3FCGA

Crystal structure analysis of the middle domain of the caf1a usher
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
78
structure length
75
Chain Sequence
PYYQWNFAPVVRGIARTQARVEVLRDGYTVSNELVPSGPFELANLPGSGELKVIIHESDGTKQVFTVPYDTPAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F1 capsule-anchoring protein
publication title Caf1A usher possesses a Caf1 subunit-like domain that is crucial for Caf1 fibre secretion
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Membrane protein, protein transport
total genus 10
structure length 75
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3fcgA00
4J3OD 3RFZB 3FCGA
chains in the Genus database with same CATH superfamily
4N9OB 3JYBA 3FFOA 5H8DA 3FW6A 4WFGD 4TUKH 5JLZB 5IQMA 1P5UC 3GSRB 5D1ZI 4NCC1 2NXYC 4P3CH 5HYJA 3VXSD 1VACA 5I8CB 4X2UA 1FIEA 3T71A 4B9FA 4QJ5B 1PTZA 1T2XA 4HVBA 5DR5L 1NZRA 5FUOL 2GQHA 1IKNA 1RI8A 1TDQA 2LTQB 3T2OA 1AZRA 3UBHA 4KMTH 4MA7L 5GS0C 3FF7A 5A40E 3ULUF 4X4YA 2EIKB 5IT2L 1FNFA 2A3TA 1OCCB 4QAWA 3IJHB 4HGMA 4K7PL 4XP4L 3ASOB 4TF4A 5E4AA 1EV2E 2ATKA 3S4SA 4QI3A 1G7LA 2GY5A 5JPMC 4LIQH 3TFKD 1XF2A 4ZX3A 4C58B 4FG4A 4LGPB 1CBVL 3GSUB 1A9EA 4HUXB 1NFDA 4EI0A 1JYNA 3O6FB 3O3AB 4PJEF 4KRPD 4IYKA 4WWKC 1JFQH 3S3DB 3HFML 2ZG2A 5CJOL 3MCKA 3IF1B 3TL5A 3BP6A 3QUYD 3TNNB 4WU7A 2ENSA 3V5KA 3QIUA 3VXSB 5CJBA 1F3JB 3FT2A 2OULB 1D2PA 1H9VA 3PNWA 3FT0A 3WEXA 4GPVA 1LK2B 1VERA 1V3KA 2CDFB 4JHZA 1HL5A 3BHBB 4NRYB 4UM8B 3RYMA 4DP7X 4DVRH 2KH2B 3QHFL 4QO1A 3KPNB 5HGHA 1XIWD 1NCDL 4YLBA 3VXNB 4LSUH 3ESMA 1X5JA 1MUJB 2JKIS 4N20A 5C0DB 1M7IA 5ACZA 1KEML 2R23B 4XCYA 4ATTA 4EIZC 4G6MH 4U31A 1N64L 5H35B 3TJHD 3L3OB 1IZJA 2X4PB 3GF8A 5ILTH 4XCEB 5EZJA 3QXAB 1TVBA 2J3SA 2QDWA 43CAA 5DZVA 5F9DC 1QHOA 1SY6H 3HCVA 3BAXA 4LMQE 1PG7L 4IGBD 3D2UD 4UI2A 4Z8FL 4CVXA 1CGTA 1F58H 3CVIH 1QSFA 3ALWA 5GPRA 1EAPB 2LFEA 5AOIA 3ZHNA 3SDCD 2W91A 4H40A 4KKCC 3Q9QA 2NR6C 3L13A 3QCUL 3IRZA 4BZ2A 1UB5A 2AEPH 4GH7B 4KRPB 2Q6WA 5F8QC 1IGIL 5I1KH 1NGPL 2X9WA 3CMOH 4XE5B 5JHLL 1UCBL 2K4WA 1J88A 3NGBC 3QUYB 3Q3GB 4BFBD 3LEXA 1QBLL 1W0WB 3VFPA 2WXNA 1P1ZA 5L8LB 1M7UA 4ZMAT 1WGVA 2M1KA 1R24A 1MJ7H 1ZRUA 1F0LA 2EUZA 5D1QE 1N3NB 2PCFA 3L48A 5D4IA 1GS8A 1JGDA 5E1QA 4U2ZA 1XIWB 3SCMA 3NJXA 1E50A 1HYSC 4EDWH 4JHVA 4U05A 4X6CF 3QQ4A 4DKDC 4LRIA 1KENH 2NY5H 3G6DL 3T0ED 2APWA 4PJBB 4YC2C 4G7QB 2G75B 4Z7OF 4DEWA 3H54A 3MOBL 3GK8H 5TE4H 1JIBA 4LLWB 2A4EA 5L2JA 4JZOA 3TS8A 2H1LM 1JGLH 1SOSA 2VN4A 3D2UB 4IGBB 4P5SA 1MIMH 3FQNB 3VM7A 2DQFA 4IJ3C 4RMBA 2PCPA 3QIWA 3SDCB 2KZ1B 3VRIA 3SPVB 4DTGL 3QWRD 1X5XA 4DKFH 2AJZB 4HJEA 4FG0A 1LO5B 2YN5A 4PVBA 1JJUA 3CSYA 4J4PD 2Y7MA 4GSQA 1U8MA 3V10A 1YSOA 4J3OF 3TWYA 5F93C 3GZKA 3HE6D 3UZVB 1FQ9C 2Z91B 3VXRA 3BUDA 5EU5A 1FZKB 1P7HL 5ADPH 3CMGA 5GRUL 2WXLA 4OJAA 2DQTH 4NUQA 3MLUL 3DX6A 3CV5A 1T7XA 3IFPA 1UATA 1AMYA 2UYLB 5LGJA 2ZNWA 3PV7A 2OR9L 4HLEA 4EBQH 4YSRA 5EWIH 3NFNB 3MRPB 2JWYA 1MWAL 3VB8A 3OR6B 2YAHA 2J6EA 3T0EB 2JF1A 2WO2B 4Y2LA 2MQ3A 3ECVA 4Y8DC 5GISL 3SD2A 1DN2A 1F42A 5IW1B 2GI7A 1RKRA 1BLNB 2VM9A 3BP7A 2Y7NA 4P5MA 5KSUA 2ADIA 2K6YA 4PJ7A 2FNWA 5ITFB 3OKKA 1L9TA 1BM7A 3U46A 3MLTB 3ZDZF 3O2VL 4Z5RB 4N28A 4LCWE 4NPYA 3VAEA 2OZ4H 5E6IA 1IQWL 2VMDA 1CGUA 4Z7VB 1NLBL 3GBLA 1OCWL 2JCCE 3MLXH 1V3MA 2HFEB 2ZYIA 3MCLL 4TNVF 1HXKA 3DURA 1BEYH 3MRKB 5IB1B 1FYTD 1D5ZA 4GBXC 2FR4A 2D2CC 3HE6B 1AXTH 4BV1A 2OMVB 4NZ8A 3AREC 4W4NA 4XVSL 3QNXB 4JHBA 1XGQB 3BUBA 5GS1A 3UC0L 2HLFD 3QG7H 4Z95L 1GAFH 1HL8A 1KPUB 1RAMA 3OKYA 1F41A 4P05A 1NGQL 1KBWA 4DPAX 2WQAA 1AMXA 5D2LB 3ZL4H 2XOTA 2EH8L 4HPHA 4D0DB 1TJGH 2ATAA 3DX9B 1OEZW 3UPRA 4W6XB 5EPMB 5SX4H 4JM4L 3APDA 4G1MA 4XNZB 2DV6A 5GHWH 4YXLH 4POZD 4ZUWA 3HPJA 1JPGB 4I3RH 4W4OA 3H7BA 4JPKH 4MCNA 1F1DA 3O9WA 1I9JH 2HTLD 4YDLC 4HOXA 2BP0A 3D0VA 1CE6B 4XXWC 4Y1TA 4APXB 3RDJA 2CUIA 1X5MA 2UXVA 4JMNA 2V37A 5EDXA 4O5LH 4WW2F 2Y7QB 1NA8A 5HVHB 4PGBA 1RJYB 4OQTL 5AKRA 4AITA 3KPSD 1GA2A 3GJFA 4MBRA 5F71A 5J6GA 3KYNA 4FLQA 1RURL 2IBZX 1OIOA 4X9YA 4GBXD 4YR6B 4J8QA 2W94A 3E8UL 5E94A 2PABA 3KXFA 1FYTB 4EUPG 1MJUH 3CNKA 3QWQB 5EBWB 2P4AB 1VFBB 2GB2A 3WEAA 5IHZA 4MCYB 2WN3A 3REWB 4GQ9H 1EJ8A 4X98B 4ZNEE 4V2CB 5EORH 1G7IB 4N6QA 4NM8H 4R90H 5DEGB 4FE9A 4DCQA 5IB2A 3ABMB 3VFGH 4U3CA 5DD5L 2P8LA 3PCYA 5F7UA 4CW1A 1VJSA 1TJXA 1YVLA 2PP8A 3HHMA 3MODL 4UTAL 1KT2A 4JDVB 3OJVC 2HX9A 4FQXA 1PX8A 3SYOA 1KTLB 3HAEG 4LFHG 2LQRA 1UYWH 2PO6A 3GBDA 3PP4H 4MJIE 4NN7B 1JNNL 3QW9A 4JFVA 3A47A 3S34L 1HEZB 4P5KB 5IFJA 3AAZB 3OKOB 4OLUL 3ULUC 3SYQA 5EF3A 4YN3A 2MTPA 4X5LA 5AB0A 3EBAA 3DX8B 4XBEH 1A3LH 2Q3XA 1N12A 4H8WC 3KPSB 4IIQC 4FP8H 5C0JA 4B95C 3KPLA 3H7LA 2FVNA 5LDSA 4FKKA 4GBXB 4TUJA 2YC1B 2FO1A 1UOWA 2YPKA 5AFAA 1U36A 4Z76A 5I1HH 1QMUA 3GSQB 4X6DF 1XCTA 3RFZC 4OZIA 3ZLQC 1WYJA 4FNRA 3UGEA 1LMKA 5TK2A 3BJ91 4J12A 4RGMB 5DHXB 5AQ0A 2RH0A 4YAQA 1JHKH 2IH3A 4Z3IA 4IRSD 1DLHA 2VZSA 2EIMB 1DVFC 1PCSA 2ISDA 1KG0B 3HZYB 3MQIA 4TOYH 3OSVA 4OCNC 1FIGH 2EDBA 3D2TA 1UM4L 4AT6A 2ARJQ 3A6CL 4JFUA 3AG2B 4WUUE 1BQHB 4UT7H 5DJAA 3I6LD 3HS0B 2FTAA 4JFHE 2Z93A 3NTCH 2DYPA 4XP1H 2IWGA 2DJUA 2Z7UA 2CJSA 4P5RA 2I9LB 4OKVA 4ZDHB 2CLRB 2YRBA 3KR3L 1IB5A 1IQDA 5EUOB 3KJ6L 4GRWB 2P47B 1Q9WA 1EANA 3GS0A 3EJZC 3O41B 5HD8D 2WCSA 1QUNB 1K6QH 5CN3A 2FWSA 4MCMA 3GI8L 3AQDA 4HUWA 2PR4L 3G04B 3ECQA 3I50H 3MCG1 3P9MA 3D69A 1S5IL 1OW0A 1N6UA 3ULUL 2XG4A 1SXAA 3AABA 4S1DD 4XODA 3MJ9L 4MB4A 3F01A 2L3BA 5FYKD 1IT9H 1WBXB 3L2MA 3NBNA 3DOIA 3LKSA 2R0ZH 4N2GA 1H8NA 1TZHA 2WMPB 3P02A 4IRSB 3UAJC 2H8PB 4F7TB 4ZXBA 5CGMA 3GM8A 4KK9C 4LOUC 4LVOC 4WTZG 3H4HA 2IDFA 3VGHA 4XMTA 1S9VB 2D0HA 3I75B 3H6JA 1E9PA 3DBXA 4ODWB 1REIA 4X5RA 1E5AA 2OP4H 4JVPA 3QDAA 1I8MA 5IMMA 1MNUL 4GIAA 3ZKQD 3TESA 3GGWA 1TR7A 2IDSA 3QSKB 1SOKA 2DMBA 4FNSA 2EH7H 1Y7VA 2ZE0A 3ASWA 3BEWB 2NUTA 1IGML 2IDTA 4BCZA 4MXWH 3LEYL 3DHJA 2X4QB 1JG9A 3C5JA 4CSSA 4RMRA 1NDGA 1IIKA 5J8OA 4O51A 3H0TB 1QI4A 4NKDB 4NLHA 5E03A 3WHXA 2GBUA 3E1F1 5DGRA 1SVZA 2CO6A 5J12C 4L2LA 4UT9L 5BOZG 1A7RL 2GG1A 4LHJB 1PY0A 4J8RA 5EH1A 4FD0A 3O2WH 5DGQA 2D9CA 1ZOXA 1CD1B 2FHCA 4QRPE 5DYOA 1HTYA 4ZMTA 2X87A 1LILA 3FCSB 1U2YA 5H94A 1HIML 1OT4A 1RH8A 2Y3NA 4L4VE 4XNUH 1U8LA 3QDHA 1LL1A 5CZXD 4FXKC 3ULSB 1IX2A 3QWNA 1SM3H 1CFMA 3ZT7A 4ZX4A 4XC3L 4UQ2B 3CVDA 3KWUA 2XWTA 4J3OC 4LLDA 5HHOA 4M6AA 5C6WH 1MFDL 4GFTB 2QEJA 4MNHA 5B8CA 4U0RB 4HZ1A 5E2UH 4JANA 3B2UC 2OA9A 4FFYH 1QKZH 3VSVA 5DMJB 4NBZB 2OTUB 3TBYB 3ZIMA 4XVJL 1MLBA 1QO3B 2FSEB 5D5MB 4KZCA 4S1SH 3LB6C 3L1EA 3COOA 4O02B 4QTFA 3WU1A 4XHJD 3OQRA 1H5BB 4JAMA 2XXCB 4YDIL 3ZTDC 4KH9A 4UTBA 5L0QB 5A7EA 4BZYA 3AS0A 3ARGC 1SYVA 4HISA 5B3NA 1NFKA 1QEXA 3IJYA 1XCWA 3U6RB 3F62A 4K7PX 5KANG 3MRDB 1E6JH 4M1GL 5JIKA 2IFFH 3E38A 1ZHNB 2N56A 4K94L 5DCCA 1Z9NA 2BOLA 3GNMH 3LNEA 3CFMA 5GGUA 1QLEB 4ONGH 1AY1L 4ZTOH 2LT9A 1FO0A 4J3VA 5KSVB 1Z5HA 2IPUK 2CBMA 3F6IA 1WBYB 2X2YA 3L8QA 3NIGF 2VLLA 4G5AA 4OGYL 4YHIB 2FL5A 1VEPA 3FQWB 3H9ZA 5GS2H 1Z1WA 4MZIA 2MQCA 4ODHH 1WLHA 2DWTA 3K8MA 5TF0A 4H1LA 4AK1A 5FYLE 1V5JA 4MJ4A 1CGVA 5MEQB 3QFDB 1E42A 1E4JA 3BCFA 4OIFA 2A4CA 1WBZA 3NRPA 3ERXA 5IFAH 2F1EA 3HLAB 2YGPA 3GSNL 1RIHH 1BPLB 1AFVL 4HKJA 1X9RA 4YBLC 5ICUA 3VFUA 4IRZL 3VE0B 1E65A 4CGTA 4JM2D 4WVRA 5LCVH 5CFHA 5IV2B 1IEHA 1PG7X 1MSPA 3QQ9D 5FM4A 3N41F 3OLDA 2R2EA 5GJSH 1JXDA 1YUHA 4WW2C 1F00I 1L6XA 3PNRB 4KRLB 2D7OA 2WAQA 4R7NB 3FO1A 3L81A 4F8LA 1HKFA 4FNLL 2XC8A 4PJXE 2O61B 5I6KA 2X4NA 1MHHA 3VMOA 3LIZL 4A1RA 2AK4D 4Z3HA 4PWJA 1E5ZA 5C09E 1EFXA 5TQ2H 2H41A 4P2QA 3EOBB 1FZOB 3MRHB 5INCA 4QF1A 2I25N 3DK0A 2EVGA 3WKYA 5ACLA 5K59F 3C5XA 3RX8A 3BGAA 2DRUA 1KBPA 1XVSA 1HXMB 4WI6A 3TURA 3MA9L 2YD0A 3EJTA 5KVGE 2K6ZA 2VJ0A 2WKOA 4NWTL 2FJHB 5IJBC 7FABL 2XPGB 4NQDD 1B90A 1P5UA 3UAAA 3H3PL 1R3JB 3S37L 3QDGA 1BBJA 3DX7A 4WV1C 1J8HA 3DI2B 3GZQA 4I9XA 1LQSR 3L4CA 4GEIA 5DC2A 2DM2A 4JM2B 1AGFA 4WI0A 2DLTA 1RU9L 2CD0A 2OMYA 2AQ3A 1Z5YD 1PU0A 5EEUA 2VDKL 2E9JA 2VW7A 4IJTA 3OKLB 3ARBA 2C9PA 4L4TE 4QRRD 3G5XB 3JXAA 1SXNA 2DYSB 4KNUA 3FUMA 2F15A 1FNGB 4U3XA 2HH0L 2MQGA 1ZTXL 4L9LA 2FIKA 2AXWA 3NRQA 3TIDB 3QT2A 4DF9A 2IQ9H 4KI1A 5B39B 3ZUNC 2J44A 1Z0MA 3SHSA 3OTTA 3WOVA 5EU6A 2BS9A 2IAMC 5AW9B 4OGAC 5DVLA 2AK4B 5JHLA 4IDJH 2A6JA 1JGEB 5EBLA 5FUZH 4XAWH 4NZUL 1J10A 4FEMA 4MS8D 4X7SH 5HGDA 1AE6H 3SPGA 1H3UA 1IEAA 1ZLVH 3N9GH 3EJYD 3W5NA 4JFXB 2HRLA 5CP7A 4PAZA 1GMEA 5FB8A 1ZVNA 5CBEB 1K8IB 3S5LG 5E99L 4BKLA 4PRPA 4JLRB 2E9WA 2EKJA 3J27A 4NQDB 5I5RA 2XTLA 1FCCA 2EDFA 5DFAA 4BFGA 1S3KH 1NL0H 3G6JF 1XCQA 3Q44A 1JOIA 4KQ3H 4JY4A 2A74B 5DU7A 5KVEE 3IDXH 3DRQB 2Z7WA 1INQA 3M46A 1V54B 3WD5H 5J5EA 3VRLE 5JIQA 1JPSL 3HHSA 1MW3A 4XVUD 4QRRB 5I19H 2PLTA 2AEWA 2CA3A 4JMXA 4EO5A 5J9PB 3LKNB 1TLMA 2EDQA 2AQRA 1KIRB 4HUNB 4TLTA 4LEXH 4OZHF 2EE2A 4W9EC 4B6ZA 5CIPH 4CJ0A 5GGSY 5C0AA 3JUZA 5E2VL 5I1AB 1ZLSL 3DARA 4NO5A 5DVKA 5HHNB 4HPOL 1KN2H 5BZWB 2Y07H 1J5OL 3P9LA 3V0VB 4Q6YA 4BFIA 4CVZB 4PJGE 2CNYA 2WWMC 2AS5M 1R3HB 3DHMA 3D0LB 2IGLA 3SGDI 4AYGA 2YGOA 5L88L 4FG6D 3O11A 2E27L 1F86A 2MNJB 1IBGH 4OCXH 2NW2B 1URIA 4X4KA 1HT6A 1JDDA 2HSIA 2WXIA 4N2EA 4XXCA 5DQJA 2C3VA 4JFYB 5F6HI 3BUPA 3GMMB 4Z7NE 2IFGA 4FQQB 4JZNB 4GOSA 3IMSA 4E9LA 4N2HA 2NY2D 4JO4H 4U1LA 5AZ2L 4HEME 2YKKA 5HYJD 3DLQR 5H2BB 5HDBE 2NQ3A 4IMKC 4Z23A 3KLAB 4Q4IA 1PAZA 5T5FH 2ITDA 1FDLH 2VDPL 3E9UA 3KEHA 1KGWA 4MMZC 1MFMA 4OSUL 2V8MA 4N1HB 2OMTB 5GRXG 5C7ZA 5JW3L 4MB1A 4P5TC 3RVUD 3VXME 4KITB 3ZYJA 5IOKA 1UZ6E 2KERA 3GS4A 3E2HC 2K3TA 4MAYA 4QHPA 5KTEL 2EXYD 4J23A 1KJ2H 1V7NH 4MD5B 3ETTA 4M61A 4NENA 4WKZA 5MHSE 4JKPH 2TAAA 5D2NE 1V3JA 5C6TL 2CGRH 1IGJB 4L1DA 2O5YL 2B14A 5AL0A 2QKIC 1IFRA 3CZEA 1OF2A 2BRQA 2VUYA 3RPBA 1DO6A 4X6EB 4PWEA 4UV4L 3V4PB 4WFFE 2FGWL 4Y9GA 5DJZA 3RWCA 1BF2A 2XV0A 5CWSA 2Y24A 1F4WH 3UP1A 3V4VL 2RMNA 3RPIA 4BFKA 2Z8WC 3R8QA 2VWEC 3ZBMA 3RA7H 5CINL 5KBNC 5E9DA 5LN4A 3HVDA 4AKPA 4O4YH 2YQ2A 4YUEH 5EEVA 2NY2B 4XO3A 3QISA 5HYJB 1ES0A 3FT9A 4DAGL 1UJ3C 1VACB 2LU4A 1WTGT 3M8OH 3IVKB 1TYEB 1FFNA 2GTWA 2YK1H 4BQ8A 1BAGA 4DESA 3DK2A 3BKYL 2DQJH 4JFWA 5CD3A 3K8KA 5KSAA 3FQTA 1H9DA 1ORQA 2Y2YA 3RTLA 5IB5A 1F4XH 2MNWA 4OQTA 3ZRCC 2X40A 1M57B 2YEZA 4YX2H 5IY5B 2ZXBA 4LHUG 1W0VA 3Q6GH 2W9EH 2AF2A 3MV7E 4GG8B 1LWRA 4QXGL 4U1KB 4JFTA 5AW5B 4YSSA 4X4YB 5CZVH 1HHGA 1IGFH 4ZQKA 1TTFA 1MHCB 1VGEL 3BPLC 5D7EA 2UZIL 2EP6A 2XXFA 1AHMA 2ATKB 1RQ5A 3S4SB 1G7LB 3CXDH 3L1OH 4WJ5A 4X6FA 1QSFD 3T2NL 2FYVA 1XF2B 1T6WA 5BV7B 5LBSH 1A9EB 1NFDB 4KO7A 4BIKA 4AJVA 4AGLA 4I1RA 4NGHL 3ZYOA 2G3ZA 2VXTH 1RFDH 5I1GL 3SDXB 4DETA 2OX5B 4D9RD 3MCKB 2ZX6A 3LH2L 4NI6A 3BP6B 3CSBA 4WU7B 3V5KB 4O58H 2YUZA 3FT2B 1C9SA 4PRNB 1A7OL 1AIZA 2OXHA 3PNWB 4U1NA 2H6OA 3TTYA 3X13A 3NZSA 4DEPC 2AC0A 3NSJA 3GUTA 5D1XA 3EOTL 4MNQA 2XX0A 3QRLA 4P2RA 5KYWA 3DECA 3WN5A 5I8KL 4UYQA 4QO1B 4ZOEA 1KCUH 5HGHB 5A2AA 3SCMD 3WLBA 4C57C 1TZGL 1WPCA 3WNIA 3K72A 5LAXA 4S1QL 1M7IB 3T1WA 1QFWM 5AVXB 4TQIA 4WKXA 2FJUB 2IPTL 4Y2DC 1QEWA 1O5DT 1WAAF 5EZJB 1TVBB 4QY8A 43CAB 5LG1A 1AI1H 2AXHA 3CQQA 4CVXB 4G7YL 5F7MC 1QSFB 1I8UA 3Q2WA 3N04A 2A99A 1YEJL 5A2IH 3QIWD 4OI8A 2E5EA 2YSTA 4LAQL 1UB5B 1EHNA 1EUTA 4KKBD 4ZOBA 2XBZA 2WQ8A 3PFUA 3RU8L 3NDYE 2I60L 2YAEA 2K7QA 2Q6WB 1K2DA 3IAGC 4NAJA 5K5YA 3GJFK 4WCYL 1KGCD 2E74C 3FAXA 3ZSTA 4LQFL 4OM1H 4Y89A 1GSMA 4DJMA 3LEXB 4XNXL 3VFPB 2AI0H 3VXRD 1IKFL 3LZFL 5HYSG 1P1ZB 2O26U 2DTMH 3EW3B 2BVYA 3IM1A 1R24B 1OD7A 1WF5A 2O6EA 3UTTE 4YHYC 4Y5XA 3CQPA 3MGOA 1IE5A 2L04A 4I88A 4P3CL 3SCMB 4TKWA 1HCYA 2CLZA 3WS3A 5T1JA 2GKIA 3FCTA 1MHEA 3QQ4B 4PY8I 5TPWL 4OUOA 2EE9A 5ANHA 5DZPA 3Q8AA 4Z7UF 5CUSH 1PZDA 1N68A 1JYWA 1G9EA 2WHVA 2PWGA 2UZXA 3RQ3A 2KL6A 2YLKA 1WS8A 5L2JB 4JZOB 4KMTL 1CGSH 1S7RA 1PKOA 5IFHL 2GBVA 4GIOA 3DGCR 3BFQG 2DQFB 1ZSHA 1R3LA 5I6NA 2PCPB 3PL6C 3QIWB 3VG0H 4UOZA 3VRIB 4UV7H 3DXAE 2J6WA 1F3DH 2V33A 3D9AH 4QXVA 5E1IA 5E6ID 4HMCA 4UINH 2WKLA 1EWHA 2O30A 3CSYB 1CLYH 4LIQL 2D31A 4Y4FC 2R7EA 1ESOA 1U8MB 4HS6A 3MUY1 2IH9A 3IDYC 2NY3C 3VXRB 1A0QH 1A4BA 4OLVH 4HXAH 2H0EA 1DVFA 3WYRA 4NC0B 1DBBL 1LP9F 2DJ4A 1JFQL 4CILA 5I6LA 4A7VA 4TN9A 3DX6B 3MGAA 2X4SB 4PN6A 3IFPB 2EO7A 1S3RA 1DQTA 2GC4C 4YSDA 5LGJB 4KDWA 4I3GA 2NY5C 4UT9A 2IOMA 2EICA 1TEYA 2N59A 3QAQA 4UOJA 4E9YA 2E7BA 4DVRL 4AUUA 1DJHA 2C9UA 3O9WD 1ET7A 2Y5TA 4LSUL 1JL8A 3BP7B 5KSUB 3IE4A 3FB7B 4K9EL 3OKMA 4XB8A 5IVXF 5DF0A 2ADIB 4PGEA 1N5YL 2P8PA 4PJ7B 2F0CA 4G6ML 5INDB 2ITFA 3U46B 1E40A 4LRNH 1OGAA 2IANA 3BT2L 1D9KA 4Y4FD 5E6IB 4WWPA 5I2IA 1WTLA 3UJJH 4MJHA 1CQYA 3VGFA 1F58L 3CVIL 1J9QA 3DURB 3M7FB 2OR7A 1T1WA 3D4YA 1KJVA 3KXFD 1OXYA 4WI9A 3C2AL 3ATFA 2P26A 3EJJX 2P28B 5D93B 2G30A 2FR4B 2B20A 4IBZA 4DP4X 2AEPL 4JS7A 4NO0A 4ZMZA 1FL3B 4EOWH 1RUMH 2NQDA 2VXUL 3CMOL 4WJKB 5GS1B 5I1LA 4N87A 5KG9A 1CK0H 4Y5YC 4C54A 4AE1A 1Z9SA 5I6XB 1K5WA 2VLME 4JBSA 3U9PH 1AQKH 4CBPA 3VXUE 5G5DA 2ESVA 2ZAGA 4LE8A 1JPTH 4BKTC 3UPRB 2GFBA 2K8MA 4HC1H 1MJ7L 1U0QA 4G1MB 3B1UA 4FQXD 4AMKH 3NH7H 4MZ2A 1QSVA 3HPJB 4ZUWB 1R6VA 3JWNG 4ADGA 2H32H 1X5ZA 3H7BB 3HBGA 3ARVA 2AP2A 1I1CA 2LE9A 3O9WB 2BP0B 3D0VB 4H20H 4K3EH 5E6YA 3UGUA 4EDWL 2VSKB 2J8UF 2Z65C 1KDIA 1T1YA 2DF3A 2NY5L 3M07A 3F58L 5JQHC 1Q9OA 3A24A 4K8RD 2AABH 3RTQA 4PGBB 5FR3A 1GKOA 2XNAA 3QFJE 5EBMA 4Y4FB 1S8DA 3GJFB 5FYJL 4EUPH 5J6GB 3GK8L 2XXMB 1DFXA 3KYNB 2AVGA 3MJ6A 2BHUA 4KQ4H 5TE4L 3U30C 4DOHE 1JGLL 2EVIA 3GXNA 4JQIH 2WNGA 3CIQA 3GMNA 3PXJA 5E94B 2APTA 3KXFB 1VZHA 1ZEAH 4FA6A 2OM5A 4I87A 3S37X 3GSNA 2QADD 5IHZB 1MXGA 3CVBA 4KXBA 1J1XL 3UBGA 1TSHA 4GRLC 5MERA 1GH7A 2LGNA 2C3GA 2H26A 3UJIH 3LVEA 3CXHJ 3I3DA 1KB5A 2JCWA 4DCQB 5AVUB 5IB2B 4I1PA 2P8LB 5HVWA 4YDNA 4CW1B 2HG0A 3LJ3A 4UYPA 4ZMYA 2BFVH 2VDMB 5ADPL 4FA7B 3EF4A 1KT2B 4FQXB 1KGUA 2DQTL 3VI3E 1PCXA 2PXYA 2WN2A 2DIJA 5DFWH 1AAJA 1NFIA 1HHIA 3GBEA 5FB8B 1G7PA 2ZOTA 1KYOJ 2DLIA 3AY2A 3IDIA 5IFJB 3LIZA 4EBQL 5EWIL 4TV3A 4BBWA 1TFHA 1UWYA 2DYPD 4P3DB 1EH9A 2H1PH 3C6SA 3BW9A 3PWLA 2CDGA 3PE9A 1J18A 3II2A 4X4ME 4YSTA 1JUFA 1HQ4A 3NUKA 5C0JB 2P8MA 4LQ1A 3KPLB 1H3PH 4JFDA 5DEFA 5KVFE 4A2LA 5KS9E 2VCOA 3QE5A 3Q2VA 4TUJB 1FFTB 1IC4H 1AR1C 3NA9H 1KBBA 2YPKB 3QJQB 2DL2A 3KAAA 4Z76B 3HI6H 5HI3C 1XCTB 3BCDA 3QEQA 1R3KA 4OZIB 2QADB 4XNDA 3FTXA 3KPOA 4Y5YB 1RP9A 2YARA 4XPBL 4YAQB 5AVVB 3MLXL 1TKWA 2CSPA 4TNWK 3RAJH 1DLHB 4QXUH 4XX1G 5KOVC 1BEYL 2YJLA 1LDPH 3WY4A 1AXTL 2HCZX 2R51A 3V6OE 1E8YA 2FEDD 4AT6B 3HJ0A 2MRYA 1IM9A 3QG7L 1G9NH 2COVD 1GAFL 5CGYD 5DJAB 4ZS6C 3R7QA 3T6QC 5ALCH 4PJAA 2F1AA 5BQ7A 5ANMA 3JT0A 3NCFB 4LF3A 3ZL4L 1KXVC 2Z93B 4N3UA 1TJGL 2DYPB 4BK4A 2W59A 1BJMA 5GHWL 3N43F 4OKVB 2MCAA 4YXLL 3AQZA 2AJYH 3S3BB 1S6NA 1IQDB 3ARDC 3KWTA 4F5CA 1QVOA 1Q9WB 3QNYA 1J0IA 3KHOA 4WI7A 1ZA6A 1R4XA 1KLUB 3QIBC 3DOHA 4HUWB 5MENE 2BVEA 2QPDB 4N8UA 3D69B 3FB5A 4DEUA 3O8XA 4O5LL 1BG1A 5F6IC 4QCIA 2XG4B 1F4AA 1EAJA 1KIQA 3KDPB 4MB3A 4UM9A 1BWMA 3SZ6A 1NBVH 2VSCA 3LKSB 1I3GH 4XP9H 4C4KT 3K2MC 3KBFA 5HHOD 1URLA 4WEMB 5I24A 2C1PA 4P46C 3OPZH 4NI3A 3FAWA 4MZ3A 1E9PB 3DBXB 4PGDA 3VG9C 4GQ9L 2PYEA 1D5XA 2X2JA 1I8MB 5IMMB 1G7HA 4OM0H 3GGWB 5EORL 4EQ3A 2DWYA 4NM8L 4ZFOL 2YSSA 5TF1H 2NUTB 3VFGL 4A6YH 1OL0A 2KZWA 2WXFA 4DN4H 1V3LA 3C5JB 4ZZFA 2AQ1A 1NDGB 1OP3H 1I8LC 1XL4A 1OB0A 1FF5A 4O51B 4BD4A 4WY7H 1IBDA 4HS3A 3WHXB 2JKSA 3F64A 2CO6B 4RFEA 1UYWL 3PP4L 3UDWC 4ANWA 1A14H 4WFHD 3GHBH 5EEWA 1E3FA 1WT5C 4ZNCD 3LH9A 1MCEA 5AALA 5DYOB 1JCVA 2GI0A 3PWPA 5H94B 2VR8A 5FW8A 2R15A 3VACA 5IESH 4XBEL 1A3LL 1U3HA 1U8LB 4FP8L 3WNKA 1Q72H 2XWTB 1F1AA 4LLDB 4W9JC 5HHOB 3T9WA 4MNHB 5B8CB 3IJ8A 3N50A 4JANB 3K6FA 5BVPH 4OI9A 4PGCA 4M7JH 1KXHA 4ZRGA 1IO4C 2PNDA 5FFGA 1FA4A 4PJDF 3T8VA 2XWJA 4CC4C 1MLBB 1JHKL 2DIAA 4LLYA 1NMCC 2BXYA 3LPFA 4PW9A 3RPKA 1AC6A 1GCFA 3M86A 1IVTA 4JAMB 5FO8A 1UTDA 3II3A 2GJPA 4TOYL 3WNLA 4LEOA 4OIIH 4CKVX 3HZMA 1FIGL 1OTUD 1SYVB 2ICWJ 1KFAH 3IJYB 4K5LA 1KJ3H 4JFOA 2HKAA 5SWZE 4IW4C 3WO4B 4UT7L 7CGTA 5IR1A 2GJRA 3F2LA 5E95B 1F5WA 4RFOH 3QAZC 4ODVH 4U1HA 4XNBA 4B9CA 2L7QA 4FS0A 5AG8A 1R46A 5GGUB 2E8ZA 3UTSE 4RCAA 4KRNA 3NTCL 4G11A 1FO0B 4XP1L 3BDYH 1ADQH 3UBXA 4D7PA 5KSBF 3QHZH 4P49A 2FL5B 2IC2A 2L0DA 3W37A 3NZ8A 4RMWA 3WI9A 1TTBA 5C9JA 1UEYA 1K6QL 1VENA 1EFXD 5IQ9A 4R8WL 4P2QD 3I50L 3PQYA 4TULH 4H1LB 4XI5C 3BMVA 1DVXA 5BO0D 3IDUA 5T3XD 1FBIH 3OKEA 1ZVYA 2G3XA 1BD2A 1YEKH 5T5NG 2PR9A 4HCGA 1IT9L 1EBAA 4UOW1 3W57A 2R0ZL 5D7JC 1WBZB 4FJYA 4WEEA 4ZMQA 2VXQH 4E0RA 1ETZA 3HUJE 3NIDB 4WI8A 5AG9A 4HS8H 2NCMA 3PS6A 1EGJL 3VFUB 1J8HD 1NCUA 1RV6X 2ZOUA 3EJCA 5PAZA 4PWGA 5I9QB 3D48R 2FB4H 2EH7L 1QWUA 1YEIH 4JO1H 5BUAA 2B08A 3GSOA 3ARBD 4FYQA 4MXWL 4F57H 2GVYA 4LGRB 2R2EB 3OMNB 1YUHB 3CSPA 4L9DA 4R9HA 4PP1C 4W93A 2HRGA 3FO1B 2J1WA 3FKUS 2UVFA 2WANA 2X4NB 1MHHB 1IUZA 2IGTA 1T5XA 2BS71 3O2WL 3SPJA 1EFXB 4PRBA 4P2QB 1KZYA 5INCB 4QF1B 3IWVA 3QUKB 4BHUA 2ZCLH 1XH0A 2IWFA 4XNUL 2DH2A 3P3RA 4QNPE 1XD0A 3QDMA 1SM3L 1JZ3A 5C0BA 3K6DA 3V0IA 2NY1D 1VFMA 4PRPD 2NXZC 5DI8A 5FYLH 5MP6H 4LEEA 4J27A 1FORH 3I6SA 2WP3T 4FFYL 1BBJB 4QUOA 1A5FH 1QKZL 4RBPK 3DX7B 1J8HB 4CU7A 2HJFA 4OH2A 1AGFB 4N86A 4WI0B 4K7FA 2OZNA 2OMYB 4S1SL 5KVDE 4Q9RH 1PJ9A 4R5VA 4HJTA 2QLYA 4AZ8A 3ARBB 3SYAA 3AWEA 2I26N 2VITA 3N44B 1TTUA 2YRLA 4P59H 5JOEA 3ZE2B 1YJDH 3FPYA 3NESA 4NHUA 2WQXA 4L9LB 2FIKB 4RDBA 3VJ6B 5LXVA 4BINA 4JGNA 4WW1B 2QHRH 5K9KA 4DQAA 1E6JL 2IFFL 4YPGB 5ECJE 5C0AD 2NSQA 3LX9A 1DBMH 1J1PL 3GNML 1ZLWH 1HC1A 3ISWA 3T0VA 3C60A 3P1VA 2A6JB 5EBLB 4ZTOL 4FA8A 1G4RA 3ZXAC 4WDIA 1P7QA 5HGDB 5AKTA 1YG9A 4M9OA 5CP7B 2JV6A 1I7ZA 3PJSA 4ODHL 2FT6A 2NY1B 4PRPB 4XTRD 4BKLB 4JO3H 3NIFF 1KTJA 1N5AA 3TNMA 4CUCA 1FG9C 2Y1VA 2A0LD 4MAUH 2D9QB 3WFHA 3WFBH 5KVGH 3H55A 2JKWA 4HK3J 2E76C 2VN3A 4UBDC 1XCQB 5T8IA 2DM4A 1Q9KA 4J3WA 4PTTB 4JHAH 4JY4B 3F85A 4G6FD 4DO5A 5IFAL 2VT0A 3FN3A 4LVNC 1INQB 1RD6A 2FEEL 2FK9A 5K1VA 3CZGA 3OZKA 3HHSB 2VTFA 1RIHL 4Q0XH 1HU8A 4K2UL 5DVPA 3ZKMC 5C08A 4HJJH 3LZRA 3B9DA 3QPQD 4MAYD 5DK3A 5CEZD 3K71A 3KLQA 3VFVA 3L2NA 1Q1JH 2ZXCA 1FGVH 1R34A 5C0AB 1FN4A 1CB4A 1SN2A 1MLCA 5HDRA 4LCCC 1MAML 2GY7B 2HFFA 4NO5B 1ZDSA 4WU5A 5BZDA 3CZFB 4N8VA 5GJSL 4M3KB 2DJSA 4WSGA 3BJLA 3P9LB 3RWJA 4BFIB 3LRHA 1M05A 2JKXA 4UANA 3DETD 3E6FA 3IKCB 4G43A 1NOAA 2ZUYA 2FECI 3O11B 5TQ2L 3ZT6A 1MCFA 5DQJB 1OANA 3CDZA 3T4YA 4BWTA 2VO5A 1HEJC 2C3VB 4ERSL 2V2XA 2NCEA 4YE4L 3IKKA 4KTYA 2K9UA 4L2YA 1DJWA 3V6BR 3WL9A 3OB0H 1EX0A 1QQDA 2X1OA 4X7CC 2ARJA 1TEGA 4WFGE 2EZ0C 4U1LB 3U4KA 5JIMA 4G6FB 5MI0C 2WOYA 4KDTA 5IQ7H 3VXSE 4XNQA 2ITDB 3QR0A 2RA1A 5IEKA 4TLUA 2Z1KA 5KSAD 1JNLH 4G6AC 1W80A 1ZAGA 1J5HA 4XN4A 5KVEH 1T0PB 3QA3B 4R2GC 4MAYB 1TUPA 4HIEA 4QLRA 1LO4L 4TTDD 1YNLL 2D73A 2SEBA 4KTDH 2YA1A 3U36A 2XZAH 4M61B 3O2DH 2EQDA 4NENB 3PDOA 3T4AA 2Y72A 5EU7E 2J8OA 2N3JA 3KD4A 1B3IA 3AADB 2YRZA 4BQ6A 1IC7L 3KL5A 4XMLH 2CJ3A 2VE6A 3ESNA 4UIKH 2IQ9L 4AENA 3SD5A 4PB0H 1OF2B 3QDJA 4MQTB 3RWCB 2JXMA 1FAKT 4HQQH 4IDJL 5DJZB 5FUZL 4IRJC 4X7SL 1AE6L 2XZCH 3KBPA 4OCSH 1HH6A 3LIUA 3N9GL 3VYPA 3NN8A 2EZ0D 3RPIB 2RAMA 1QAWA 3T3MB 4EI5C 3IFLH 4UQ3A 4L1SA 4ABVA 2DY2A 1LO2H 2ZWYA 3TEXA 1ES0B 1C5DA 4JY6A 1TZAA 2XT1B 1BMWA 5GGVY 2GTWB 1O7DC 3L6FA 3T6ZA 3WEBA 5D1XD 5CD3B 4OF3A 4EKJA 1S3KL 1DQDH 4NZFA 1OAYH 1NL0L 3FQTB 4MNQD 1ORQB 4P2RD 2OYPA 4W1TA 5KSAB 3FS9A 3GUFA 3ZZLA 1SEQH 5IB5B 1JNJA 4KQ3L 4HZLA 4MQ7A 5CLZA 2YEZB 3L1FA 4FI8A 4QHNA 3IDXL 3WD5L 1A25A 2E9BA 3FTSA 1MI5A 3HRZA 2BSRA 3KLHC 2HMID 5I19L 3KGTA 4JKWA 1INEH 1HHGB 2EEXA 1TNMA 1HQRA 3DGDA 1UD4A 4PJBE 4ZQKB 3SGKC 3K2UL 1JTPA 1M53A 4J2QA 1F90H 4M7LH 5AW7B 2FBRA 4GAJH 2EIZA 4WJ5B 3INUH 4X6FB 3VI4F 1JWMA 5L9DH 2F9BT 2VRKA 1KN2L 4LAJH 1NOFA 4WO4A 2Y07L 2F74A 3O4LE 3C8KA 5E8PA 1WA0X 1ZXQA 2OSLA 1DSWA 4DKEH 3Q01A 1AHKA 4ZAKA 3I9IA 5J06A 2R4RL 12E8L 2GSMB 1MCQA 1I9RH 1IBGL 4OCXL 2D7TH 3SGJA 3KEDA 5DWUH 2E0PA 5IF0A 1A7PH 5HI4C 1U3NA 2OXHB 4YQXH 1KV7A 3D4ZA 2MSPA 2B7DT 1DJYA 3X13B 4QLWA 3FSVA 3FO2A 4ZO8A 1WO2A 5JPNA 3GUTB 5D1XB 5DS1A 1SUJA 3JSSA 4Y5VC 4MNQB 4BEIA 4P2RB 4JKKA 4XNAA 3OAZH 5KYWB 3WN5B 2HB0A 1ODUA 3GMLA 2XYCA 3JWOH 3WLBB 3KM1A 4DK5A 3NCJL 2APBA 3NJIA 4PJHA 5DMGC 3K72B 3N85H 1ZHBA 4KGLA 5LAXB 2BERA 2JKTM 2VLJA 2BMKA 4WEBL 4ZW8A 1FDLL 5T5FL 3LN5A 2BSSA 2FT8A 2KLSA 5EOCH 1QEWB 1LHZA 3T0EE 5FAAA 1QA9A 3VH8G 2P44B 3ARRA 4K5PA 1ZIAA 5DYFA 5FXCH 1KJ2L 1JYXA 1OAKL 1G43A 4ACTA 4AEHL 4ONFH 1D5IH 5EZPA 1BA9A 3QUZA 1M2OA 5DZLA 3B5GA 4JKPL 3WS6A 2CGRL 3CX2A 4QWWD 4TNEA 3RILA 4AUYA 2VDLL 3VRJA 2BOCA 2ED9A 3MRIA 1SOQA 4PWFA 4Z7VE 1O6VA 1K2DB 1E2VA 3QXWA 1CI5A 2Q7AA 2JKNA 2VC2B 5J3HD 2KQMA 5T1KA 1F4WL 2DMGA 2XBDA 3X1EA 2XN2A 4LT7A 2WJ5A 1G7MA 5F0JB 4Y5XB 1D6VH 1P4LB 5DMGD 1O7VA 4O4YL 4YUEL 3MGOB 4GS7C 4PY7A 2CLZB 3WS3B 1Z5LA 1DDTA 4MASA 4DVBA 3M8OL 3FCTB 1MHEB 2YMXH 3MNDA 5D2LE 3F6JA 2Y5QA 2DQJL 3C12A 3K4AA 3OX8A 4X5QA 5I75B 2F8VA 2CAKA 2XQYK 2UZXB 5IROC 3MUGA 2Y7OA 4U1SA 1GGYA 4YX2L 2YEQA 1PEWA 4PV1C 3DBSA 1S7RB 2W9EL 4PRHA 2NY7H 5IJDC 1R3LB 3I9GH 1U4FA 1U6AH 3K7UA 3U4EB 3NACL 5DHMC 2ICWA 1OGAD 2IAND 4B60A 1D9KD 1A21A 4WEUD 4UNUA 1HL9A 3CC1A 1U8OB 2HTKC 1N8OE 2E56A 3CXDL 2D31B 2R7EB 3LRGA 3ENEA 4HS6B 4YHZH 3GIZL 3WEOA 3B9VA 5LBSL 3T3PB 4MHHG 1FYTE 3FSWA 4TNVK 4HAGA 4L1HA 4NO0D 2VXTL 1RFDL 3K6SA 1DFBH 1FV1B 4U1GB 4WI3A 3OVUB 4N8PA 2GHWB 5ISZA 4XP5H 2IOIA 3GMPA 4HSCX 2ESVD 4HULB 3AG3B 3GEFA 5F44A 1PF3A 1NWOA 1ZANH 3C87A 3PGDA 5F7EH 1TZIA 1AGEA 4M8QA 5K93A 1NBYA 1KCUL 1WAAA 2WWKO 4GSUA 2Y5TB 4XOEA 3MAWA 1FYHB 5IMKA 2BCMA 4PGEB 5JMRA 3OKMB 1D6EA 5EULV 1RL1A 1AIFA 1J0ZA 5JIHA 3THMH 1VAHA 2BNQA 3RTQD 3TPUA 1Y18A 4CMMA 1OGAB 2IANB 1D9KB 5I2IB 4TQHA 1AI1L 1XH3A 3KPSE 1RZ7H 3PHSA 3Q5TA 4PVLA 1A3RL 4BQBA 1T1WB 1T2QH 2QGDA 4EN3C 1RUKH 3L54A 3CVHH 3OKNB 1NKGA 2YWZA 3OR7A 1XB3A 3VYNA 2EXWD 1XBRA 5CAYB 1YDPB 1EVUA 1H19A 1YECH 4NO0B 4F7PA 3QULB 2WO4A 1SJEA 5KG9B 5I1LB 2FX8L 2CK0L 2MQ0A 3MLWH 4OFQA 4APQC 4OM1L 1X5KA 2VMFA 2AI0L 3BGFB 4IMLA 5IMOA 3GYRA 2ZF8A 5D1QC 5IUSA 2BZDA 2ESVB 5G5DB 2GFBB 3SKMA 4JQVA 4MJ5A 4YSQA 2PXYD 1XSIA 5I23A 4Z7UA 1OCRB 2WCPA 4GSXA 2ZX7A 5FIEA 2VJ8A 4N24A 4AL8H 2YKLH 3P30H 4PI2A 2WXQA 2VN7A 4BFEA 1KWKA 1CICA 1T1YB 1YPZE 1Q9OB 1PY9A 3RTQB 3OMAB 2C3WA 3BIAX 2XNAB 3PIQA 3BVVA 5EBMB 4M48L 4URTB 1S8DB 1ORSA 4JFDD 2A38A 4AM0B 1WEJH 5EUOE 4GRWE 1CGSL 1SPDA 1X9LA 3RGVA 4JDEA 1SJHA 4P0DA 3TBSA 5HBBA 3DO7A 4L37B 3QEQD 4NRZA 2ENYA 2FO4A 1PDKA 5DEZA 4JUSA 3B2DC 3D9AL 2Y22A 4AG4L 3N40P 1EGJA 3I9AA 4UINL 5D72H 5MERB 3QK0A 2H26B 1F45A 3VFRA 5TGBA 3ABZA 4CVUA 3VQLA 1KB5B 4OZFG 3BSHA 3ZHFA 1ILUA 5HHXH 1A0QL 4OLVL 4HXAL 3FSAA 3D39A 2OI9B 1ZA3A 3WCYA 2R2CA 2V5TA 2XVLA 3NJHA 2PXYB 1K85A 4JO8A 3DTDA 2BFGA 3RBSA 1NFIB 1HHIB 3B3BA 4AYSA 3EFDH 1G7PB 4OLZH 5I74B 5IHHA 1D5MA 3IDIB 1A22B 4FTVA 4JFZL 3L3KA 3I6LE 1KN4H 1KGJA 4H13C 2WXGA 1NC4A 3WJLA 2H1XA 1GY2A 3LQAH 3SZKC 3C6SB 1NEZA 3BW9B 3PWLB 1FNEA 2CDGB 3DX3A 1JUFB 1HQ4B 3GJEA 4JKNA 2P8MB 1GGIH 4JFDB 1DQQA 3A0OA 3BP5B 4MLSA 5DEFB 5I30L 3U25A 1CFVL 3UZEA 3ZE1F 1IAOB 3S35H 2PPCA 1QTYT 1SVCP 3O8XD 1ZTMA 2QV2A 3QEQB 1R3KB 3FUFA 1BFSA 4R6UA 4LRNL 2VISA 4PYGA 1BDYA 4UM9D 1MFCH 1PLGH 1T2JA 1DVTA 3LZPA 3KPOB 3UJJL 1JGUL 1OP5H 3T0XA 3RZCC 2A9NH 2AJVL 2VDNH 3GBML 4F15C 4NPJA 2AK1H 1XTLA 3NYKA 4KUCF 5TE7L 4R7VA 5FFLA 1EXHA 5DS2A 2VDKB 1MDAA 1QFWI 1SFDA 1A7NL 1YY9C 3FBKA 4YHNA 3RIAF 3SY0A 4AQ8A 1WQVT 4MA8H 4EOWL 3N1FC 1RUML 5J0BA 3WHE1 1X7SA 3JV4A 3AG4B 4HH8A 3V7AG 3FPXA 1KXQE 5D5ME 5DQ9A 2FBJH 1N6VA 1LO0H 2GITA 4PJAB 4NQSA 3H9HA 4BZ1A 5BQ7B 1C5BL 5C0EA 2WD0A 5ANMB 1AQKL 2E7LC 1GZHC 1V10A 4LF3B 5DUPH 4OVUA 4LOFA 2CRYA 4HC1L 2GEEA 4L5FE 4LDOB 5FGSA 4AMKL 1OOWA 1UT1A 5E23A 1NEPA 2DKUA 2QVKA 5LHDA 3VGAC 2B2XH 4XMUA 1QVOB 2ZKMX 4XPFH 3QNYB 1S7VB 1ZA6B 4H20L 4K3EL 4NAMA 3RWHA 5F72S 3FB5B 2M2DA 3O8XB 3PWPD 2QJDA 4PJXF 2H2SD 2WIIA 4QCIB 4TVUA 2AABL 1U33A 1R33A 1KIQB 5TTRA 3WXVH 2V5YA 1Q0YH 3DSNA 4UM9B 4P9MH 5KVFH 4KQ4L 2VDOL 1MDTA 1QWHA 2DL9A 1EPFA 4HIQA 4POUB 4JQIL 2C1PB 4DP1X 5KS9B 1I8KA 1BFTA 1ZEAL 2E75C 3MLRH 5DJYA 4XMVA 4FL4B 4BFNA 4PGDB 3X2QB 1BYOA 1PZ2A 1MREH 4RISH 5K39B 1G9NC 4FKHA 5JQIB 2OL3L 1G7HB 1HJCA 2C9SA 2LOEA 1Q0EA 1PZ5A 2VKXA 2LLLA 2AJSL 3UJIL 2E3VA 3CZLA 2YSSB 1T83C 5AYTA 2XN9A 2DLFH 4HJGA 3T6WA 1CT8A 5AL8A 2HRPH 4GAAA 4Z6AT 2BFVL 2P45B 3FHQA 4HS3B 2EAEA 4NHCH 3TT3H 3NSXA 4RFEB 5C3LD 3C6LC 1RK0A 1XGZA 4WO0A 1F2QA 1F13A 2EECA 3L45A 2CMRL 2EKSA 2IDUA 1XEDA 3UOAB 1RXLA 5JQ6H 3PHOB 2GJZA 3PWPB 5DSCA 2H1PL 2XN1A 3MPCA 1BQ5A 1NUNB 5F7BA 1H3PL 3V4UH 5HHPA 5IUCA 2EE6A 1U93B 3B4NA 1IC4L 3NA9L 1UZGA 4GFXA 3PQYD 2WV3A 3BWAA 3HI6L 4G9DA 2AEIT 2R0LH 2X0VA 2XPZA 1I8AA 4A7TA 4PGCB 1BD2D 2RACA 4WK0B 4FLRA 4EIBA 1ZKAA 2XWJB 3MV01 2BDNH 2ZP8A 3KWVA 3O45B 4LLYB 2BNRA 2BS8A 3R1GH 3V4LA 2FX7H 3RAJL 4QXUL 2YD3A 5T1DH 4BHUI 1LDPL 3CLWA 3UPAA 1YMHA 4F1ZA 5FO8B 5LGYA 1OPOA 4DH2A 2EILB 1SJMA 4LEOB 2BSEA 3HZMB 3IGAA 4GI8A 4W9GC 4IBVA 4JFOB 1O5PA 4O9HL 2NNCA 3VRLF 3L4TA 1KXTA 4ETQA 5IR1B 1ZGLP 4HBCL 1G9NL 4UIMA 4PLNC 5DO8A 5I16B 1FJ1A 4U1HB 5ALCL 2QQKH 3F7KA 1QPPA 1HHHA 3OC8A 5EOTA 2Y06L 3AU0A 3MBXL 5CEXA 2V9UA 1E5BA 5CSZA 2W95A 2XVBA 3JTBA 3UBXB 3ALXA 5AEAA 2AJYL 1KLFA 3TVMC 1CXEA 3D0AA 5I82A 5IGXL 3NZ8B 4JFSA 5HDWA 5B1KA 5IVNA 5JIPA 3AMLA 4BCXA 5IQ9B 3P0GB 4DPBX 1AHWC 3PQYB 4PJGF 4HK3N 1S78D 3EYVA 3OKEB 1BD2B 3KCWA 3WTTA 2WW8A 3DMMA 1NBVL 3QDMD 3W56A 1CDBA 1I3GL 1KTRL 1MN4A 2ADJA 4XP9L 5C0BD 3ULVE 1B4TA 3KMDA 2ETWA 2WZAA 5E56A 5HP5A 4E0RB 1ETZB 3SB3A 3TA3A 3WFEH 3FCBA 3IXTA 2D4DA 3NMEA 4J3OG 1A4JA 4NQDE 4YVNA 3OPZL 5JO5A 1AOHA 4K4KA 3QJHA 2ZWKA 2GW5A 4L3EA 2H6UA 1KTDA 1AS8A 2CIKB 3CCHA 3LPPA 4G80A 4U1MA 5HDBF 4U4IA 5DUMH 4OM0L 5L4JA 1T89A 5AAMC 1OLLA 2Y6SC 3MTRA 4M1CC 4BFJA 2VUKA 5TF1L 5LO7A 5GRJH 3GSOB 4A6YL 5JZ7D 1YNTA 1FVDA 3D7PA 3QI9A 4DN4L 1U21A 2XQYG 2CGYA 1UZ6F 4QRRE 4KKPA 1YAIA 2P5EA 5KBMA 2F2HA 4TSBH 1N6QH 4WY7L 4AI7A 1VFUA 1VSCA 2YPLA 4XO9A 2A6IB 1A14L 3FU8A 3GHBL 4HKXA 1XB6A 1T5XB 2IO5A 3CDGA 3C60D 3CXHK 4PS8A 4HIHA 4PRBB 1CFSA 4KJPC 1P7QD 4LPWA 4XBPA 2OCFD 2BINA 1Z9MA 4NAQA 1OWRM 1QLFA 3W11D 1KACB 1MF2H 5D96C 3QDMB 1A6TA 1Q72L 1DE4A 1P4UA 2K8QA 4I77H 5C0BB 1I75A 1CF8H 5DI8B 3GXMA 4FYRA 5DD1H 1KYOK 2Y7SA 4LCIH 1M1XA 4U6YA 4M7JL 2HYMA 1MCRA 4JHUA 1T80A 1JRHH 2BVQA 2HT2C 1TITA 4QKTA 3JUYA 4IU2A 4R0LA 4X5WA 5GRWA 2NRDA 2BLFA 3TIEB 3ESUF 3HC4H 3UMTA 3PWVA 4K7FB 4HLZH 2HLEB 1XWVA 1OF0A 1OE2A 1BVNT 5GZNA 4P06A 1TVHA 4MXQD 1G1YA 1CQKA 1PVHA 1X5IA 2VITB 1QWNA 3C09B 2VZ3A 5FO2A 1BMGA 4HGWA 4NHUB 1KFAL 4G8GA 4H25A 5C08D 2WUCH 1M9SA 1KJ3L 4UF7C 5K9KB 1AR2A 2H7WA 4HWBA 4XPAH 4Q97A 3GHEH 1IGYA 3VFOA 4RFOL 2HFGL 4ODVL 3NIGB 3SGKA 3FONA 3B7TA 4LU5H 4X83A 3C60B 4PG2C 3EYQD 5TFSH 5C97A 1A6WH 2H6PA 2XHNA 1UA7A 4ACPA 4WDIB 1MG3C 1P7QB 2F61A 3QHTC 3TX4A 1SLWA 3BDYL 2GUYA 1CXKA 4R26L 1GYUA 3QHZL 2NZ1A 4H5SA 4GLRI 4QRSA 4NRXA 3NP4A 3KJ4C 1EZVX 2W88A 1TZ8A 1I7ZB 2LAAA 3PJSB 4GKSA 5CCKL 1BHGA 4M5SA 4Y4HC 1S7QA 3CLEH 1N5AB 1X4YA 3RL1A 3TNMB 1A02N 4UUJB 1FBIL 4ANKA 2BY1A 3VXPA 1WIOA 3WFHB 1XZ0A 1YEKL 5KWYC 3MNVA 3DJZA 3DX0A 1CL7H 1Q9KB 2XN0A 1HVXA 5JORA 3E80A 2VXQL 4N90D 3IFNH 5HYJE 3JVGC 1YJDC 3E6HB 3L5HA 1Q4NX 4PD4J 3MRQA 9PCYA 1OSZA 4Q58C 2X89D 2J1ZA 2CUMA 2BIPA 2QPFA 3D06A 4NCDA 5C08B 1HHKA 4C83A 5KVDH 2FB4L 3M17A 4G59C 3K71B 5D9SA 3VFVB 2EUVA 2ZUSA 1YEIL 1WWAX 2YXFA 1FN4B 3MBEC 1MLCB 4F2MA 8CGTA 3ATBA 4GKZA 2HFFB 4F57L 3BWSA 4WU5B 5BZDB 2WTPA 1UZ8B 4N8VB 5B1AB 4RIRA 3RY6A 4LPXA 4F80A 4P23C 4GYBA 3RWJB 4FMFA 5B22A 4WRLA 4MX7A 4PJ9C 1BEXA 1JK9A 3QDJD 5FX3A 4G43B 1QZ1A 1MFBH 5J11C 2ADGA 2KKQA 3AW5A 3CDZB 3T4YB 1JE6A 1H15A 4OU3A 4LLVA 4B5EA 1NFDE 2V2XB 5GRVL 3SBWA 3VNYA 4F8PA 3FQYA 2ZCLL 2NZ9C 2X4OA 4MCZA 4H0IA 3WL9B 4RWYL 2V0AA 1BCIA 2WXJA 4EI6A 1QQDB 5I1DA 1MW0A 2ARJB 2W0FA 2XBTA 2WBKA 4XMWA 5FYLL 4KUZH 4XNQB 1J5DA 4YBQC 3MN8A 3AU1A 1K5NB 4KTEH 5IEKB 3CZUB 4LZKA 4BSVA 3TZVC 1GHFH 4PRIA 1BVZA 3VD9A 1O0VA 4TTGA 3UTZA 1AG6A 1YLBB 2NDGA 2XA8L 2ZOLA 5FYJD 4P9HH 5A2KH 3K0WA 1EEYA 4Q9RL 5GGTH 1MI5D 2SEBB 1Y1DA 4Y8AA 3U36B 3DJSA 3T4AB 3PDOB 5C09D 5I1EH 1HOEA 2OTWA 4MKMA 4P59L 1YJDL 5JOFA 3IJEA 1PYWB 3DHPA 1CJYA 4EVNA 1U4EA 2VE6B 3RIFF 2QHRL 3ROOA 1EVTC 1T03H 3H2WA 4AENB 1TLKA 3BT0A 3M1CA 3QDJB 1DBML 1KELL 4RGOH 1I1AC 4XMKH 4LVEA 2G5BB 1QSFE 2JXMB 4WO4D 1DL7L 2Q3ZA 4N5ED 1HH6B 1HEHC 1N0XH 3NN8B 2QSQA 1X5YA 2ICEA 1R5IA 5IBUG 1BOGA 2P49B 4ZAKD 1I7TA 2IVFC 1IBYA 4V1DA 2FCBA 1RLBA 1ACYH 4JFQA 4HW6A 1TTGA 4D9RE 1C5DB 1E4WH 1DJXA 4JO3L 4JY6B 5A6MA 2QQQA 1DSYA 2ZG3A 5BMFH 3X3FH 3LMJH 5FUCE 5LXGH 2EYTA 5E1GA 3M1BA 1XH2A 4MAUL 4ZTEA 4UMGA 3WFBL 3D8MA 2BIMA 3JTSA 5KVGL 4QPEA 4ENED 2V6HA 1RSFA 5FKAA 4HZLB 4QHNB 2EYRA 3Q8BA 4HOWA 3GKZA 3P9WB 3HRZB 1MI5B 3KPTA 4G8EA 2SODB 2VZOA 4Q0XL 5SX4I 5C09B 4CC0A 5K9QI 3QORC 3V6ZA 4MMYA 1HQRB 1JPFA 1SQMA 5KYNA 4OCWH 1NAKH 1I1AD 3HZ3A 3EOAA 4HJJL 4KO5A 2J20A 2PW2A 1Q1JL 4H4NA 1FGVL 3AT8A 4KKLC 2EIZB 4AX3A 3B9KA 5E08H 1P4IH 1OHZA 1GRWA 2R69H 3DPDA 3MC0A 4KY1L 1UKSA 3WNNA 5ABZA 1KF9B 4F8OA 3QUZD 4WO4B 3QG6B 2IADA 2BY2A 2F74B 3C8KB 4GO9A 2OSLB 1KBGL 3EYOA 2C34A 2WB1A 3EDFA 4AQZA 4ZAKB 4YDKL 4M93C 4F9LC 5AW4B 3HNTL 4BSWA 3BESR 3SSGA 2DMHA 1LQBC 1KGCE 2ICWI 2JQAA 3FMGH 5IF0B 5T1KD 1EERB 1CGWA 3VXRE 3BVDB 3FO2B 3FRPG 4IHBA 1P84J 1PFOA 3QARA 1J7VR 3U7YL 5JPNB 3FTYA 1NCCL 5D1QA 2PKDA 3QEUA 1YEDA 4GUCA 3GMLB 3MRJA 4BH7A 3QQNA 2G3MA 1C5CH 4PJHB 1W72B 2X1QA 4HJ0D 5IQ7L 2FQFA 4YL9A 1BVKA 2BMKB 3GFUA 3LEVH 1PG7W 3LN5B 3UAEA 1DSFH 1HNGA 4XCCH 2BSSB 1MEXH 1JNLL 3WEMA 1QA9B 2EADA 3KWXA 1BOYA 1I1AB 2B1HH 3PXLA 5HHMD 3KPPA 4I9WD 4HG4J 6CGTA 3BH9B 5D2NC 4PRHD 6PAZA 1BSIA 5HGBA 4KTDL 3CN1A 1XGUA 3O2DL 2DN7A 4PJ7E 3QUZB 2XIBA 4LKXA 1YNKL 2OFQA 4XMLL 4UIKL 5L8JB 3VRJB 2BOCB 1KTCA 3GRGA 3MRIB 3LTVA 3QEGH 4JG1H 4PB0L 4ANVA 2DEYX 4HQQL 4NFDA 3TOPA 1G94A 5T1KB 1CFQA 3RGBA 5CXPA 2B5IB 1DZ0A 2XZCL 1OE1A 5IKCA 4GINA 1G7MB 2YOAA 1NUGA 3FB8A 1O6SA 3IFLL 3ZTNH 3JWOC 3GI9H 1YC8A 1SLXA 2VW4A 1UEMA 3ARYA 1JZ8A 1U3JA 4JY5L 4PY7B 5BNXD 1OTSC 2N7BA 2CM5A 4DVBB 1VFOA 1NCIA 4YZWA 4NUJA 2FT7A 3RHWF 3K6NA 1M6OA 4FFVC 3BYTA 4PCTA 3B6SA 1DQDL 1OAYL 4DUXA 3OX8B 4R7DA 3LD8B 1IKOP 3MUGB 5DZJA 4U1SB 3NCXA 4EUPA 2K7PA 5HHMB 1D7CA 2AQSA 4PRHB 4Y7OC 4YNYA 2LU7A 2P80A 3MXWH 5AZEH 1O7SA 3UYRL 2EDHA 4Z0BH 3VI4A 3GO1H 2BNQD 1T4WA 3AT0A 2ICWB 5KS9F 3ECWA 5E4OA 5C2BL 1SHMA 2DTSA 1HNYA 4KK6C 1W8OA 1F90L 1CBJA 2W0KA 2MHAB 1JGVH 1QI3A 1QBBA 2OL3A 3FH8A 3INUL 4GAJL 5A16B 2AV7A 1HI6A 5L9DL 3LS4H 3B5TA 3KXFE 2Y7LA 4WNJA 5CJQH 1FG2A 2MIZA 2Z1PA 3HAEA 3S5LA 1YMMA 3RUGB 4DKEL 1E28A 3K6SB 1E43A 4M7ZB 4KI5F 4AE0A 3MV11 4AQAA 2PPAA 3IK2A 4NFBA 1A6VH 2WY3B 3Q2LA 2J56A 5IBLC 1I9RL 2ZWNA 1YEEH 3GMPB 5DWUL 1A7PL 5EO1A 1SF3A 1UT9A 3MJ7A 3WN6A 4D7BA 3MV7D 1OOAA 3PGDB 1TPXC 1TZIB 3VGBA 1AGEB 4M8QB 3J2PA 2O5XH 1NBYB 5G2NA 5FHAH 3V9FA 3JWOL 1RUPH 3RVWD 2F5AH 5IMKB 3N85L 3RWGA 1T3FA 1D6EB 1GSKA 3U7AA 4R5XA 1CLOH 1CICD 3F05A 4K3DL 1AIFB 4AC4A 1AO7A 1O9VA 4YIQB 4MRBA 5EOCL 5AUMA 1AJ7H 2BNQB 1CDIA 5GSVA 1QRNA 3TPUB 3QJUB 5D1ZA 3S3SA 1Y18B 4CMMB 1OLZA 3F7PC 3LNFA 2Z4QA 1XH3B 2A1WH 1B4RA 2R1XB 3U0WH 2B1OA 2G2NA 1ZPUA 3N6YA 2JJWA 3MO1A 1D5IL 3RGVD 1U8KA 3MROA 4X7EC 1UASA 5ESVA 4OZIE 4PQXA 4F7PB 4XO8A 1GOHA 2FLMA 1RUAH 1SJEB 3F7VA 1WFNA 2R2BA 3VWKC 5I71B 3WDJA 3RB7A 1RJZA 4I2XA 1TCMA 4P8QA 4IMLB 1FL6A 1J9TA 2Y2WA 3MREA 3FT3A 3D39D 2Y4SA 3MV7B 3SKMB 2F53A 4GP4B 4PJ6A 1G84A 3EFFA 4MJ5B 4BELD 1D6VL 4LDCA 2EC9T 4NZTH 5DEJA 4Z7UB 4GP8B 4PSRA 2YZ8A 3OJ2C 3L4VA 2YAMA 4CA4A 3FSOA 4GAGH 1AC0A 1DJGA 1KYAA 5C2UB 4FTVD 3WNOA 1VRSA 2YMXL 4XB7A 1NC4D 1CICB 1SRDA 5H37H 5C0CA 3CHRA 5AW2B 2DQHH 3C8DA 5EFIA 3PIQB 4WTZA 1MIEH 1ORSB 3IJ7A 1EK3A 1IBFA 4RDQG 4U6VH 2WCGA 2NY7L 2DH3A 3MRGA 3RGVB 3PABA 1SJHB 4JDEB 5TH2A 3TBSB 5KW9H 2BJMH 3S9DB 2BXZA 3DO7B 3I9GL 4NRZB 1U6AL 2FO4B 5LJYH 1IRAY 4N1EA 2HT3C 1FE8H 5EOCJ 3US0A 4FQHA 3BRDA 1LE5A 3RY4A 3L5JA 3VFRB 3TN0C 4A7UA 1ACXA 2UWEA 4YHZL 5JR1L 2XZQL 4E9XA 1TPXB 3SPHA 1BZ8A 4B27A 5D4JA 3EJUA 3O3EA 3D39B 1U92A 5L7XL 1JTOA 5EC2A 4AL8C 1ZA3B 5SWQA 1DFBL 2WBJA 1T6VN 2YBRA 1OK0A 4P4KA 4U1JA 5KJRL 2FEEI 2P48B 2YBGA 1P6FA 1D5MB 1WISA 4XP5L 4FTVB 4QJ4B 3L3KB 5TDPA 1HESA 3F00A 2DQDH 5JXEC 3L7EA 1NC4B 1F8TH 3FK3A 2FDBP 1ZANL 5F7EL 3CHPA 1KCBA 1FNEB 2K0RA 5LGHL 3DWTA 2DWDB 2Y2TA 1NLDH 3BZEA 1WHPA 3DXAD 3GJEB 1NCJA 3OF6A 4RMSA 1DQQB 3B3IA 1H6FA 4I4WA 5IQLA 4LDEB 2DW5A 1BM3H 4YWGH 2XSKA 3AM8C 1JDCA 2YPVA 1EEZA 3P54A 1KJMA 1PEZA 3LCYA 1XX9C 2AAVA 2J5LB 1C16A 2VISB 3CJJA 4RSYA 4NS0A 2R1WA 3TN0D 4GRWH 4NWUH 1ZLVK 3LYRA 1RZ7L 2EE3A 3CSGA 3WIFA 2K1MA 3QUGA 2QQNH 2WZ0A 4W9CC 3HKZA 3CN4A 1T2QL 4NNYA 5HHOE 4KVCH 1RUKL 1A64A 2DQ6A 3CVHL 4JG5A 4YHNB 2FUQA 3GTTA 4TNGA 1RZIA 3SY0B 2UXGA 3N42F 1YECL 4BGDA 4KAQL 3ARFC 1CXLA 2XFXB 1BXAA 2FGZA 3JV4B 3MLWL 3QZBA 5DQ9B 3G08A 5DQDL 1GYWA 5ETUA 1ZGLM 3OZ9L 4JDZA 3EO9L 1MCHA 2XN9D 3H9HB 1WS7A 3LQAC 4FQIH 4NQSB 4XPTH 1BG9A 5FLVA 5DHYB 5J1TC 2FIRT 4P3WA 4MWFA 3QUMA 3VWJC 1KCSH 4X5PA 4AL8L 1UWEH 3DXAB 4DGVH 4L05A 2RB8A 2ZOOA 4M8VA 1EBPA 2YKLL 2WXOA 3P30L 1FI8C 1I85C 2P7TA 4RLDA 4WFHE 4GQQA 3RWHB 2O4EA 2ZF9A 3DA0A 4H8WH 3CQFA 2Q20A 5AW0B 3T8XA 2WIIB 4C55A 4YZFE 2EDNA 4RMUA 4UZGA 1I3RA 4WK2B 3WLWC 3TN0B 1F97A 2Q76A 1WEJL 1SXBA 2QPUA 4ETYA 1RZJH 4OFDA 1M1SA 5C0ND 5DVNA 5FEBA 5I26A 2J2ZB 4XMPL 5HI5D 2IQAA 2VXQA 1I8KB 1EIBA 1HKLH 1HX0A 4CDGC 2APXA 4QNPF 5DJYB 3CH1A 5FDWA 2FQEA 4NN6C 4WNSA 3BKJH 4XWOC 5FYKH 2BNRD 1PZ5B 2B39A 2NY4D 4P57A 4WSKA 4L8DA 3RNQA 2KPNA 2XN9B 2YA0A 4A68A 3NIDE 5HHXL 4HJGB 1MCJA 1CT8B 1CLCA 2BSED 3EGDB 4J2XA 2UX7A 3QZMA 2N0KA 3X1NA 3PPEA 1E4HA 3O3UN 4EE2A 3ZN6A 1F3RB 1DCEA 2VZTA 1RK0B 3EFDL 5CR8A 4O02H 3QUXA 4OLZL 4PLKC 1AQ8A 2PCYA 2GIYA 3DNKA 3IGKA 2EKSB 1KN4L 2BIQA 2NX5A 2WNWA 4JFEA 1RVFH 4L5FH 2GJZB 3LQAL 1SZNA 1CTNA 2VDQB 5DSCB 5JW5A 2DOCA 1XBDA 4PG2A 4JPSA 2EVJA 2NMSA 2X41A 3IPEA 5AVZB 2QQLH 1GGIL 4MLIA 5HHPB 4MMXC 4WFED 4LBAA 1QLEH 3BSZH 4XPHL 2F58L 3S35L 1E8ZA 3BWAB 4G9DB 4P2QE 2EO1A 1SDYA 4ZFFA 1EDHA 5PCYA 5IOPA 4B9GA 5IM7A 1MFCL 3RVTC 2J73A 1PLGL 1J48A 2RIKA 3DMMD 4KO9A 4LSDA 3WIHL 5T3XE 1PLBA 2HVBA 3K1KC 2A9NL 2VDNL 2BNRB 3Q5YA 1NCNA 2AK1L 3PJLA 3V6OC 1BVLA 2NY4B 3TA3D 2AHIA 5GGQH 4Y1SA 5E5MA 1YMHB 5FF6B 4B0MM 4BGLA 3CHQA 3QDGE 3L9RB 3W5MA 5CN2A 3IGAB 4MA8L 4LXFA 3KPRA 1NTDA 1NAMA 1J8HE 1WFTA 1QBAA 4J1UA 1KXTB 3SQBA 1YEGH 3BISA 2HRHA 1HE8A 4ETQB 4UIMB 3BD3A 2FBJL 2JJSC 3C75A 1DEEB 1U8IA 3ASNB 4HF5H 3TT1H 3GBNH 3QI9D 1DANT 3C5ZA 3CFUA 1HHHB 2ZCKL 5EOTB 4KK8D 5E4EC 2GIMA 4FLOA 4JQXC 1T4KA 2P5ED 4XN8A 3X1FA 5CEXB 3ZE2E 1JZEA 1NCBH 3I2CL 2OYMA 4G72B 2V3EA 4WQOA 1KLFB 2YPLD 1PKQA 2H2PC 2I9TA 4YE0A 3JV6A 4HYTB 3D1MC 4XPFL 4BQ9A 5EU6E 1QW8A 3SDDA 1H8SA 2C7UB 5ITBH 4M29A 4OJFH 3EYVB 3BPOB 4UWQB 1UH2A 3UERA 5FCUH 3WXVL 1XR8A 1NGXA 1FLRH 3DMMB 2IPKA 1QD0A 1J05A 4TS6A 3VI3B 1XGRA 2NNRA 4HHWA 4PRPE 1RZFH 3TA3B 3ZZSA 3IXTB 1PD0A 4FFZH 2W60A 1A4JB 2WQUA 3MLRL 5JO5B 3T09A 5IK3A 3QJHB 3D50A 1MREL 1NBCA 2G3NA 3HE7C 4RISL 4U1MB 4G80B 4AKOA 2GC7C 2XFGB 4J5VA 1P6WA 1PQZA 3OMZA 2AXJA 5GZND 3WJJA 2NOYA 1YNTB 5J57B 1FVDB 3QI9B 1E90A 2HRPL 4HOZA 2P5EB 1J1OH 32C2A 3MLZH 2PUQT 2G4EA 1YEHH 4G8GD 3SGEH 4DW2L 2LR4A 4PLJC 1FUNA 1MCWW 4NN5B 4Y19A 3V79C 4NHCL 2YPLB 1L7IH 5B1JC 1P9MC 4DP5X 5B4MC 4HKXB 4HUMB 4RSVA 1HYRC 3CDGB 5C0AE 2V9TA 4JR9H 1A47A 4HIHB 5IWLC 3APCA 1CFSB 2R29A 2GEQA 2CO1A 4XBPB 3NA4A 4MYPA 4M8RA 1A6TB 4F2EA 1DE4B 3VW3L 3VFTA 1CDCA 3CFJA 3NRFA 4KVNL 1ZHLA 3NAAL 1DJSA 4JGMA 4B7IA 2R0LL 1M1XB 4GAFB 2D7NA 2BC4A 4U6YB 4N2OA 2OMZB 1HOCA 2BVQB 1B0GA 4IU2B 2VB5A 3LV3A 4R0LB 1NM4A 1RZ8A 4X5WB 5FA3A 4AQEA 4NC2B 2BDNL 3R1GL 4GP5B 3WY2A 1A4CA 2FX7L 3WELA 4ZI8A 3PWVB 3DSFH 1MOEA 3SE3A 3TO4A 5KVMC 4BUGA 1FC2D 1JXGA 1KCRH 1MCDA 1TVHB 1JF5A 2UZYA 4FMKA 2QDVA 1DR9A 2BIHA 3BP4A 5B1BB 4QHMA 4HGWB 4G8GB 4H25B 4FI6A 2PN5A 2V9RA 3CIAA 3BZFA 4L0PB 5EHFA 3EFOA 3TJEH 3R4RA 1IGYB 2VDLB 3VFOB 4QYOA 4M6NH 3SKJL 4AEIH 5CEZE 3FONB 5CD5C 4ZMPA 3M45A 2Z92A 2H6PB 1VKXA 5CSBA 1IGTB 3RKPA 1RPQA 3P3TA 3CBKB 3S8FB 5I17B 4H5SB 4QRSB 4NRXB 1T7VA 2Y23A 5FLUA 4U49A 3DYPA 3N5AA 4NUMA 2PMZA 1S7QB 4NJ9H 4AIOA 3RL1B 5LB1A 5AOZA 1NBZA 1SMOA 3VXPB 4DFHA 4UDTA 2GJ6A 1SXSA 4LHUA 3MNVB 4XC1H 3SDAA 5DMKA 2CHNA 2ROYA 3FUJA 4MTMA 5E9DE 4A2FA 1TQUA 4C4KO 3P0YH 5JORB 1NGWA 2D3VA 1UD5A 2ZXQA 2VN5A 1IFHH 3GRWH 3WFEL 4PHZA 1K4CA 3MRQB 4PUBH 4NB7A 4XVTL 3V5DA 1B0RA 3KS0J 1E8XA 2ZWSA 4IEFA 2DIBA 4PRID 3OSKA 1M2VA 1HHKB 4C83B 2OMXB 5DUML 3DTXA 2PETA 3IJSA 2KLTA 3M17B 3QFGA 3VQ2C 5GRJL 4F2MB 1J0HA 3CBJB 4GKZB 4E68A 1T66C 3VGEA 1I7RA 2QGCA 4RFNC 5FYJU 4HCRA 1B6DA 2UUDH 2VDRL 1N6QL 4RIRB 4TSBL 3V55A 2WKGA 4NUGH 2VABA 2HZHA 3Q43A 4R4FH 4UTCA 3ATEA 1CPUA 1BQRA 4MX7B 3CFKA 4N2FA 43C9A 1EO7A 3QYNA 1JK9B 1G7QA 4I18A 4P2OA 3BKCH 1YO4A 1P1VA 3MV9A 3REVA 1NM9A 2ADGB 2CO2A 2F19H 1AXIB 5D7HA 2A6KA 4AQOA 1H15B 4Z7VF 4LLVB 1T21A 3N06B 1LK3H 4ODSH 2XWBA 3UX9B 3MMEA 2K3HA 2X4OB 4MCZB 3OWEA 3ESVF 3ZL1A 4V1DD 5I1DB 2R9HD 2CRMA 2ZJSH 4AXWA 2W0FB 3EYSH 3V4PH 5I76A 4Y0GA 2DQGL 5DD1L 4CU8A 1EA9C 5CJXA 3AU1B 4WTWA 1HE7A 1JRHL 4BSVB 5D1XE 3IXAA 1NICA 4PRIB 4LASH 4P2CG 4MNQE 1T0MA 1BW8A 4P2RE 2WYTA 3HC4L 3LKRA 1NANI 3UTZB 3WJMA 5D2LF 1I9IH 3OLIA 1EEYB 4PWKA 1S9XA 2LW3A 4R3SA 4OJYA 2RFXA 1VCBC 3TYGH 2OTWB 2WB7A 3NSYA 1ZGLA 5CP3A 1NUDA 3KGUA 3U79A 5JOFB 3IJEB 4FFWC 4KJQD 2WUCL 4EVNB 3TFBA 4ZYKA 3ROOB 3S3CB 1EJOH 3OKDA 5HDQL 5HYSA 1MVYA 3SDYH 2XTJD 1TU2A 1N8ZB 3AACA 3B9KD 3BLPX 4LU5L 2GABA 2X88A 4MSWA 5F1NA 3QC6X 3SGDH 4NOBA 4JPVH 5TFSL 3BC9A 3MZGB 3MYJB 1ZLUH 5DDHA 4IU3B 1GS6X 4Y16C 3PHQA 2ICEB 1R5IB 4NKIH 1BOGB 5TDNA 4KZDL 4XWGH 1I7TB 4V1DB 4JFQB 3NJJA 3G6AA 4IHOA 3IE9A 1IZKA 3ISYA 3IS1X 5BV7H 3MR9A 3CLEL 5I5MA 4FQJH 1Z9LA 2EYTB 3CWGA 3G9AB 3W2DH 3M1BB 3QRFM 3EGSA 1CF1A 3BPCB 1K4DA 3JTSB 4MVBD 1CL7L 4P9HC 4ZOAA 5FKAB 3GXFA 4FYTA 4CMHB 2EYRB 2WBXA 1QLRA 3IFNL 4HUKB 4F58H 4G8EB 4PW3A 3UO8B 3ZKNC 3IN0A 2LTQC 1GL4B 2FSDA 4NYLA 1MAKA 4ZMWA 3V6ZB 1RIVH 4MMYB 1JPFB 1FRGH 5KVDL 3MRNA 4TQEH 3EOAB 4A66A 4GW4A 3VO0A 2PW2B 3SOTA 4K3JH 2XTJB 3B9KB 3SIKA 2ATPA 2NY0D 2XG5A 5J89A 3T2PA 3NJMA 2YXWA 3BQUA 4KZ0A 2YN3A 2IADB 5JYLA 3QS3A 2QSVA 1BGXH 2DI9A 3EYOB 4PRDA 4FN0A 2Z9TA 3QZLA 1OSEA 1LDSA 2WC7A 4LP5A 4BSWB 3VFNA 3O6FC 4UOQA 3Q5OA 3ARXA 4B5ZA 4Y9CA 3FYEB 4BZ2H 1HWWA 4LSSL 5GIRA 3T3PE 3MA7B 3CFBA 5DJDA 4NQTA 5KN5A 4HIJA 1JZFA 3PREA 2NW3B 2C9VA 1IM3A 2A5UA 2MKLC 3QEUB 1YEDB 3SKOA 4BH7B 2OYLA 4KUZL 4WK4B 2C1OA 1TJIH 1PFCA 1BZQK 1BVKB 1NGYA 4Q7DA 4OF8A 2OMBA 4KTEL 1CYWA 2EDMA 3OZLA 4JCWA 1LGVA 5D7SH 5DXWA 1IAIH 3OAUH 1P7KA 2ZUQB 1BZDA 5IJKC 3CZSA 3LRKA 3T04D 3ZX1A 5EU7C 3V6FA 2YAPA 2J25A 4P9HL 5BO1H 5GGTL 5HGBB 1PMYA 3FU5A 2NY0B 2P80D 3L3OC 1NPJA 1XGUB 5I1EL 4U0QB 5BJTA 4LKXB 1JHLH 1KZQA 5EUOF 2BWIA 4GRWF 3E0GA 3HZVA 1ZIBA 1X9UA 1KIPB 1WJ3A 3QJSB 3ZRSA 1T03L 1OGAE 2IANE 2AV1A 3TFKC 3B5HA 3ZDYB 5DFVD 2XLLA 4PMEA 4RGOL 5CF3A 1M56B 4XMKL 3CX5J 3CK0L 4KRPC 4WHTA 1CFQB 4FQLL 3X14A 4LFHD 1T7YA 4JRYA 2E6PA 1T7ZA 1YMMD 4QOKA 2Y1ZA 5CSGA 1NIFA 2EDLA 4YO0A 5D7LA 5IKCB 3FB8B 3EDKA 1O6SB 5EEZA 1A3QA 3QUYC 4NQVA 5JDSA 4U33A 4OVVA 5FOJA 1ACYL 1RHHA 4TPRH 1IC1A 1E4WL 3K80A 3HB3D 5L4IA 3HC2A 4OTXL 1IVLA 2OAAA 4NJAL 5BMFL 3X3FL 1TG8A 4N2CA 5LXGL 1M6OB 2ESVE 1WUNT 3EH5B 1XIWC 3I85A 4R7DB 5DA0B 4M5YH 1FL5A 4M7KH 5JOPD 4E9RA 2V5SA 1GS7A 2VDOB 1AVAA 4YNYB 3SJVA 3TJHC 1OSPH 4NP4H 3VUAA 1AO7D 3S35X 4HWZA 3VI4B 1WDAA 1QRND 4LPYA 5D1ZD 4IGBC 3ZQXA 3F6LA 2VN6A 4OCWL 1NAKL 5F3BA 4X4XA 3FH7A 2OL3B 3SDCC 5E08L 1P4IL 2R69L 2AV7B 1HI6B 4H88H 3HEIB 2X6AA 3W0WA 2XICA 3STZA 1G0XA 5AW6B 4PD4K 5AAWC 3GSVA 2JJVA 3R06A 2DQEH 3L9YA 5L8KB 1FG2B 3HAEB 1ZJBA 3S5LB 1YMMB 4TSAH 4DHLA 5E8DH 1E28B 1VGKA 5EF0A 2EDRA 4AQAB 4FHBD 1SLUA 2VZVA 3SQOH 1QG3A 4JK0D 3FMGL 3HB3B 5CJ5A 5EO1B 4J3TA 3MJ7B 3EO0A 3AXLA 2F53D 1EHAA 2VQ4A 1ED3A 4PJFA 3MRRA 4ZX6A 2K9FB 4B9YA 3BH8A 4YFEA 3W9EA 2ZUWA 1J11A 3T0EC 3RWGB 1T3FB 3KGRA 3MDJA 3JZ7A 4MDRA 4QHKJ 5IIEA 1DN0A 1JWSA 4KKZA 4KK5D 3HMWL 3LEVL 1AO7B 1DSFL 5C0CD 4XCCL 2R2HA 1MEXL 4I0CC 5AUMB 3TCLA 2B59A 5LVEA 2ZYRA 1E5YA 1QRNB 5D1ZB 5GS0L 3O4LD 4UT6L 4XCFH 2XY2A 2WO3B 3WIHA 2Z4QB 3MUJA 4RH4A 1E5UI 4QTIH 2HVKA 3K74B 4FG2A 4JFDE 4LSQH 4IBUA 1TEFA 3MSPA 3MO1B 1U8KB 3MROB 1E4KA 2Z31A 2OMWA 3L95A 2DEWX 4RNRA 3QEQE 4JFFA 3AB0B 5ESVB 3U82B 4J4PC 3GJFH 4YK4B 3QEGL 4P04A 4JG1L 3F7VB 2R2BB 3MV8A 3HE6C 4WLCA 2EVHA 4P4RA 3EAKA 4BJLA 5LWYH 1RJZB 4I2XB 3VNZA 4XXDA 1FL6B 3MREB 3UGXA 5B3JE 3FT3B 5B7FA 2PTTA 4Z7WA 4OZ4A 5DK0A 3BXNA 4N85A 1V55B 2F53B 2WBJD 2F8OA 3EFFB 3GI9L 1RLWA 1A2YA 2IBZY 2OKMA 1NKRA 1IGCH 4P4KD 4XRCB 5ICYA 1E7VA 3GKWH 1VZIA 5T3ZL 5KANI 4B9PA 4XNZC 1NWPA 4PJAE 3MYZA 2F68X 2ZCZA 5ANME 4JB9H 2HN7A 3H3KA 2VDMH 1PSKH 2CRIA 3OV6A 5C0CB 4KXDA 5EFIB 1D5BA 3O4LB 3OF6D 3S97C 1F02I 4F5CE 4GUQA 2J71A 1OQOA 5GRYA 2FQGA 3MRGB 5HVHC 4U7MA 3PABB 5EZIL 3G3LA 5AZEL 5TH2B 3ZMEA 1ITBB 4Z0BL 3SE9H 5J7CC 3GO1L 1RHFA 5ESQA 3VXQA 2NYKA 3H53A 4GQZA 4K8RH 2D3NA 1BIHA 1WH0A 4HBQA 5GRVK 1LE5B 2CO3A 1SDDA 5D70H 2OPCA 3LKPA 1JGVL 3KE0A 1WICA 3LS4L 4LCYA 2UWEB 5C0IA 3RKDD 4RA3A 1OZUA 5DO2D 3LQZA 4AH2A 1TTCA 4F27A 1AP2A 3O3EB 4W9FC 3FRUA 3MLVL 3BPNB 1U92B 1FSKB 2HLFC 5E8OA 3SBPA 2WBJB 1AGDA 2EC9U 3RIAK 3CLFL 4P4KB 4U1JB 1LE9A 1PNCA 3P77A 2DLGA 4IIZA 1YEEL 5BPPA 5GZOA 5TDPB 1ZD6A 2AEQL 3L7EB 1A7QH 4POZC 5E8NA 5A3ID 4DQOL 1FZJB 4NN7C 2H3NA 2HTLC 4ZW3A 1BF8A 3BZEB 2ZKHH 4YHKH 5FHAL 3BKMH 1RUPL