 1IY2A 1Z7GA 2QL9A 1A4IA 5LNK1 2FMUA 2VP9A 4B76A 2GYUA 1G291 1Y9EA 3BDAA 4FFOA 1QH8A 5AYVA 1UEXC 1XJ5A 1E7SA 2IYQA 4ZLPA 2PBZA 3MWFA 1RQPA 4Y9DA 1X7WB 2XUGA 4PG6A 2BF4A 2FZKA 1O92A 2WKRA 1EI9A 3OBIA 3ZH2A 3STVA 1T2EA 4ACBA 4AUNA 5CCXA 4M1SA 2Z6UA 1P1CA 5EJ7A 4XGNA 1U5BA 3LQRA 5JC1A 3OD1A 4PLVA 4OK5A 3O2QB 3QA3E 2DHMA 4CMJA 2DE0X 4E2WA 5K8IA 1XELA 1LRKA 2BVNA 3GGJA 1FUKA 4LRXA 1IOVA 4KYVA 5I4CA 3C8ZA 5E4JA 4ZHQF 1G6OA 2LWIA 3GOQA 4BNVA 2BMJA 1JQ3A 3KLNA 3L01A 4EKIA 4H7PA 2PA0A 5ADWA 5FLEX 2UZ0A 5E4FA 5L7TA 4WBNF 4LZWA 2OV1A 1BJKA 3EQ2A 5IJXA 4TXJA 1G2IA 1HSOA 1Y3FE 5LU9A 5HMMA 4PZ9A 1QMPA 2ZYDA 4YCDA 5JAHA 2QAGB 1U8XX 2VPXA 1NXWA 4N8EA 4L8GA 1IBLB 5FTMA 4D9BA 1F1BA 2CV0A 2P78A 3TLZA 2EKDA 4TMVA 5WRFA 3PIDA 3LNTA 3N0VA 3A14A 1ESNA 4B6PA 4KO3S 5DOZA 3RH0A 4U63A 3Q3JB 5J2TA 2R1VA 1JU4A 2JVKA 1FNSA 2KE5A 2OXFA 3BJIC 1XRAA 4YIKA 5TMEA 3JQBA 5TMPA 4JBNA 3CQ9A 4KAAA 5B30A 1LVUA 1UAAA 5DTEA 3SMVA 2Q6IA 3G5MA 3HWWA 3IOCA 1N5IA 3OY2A 4HWPA 3CPSA 5TR9A 4S2EA 1NX6A 3NC4A 1ZY2A 1XCPA 2XEXA 4FTFA 1IM5A 4Z54A 3FYUC 3AFOA 1GPDG 1DCTA 5JYBA 4LYAA 1DP4A 1N78A 4QGSA 2Y2VA 1DXYA 1X2EA 2NM0A 2YCLA 2BGRA 2QA5A 1EZ4A 3VO1A 3M9XA 2XYRA 3FB1A 3ZHXA 5A9RA 4GOLD 1U6IA 5DEOA 3VPFA 1N1GA 1NJ2A 4QTYA 3GLGE 3L04A 2GNAA 1T34A 3G8DA 5CITA 5CIQA 4BO8A 4C0XA 1PI3A 3L7NA 3NG1A 5DBEX 2VTEA 3I2FA 3H1FA 1QZ3A 4K8OA 1CYEA 4LDRA 3GUHA 3LA8A 3QVUA 1OBCA 4YROA 2BI8A 4UTZA 4RMIA 4F4DA 2P91A 3L6CA 1UCFA 3UW3A 1I6MA 5KS2A 2X41A 1YE5A 2ASVA 2XXJA 3HFJA 2Y2UA 3C8HA 4OFXA 5P8WA 3GR0A 3UWOA 5LQMA 4KXWA 4M21A 1K6XA 2VQFC 4FMPA 4JB8A 4LJ5A 4TWIA 2OHHA 3R8CA 2O8CA 2PXAA 4G4IA 4EB3A 2JKVA 4E88A 2GCPA 2IUSA 4Q1VA 1WF3A 3C6XA 2VATA 3R7SA 2HSGA 3HQ4O 4XCVA 4FHCA 1Y4ZA 2PAFA 3A1EA 1NZFA 2HI0A 3RAJA 5G3ZA 1IU9A 2VPPA 1QUFA 3DBLB 1Y6FA 3OAAD 3RADC 5C8XA 4G2NA 4WLVA 4E1BA 1P60A 3BICA 3CX4A 4ZTUB 2QRQA 1S02A 3CT6A 3Q2OA 2CHEA 2F1KA 1NRXA 4YCLA 1K3UB 4I3FA 4CMIB 3ROQA 3RI3A 3WL4A 1O97D 2NUPA 3DVSX 5H5JA 4AKSA 5AW3A 5LFAA 3EQ6A 1ZVQA 2CLFB 1PG4A 3GHHA 1I30A 3IVAA 5CT6A 4AJKA 3G7UA 4Y0NA 2AYAA 1DC3A 4D4IA 2PROA 3JAKA 3PPVA 4U2GA 4J1TC 1DAKA 3Q6NA 4JJAA 4L9RA 3V2UA 4EG7A 4QT4A 2DRIA 4FE3A 2BEUA 3T12A 3LCJA 4WESB 5CMLA 1VDMA 5EYPA 3A4LA 5KO2A 1O5OA 4FB4A 1NBWB 3EPPA 1IUKA 3VX3A 2JF0A 1B8OA 4NHOA 3F46A 4P5EA 2OCKA 3KAPA 3WNDA 5TQ2B 2O8EA 1EFDN 3EZ9A 3BAFA 3QX8A 4KYIB 1WB5A 5I01A 1PIWA 3U19A 2ZZMA 1YULA 2CXSA 5IWAC 1HEIA 3ZZTA 1C5KA 1RYNA 3FNFA 3FPJA 4INJA 1E7QA 4JLJA 3ZCRA 4D57A 2KLBA 4DHEA 4P4NA 3D8HA 5EIBD 1CCWA 2D5AA 3AMVA 3H11A 5T4FA 1FU8A 3CXRA 3LS2A 5EP3A 5GONF 2V0NA 1E3IA 1L1RA 4E14A 5J2UF 4JH0A 3OX4A 1FMLA 4QOGA 4Y2SA 3FUTA 3QU5A 3P0HA 1KJJA 5SY4A 1DFHA 2WUEA 4JQCA 1YU9A 3RYFB 2QTZA 1JDPA 2SHKA 3FRHA 2ORVA 3Q7IA 2XNDD 3DEAA 1OU0A 3AEKA 3S7ZA 3TCKA 5ALYA 1VI2A 4MS1B 1UDBA 3ELDA 1IBSA 1OFHA 2V7BA 3CX7A 3KJXA 4XVQA 3TTUA 5JZSA 4CGZA 2B78A 2OSBA 1GDHA 1ST2A 1IXRC 3RHTA 1AKUA 1T0JB 3BHNA 3R7WA 2JFVA 3WK9A 4F2GA 3ZK8A 1DX9A 2OHGA 3IP9A 3U4CA 3R3VA 4C2BA 3PGLA 2UUAC 1ONBA 3PZRA 2K7ZA 2E8EA 1EVQA 3NPMA 4JT8A 2HK6A 4PHTA 1H1LA 4RHFA 3WL7A 2C84A 1QE3A 1M2NA 4LC1A 1P91A 4QDZA 3ILVA 2G71A 3I76A 4BFXA 2V98A 1A8SA 1XFAA 1AM4D 3IBSA 3JYPA 3GEEA 1RM0A 2OV2A 3EGDB 5E9JA 4BBAA 1ZM4A 3IAUA 4M1OA 4XAQA 2MINB 1KXJA 2DMRA 3NETA 1K0RA 2QVZX 3VTFA 2NU8A 5A5FA 4IY1A 2G5PA 4GR5A 1NLYA 1VRCA 2E48A 2X8AA 3GLSA 4IILA 5E1DA 1EDOA 3JVVA 3OJ0A 3QQPA 4QC2A 1NBEA 5FORA 4L3WA 2RGUA 3DYVA 4YP0A 4LRWA 3T1HC 2CUKA 5COAA 5DIFA 4PRZA 4Z99A 4CXMA 4G0UA 1A82A 1QIKA 2GH1A 3IQWA 4R68A 1EINA 4ARZB 4E31A 2J59A 4QVIA 2ALJA 1XQ1A 2OC4A 1KEVA 3ETCA 5KB3A 1QFSA 4TMKA 2WJZB 4FHFA 3EGCA 3K6SA 4ER5A 4PSDA 1V3UA 1H0RA 2VDWA 5D51S 5AUQA 4C4OA 5LSAA 1VE9A 1FDOA 2H85A 1NLUA 1WDWB 2BP7A 3DKIA 3IELA 1MABA 3T5DA 4EDFA 1QP4A 4RSGA 4CTKA 3T6KA 4UBLA 4P93A 1QHHB 2WZBA 1UC4B 3L8GA 1W9HA 4FW8A 2WBLC 1YVUA 5EGNA 1BA3A 2R1TA 1BWRA 3A2LA 3BCHA 3SSNA 2QZZA 1L7NA 2FDRA 4TM7A 4YUXA 2GFIA 1ZVMA 3MTEA 4NOKA 3MB8A 5BORA 1S3GA 4OYHA 4FN4A 4ZMRA 2VS1A 4KTTA 2I1QA 4J4BA 3ZWCA 4LF9C 2EWWA 1OLSA 5JNTA 3BULA 4P3KA 3VUFA 2YHUA 2P5YA 3RRXA 3BFJA 1S3FA 3DE6X 3KSMA 2J0UA 2YCBA 3ZKWB 1IHDA 3AY3A 4YK7A 2JAWA 1P3DA 4AKHA 4GXNA 1MB3A 1U31A 1D1PA 2HCTA 2D74A 2G1AA 4L6IA 4PYMA 4RLHA 4IIEA 3RUAA 4A0HA 4QZVA 1TGVA 1W47A 1XZMA 3AJDA 1USWA 2WWYA 2JCVA 1GFWA 4NQRA 3L0YA 2DBZA 4ZT7A 4OHCA 2XSZA 3CRRA 1R15A 3MWLA 4ROTA 4CG2A 2ISSD 2ID7A 3GLIA 1TLFA 3RTAA 3QM1A 1TYCA 3JZFA 4JASB 3OTWA 4BZWA 4D45A 3BWCA 3F6RA 1E1QD 5KKCA 4LV8B 4UDYX 3IQXA 3DPUA 4N65A 2A9KA 1ADYA 1NUQA 5ALGA 1WUHS 2I6SA 2H00A 5HBRA 3W8RA 4DJFC 16PKA 1EFTA 3TRIA 1FQOA 6Q21A 4IICA 2FRXA 4XGKA 3GJRA 1BS1A 5AW9A 1YTLA 4FYJA 4XSVA 3TNLA 2YJ5A 4XIFA 3H3FA 4MLDA 4MQ5A 2C2BA 3EXHB 2ODBA 1U6JA 4K9MA 5AHRA 5I6DA 3EVDA 3BK1A 2CLEB 3F6YA 4DXHA 5IYZA 2ZBFA 5JRZA 2WSLA 3LUJA 3Q9UA 1RWMA 2IOQA 1GZUA 3RIXA 1ZLXA 4OH1A 5EQFA 2OM6A 3FTCA 3TCXB 1X9IA 1EM8B 3PHIA 2QTCA 1XJ0A 3IEXA 3NNSA 1OIWA 1VJ5A 4LY0A 3ZQ4A 4BRUA 1C3VA 4C21A 3MINA 4BGDA 2XQIA 3R5TA 4HLQB 5D1HA 1X80B 1HFWA 2WFAA 3SC4A 1AMOA 2ZSDA 3S29A 3T9FA 1QGDA 3PUXA 4ZO7A 4AURA 3CEJA 5DFAA 4DEXA 2ZVQX 4QO8A 1SIWA 4XWYA 1BCRB 1DCKA 2NVUB 1CLEA 3NDRA 1DBVO 3OG9A 1E94E 2EX1A 4I1IA 4PEVA 4KR0A 4YJ3B 3LC7O 3WHLA 4IJQA 4BASA 1LDGA 1WKBA 3ON5A 2Z58A 1OXSC 3FNIA 3PQDA 1NXPA 3KQMA 1FFWA 2ZVJA 2NSLA 4CMEA 3LXXA 1YIOA 1MQ9A 3SJCA 1E62A 1G6Q1 3U4AA 3IEVA 1CUVA 2G4VA 4DZZA 5INTA 3LPAA 3BA6A 1CF2O 1ZMTA 5MFPA 2BEJA 1I4OA 4E5MA 3DVAB 1KH2A 3SDSA 4D97A 2WKSA 4FDAA 3LNOA 2BTQB 3SXUA 2FP4A 2P4SA 4BNLA 3ZKAA 1A0OA 3FOZA 1FP1D 2V0GA 5EXPA 3OPYA 1KWKA 1ZMBA 2X4GA 1I24A 2WAXA 5DO9A 1GDDA 4HY3A 3GWGA 1GQOA 1H65A 1D2CA 1CY8A 3MXOA 3VDRA 4HNTA 5KTRA 3NAQA 5L6LB 2W0SA 1ECCA 2QTHA 3GOHA 2PKQO 4QHSA 2HYIC 1CQWA 4DPMA 4A91A 1EA7A 4FR5A 4DLWA 2VQ6A 4HQNA 1LPSA 2ZWPA 4LXUA 4JZKA 1RXEA 4KG7A 5D3MA 2G28A 4H7IA 1NBMD 3TX2A 2OHXA 1NVVR 3K9GA 4IDBA 3V4RA 3ABQB 5K20A 1EK5A 1TFRA 1W75A 3SS9X 3TPCA 2V3VA 2CGEA 2JIPA 3PNKA 2V9CA 3I9KA 3IOBA 1XQXA 4PFKA 2VPYA 1Y33E 3MWDB 5KX5A 3ZWXA 5IJWA 3UFXB 4MQMA 1EIZA 1M5UA 3PGXA 1FDUA 1VTKA 4O59O 3S2IA 1NDQA 1N7JA 2A67A 3LO8A 3EGVA 3A27A 3VPHA 2PQ2A 1YBVA 2PEYA 3OPYI 4MHTA 1CFZA 1OLOA 4B4OA 1FVFA 2GEVA 2LNDA 2QQEA 4LHXA 4YB8A 1NJ6A 1XGKA 5G41A 1OV4A 2GM5A 4UE3S 5DCLA 1GY8A 4MPTA 1K88A 4RTMA 1RM5A 4XTRA 5F3DA 2HM7A 1HDYA 4BN0A 1YCHA 2Z51A 2OK8A 3GLHB 3JALB 3OMWA 3P97A 4TL6A 1O58A 2YWHA 3VYRB 1JEQB 4YR9A 3PTAA 4OU4A 3LT5A 3TJZA 1KKUA 3R44A 1O94A 5F73A 2F3QA 2R97A 3R76A 1CR4A 3WIOA 3GLHE 2REBA 3NPAA 2IPOA 4IIXA 2C31A 1SOVA 2VJNA 2YJGA 3L6EA 3INYA 1A5SB 5DIZA 3WWYA 4FMCF 2Q4DA 1JQBA 2WZDA 4PIVA 5EQDA 4RQBA 2YJ3A 2A9QA 5JJKA 4XYBA 1C8LA 5K4AA 1NQVA 2Z09A 3OOHA 2Q41A 4JJEA 4DA9A 3OZEA 4DGQA 2C7BA 4JP3A 3RKUA 2VYND 1QS0B 1YA8A 1PW7A 2QZ9A 2X5XA 1T9GS 2QE7A 3WGVA 3OOYA 4PPYA 4IOJA 3SBOA 3DLAA 1QIHA 1P0CA 3DBRB 2HBQA 4L6AA 3EEOA 2G4LA 3KETA 2JFFA 2YWRA 3EISA 3JV7A 3AXTA 1FLOA 2B8TA 2W2LA 2WYHA 4NBVA 5KI6A 1A9XA 3C2QA 3MRSA 4BO1A 4DA6A 4H6VA 3A70A 4G8BA 2FQ1A 1Z0DA 1GRVA 4MKIA 5H82A 3BXFA 4BNNA 1TECE 4KWCA 1GYRA 3A1SA 5EIWA 5JJLA 1PE0A 3AK4A 3PEUA 5YASA 4RO0A 1J00A 3DTNA 4WOCA 3H1EA 1NXTA 2ATCA 3BXZA 1A9RA 1USKA 3DOFA 2I29A 5K99A 4IG4A 3E0XA 3AUKA 3FR8A 5EZQA 1YZUA 4X3OA 3ESXA 3BL6A 3HDTA 4NZMA 3WAGA 1J9GA 5L9AA 4DC0A 4KJZA 3QA9A 2YV5A 4FZJA 3KQLA 4JJIA 3PRHA 3RLIA 3N2ZB 3FNBA 4L85A 3A1CA 3SZRA 1L7BA 4EY4A 3AI1A 1E1CB 1L7AA 4F0JA 3VSAA 1PWYE 3WK4A 1VG0B 4B7AA 2AKAB 4CNQA 3UT0A 2CL5A 1A7UA 1XK7A 1PJLA 2G72A 1P0MA 2VPTA 1LBSA 1VM6A 1Z26A 2AE2A 3Q11A 5AI5A 3UAXA 3AB7A 3W7AA 5IT9A 3AEXA 3QITA 4LI0A 1XMOC 2B94A 2OGWA 4XIIA 3DLIA 5FPTA 1S8FA 4UU7A 4DDTA 3AZPA 1E98A 4MR9B 4AIRA 1PV1A 5BV7A 2YINC 1LD3A 4EMBA 4R0VA 3NT4A 4G9GA 5JVDA 5DBIA 5EFOA 2F1HA 5DP1A 4B6FA 3MOGA 1I7LA 1E4YA 3KG2A 1QZXA 1GPBA 3GRCA 3EXEA 2NN3C 2Q9CA 1X7GA 2XRMA 1Q1GA 4L4XA 2QQ0A 1RXSA 2B1QA 3VGPA 1M0WA 2IHUA 3LSTA 2C3MA 2ZCUA 4WOJA 1N32C 5JMOA 3LF1A 2WHQA 4W82A 1RQLA 3R5XA 4IS3A 2FFQA 1RC1A 5DMXA 2FSSA 1C2TA 1GAQA 1XYGA 1T5HX 2YH2A 2W9XA 1YZTA 4DS3A 1BHQ1 1DBRA 1XRNA 2PYDA 4CI0B 4QM6A 2Q62A 3F4LA 2FPPB 1YDEA 3WKEA 4CF7A 2G1KA 5L3QA 2WVHA 1GTZA 2EZ9A 1IHOA 2QD5A 4H7HA 4ZARA 2IHNA 5HSGA 4N48A 4GEKA 3WL5A 2EJCA 1F3OA 1HDZA 1RLJA 1EVZA 4E4YA 2DT8A 2HNKA 3GJ6A 3U3ZA 5EJFA 5L7YA 3U7HB 3MCZA 4HF7A 5CURA 1OILA 4DR6C 3OFVA 2VWPA 4N6NA 3Q98A 3DQPA 3KXIA 5E7QA 1D0SA 3ILHA 2GLXA 3Q12A 1NTOA 1GNRA 1Z83A 1J22A 5FAXA 5IM5A 3ROEA 3R1IA 2I6GA 3OQIB 4ZO6A 3LCRA 4Z7OB 5ISMA 5BOSA 4U7DA 1MNAA 4OG2A 5AHOA 5D2CA 5CW2A 3NRJA 4ERXA 2R4TA 4NXMB 1A8HA 2H1HA 4AS1A 4DR4B 1QV7A 3PEFA 4FFNA 4UNNA 4J9UE 1U0BB 3K72B 1MA3A 2V7TA 3LKBA 2ZSEA 3N58A 1EVIA 1UFRA 4JSRA 4NY1A 3FLEA 1D2EA 4M99A 3ROZA 1BO6A 1Z4JA 2W11A 3R6GA 2QX6A 1C50A 2XX3A 3O4VA 1ST3A 1HL3A 3PFWO 2D2XA 3MJDA 4EEKA 5AVWA 4JYAB 4PAWA 2XUHA 2ZJYA 4DV6C 1AURA 1TXGA 5H68A 3T35A 4IJMA 1F4VA 1P75A 4XA8A 3UKOA 4ZEXA 1M6EX 4F9FA 4W6ZA 3UBMA 2D5LA 4B2IA 2NOAA 3SHQA 4FCCA 4DGSA 3HJTA 1P7PA 2PPLA 3R40A 4MRMA 4MYDA 5FI3A 3E7DA 4RGQA 3OZIA 4L51A 4ZAVA 5HIJA 1HG1A 1H2XA 2AG8A 3KQTA 3L8ZA 4UHHA 2R68A 1PR5A 3BB1A 1KMHA 4G65A 4GAEA 3CKMA 1U2DC 4B6RA 4I1VA 3G5AA 3GDWA 2XAAA 4U2EA 1DBSA 4V0NA 3DT6A 2D6FA 4WI1A 1WP4A 3HI6A 1ISFA 1T4CA 3KB8A 4H60A 4QUBA 4KJXA 4WADA 5EAIA 3S68A 2Z8ZA 4AKTA 3HYCA 2MR5A 1Q0PA 4ZGWA 1QIDA 1XXLA 4Y2HA 3LIPA 3QVXA 3LKZA 3USCS 1ZCFA 2RAUA 1R0CA 1TZCA 3HKEB 1Q3TA 3RTCA 1RMTA 1JV2B 3MWDA 4MRNA 3EHDA 4Q82A 1I51A 1RYEA 5FUXA 4R98A 5HGJA 4R2JA 3SMQA 3EX7C 2IPXA 5I3ZA 3PYXA 3AR3A 5EP1A 3ZDAA 3L0BA 4B09A 4B87A 2H11A 3FVWA 2X5NA 2YRFA 3GZTB 1KQNA 3GD5A 3ZZNA 4CKWA 1UBEA 4NZPA 1IZ8A 1LH0A 5JOQA 5JS8A 5K8UA 4YJKA 2PSJA 4QVKA 1MD9A 1UWLA 5C8DA 3F98A 4R1NA 1CETA 1GPWB 1AKNA 2OT3B 3MT8A 5JS2A 4INPA 3L95X 2NO5A 1I33A 3PUZA 2W6IA 3GLGB 4MGYR 4FX5A 3SLKA 2W6JA 2O5CA 1FFXB 4JXZA 1LX6A 2IZ0A 3AUUA 2R6JA 2ZP1A 2PR2A 4BEWA 1CJTC 1Y9ZA 4BXOB 1E3MA 1HFJA 1DJNA 1MAHA 1GQQA 1RXUA 3GJ4A 3KU4A 2QYOA 3VOTA 4P7GA 2R6ZA 3K5PA 4AQYC 1T25A 1D07A 3LBHA 1LBTA 1GRCA 1YZYA 5CTJA 2OM2A 4IIHA 3S2GA 3R3WA 1I0LA 5CG1A 1ILWA 2VRCD 5HZGA 4KMSA 2PQMA 4JJ6A 2PZEA 3A32A 1YD7A 3RASA 1GNQA 4JENA 1P4EC 1G16A 2B34A 2BSAA 3ZVNA 1DAEA 5F98A 5KSZA 3U40A 2QD4A 4X71A 2QAIA 2HX1A 1ZOPA 3KPYA 1U2DA 2NVUA 1ODFA 4OXRA 2VWHA 2IQ5A 1GSOA 3CEPB 3MILA 1CRZA 2E4VA 3T3OA 4LYEA 2AYZA 3GVCA 4CQMB 4KXUA 4GF5A 2C04A 3G2OA 2P30A 4LGMA 1DPGA 4TWBA 5KKNB 1X42A 1E0DA 2PRYA 3MMPA 2BFEA 4IZHA 3EZNA 1EUZA 3R7DA 3OQIA 4GECA 4C4TA 4CW7A 5K6RA 4UU8A 1OFTA 3DS8A 2ZUBA 4D3YA 4KLZA 2X6TA 3A6PC 4QYTA 1O4VA 2ZYRA 3K09A 3WL3A 4BJ6A 1G3RA 2AOUB 3EBPA 3BMQB 5TPWB 2GO1A 3NOVA 3WL8A 3CEAA 4E3WA 2FF5A 4XUCA 2HTEA 3X1XA 4ZT5A 4G0OA 5BMVA 4KI7A 3EEFA 3T3DA 4C2AA 4RMGA 1WUKS 2NT4A 3V2GA 3FI0A 3P9SA 4AUEA 1IOLA 1NY8A 1FCJA 2FDXA 2XUQA 1ICEA 2YDXA 4HNRA 3V1NA 2AOXA 2PT9A 3B70A 3O82A 4H1WA 2QU7A 5ERGB 4WS9A 5T8TA 3VNSA 1RBYA 1H5QA 1VKRA 4J3FA 2R1ZA 1MJGM 4M8LA 3L7CA 5D00A 3W5IA 4BFVA 3DYBA 4B73A 1EUCB 4L57A 1UJNA 2APJA 3ANMA 5AKIA 1PJ3A 2PRSA 1PSDA 2ASEA 2VWGA 4C30A 3TVYA 4DV2B 1IVNA 1H23A 2P7IA 2W83A 2XTZA 2JLVA 2DY1A 2WDZA 1Q15A 1UXJA 3BPSA 3ICWA 3IP8A 4UNSA 3GPDG 3SEFA 5DJ5A 1G5IA 2B0CA 3IMGA 1M8GA 2WIGA 4IKEA 3P45A 3RUCA 3IB3A 2NZ2A 1MFPA 3LJKA 3UUWA 1RPTA 3DZCA 1QWIA 1V43A 4R9UC 3W1VA 5LOVB 2HH9A 5C1DA 3PQ5A 1FUGA 3EARA 4OM8A 4ZVSA 1VLJA 1WPQA 3MYRA 4GP9A 4AZ3A 4NV0A 2ZWOA 4EJSA 5EIFA 1I3KA 3T9EA 4ZRMA 1QDUA 1XB2A 3ZYCA 4M38A 4J49A 3GJ7A 2X9NA 2HMSA 2PTHA 2Z3VA 2ZITA 4BO7A 4ENPA 4YCSA 4TL8A 3I0ZA 3ENNA 3P2IA 4E07A 2IS1A 4Y2RA 3FNEA 1URPA 3QG1A 2WOJA 4UREA 2O9JA 5EZSA 1SQSA 2F1JA 3BJEA 3U44B 2V7XA 2ZQ5A 4MKHA 1I0ZA 1IDN1 3WBKA 2EOAA 4MMYB 4F97A 2GESA 2GM3A 2J85A 3B1WA 3L46A 4ZCPA 5KQRA 1KZ9A 2GCEA 3G2IA 3CU5A 3W8NA 4WJLA 4F84A 1I7PA 2QUJA 4NZNA 3KSDO 3F49S 5BO5A 2Q0XA 1IN7A 3CPEA 5BMOA 3O1LA 1NQ5A 3ZS9A 1RYBA 2IPNA 4I7EA 2NUBA 1I6KA 4DLUA 4DBLC 5FBZA 3SZOA 1PG0A 2J0QA 2QY9A 3LYUA 1XZIA 5FI1B 2Z9DA 3D8RA 3SYRA 2KDNA 1V6AA 3OJOA 2EKLA 3D4PA 4EHJA 2FWMX 3FDFA 1C0EA 1DINA 4TYMA 1E58A 2AW3A 3OUUA 2JD2A 3HXLA 3BXGA 4TL9A 4FJ2A 4BLTA 2VJAA 4G25A 2X1HA 4H17A 4R2XA 4X00A 4ZVKA 3HA7A 1YS1X 4IWXA 3UAGA 5KX5B 3AOEA 1XKXA 4N6GA 1KFEB 1TLTA 3JQAB 4G0QA 4HTFB 1L4GA 1AHIA 1RXIA 2CZGA 4R1LA 4CCYB 1PSWA 2BFDA 4DDMA 4B3RC 3A3OA 4RJTA 3VOAA 1K6MA 4EQ6A 3EVTA 1T0IA 5D5PA 2QM7A 4R1OA 2QW0X 4HVTA 4IVQA 2X7JA 5T7BA 4IZ6A 2TRSB 2ZIVB 3BHMA 2WVAA 3B6ZA 4R2LA 3AKZA 4PY2A 2FPMA 1FDWA 5LWQA 5B64A 5JNUA 4L78A 1VFPA 3KKEA 3R3JA 2M6KA 1MOQA 4YV1A 3HK2A 5CVJA 4E08A 1GCGA 3OIVA 4E2ZA 1E3EA 1G8PA 4L0MA 4TV8A 1LV8A 2OZLB 2X2FA 3VYVA 1R12A 3BXPA 4DE5A 4RJ2A 3NWBA 1F2TA 1G42A 2YY5A 5E95A 3CC8A 4WFQA 3T5AA 3BGDA 3K70D 4DSUA 3ZW7A 1ORWA 2FEAA 3NH9A 3FSRA 5FA5A 4U6SA 2H0RA 5AJWA 2XT0A 3S5UA 3FKQA 1TYEB 2QIPA 5DVZA 3I2JA 2C9CA 4G1MB 2RJNA 1AHHA 4P32A 4Q7EA 3LBIA 3PC8A 1FSPA 2V3CC 4RQTA 5LNK6 1D4ZA 1T9DA 3OY7A 1KZ4A 3KQQA 5LZ5A 3UXHA 4F60A 4HWRA 2C2XA 3JQCA 4B6EA 3BOSA 4FXPA 4QXMA 4PZ0A 3I8SA 4E5UA 5C8VA 1ZI8A 2EP8A 1Q7CA 1FY2A 4PGHA 2WNSA 2OYSA 3CW9A 1GLGA 2PZKA 3DTVA 3N2IA 2Q3BA 2P35A 3S8YA 1H6DA 1RLOA 4POAA 4BMYA 4RPHA 3ZZ1A 1GPLA 4OGKA 2Q27A 1UJCA 3ID6C 4KC0A 5FKJA 2F64A 2WSSD 2QRMA 4FFVA 1YASA 2F43B 4GP7A 3ADOA 3MM4A 5BN4A 1Y8QB 1PVOA 5AVOA 4KQMA 4RCVA 3AF5A 1JHQA 3O8QB 4IX1A 4KE6A 4L16A 4Q02A 3WRVA 2BMAA 5H59A 4BRSA 4DIKA 5KZMB 1T1IA 2WEKA 4IRUB 1L7PA 5KNCH 2KPOA 5E7IA 3IQFA 4W8OA 3JAMA 5CXXA 5KNBH 4GU5A 4JBGA 1NE7A 5T4HA 3AF3A 3AEZA 4IMIB 3BMOB 3A4NA 5E9WA 2DWQA 1E3SA 4UUOA 3T7RA 4RL6A 4DR7B 3PNVA 4LZAA 2D7DA 1TMOA 4G0WA 1CJSA 2YZNA 3C74A 1GEEA 4L9WA 1KZ7B 5CHYA 2GR9A 4OQZA 3ZYZA 4NAVA 3OPNA 2FHSA 4D8WA 5LQCA 6REQB 3ZOZA 1IY0A 1LFDB 2OGTA 4ID3A 1U3FA 1XZFA 2FY8A 1SKMA 3ZHQA 3PXXA 4MQ4A 4HGPA 4L4YA 4NWIA 2OZKA 3TPFA 3AH8A 3P4YA 5T57A 2GZRA 1Q5PA 3FD8A 3KZNA 1U7PA 3FDIA 5DX8A 5C1IA 4J0GA 4QA9A 4KFTA 4ZO9A 3PXAA 3A58B 3LAXA 2OBLA 1FFEA 3BFKA 3UUFA 4BB9A 2GPBA 1SBZA 4MYHA 4NDNE 1P4GA 4RENA 1XVVA 3ER9A 4OXXA 1NXVA 3EDRA 4E2YA 5TIIA 5SZIA 4N5IX 2VTBB 1NFFA 3KT8A 5DNVA 5FLYA 4LUCA 3RFUA 2P1DA 1T4BA 2P3LA 4U7PB 3ZCUA 4MO9A 2JEYA 5ARDA 3STWA 4JR2A 2RBEA 5DNWA 4H7DA 3P27A 1BXGA 2HPZA 1X3SA 2JI8A 1XZDA 3WYGA 1LS1A 1R8QA 1E5XA 2PBFA 2PVSA 4R9SA 4YECA 4X0EA 3K9CA 2WWHA 4KI0A 4E1VA 3LQYA 3CXUA 1NVFA 2I7CA 4FFDA 2WV7A 4CL0A 5LQSA 4KPFC 1YTUA 4BBZA 4NCAA 1JX6A 4PLPA 3OWHA 5GOZA 1N7HA 1T5BA 3TOVA 3HA2A 2YIVX 1T24A 1P7ZA 2DWUA 2YHSA 3K8ZA 3NCTA 2FLKA 4PYOA 4U8HA 5K85A 4IR7A 2EBFX 1EYZA 4HQ0A 4OHFA 1C2YA 1YR7A 1EXWA 2JJ2A 4YRPA 1NFRA 3CBGA 2H9IA 3PCTA 1VP9A 2ZRNA 1LDEA 3WK6A 2WILA 1HTTA 2HA7A 1G4AE 2JI6A 4K9SA 3ELWA 2OYCA 2AYXA 3OMXA 2P9JA 4M0DA 2XITA 4RACA 5G0WA 5TQ0A 3JQAD 1I3NA 2CBZA 3UTCA 3MW8A 2FA9A 3IAHA 3O94A 3OT5A 1VL2A 5A1GA 1UK6A 1JA0A 1V11A 2OILA 1UZLA 3LCMA 1TKRA 4DT1A 3E1SA 5KKAA 2FZWA 1B8VA 3D2AA 1Q84A 3H2JA 3SLRA 2MIIA 2PZFA 4ZI5A 3O8NA 1NVGA 1Z2OX 5ER6A 2R44A 3CG4A 4P4SA 3AW9A 4A03A 2EJWA 3E05A 1LTHR 1M54A 2N3ZA 3AJ9A 2G63A 1KZYC 1UOQA 5EZYF 4KLAA 3FJ1A 4MWSA 3TECE 1W36C 4DUZC 2CYAA 1H3FA 2FKNA 2QL6A 3MBKA 3NAMA 3TKLA 1KXZA 3ZOKA 3QVOA 2C07A 3D3QA 3PNYA 4FKZA 4IDPA 2G5CA 1X2BA 2A92A 5IBRA 5JDIA 3LWNA 4WKGA 3UV6A 4AWBA 1A9ZA 2E9SA 4OGGA 2D7VA 3I9MA 3H9QA 3NM5A 5FUYA