3FCGA

Crystal structure analysis of the middle domain of the caf1a usher
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
78
structure length
75
Chain Sequence
b'PYYQWNFAPVVRGIARTQARVEVLRDGYTVSNELVPSGPFELANLPGSGELKVIIHESDGTKQVFTVPYDTPAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F1 capsule-anchoring protein
publication title Caf1A usher possesses a Caf1 subunit-like domain that is crucial for Caf1 fibre secretion
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Membrane protein, protein transport
total genus 10
structure length 75
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3fcgA00
3FCGA 3RFZB 4J3OD
chains in the Genus database with same CATH superfamily
3W82A 2LE9A 4H8VA 5KSUB 1GZQA 4RFNB 2AJZB 3LZQA 1MZZA 5GJSH 3UC0H 5K9QI 5CZKA 5ETUA 1E27A 3TURA 2Q6WA 3D39A 4V2CB 1CYXA 4IW4C 3VFSA 4F58L 4Z7OB 4LVHC 4Z7OE 4EI5A 3CLEL 2ZX9A 3CZEA 4GAYB 4IBLT 3S4SA 1HHJB 3T0EC 1DQMH 1S6NA 1TETH 4JHBA 2H3XC 4K73A 4Y19D 5AFAA 3VD9A 2IDCA 2WLIB 4MD5A 2CLZA 1G7JB 4Q9RL 2R4SL 3E6FB 1S7RA 2P4AB 2RH0A 5F9JB 2HKHH 4K9JA 2VL5A 2HUEA 4ZO7A 3ARDA 5CZXD 3HRZB 4AITA 1XCTA 1MCPL 4NIYE 4E9TA 1RSYA 1A8JH 2VL4A 4L3FA 2R29H 4AQAB 3VFUA 1PF3A 2BVEA 3ISRA 3IXTA 3S96B 1JTOA 1UVQB 2SEBA 5DRZB 2CMRH 3BWUF 3RIKA 1TZIB 2CA3A 5GRJH 2Q8BH 3NSDA 2HJKB 1QPPA 1SEBA 3T9WA 1S7XB 3UP6A 1MCLA 4Z3IA 3A6CL 1N59B 4WK0B 4U1NB 5I24A 1FUNA 2ATKA 3NBNA 2NW2A 5EEYA 3HC0B 3FSAA 5LGHH 2PO6D 4PJBF 1MEXL 2D03H 3IJHA 4QTFA 4PP1C 3WDHA 1Z3GL 4IOFC 3DNKA 3G6JE 3AQYA 3G6JB 2K6ZA 4IBSA 4S1RL 3DPDA 5EDSA 3GKWL 1FG9C 3DX7A 1JZGA 2EXWD 2KC0A 2VDPB 1KJ2B 3BZ4A 2JI1A 4KX9A 3KPPA 4MAYD 5GZNC 4KO5A 3IGAB 4KFMA 1PG7H 4M9OA 1KCKA 4WSKA 4BH8A 1GZHA 5DGQA 4G8GD 1RK0A 3RTQC 3KJ6L 4JB9L 4XP9L 3X3FH 1GGCL 1WFMA 4I88A 4QF1B 5AVYB 4B60A 2W9EH 2ZSWB 3AG4B 4Z7UA 5CMAA 1YECH 2IPKA 4GSUA 3U30C 1ZS8A 5JQHC 3EBAA 5DK3A 5CCKL 4LSUH 4L8DA 2FB4H 3NGBC 4RETB 1CT8B 2F8IA 5HDRA 1D5ZB 2VJ0A 4GSDH 4J8RB 1ZT7B 1Q94B 2R0KH 5DHMC 1R1CA 3BEWB 2PWDA 1SF5A 5DT1H 4MYWB 1GR7A 3HPJA 4NQSA 1C5BL 1OCZB 3EH3B 5GJTL 4Q74A 5A2IH 2VE6A 6FABL 3P4NB 3OKKA 1U92B 5CLTA 2V8MA 4RMWA 2IPTH 4NI6A 3KDPB 4UQ3B 3EYOA 3WEXB 3ALPA 3G5XB 3RWFB 4HETA 3WNOA 2CLRB 2EECA 2NY0C 3IMTA 4CSPA 2XNAA 1Q4NX 4KY1H 2WVTA 3EJSA 3VXSA 4WTZG 5HBBA 5HYJD 3AREC 2ADYA 3ZTDC 3ME0A 5ABZA 1BIHA 1P2CA 2CBPA 3CK0H 4GMTH 3UTSA 4FZ8H 3GTNA 2F54E 2F54B 1O9ZA 2X70A 3S97C 1BPLB 1WC7A 1CVRA 2ENPA 1IAOA 3OSKA 2OPCA 4MZ2A 5C2BH 3U4BL 5T5FH 3CC5B 3VWKA 1IGCL 2NOYA 3ATDA 2PCXA 3OPZH 1JHLL 1FZMB 2HX7A 4U7MA 5J13C 4YSPA 1WAPA 1HNFA 3C8HA 2J88H 2IMNA 3QDJD 4K55A 2WGXA 1UACH 4TQIA 1Q90A 2FHFA 2QQKH 4WKZB 4ORZC 3TIDB 4POUB 4P4KC 1H0DB 3GNML 4WWKA 3C5ZB 3IJSA 1OM3H 1BGXL 1P4IH 2XZCL 1LM8V 4U6YA 5E2JA 1QBLH 1S5HB 2XV6B 2YFNA 4NUGL 2JJSC 1A4BA 4LEBA 2KYIA 5LWYH 1X5MA 4BKTC 1TVHA 4KRPC 7FABH 5D2NC 4EDWH 1CB4A 3WENA 2FJGB 1YO4A 4PIBA 1R6VA 5ADOH 2G30A 1LO5B 2IF7A 4ODUA 2EUXA 4JEGB 1AC6A 4QHMA 3SZKC 1KCRH 5DLMH 4O2FB 2VDPH 3BISA 3FRPB 3DC0A 5E8DH 1F4YL 3WIHH 1JHKL 1DJIA 4NAMA 1HAWA 1MFCH 2UY6B 4LRIC 6PCYA 5D6CB 4AQEA 4Y8DC 3NK3A 1WLHA 1FNHA 2AV7B 3MV11 5HHQA 3K2UL 3JTBA 1JWMB 1H3PL 4X83A 3WNJA 2QADD 4PJFA 4JFQA 3ZE1E 3WS6C 3ZE1B 1T83C 4TNWF 1WPCA 2OMVA 3IDMB 2E7HA 3OAZH 1YUHA 1ZLVH 3U36A 2JIXA 3AM8C 4RMTA 5EIIG 4ZAKB 1FL3A 1TYRA 3IPBA 1YY8B 4GEIA 4BWWA 5B8CA 2VXQL 1RMFH 4XWOC 3ZO0A 1XF2A 3Q44A 2P45B 4WY7L 3V6FA 3HZMB 1DQVA 5JTWA 3HMXL 4UUJB 4NOFA 2DQJH 4GBXC 2ITCA 2VC2L 4OVUA 3LXCA 4NQDA 1RVFL 2Y1YA 4IU3A 1J5OL 2NXZB 1Z9SB 1BFVL 3T0WA 1J9SA 6PAZA 4OZGF 5IR1B 2FH6A 4L9LB 4PG2C 4L8CB 3JVGA 4HS3A 1RHHA 3GC3A 3KBFA 5AAWC 3WFHB 2NT0A 3DVFA 3L5HA 3DTXA 1FN4A 5AB9A 1WRFA 5J1SC 1E9QA 3JTTB 3OKYA 3KCPB 3VMNA 2QJDA 4OCMC 5EF1A 2YAFA 1UJ3A 3SKOB 5ALBL 2YUZA 1BQUA 3FSZA 5F1NB 5MI0B 5HHPA 4N24A 3DK0A 1MVUA 1LE5A 3NJKA 1AGFB 1E4WH 3U83A 4FKKA 2CIKA 2NY1B 4CW1A 4H8WC 4W9LC 2BFVH 2JE8A 2ZSVB 5F7YC 4PW3A 1I1AA 1QSFD 3NEEA 5TGBB 2A6JA 4NP4H 4HUWB 1F02I 1LEGA 3ZR5A 4B9ZA 1J18A 3D18B 4XCFH 4XX1G 4ZFQA 5I16A 1Y18A 4MCZA 5AB2A 5CP3H 3RGVA 1M71B 2CK0H 5DD0H 1NGYB 1ND0A 3EXJA 2JJTC 3OAUH 1Q0EA 3ULVL 3E6HB 4PJDA 5AVUB 2E27L 3VFOA 4TNVK 1J1XL 3B2PA 4IKJA 3KWWA 4AJ0A 4Z3GA 5L6YH 4PJEF 5GISL 3WJLC 2ADIA 3EOTL 3GMQA 3NZHH 4Y5XB 5D72H 3UXFA 1FDLH 1U6AH 5AOJA 3O8XC 3B2XA 2YEQA 2G3ZA 1QQDA 3UYPB 2WMPA 3P4OB 4K8RL 4D0DA 4GQ9H 1ZY9A 3QH3B 3T0EA 1HHGA 2OTWA 1F45A 3DARA 4HUUB 4W6WB 5E03A 3EHBD 4QRQA 1HC1A 1NEZB 4AMWA 3C2SA 4P46D 4M6OH 4TRPL 4XZUA 1INDL 2X6MA 1HE8A 1I8KB 3BFWA 5CCHE 1P69B 4JY4B 3H6AA 4R9HA 1MFMA 1U8KB 1XCQB 2BZ7A 2EABA 2W0LA 5EO0A 2C4XA 5EOCL 5JO5B 1FO0A 1OP3K 3D69A 3QPQC 4J4PC 4PWHA 1MJUL 2CR6A 5D5ME 5D5MB 5EA0H 5DHDA 3WFEH 1M7XA 5CLYA 4GG8A 4Z9KB 2BWQA 3VJ6B 3FRUA 1EJFA 1A9EA 1NANI 3VYPA 1QNZH 2OTUB 2UUDK 4Z3TA 1A66A 3C5JA 4BFRA 1MPAH 1PIGA 2BXZA 3FHAA 1WK0A 4Y4HC 4UTBA 2Q5BA 1TJGL 1DL7H 1P4BH 2IV9A 4PV9B 1FVDB 3N55A 3O3EB 3PWVB 1LK3H 3L7FA 1S9YA 1V05A 4EIZC 4FABH 4DP0X 1ZT4B 1GPOH 4BD4A 2WUBL 4CBZA 1DQDL 4OZFB 3E1F1 1TDQA 1LDPH 2WBXA 5DK2A 1VFAB 2MTPA 4LAQH 3P9MB 4YX2H 5GZNA 3TWYA 3B2MA 4R2GD 4M7KH 4PJXF 2ZG1A 1CDYA 3K8KA 4Q0XH 2BWDA 3RTQA 3ARYA 2DWSA 2ZXGA 1KLFB 1MHEB 2QQNH 4X80H 4RWYL 2CXKA 5D1ZB 1IEBB 3FT1A 1DP0A 2ESVA 2F7IA 3U1SH 2D31A 5GGTH 1T03L 1E3XA 2VTFA 1HWWA 3VB8A 4H88L 4Z1PA 3EJZC 3O2WL 1KB5A 3BFOA 4WUKH 3ZDZF 2A9DA 3AT0A 3D34A 2VNCA 2CRYA 2P1YA 5LGKA 1BWWA 3K2KA 3MJ8A 2FD6H 1A7PH 3FPYA 3APMA 3CQQA 4GQRA 4G7VH 3VACA 2YARA 3W57A 1UENA 3N85H 5HJGA 1BZ7A 1PZ2A 4LKCB 4L29B 1VCAA 2IC2A 4XBEH 5HDLA 5FAAA 3STZB 4F24A 5KSAB 3KLHC 3X12A 2NQCA 1XGPB 4RISH 2Y07L 3ZTJG 3G5YB 4M7LT 1NMAL 2LU5A 4WWID 5E2WL 1PG7W 2R0LL 3CXFA 4YBQC 5D2LA 4OCYH 3SSGA 3CGTA 4FG2A 1PY0A 4OFPA 3NCYS 3L8QA 1CJYA 4UT7H 4XP6H 3DOSB 4FFYH 3D07A 1I82A 1HOEA 4KUZL 1NC2A 4P5RA 2ADFL 3R19A 2IWEA 3AREA 4ZX3A 2YEZA 4G7QB 1VZGA 2BC4B 3ETTA 3N0PB 1WIUA 3RNQA 2UX7A 3CQPA 4NSKA 5D7JB 1DVYA 4JPWL 3CZUB 4RAVB 1NC4A 1BAGA 3SDCC 1URLA 1E0OB 5I1EL 1R5VA 1U8LB 3POHA 2WKLA 4K9EL 3IWUA 3RZCC 1RU9L 3ZRCC 4ODTL 4A2EA 3FT3A 3K6SB 4M8VA 1FYTD 3U46B 4XPGL 4J3TA 4NO3A 2EYRB 2WXFA 1J9QA 1M57B 1YJDC 2WVSA 4P4KA 4FEMA 3M1OA 4H26A 5AZEL 3KL3A 1M3IA 3SCMD 3NZ8B 4XMWA 4XMPH 1PNDA 4Z0BL 5K9JL 3DGGB 4XXWA 2R1XB 1N68A 2X0WA 4YDZA 4S11A 4CSSA 1G7QA 5DO2C 2OMTB 5D2NA 2NMSA 4PJ9B 1AC0A 2BHZA 3QC5X 7PCYA 5BQDA 1F3JA 3OLDA 1NFDF 4IBTA 4M43L 5CHNB 4IMLA 1J1PH 5AOIA 5KYUB 3TO2A 3VX1A 4DZBB 1X7QB 2OJZL 4OGAC 3DMMB 4ZFOA 4FC3E 1FZOB 2CR3A 3NA9H 3TJHC 3MI6A 4NT6A 1CGSL 3TZVC 2JTYA 1CD0A 2ENYA 4LRIA 5AOLA 2A83A 3BP7A 5FKAB 4LFHD 3SEPA 1NIDA 2F08A 4IKNA 2JJUA 4MAUH 4P2OB 4Y1AA 4KMTH 1EO8H 1ZIAA 1I4FA 4JPIB 5F88B 4RIRB 3WS6A 1T83A 4WGKA 4MMYA 3T6XA 2E7LC 4FFVD 2Y06L 5D8JL 3UJIH 3AM8A 3B5TA 1ETZB 3MZGB 4IJ3C 1V27A 1X6NA 3WLBB 2QQQA 2OBGA 1AI1H 2QDVA 3QZWG 2V2XA 2XKNB 4JM4L 3VG0L 4IS6B 5BO1H 1AOHA 3OKDA 2ZCKL 4I0PC 3MRFA 1CCZA 1L9MA 1LWJA 4K3EL 5EZPA 5AVTB 1T0MA 1TFPA 4E0RB 3GS7A 4CSZA 5GSVB 5F1IB 2RR3A 5LGYA 3E0GA 4ZTOL 1AP2B 4YLCA 3VD4A 2EUZA 2EEBA 3BD3A 4JFDD 4PG2A 5AKRA 2D3JA 4MJJA 4GS7B 2CCLA 2X4QA 3GHEH 5AAWA 5E24E 2AQRA 1BIIA 4KKAD 3IKCA 4ORGA 1MI5D 1IVTA 2VN4A 3K6DA 4KROB 2YFOA 2ARJA 3WJMB 1F6AA 3BQUC 2Z92B 4N2NA 1SQMA 3QUML 4WI8A 5EEZA 1OAQL 2YPVA 4LGPB 4PRHE 4PRHB 4PJIA 5FW8A 5DQDL 2DWDA 3TS8A 4YXLH 5AVQB 1UT1A 2I25N 1XF5B 5I75C 4XNDA 5AWNL 5G2NA 5TDPB 1FZKB 1HSAB 4PV1C 3T3MF 2EDNA 4Y9EA 2O5YH 1JL8A 2EDMA 5E8EA 5DJ8B 4RBPH 5I30H 3QO1B 4HK3J 2EICA 3TH4T 4AGMA 2L0DA 5HHXL 4HXBL 2JJTA 4RAHA 2QV2A 2KS0A 2HVBA 2XBDA 4IKKA 1XH1A 2HTLD 1KXTB 4OGQC 4UNIA 5DR5L 2CSPA 2DBJA 2CPUA 1FVEA 3WJLA 5J56B 2X44D 3PDGA 1DQKA 1JGDA 1JOIA 4NZTH 5BCAA 3O8XA 3QNYB 2Y36L 4A2DA 3PXJA 1OGTB 2EZ0D 3OKOB 4U2ZA 4ZBJA 2AXJA 2QHRH 5HI4D 3VRIA 4OCRL 3U9UB 3LS5L 3FN0L 1ORSA 4OJEH 4NHCH 4AEHL 3SODB 4AIZB 4XAKE 3APNA 3DVIA 4JJ5B 3WO4B 3QUXC 3QDGE 3QDGB 4G42A 3PABB 4ENEC 2AW2A 1U8OB 4A2MA 3E9TA 1MH5A 4IQHA 2JB6B 3VDCA 3FQWB 3V4PA 3OPUA 1HYSD 4XCYA 3QJSB 4J4PA 2EE6A 3O6KH 4JG1H 3UH8A 4KJQD 4KUCD 3ZTEA 5INDB 3NIFE 3BKCH 3NIFB 4G6ML 1T0NA 3A22A 2E7DA 4A2HA 4C4BA 2G5UA 1R3HB 3JTSA 1EHXA 2HLFD 4F91B 4PS4L 4MDRA 4W9ZA 1YN7B 2W1NA 1S7WA 1LVEA 4GAGL 1EWHA 2WBWB 3ESVF 3QJRB 1AGCA 1YNLL 4TLSA 4Y4HA 2E4TA 4BQCA 1SBSL 4UM8B 3O6FD 4N85A 2YXWA 5FO7A 1Z9NA 2V3DA 4AW4A 3F8UB 3DX8A 4PAZA 4QRPD 4Z3EA 4PN6A 4BINA 1PX4A 2WNWA 2CM6A 4R7DB 3FQ1A 4JO2H 4TVPE 4NN7C 1DBKL 1ACZA 5KVDE 2DMKA 4PJBE 1JPFA 4PJBB 3VFRA 4A7VA 4JFTA 5D6DC 1GAFL 1CQKA 4RFNC 2EDJA 4PD4K 1QLFB 3TF7C 3GMLA 1BLNB 1UHVA 3L81A 3D85D 3TN0D 2P7TB 2CO1A 2Q86A 4CN4A 1Z66A 5JHBA 1FL5B 2YBRB 4ACPA 1HZKA 1A6ZB 5ECGA 3CDCA 4LSQL 4DVRH 3QI9C 4W9CC 5F1SA 4TUOA 2CDEB 3Q2LA 2HWZL 1T3FB 4DGIH 2VXVH 3ETSA 4JQIH 4L1TA 3CFBA 3AY4C 3PHQB 4CN1A 4IBQA 3KNBA 4G6KL 4PCTA 2F7OA 4TNFA 4ELDA 4M1CC 2I5YH 1QVOB 3LPWA 1NGWB 2NRDA 3SGJC 4PJHA 2V5MA 4HJGB 5SX4H 3HRZC 4I89A 4FEIA 5DQJA 4EZLA 3IF1A 1MHCA 1D2PA 3WAJA 1OPGH 3SQBA 5LXGH 5EOCJ 3RDTD 3X13B 2V5TA 4N5ED 5AW6B 2VJ8A 2UWEE 2UWEB 3FU7A 2EIZB 3II1A 2VDKB 4XNQA 5HHNB 3SYAA 4OZIA 3CE1A 3GXMA 3N6YA 4O9HL 4ZW8A 3T2NH 2IGFL 2YXVA 4ODHL 5B1BB 2JQMA 5BV7L 4HT1H 4MA1B 2J5LB 3EKCA 1A6PA 2GSGB 2A9NL 2AEPL 3PJLA 1CG9A 4LHUA 4I18C 1NOFA 2EIDA 2CRZA 4LLDA 5F3BB 1XD0A 2Y1VA 4HUXA 3GSNB 3KAAA 5IQOA 3HKFA 1N64H 1N0XL 4ICWA 4A37A 4X6CF 1LEKA 4JFUA 4LOVA 3HI1B 3DROA 3QRFM 2KDYA 1MFDH 3PHOB 2Z93B 3IB4A 1L7IL 1RZJL 1BYPA 4Z95L 5CLZA 5C0CE 5C0CB 1TF4A 3W38A 3BGFC 3MRIB 4AENB 4AW7A 2IH3B 4NO0A 1X5LA 3DUHA 3AUWB 4MRCA 3BGAA 3GS0A 5C92A 4JVPA 3SDCA 1BVKB 1CLYH 3MXWH 2BMKA 5KUKA 1DDHB 2FYVA 3SOBL 3RZCA 1RUMH 5F0JB 5EO9B 4MXWL 4BFKA 2R8SH 1FE8L 5DJZB 4MZ3A 3FOMB 4AKOA 4ZO9A 4FKEA 2H26A 2FQEA 4OIIL 4UV7H 3TPUB 3MFFA 5KSBA 2CR0A 1NPUA 2V0AA 5MEPB 3TH2T 3RKDD 2WUCL 4O02A 4HMDA 2XSKA 3TEWA 3HZVA 3U2JA 1EDYA 3BEVA 4ZPVA 3Q01A 3ABGA 1YMHA 2EUVA 4N0YL 4P2QD 3VWJD 5IUSA 2GJ6A 3DIDA 3QQDB 4XVSL 4YHYB 1ZKAA 2P24A 4TVPH 4V11A 1VEOA 4N9GA 4FQ2H 3EH5B 3QVAA 4TQEL 3EXLA 3QWNA 4U1JB 1CLCA 1A7NL 2W07B 3DA0A 3QUZB 3DUSA 4WHYG 1F3RB 3OKLA 4KJPC 4X0KA 1RLWA 3A6BL 5DZAA 1NGQH 2KZKA 2KLSA 3R18A 3MODL 3UBXB 3MRKB 4F8QA 4P9HH 1WH0A 5IVXF 4JKKA 3TZVA 4R7XA 4ODWA 1OKEA 1K2DB 1W91A 4WW2B 4F7CA 3GB7A 2OXGB 1OOAA 3OGCB 3FT4B 4PREB 1BCIA 4MJID 4UBDD 4HG4K 3ABMB 3F7YA 2XQYA 3U7WH 3R7QA 4D9LL 1P1ZB 4KTYA 3GBMH 3QFGA 5CN3A 4I4WA 5LVEA 5MEOB 2E7LA 2RB8A 1BD2E 1BD2B 1JXJA 4M3HA 3QDHA 1E2ZA 1NUNB 8FABA 1M7IB 4G72B 4NHUB 3AB0B 3MRJA 1KFAL 3VXRE 3IE9A 3VXRB 4XB8A 5MENB 5MENE 3UTPD 3TLRA 5I1AA 5I1LB 1C9SA 3KYAA 3LB6D 5GHWH 3RVTC 1OT1A 4I0PA 1OAYH 3I6KA 3DSNB 4ANXA 3B2VL 3CQFA 1HNGA 4PYHA 1CUOA 3R1GH 3SPHA 3LNEA 1YY9D 4DPRA 1PQZA 1EJOH 4ZD3L 2VUOA 2NXYB 2WAQA 4Z5RA 5D70H 4BWTA 1H15B 2DM7A 4FJYA 3ZTJH 1NBVH 3GSNH 3MA7B 4X6FA 1E5YA 4UZUA 4PRBA 3RX5A 1VEPA 5DEZA 2OR9L 3UO1L 5LBSA 4OH2A 5DC9B 4PBXA 1WYJA 2DW5A 5IQ7L 3LDBB 2NY3D 2IH1B 5GZOC 4XCEB 4NUQA 3JQOB 1I3GL 3WUWG 3AMKA 1X4YA 1DQQA 2FWSA 3VSTA 2R1WB 1I8MA 5EORH 1IGFL 4GKZB 3RWJB 4QXTB 4Q97A 2A74B 1ZCRA 2C1OA 3HB3B 5SWZE 3BO8A 5SWZB 5L0QB 5IFJB 3I6LE 2Y7QB 4OFIA 1DN0B 1KCUL 4JDEB 3HG0A 5AG9A 3GHBL 5GQBA 1T5XB 2OTPA 2YN5A 3SDDB 3OWEA 4A63A 1G6VK 1BZ8A 3X1BA 4ZAKC 5F7FA 1QSFA 5JHDD 4FHJA 2MFNA 2X9ZA 1DFBH 4NJAL 4AYMC 2V17L 1KTDA 2IBZY 1CE6A 4JO4L 3E8VA 1TNNA 1D6VH 4OLVH 2H2SC 2HH0L 3EH1A 4OLZH 5JW5A 2VITA 3VTAA 2WO3B 1WBYB 4D0BA 2P3YA 3TJEL 2WZ0A 3M17B 5G5DA 3VGAB 1ACYL 2A1WH 3MRHA 2FGZA 3HR5B 3IFNH 3QUXA 4A2LA 1BVNT 4PLJD 1AGBA 4PB0L 4L9LC 3DIFA 1A5FH 1WFJA 4J3OC 1YEEL 1KN2H 3DKHA 5TD4A 2ZX5A 1MLBA 2A6KB 4KI5F 1PKQA 2LAGB 3HG5A 1WZKA 3WSQL 4AJVA 1WIOA 1HL8A 2HFGH 2YR3A 2FLRT 3O6LL 2XZZA 1DO6A 3KPMA 4NLHA 4QHNA 5I9QC 1Z5HA 3ZMEA 4LLQA 1OAJA 5IMLB 4UAOB 4HZAA 5CINL 2ENJA 2Q2EB 4DEPC 2FUQA 3LVEA 5E4IA 2WXRA 3M07A 1X7SA 3EDFA 3V52H 3VM5A 3WXWH 2NY1C 1FA4A 1I9EA 2WLKA 4JFEA 4UQBA 4ZMVA 3D30A 5IVZA 1W0YT 3ZUNC 3WHXA 4NO2B 3RVXC 3DBXA 4KXZI 5KANI 1S7SA 4XN4A 1ZVSB 3FK3A 5FA3A 1N4XH 4HS8H 2OLDA 2E6PA 1HKLH 5D6DA 1DEEB 4HUKB 5J11B 5FO2A 3NYKA 3PAUA 2RBLA 5KUMA 5DA4A 3Q8EA 3CFKB 4XB3A 4XVTH 3US1A 2MOVA 3UIZA 2QPDB 3FQYA 5LN4A 4N0UA 3CFMA 1GMIA 3FB8B 3QI9A 4NM8H 3S5LA 2P42B 1ZANH 2V9UA 2WLIA 1KCSL 3AY4A 2BY2A 3O9WC 3RX8A 2C26A 4M61B 4MKMA 5C7XL 1UD5A 1XQ4A 3IMUA 5AALA 1YEGL 1JPEA 2XBTA 3SGJA 2XVLA 2P8PB 1E30A 1JZDC 5ERWA 3II3A 2HX8A 4YC2B 3WJJC 3QR1A 1QFUL 3ZTNL 4I9XA 3GEFA 2VN5A 3EF4A 3TBWB 3BN9D 2VZUA 4DP1X 1SDAB 4XC3L 3FQ2A 5HY9B 3C6LC 4B7LA 3QEQA 3DGDA 2OFQA 3MUZ1 4QTHB 2QGCA 3SBQA 1ZHBB 4P59H 1WGOA 1TKWA 1U0QA 2H6PA 3L16A 4KO9A 4Y2OA 5ACZB 2FWLB 2ADJB 1V7NH 3VG9B 4LLUA 1BX2A 2XX1A 4I18A 1A14L 3LIUA 1FC1A 3LS4H 1JNHA 4OSUH 3T0BA 5L8KB 5ITBH 3OKNA 4BFBD 2X41A 5DYOB 5TPWL 2AABH 1RJYA 3P4LA 1NLDH 4LASL 5EBLB 2PW2B 4GMSH 4ABVA 5LAXA 2NNFA 5FO8A 3ULSA 2BP8A 2MCAA 2CKBA 3QS3A 4GUQA 3IGAA 3GTTA 4KK9C 1F41A 3BUYA 2WKOA 1CPUA 3IDNB 1ZXQA 2Z1PA 5F9OH 1X9LA 5HPMA 4P07A 4WO4B 3P3UA 2WOYA 3LV3B 4K94L 3ROLA 1KJ3H 5LBVA 5EPMB 5D1ZC 4MX7A 4ONOA 1HYRC 1YQVL 1AQKH 5I8OL 2VDQB 3QZPA 4UT9L 2GI7A 1CDUA 1YEFH 4HUMB 4R7NA 5JW4Q 4LCIH 4LBEA 4QJ5B 3BYYA 1GZPB 3KLKA 4D7BA 1S9KC 4PEEA 3BZDA 1BOYA 1E28A 4YE0A 5I0YA 4DKFL 1C08A 1KYAA 1G9NH 2H1PH 2Z8VC 4KWUA 5D1QE 5D1QB 4TUKL 2P5EA 3GSVA 5E2TL 1NLBL 1TNMA 4HF5H 1F3DJ 1G9HA 1RZQA 2NW3B 3HUJF 4X4MA 3BJ91 4KDVA 3MLRH 4G8AC 4OT1L 3EOYG 1N2RB 3OVUB 1H3UA 2EH8L 2DF3A 3TIEA 3WEXA 4FP8H 4HALA 2XWJB 4JVWA 5FKPA 4Z78B 1H8LA 5CD3A 2OMYB 1NCCL 4MMXC 2J1XA 5T1KB 4PV8B 1TQBC 2DD8L 4HV8B 1XR8A 3LKQB 1J8RA 2QEJA 2YGOA 4J6RH 3VXUA 3WKPA 1NIEA 5GGUB 1PCSA 2XA3A 3NFSH 4H1LG 4QY8B 4YJZL 2O6EA 5JOPD 2BSSB 3QXUA 3KPQA 3S37L 5IOPB 1RUAL 3FQUB 3L7EB 2YRPA 3BRGC 3AU1B 4PRDB 2AVGA 1F8TH 2APVA 4H2CA 3VQMA 3F65A 4GG6A 1JJUA 1AQHA 3BP4B 4DCQA 3IGLA 3GM0A 4UTAH 2GIXA 4JL1A 4ETYA 1BZDA 1GYVA 5BQ7A 2AXFB 5CP3A 5FB8A 4WEUD 2Y5TB 5FYKU 4OF3A 3RWDB 5JR1L 3I2CH 4HIXL 4ZUVA 3FJTA 3SGKC 4P3WA 3GMPB 1LDSA 2AZUA 3WTWA 4FA6A 3UBFA 3HG1A 4BGDA 4OKVA 5L4MA 1DJZA 2DWXA 3S3DB 1KLGB 3K71A 3ZVVA 3H42L 5JXEC 3CX5K 4XHJD 2GC4C 2R0WH 1TYEB 2A38A 1NWPA 4KBPA 5C09B 5C09E 1N6UA 3SY6A 1NCBH 1TJMA 2YMXH 2OULB 1LO5A 1QLRB 4MJHA 3VD0A 2K4WA 3KH3A 3EJPA 2PUQT 2IH9A 5INCB 4DERA 3HZKA 4GUPB 4HIJA 5GZOA 3HVNA 4Z8FL 1JZ6A 2C7FA 3ES6A 4JCMA 3M46A 3MTXA 4UIMA 1PDKB 3MLSL 5EUKB 5D6CA 4YXKH 1OY3B 1M2VB 2I32A 4P9MH 4U7KA 5GIRA 3VFGL 3N41F 3WUWB 1TQSA 2AV7A 5IMOA 4P2OC 3UG4A 4YSSA 3TFKD 2VW7A 2KMWA 1AR1C 1C5DB 1GIGH 2VDQH 3QQ3A 1JGEB 3AXIA 5ID1B 4KXDA 4KO6A 1M6UA 2MJWA 4XWOD 5DQ9B 4KY2A 5DEFA 5DUBA 3VSVA 4LZKA 5HGBB 2XXMB 2XRAH 1J11A 3SYPA 4KZEH 3LZFH 3E3QE 2LU7A 1XT5A 2HJFA 2IFFH 2X2JA 3MYJA 4PCSA 5FFGA 2I60L 2C9VA 4UDTA 3ILDA 1NOLA 1LNUB 2B4CL 3D9AL 4I3GA 1FFTB 1OM9A 2ETWA 5TQ2L 2XYCA 2AGJL 2FIKA 5E5RB 3ZR6A 3S8FB 4X4YA 4F7PA 4KV5F 1GGYA 2Y2YA 2UZPA 4IRZH 4XBMA 3Q5TA 5T5NF 1NOAA 2R2EB 4Z76B 5CF3A 5IR1A 1EEZA 1HSBB 4L9LA 4Y8AA 4FQCH 4FXKC 4F2MB 4F2ME 5L9DH 2VDRL 2J44A 2VR5A 4WHYH 4B97A 5I66B 4CC4C 1RSFA 2WVVA 5ABAA 5JHMA 1ASQA 2ZUYA 3RDJA 1R3KA 2Y6TE 1UEYA 3N40F 2J8OA 3SBPA 1G0YR 1E6OH 4L3CB 1O6SB 1A1OA 1ZVYA 3EO9H 1GGBH 2CU9A 3ASWA 3B9KB 4POZD 3L08A 3SYCA 4JO1H 2EEFA 1HEZB 3QJFA 1N6VA 4QRUA 2NY5H 4FG6D 2VKXA 3B9VA 5T33L 3SYQA 2YMTA 2WYZA 4A55A 1VACA 4RSYA 1FGNH 5FX3A 3OJ2C 1IGMH 2X6CA 4RNRB 2M8XA 4Z7WE 2N1TE 4Z7WB 3WEOA 1ZT1A 5CSZA 3IAQA 1P5VB 4R7VA 2C9QA 2XXCB 3CZSA 2FCBA 5TFSH 3WEBA 1R3JB 5I6XB 2CO7B 3VSQA 3QHFL 1TUPA 1BQKA 1FO0L 1R34A 4QRPA 2HVKB 4E42A 1EGJL 1U2CA 4C56A 3CHRA 1ZHLB 5E94A 4NRYB 4FFYA 1UXSB 1W72H 3UGEA 3EYQD 2E86A 1AKJD 3PGCA 3QE5A 4F8NA 3HPLA 4TL5A 3KS0J 4NPYB 1E90A 4XN8A 1PYWB 1EHNA 1T7VA 3TYGH 3U9PL 4HSCX 2FE0A 3O9WA 2TSBA 3LRKA 1Y1UA 3IGUA 3TO4D 5EWIH 4P3DA 1ZA3B 2NSMA 2BSRB 5IHHA 3D2UB 4MA3A 1KWKA 4ADJA 1U8KA 5JO5A 1XCQA 2YQGA 2H0EA 3MRDA 1PZCA 3N1PC 2D7MA 3WJJA 3BZ5A 4PJAA 2EQDA 3QEGL 5EOTB 2APTA 1EXUA 3C6LA 3NFPB 1CLOL 2BY0A 2WP3O 4AZ8A 5DJCB 2ZONA 3INOA 1MWAB 3CHXA 4U6TA 2OTUA 4L3ED 2EO7A 1T7YA 3IXAB 2YXMA 4XVUD 4WNSA 2P8MA 1AS8A 3G3LA 3VQ2C 1BPVA 2ZF9A 1SVCP 1R5IA 4GLRH 3O3EA 4ELMF 1HXYA 2X4RB 2DJ4A 3VCLB 3ZDXE 3ZDXB 1AHWC 2XZQL 32C2B 3NIGE 2NR6C 3NIGB 4WCYL 5GGRY 2EDEA 3SKNB 1LWHA 3V0EA 1QFWM 4EMZA 2P44B 4OCSL 1A6VL 2IMMA 4OGYH 5K93A 2C1PA 2UYLA 1HZHH 1Q9KB 3NACH 4M4RA 3LQAC 3LN4A 1VFOA 4ZTPL 5CJQL 5EU7E 1S3KL 4L1DA 4P57B 5E8PA 1VADB 3E8UH 1I7RA 4P9HC 3MNDA 2MNJB 1NDMA 5F7EH 2PNDA 4NQUA 3WTXA 2YSTA 3MRCA 2OW6A 2ZX6A 2BWIA 4PWFA 2H0PA 5DURB 1URIA 3I9GL 4CU7A 2OMNA 3LEVH 1TVBB 3QP3A 3UTQA 3IU4L 2F0CA 4YDVA 5ENWB 1SYSB 3UAEA 5EEWA 3KH4A 1B0IA 5M95B 4LHQB 1INEH 4TSBL 1QFOA 4AE0A 4CDHA 1NQBA 5KYNA 4WU7A 4L29A 3NJHA 4WU5B 2AK1L 1JAEA 1NCOA 5C07A 5AUMA 1WE5A 2JKTM 1KXHA 1KGIA 3STZA 1HHHB 1P7QB 5EC2B 2OI9C 2OMXB 4NENB 3VFWA 3EH2A 4LPYA 1RP8A 4C55A 3MACL 1K5NB 3GMRA 3O2VL 5DJAA 1NAKH 1VB9A 1NGXA 2FWOB 3FO0H 4OZ4B 5EU3A 2EDBA 4LHJB 1NAML 1TZ8A 3L2MA 1EEQA 4B9GA 3GJFH 3RL2B 2PWHA 3TCTA 4QO1A 3FUMA 1XF4B 3L4VA 4MMXA 5KG9A 5F6HI 3ZT5A 3C09C 5C0ND 12E8H 5DC4B 4H0HB 4XO5A 5IM7A 2J56A 5FCUH 2G3MA 5CNHA 3LYRA 4GRWF 3L3GA 4Q89A 4UDUB 2Y6SC 1BFSA 2NZIA 4D2NA 4L37B 2OSYA 2GTZB 2MCPH 3NMEA 4KK8C 4PS7A 4WTZA 2YZ8A 3D0LB 4K5NA 2X0VA 3GUFA 3PUUA 2IOMA 4UU9A 4JY6B 1KMGA 3L4CA 4PGJA 5D7HA 5E0QA 3W0WE 4H1LB 3L45A 5E6IC 3W0WB 2DQHH 1BOGB 3B2DC 3RVUC 2JF1A 1ADQL 3INUH 2LVCA 2FQFA 3NIDF 4ERSL 3K6SA 1CMOA 5J06A 3PLYA 2VMFA 3O0RH 5I71C 5IREA 1AE6H 1MAMH 1MWAH 3PWLB 3TA3A 1AVAA 2DH3A 3UAAA 2GFBA 1DUYB 1NGZA 2OZ4L 1NM4A 3SGKA 4N2MA 1G1YA 4KQ3H 1UB5A 3NZ8A 4AT6B 4C4UA 1PGRB 3V0WL 2CJ3A 4PGZA 5JXEA 5DDHA 5F7DA 3QNZA 5IHZB 2RTTA 4FQQA 4IRSC 4YNYA 2ORBL 1ZDQA 5CCGE 3JV4A 1DVSA 2OMTA 2VMEA 2J8HA 1K4DA 3KYKL 4YDIL 4QRBA 4F58H 2EDTA 4ZUTB 3CLEH 3QUZC 3VRJB 2BIOA 3OV6A 1NDTA 5CHNA 2FLMA 1MVFA 3PDDA 2C9RA 2GCYA 4MQXC 2OW7A 3M88A 5L2JB 4DEWA 1LE9A 2IADB 1TEFA 3VD5A 4Q9RH 1JDAA 1UH2A 2R4SH 1BQLL 3HZYA 4HJEA 1X5ZA 3KPOB 4ZPTB 4JRXE 3POCA 3QARA 4JRXB 3I9PA 4NBZB 2XUWA 4PRNB 3WS3A 4OTXL 3KPRA 5DYFA 1QEXA 1FNAA 1ZA6A 1XH2A 4HKXB 1OT4A 1ONQB 4RZKA 3KWXA 5GGRB 3R7RA 1VESA 3UIYA 1MCPH 3BDYL 2OXHB 4EN3B 2IAMC 1KTLB 2E9GA 2ZQKA 5EO1B 1DO5A 3AABA 4QJ3B 2V2TA 5H2BA 4UM9B 3WIFA 1ETZA 3VFPA 5C0BA 3WLBA 2IPUK 4HK0A 5KBMA 1U8HB 2YKLL 4GSRA 2N7BA 4J28A 2P43B 4ZUSA 2GJRA 3TBVA 1MY7A 4X6DE 4X6DB 4YBHA 3A6CH 3W5NA 3T0VA 4G5AA 5EIIA 1DN2A 1RZKL 2BOCB 1F4XL 2YPVL 5DS8B 3EDKA 2APFA 4RVBA 4PRIE 4PRIB 1QI5A 1MEXH 2CJSA 2FATL 4M7LL 2CIIA 3GGWB 4N0CC 1Z3GH 4XNMA 1KCVL 1QACA 5DJ2B 1W16A 2PWFA 2YO3A 4S1RH 4Z7QE 4Z7QB 3GKWH 3MBED 5F89B 4J3WA 3VH8G 4FXKA 4AQ1B 1OD7A 3BQUD 3SZ6A 2XWEA 1VZIA 1U8CB 4K7FA 4A7QA 5L7XL 4CC4A 2AK4A 2ITDB 4KH9A 3TC9A 3I3DA 2F74B 5EZJB 3VTMA 3EFFB 3LDBC 1G7PB 4HGWB 2Z92A 3KJ6H 4JB9H 3MBWA 4XP9H 2H7WA 2VDMB 2VQ1B 1R3LA 1GGCH 3FW6A 4EDXA 4F7MA 1M9SA 3OF6A 1XEUA 4XZ4A 5H37G 2N0MA 4PVMA 2ATPA 4ONHA 4X4ZA 3I74A 4DPBX 4NQVB 4BFGA 2A74C 5CCKH 3IFOB 1XF5A 1G7LB 1WICA 4H1LH 4NYLA 3KPNB 5JA9A 3SHSA 1FZKA 2ZICA 3AG3B 3MRMB 4YSTA 4Y7MA 4B41A 4ZT1A 3GWJA 2VOTA 4YVUA 5TE7L 4L4TD 5C8JA 1IIIA 1Y6NR 1V54B 1S46A 3V0VA 1J0JA 5C08A 4AGOA 1JD7A 1C5BH 3EFDL 3UPAA 2GK2A 1CURA 5DHVB 5GJTH 4WTQA 5SWSA 4EE2A 2VC2B 6FABH 2EIKB 1BMWA 2BNRE 2BNRB 3UAJD 1GOHA 5D96B 2KKQA 4OZHE 1VHPA 4OZHB 2CG9X 3L4UA 2AQ3A 2QTEA 4ENED 2ITFA 1SLXA 3KXFB 3KXFE 5H8DA 5C0DA 1KZYA 3RVWC 2KPNA 3KVPA 3LH8A 1Q8MA 4XO4A 1BVLA 1JSYA 4JZNA 2F2HA 4G8FB 2FQDA 3T71A 1P6AB 5AW4B 3CFTA 3A24A 5GGSA 4EXKA 5B4MC 3FQWA 3G6AB 4HWEL 2PETA 2XV3A 2WXMA 1Q9OA 1TZGL 2V5RA 1X6LA 1Z5LB 1RHFA 5CR1A 4F7EB 3T65B 1BQHG 1OAKL 2Z31D 3UTTE 1TR7A 4GY4A 3UTTB 5DZJA 1HKFA 1NBCA 2NTFB 3EO0B 2XTJD 4LLMB 3U4BH 3ZY7A 2AQ1A 3SE9L 1IGCH 1JHLH 1PFCA 1QFHA 1QYGL 1HILB 3O4LA 2CBMA 2HN7B 4XO3A 2N7SA 1MF2L 4ZW5A 1VFMA 5CKGA 3K4DA 1G9NC 3GNMH 3GK8L 1AHWA 3V5HA 1VIWA 2DMGA 3BAJA 2NR6A 2ZOOA 5BRZE 2GY5A 1BGXH 4I5BB 4DN3L 5BRZB 2F7RA 4J5VA 3JV0A 3MLTB 2C3WA 2XY2A 1U8PA 2R2BB 4KUCF 2KZWA 4NUGH 3KYMA 4IBVA 3L13A 5J11C 3UOAB 1BAFL 4U1GB 4OJAA 1B2WL 1A6TA 3CVHA 3KYNB 2P7TA 4KTDL 2Y9RT 4JN1L 4RFEB 5F7LB 2VMDA 3T09A 4JM2F 1HEHC 4ZXBD 1FVCB 3TCLA 2YUVA 1J8SA 1HQ4A 3ARTA 5KN5B 2XG5A 2CGZA 3HC4L 1PLCA 5EFIB 1OSPL 1F4YH 1JHKH 4FF9A 4QRTA 2XWBA 2WINA 1REIA 1OALA 3V79C 1TSRA 3H4HA 4RWHA 1QATA 4PH8A 3CN0A 1Z7JA 2CUMA 5IZ7A 3VVWA 1PD1A 2J6EL 4TSCL 3K2UH 4AXWA 1H3PH 1XTMA 3GRWL 2W9LA 3UC2A 3G5ZA 3TYFB 5FK9B 3EGXB 1SOSA 2CNYA 5DRXB 3Q6FB 3FQXB 3V0IA 1MDAA 1D5MA 1TQCC 3FONA 3IFLL 4P5SA 2PW1B 1UWYA 4RMVA 3PWNB 1JNJA 4WFHE 4QOKE 4QOKB 4AM0B 5FECB 2VXQH 3P2DA 4X6EA 3QJVB 4W6XB 4R4ND 3UYRL 2CLVB 3EO1B 3OBAA 3QFDA 4ZODA 3WNIA 1AKPA 3VDAA 4FNPA 1QWNA 4WY7H 4LLVB 4NUMA 3V5DA 3RFZC 5IJKC 3VG9C 3JV6A 4M1GL 1L3NA 3HMXH 5DHVH 4E9VA 3COOA 1KTBA 3BH9A 4JZOA 2VC2H 1D5XB 1EEYA 1RVFH 5DI8B 4AYBA 2J7LA 4BZ2L 3V6OE 1J5OH 1IBFA 2CHXA 4ZOAA 2UV3A 4X7SL 1BFVH 1AZUA 4UYPA 4Z23A 3GMOA 1XIWB 5TH2A 4NOBA 1JMZA 5T1LB 2Y3AA 4JFYA 3FCTB 4I8DA 2G5BB 5C0CA 4U33A 1T4KA 4CU6A 4QRRE 4KVNL 4QRRB 4QGTA 3N0AA 3CBJB 1A4AA 3IPEA 5JIKA 1HHIA 1BXAA 2NDGA 1KBGL 4H8QA 3MGOB 3BUDA 5ALBH 2EDFA 1BVKA 2WQAA 2ZAGA 5E6IA 4ATTA 4AVKA 1PFOA 3GFUA 2X42A 2NUPA 1BEXA 1R17A 4YDJB 3TPUA 2K8MA 2VERA 1TJIL 3C8DA 3GSOB 4XCNB 5MEPA 3LEYL 2ADGB 1IC5L 3UDWC 4ZFZA 3RWHB 5LCVA 3AQDA 3NPSC 3LHPL 4CADB 3ULVH 2E27H 2BW5A 3LN5B 2YWYA 4G9DA 1J1XH 4IRSA 4DO4A 1TFHA 2B15A 1ZTXE 3U82B 5GISH 3EOTH 3AXLA 1EPFA 3K6IA 3QUZA 3U0TB 2EO9A 5DA0B 3D25A 1NTDA 4PY8J 1SQ2N 1U3NA 4K8RH 4L1LA 1XBDA 3ZYJA 2DY2A 2YLKA 4QUOA 5KOVC 3OXSA 1MREL 4BK4A 3T1WA 4Y16C 2VQ4A 4G7YL 5IVNA 4IRJB 1K2DA 1QSEE 1QSEB 1INDH 1S7UB 3GMMB 4H0IA 4TRPH 2DLTA 4UZGA 2F54D 2LFGA 1JHTB 3FT4A 5LAPA 4PREA 4XCCL 5AL0A 1K72A 5EOCH 3ZKQD 2WLLA 2X1QA 1NICA 5KS9F 2PWEA 1MJUH 1P1ZA 2IAMA 2FZ3A 1JK9A 2NY2B 2Z7UA 2IDQA 4JZJB 4EKXA 3ZKXB 2NY5C 2G0LA 2H5UA 3CVCA 4ANVA 1S9XB 1T1YA 5H94B 3VXRA 1C8QA 4GW5B 1JVOA 2VYRE 5LBSL 4DFIA 3C5ZD 3GDBA 4MXVF 1TJGH 1U3HB 3GSQB 3VA6A 3DRQA 1KNOA 3FB5A 4FCHA 3QZWA 4B96A 1MHHB 3VI4F 2B5IB 1AHMA 2WUBH 3S48A 3M7FB 2WXQA 1GOFA 1DQDH 4I1RA 1F11B 4KV5E 5CSBA 4YH6A 5KVFL 3F64A 4YDLB 4X8GA 4G8IA 1TZAA 3R4RA 1KN4L 1GS7A 1EQWA 3W5MA 3RL1B 1D5IL 3KWVA 2EDOA 1W15A 2QVMA 2ED6A 3Q2WA 5IBUG 4W9GC 2YEVB 2Q87A 3WKNA 3FDWA 5G4MA 1F58L 1HZLA 2QV4A 3GSWA 1F42A 3FBQA 3TT3L 2LTQC 3O0LA 2W94A 3JWNG 1M3JA 3D4YA 4RWYH 2YC1A 5IMMA 2MHAA 4PJ8D 3RWJA 1T03H 2MPAL 1UUSA 1X5AA 4E5XB 1SJEB 2QKIB 3P11L 4H88H 1NKGA 3O2WH 3VFNB 4FQ1L 5H4YA 2NT1A 3WE1A 4J3SA 3HS0B 3OX8A 5EU6E 1UXWA 4ZJ9A 4BCZA 4JDEA 4MXQC 5FYJU 2CD0A 3DO4A 3A5VA 4Y2DC 4RH4A 1MW3A 2V9TA 1JPTL 2AQPA 4YK4C 4AV5A 1OL0A 3WHE1 4NFBA 2Y72A 1HS6A 4O51B 2Y07H 1FYHB 1EHKB 1NMAH 5E2WH 3U0PB 3T4YB 1IC7L 3IWVA 2R0LH 4QPEA 4ZSOE 4ZSOB 2NXZD 2BVQA 3U6RA 1QWUA 1W6WA 1E3ZA 3NP3A 3LKPB 3AMLA 3ATFA 2HT3C 4HJJL 4PWJA 2YPKB 4KUZH 2IANE 2IANB 3QR2A 5E1AB 2ADFH 2Y69B 5ICXB 1WT5C 5MEQB 1IKNA 3IDYC 4JAMB 5IGXL 3S8WA 4PWIA 3QUMB 2JK5B 1IIKA 1FLTX 1PZSA 1RL1A 1KIUB 2JV6A 2BCKB 3ARGD 4JPWH 2M83A 4QD2E 1EX0A 2XIIA 4KPHL 3WD5L 5I1EH 5AD0A 4CKQA 2PYEE 3LJ3A 4K9EH 2WTPA 1RU9H 1S5IL 4ODTH 4Z0XB 1U4FA 4URKA 3QUYB 2VQUA 4QXGL 3NN8A 2HMIC 4N86A 2PXYC 4XPGH 4R84A 3ARFC 4HX1A 3GZOA 5AZEH 3BYTA 3DPBA 4CC1A 4NO2A 1UUNA 3D2TA 3FO9B 3BPNB 3HHSA 4ELME 4ELMB 5AB0A 5SV4A 4Z0BH 4QNPE 4PJGA 1J8HA 5K9JH 5I6XC 3CCHB 2EP6A 4PGBB 5DVNA 2Z4QB 2E74C 5B22A 1TOXA 3PAYA 5FYKL 2E7BA 1MG3C 3OAYK 3X1EA 1QSZA 5BS0E 1XL4A 5BS0B 4RQQB 4M43H 3HE6C 2FR4B 4NI3A 2ZG3A 3REVA 3ZZQA 4ANKA 3CDZA 2OJZH 1X3DA 3ULUF 3DTDA 5LO7A 1CGSH 4F3FB 1QBAA 2AITA 1AZNA 4PJDF 2EKJA 1XGRA 3VGDA 4DESA 3BLBA 4M61A 2ERJB 1EAPB 2BP5M 3OZ9L 4ANUA 3LCYA 3VXPB 3MNWB 1AH1A 1UFGA 3RHWK 5GSRA 3S4SG 4H0GA 5HGDA 3C60B 1LXMA 3IJYB 1KT2B 1OE1A 2G4EA 5D8JH 2Y06H 4UTAA 2EE0A 4KX8A 5ANHA 2ENSA 2W59A 1MZYA 2WCPA 5DZ9A 4Y0GA 1AY1L 2VIRA 2EH7L 2YD1A 3H56A 2CKBL 1RUPL 4JM4H 3VG0H 1ERNA 3PJNA 5JPNB 4LVOB 5DJ0B 3RFZA 5IJKA 1MCBA 1P5UC 3D0VA 2RACA 3B8YA 4JRFA 4C47A 4GUOA 1SN2A 3UERA 2ZCKH 1WBZB 4JGUA 2H4EA 4N0FB 3TWCL 3VXMD 4O00A 4L0YA 5EZOL 4L48A 4K3EH 3DYPA 4RX4D 4G83A 1H6TA 2E56A 4ZTOH 2XIBA 1LGVA 2HVJA 2ZTBA 4LCWE 4LCWB 3STLA 4CRPA 3D05A 3T6ZA 5SV3A 1FFNB 4DF9A 3MNMA 1FI8C 3B7YA 4KH2A 4FA7B 5BPPA 4KRNA 4ADGA 3LEXA 1CE1L 3U2IA 4GRWE 4GRWB 4XI5D 4KO7A 4BH7B 4E68A 3MKKA 4M5TA 2VSDA 3QUMH 4ZMOA 3WTSA 1OAQH 1T04B 1WZAA 4LSVL 4G8EA 5EG6C 1LILA 3V0AC 5DQDH 4ZMQA 4G1MA 4JCLA 4X9GA 4HJSA 1OTSD 5BJTA 2IDSA 3WMQA 5C6TL 2BK8A 4FHBD 3FUJA 1SLVA 4R5TA 4WFEE 1QUPA 4HAGA 4M29A 4P5KA 4CVXB 3E2HB 5AWNH 1A1MB 4NNYB 3OQRA 3EYFB 2IEPA 2DAVA 3UDWA 5F6HJ 5DJDB 5E5LA 4XNXL 1MCFA 5AVSB 4FQIL 4N2BA 1BMZA 5IP4A 3PWPE 1BZ9B 3PWPB 4X5WA 5KSAD 5HHXH 5BV7B 4HXBH 3WUZA 4JFOB 3RY6C 1T5WA 2Y7MA 5MP6L 2WJ7A 3UTZA 5J9PB 5DR5H 2XN9D 1ZRUA 1NANH 4GO8A 3MV7E 3MV7B 4R5VA 2BVTA 2D2OA 1YMMA 2Y36H 3LNHA 3SGEI 3IDGB 1RP9A 3GUTA 3ZQWA 1QP1A 2WIIB 1RLBA 4TM9A 4OCRH 3LS5H 4ISVB 4I7ZC 3FN0H 2E9IA 5CZRA 5HGHB 2F19L 2NYYD 1M1SA 4XMZA 4AEHH 3MMEB 4TSAL 2LVEA 4Y16A 4MCYA 1BVZA 1CK0L 1P84K 2F5AL 1BG9A 1ED3B 4HEPG 1FSKB 3MAWA 5D7LA 4EZMA 3BFQG 2EDQA 2YOAA 5D7JD 5EEUA 2D7TL 5CIPB 5DRNA 1EFXA 1RJZA 3NH7L 5DD5L 2Y0SA 3WKML 2WQRA 1S8DA 1JXGA 1OHQA 4TXVB 3KPTA 5CGTA 2XU9A 3QZNA 2DKUA 4G6MH 3EJCA 1NMCC 5HP5A 1BW8A 2VLJA 4RFOL 3V0JA 4FQHB 2J5WA 1OEZW 3P3TA 2Z6FA 4HKZB 1UTDA 4PS4H 3BLKA 2M2DA 3FO1A 5CP7B 3ILQD 1MCEA 2Z7YA 4XGZA 5E9NA 2DLIA 3CC1A 4GAGH 5IB1A 1YNLH 3RWEA 4UB0L 4NWTL 5KBDA 4ZK8A 1SBSH 4NZ8A 5EBWB 1D3CA 2Y5TA 3AT8A 1YLBB 4ILDA 3VRLF 3SO3C 4D7PA 1WAEA 5I18L 5I8EB 3IMVA 1PLBA 1DBKH 2HKFL 5IHBA 2PWGA 2BHUA 1AD9A 4PJ9D 1KDJA 5FGBC 1GAFH 3DHUA 1W0WA 3SBRA 4B0MM 1W72A 5C09A 5D7IF 3B9AA 2ISDA 4U1IB 1KCBA 1AXSA 2WXPA 3DMMD 3VFTA 1OCOB 2X1WL 1NBQA 3S3JA 5C0AE 1S7VB 5INCA 4DP4X 3WIAA 2X4PA 4XAWL 4KOBA 5C0EB 4FFTA 4LSQH 2GTWB 1UM4L 4I9WE 5FA4B 3RA7L 2BVOB 1LEIA 2HWZH 4OGZA 5ESAA 4IHOA 2CJUL 2RFXB 5AYUL 3UABA 5I8CA 3TF4A 1S9VA 4N8VG 4P2OD 3CDGB 1VF5C 1WP6A 3P4MB 1UZGA 4G6KH 3U4AA 2WBJB 3ZPDA 4Y4KC 4ONFL 2BRRL 5JW4M 3HMWL 4RMBA 3LNIA 1U8JB 1S78D 3O41A 5GS0C 4FQPA 2IFGA 4EN3C 5I1KL 2DI8A 5EU5A 1K85A 1F3DH 1LQSR 2QMJA 4Y2DA 1PD6A 2V9QA 2RMNA 3TNNA 4O9HH 5B1KA 3IJEA 2IGFH 4ODHH 2VGLM 4P2YA 3SE3C 2FBJL 5BV7H 3QULA 5E99L 2A9NH 1P7HL 2AEPH 1A4KB 3HVDA 3VSUA 3QWOB 3I6GA 3MDJA 4WHDA 5L2KE 5IEHB 1D7DA 3QZBA 4UNTA 5L2KB 4GRMB 5L8JB 3C6SA 3N04A 3AG2B 2YQ2A 4OLXL 1N0XH 4GKNA 5AQ0A 4KROD 1L7IH 4AQ1C 1RZJH 4Z95H 3VMOA 1YEHL 3D3VA 4PRHD 4N3UA 1M1XA 1MCHA 4ZNEA 3GIZL 3BP5B 3TJPA 5TE4L 4Q9CA 5CIPH 4HS6B 5DEGB 3DXAA 4NZUL 2O61B 4GO9A 5CLXA 3SOBH 2EKSB 3L6FA 4OV6F 1NSNL 4MXWH 3OKEB 3MCG1 1M9WA 1QKZL 1FE8H 2V3FA 1UZ8A 1F00I 3VX0A 1JWSB 1BVOA 3AS1A 1UM6L 2PXYA 1FNGA 3OTTA 4TQ8A 4OIIH 2O93L 3ARFA 3ILPB 5IROD 4ZDHA 2WUCH 2XA8L 5C0GB 1KIRB 1MFUA 1B0RB 1CFTA 4HUVA 3PJSB 3M1BB 3RILA 4AGPA 3GIVB 3SQRA 4U3SA 1P5VA 5CEYB 4N0YH 4PJIF 1V10A 3FT2B 4XVSH 5KANG 4RMUA 3QGVA 4GAFB 3I75A 1UD4A 4XMTA 1SLWA 3IYLW 3GJFA 4TQEH 3VFMB 4KC3B 5J1AA 1A7NH 1OF0A 3Q8FA 1ZHLA 4AY0A 4XAKD 4ZO6A 2A9AA 3BSZH 3HE6A 3A6BH 3IJ8A 2EACA 3QDGD 4OIBA 4IDJL 3ZDWA 3MODH 3TVMB 4ZUWB 4JM2B 2FRGP 3HG3A 2XV0A 3U48A 2YAMA 3FO2B 4LDOB 1O9VA 2YUXA 3F12A 4CMHB 1X9RA 4ZXBA 2EC9T 2NQDA 4NKOB 3QQXA 1UT2A 4WJKB 1OZTG 4HPYL 4W6YB 1GZQB 4D9LH 5ETUB 4L8SC 1E27B 1AYRA 3EUDA 4M6ML 3FKUS 5IFAL 2Q6WB 1XGQA 3D39E 2TRYA 3D39B 4OLEA 5FM8A 4WI7A 4IGBC 4EI5B 2DZEA 1G1CA 3WY3A 3HG2A 1IBHA 1MFAL 3S4SB 1KFAH 3F04A 2OMUA 2X28A 1CFMA 5F7BA 4BK8A 4MSWA 1KELL 3FYEB 4HPHA 4MD5B 4R90L 2CLZB 4IOIA 1P5UA 1RZ7L 4HIIA 1S7RB 4TVPD 2HPTA 1A0QL 2WXOA 3ULVC 4LKXA 4RLDA 3MRNA 4JFXA 5I17A 3B2VH 1AXTL 4JO8A 2P5WA 2VL5B 1T80A 3X1NA 3NCJH 3ARDB 5FO9B 4ZD3H 4FNUA 3W3BA 1G6RA 1XCTB 4YS4A 3OWRA 3NCFB 5KEZA 4PPTA 3VFUB 2X4UA 1O6TA 3IXTB 3MJGX 2SEBB 4K8RC 1E7UA 1ZSDB 3RHWF 5BNXD 1EZVY 5HYFA 3D4GA 2OR9H 4R26L 3UO1H 1X5FA 1SEBB 1HCVA 5IQ7H 5LQBL 1XX9C 5A2BA 1I3GH 2ATKB 3QIWA 2NW2B 4XHQA 1COBA 4Z3JA 4N6QA 4OJDH 2Y5QA 4KMQA 1IGFH 3BOVA 1SHMA 3IJHB 4KKCD 3FPXA 4E9RA 2ZZUT 5ENWA 1SYSA 3EGDB 5DFTA 4BRJA 1U4EA 4RSVA 1PLGL 3DX7B 3IK2A 1HL5A 2FGWL 5T3ZL 1KZQA 1AMXA 4O2EA 4QHUA 3BZ4B 1TCMA 4J3UA 3CHOA 1KCUH 3KPPB 1X9UA 5ADPL 3GHBH 2C7UA 1E6JL 3RY6A 4PGEA 4BH8B 4G6AC 1RK0B 1BXUA 3AQXA 5AKSA 3GLDA 4X9FA 4NJAH 5E7FA 2V17H 3E9UA 4JDZA 4Z7UB 3D08A 3B9EA 2IPKB 3KS0H 4Z7UE 1ZS8B 4JO4H 5CMAB 1S7TA 5IQMA 4MQSB 1JZFA 1NCJA 4PFEA 4KZDL 2HH0H 3C12A 4PJHF 3ENEA 1K8DB 1TQWA 3E38A 2NY4B 4L8DB 1IC0A 4HK3N 4C59B 1NCWL 3BIKA 3ZHLA 4BRVA 3QFJA 3UG5A 3TJEH 1IFRA 5JIDA 3B37A 1ACYH 1KXVC 1KYDA 1AANA 1G94A 4FXGB 1EVUA 1EV2E 3QNFA 4PB0H 1IFHL 4WVRA 2VAAA 1YYML 2EADA 4NQSB 4AGQA 1YEEH 5F7UA 4NPJA 1D7CA 5C3TA 3WSQH 3SDYL 1KGJA 2DRUA 2VE6B 4LP4A 1ZLVK 5IB3A 4G80A 3OKKB 4P05A 3U4EA 2B39A 5I5JA 4HAKA 4IK6A 1SMOA 3O6LH 1G5AA 4U1MA 4G7RB 4H1LA 4NZFA 1I7UA 3BAEL 4IBZA 3EYOB 5CINH 4ANWA 4B9YA 4Y88A 4AMKL 4EBQL 2H6UA 5FOJA 4GSQA 2A7BA 2XNAB 4L5FL 3V10A 5TE6L 1QTYT 1KGUA 4KJWC 4RGNC 3VXSB 3L4WA 3VXSE 1KGCD 5D7EA 5DHYA 3X1FA 4XP1L 2ZX7A 3BX7C 1DUYA 2XTSA 3A0OA 5EF3A 1PKOA 2VM9A 3O3UN 3UTSE 4WTXA 4YFEA 2OSWA 1KJVA 2UXVA 4DKTA 3TBBA 2X70B 2WNGA 5FGBA 1WC7B 1IAOB 2QSCL 3GD1C 1VGKA 3ABKB 4PVBA 2GW5A 3C9NA 3VWKB 2Z3FA 2YWZA 1MLCA 2E3VA 1HX0A 4RGMC 4DVBA 4NC1E 4JLRA 4XNBA 2BSED 5HI5C 3RVVC 2WXHA 4F9PC 2QLVB 2H2PC 4M3KB 2YD2A 3CSPA 1KCSH 4WWKB 3IJSB 5C7XH 1WIPA 5JPMC 2PTTA 2Z91A 3AS3A 1MCIA 1WZMA 1YEWA 4DP7X 2CDGA 2HX9A 5DC2A 4U6YB 3RPIA 1J1OL 1YEGH 2KLTA 4Y4KA 1ET8A 1BD2D 2W92A 3B5GA 3K2MC 5JZ7C 4PGCA 4JDVA 1TVHB 4K9EC 1QFUH 3Q9PA 3ZTNH 1DJYA 3H9SA 2ZWLT 4XC3H 5FWRA 4ODUB 5MEND 2ICWA 2XACC 2VKWA 1FG2A 4QHMB 2YQBA 3VW3L 3RP1A 3N42B 2BHFA 1LTXA 2CKNA 5HDBF 4P5MA 3ZKXC 1WWWX 4OF7A 5G4NA 4YWGL 2NNCA 2GBVA 4A6YL 5K39A 2JSFA 1JFHA 5KJ4A 3WMSA 5HYQA 4LVEA 4OJFL 5L88L 2BSTA 1NKOA 1A14H 4LPTA 2NXYD 2Z4TA 4AQEB 5DS8A 2YAQA 3F7PC 2YPLE 2YPLB 5HHQB 4PRIA 3MV8D 3OMNB 2N0KA 5TPWH 2JKRM 4FTVA 4PJFE 4PJFB 4JFQB 1A21A 5EUOF 2OMVB 2D4FA 4LASH 1YUHB 3L4XA 4AQ1A 2JIXB 3KGUA 1XSIA 1FL3B 5B8CB 2W60A 1PJWA 1THAA 2M26A 2A73A 4TL4A 4KK5D 4HGWA 3QJXA 3V6FB 5ABDE 5J5EA 4K94H 3HB3D 3MJ9L 1TTCA 2ITCB 4NQDE 1UWGL 4NQDB 3VYNA 4HFWB 3BT0A 1YQVH 5EB9A 5SWZD 5I8OH 3AY2A 4IU3B 4BCXA 4UT9H 3I6LD 3VGFA 5BVPL 4FYRA 5I74C 1IM9A 1O75A 2F1AA 1SOKA 3SDDD 4HS3B 1LO2L 1RHHB 2XG4A 4X4XA 4EI0A 4Q6IA 3S5YA 3DTXB 1FN4B 3SKUD 1H3GA 1CDCA 2P8LA 2EIMB 4BBWA 4DKFH 1CFQA 3C5SB 1IJNA 3V9EA 4AQ8C 3GI9L 1UJ3B 4TUKH 3GBDA 5E2TH 1NLBH 4JNXA 4X5RA 1IBZA 1O6VA 2F5BL 4X2UA 5HHPB 1OGPA 2F53D 5ACLA 1TSHA 4QRFA 3UL4A 3VD2A 1KYUA 4MBRA 1MVUB 1JPST 3SJVA 3UYOD 4QRAA 1LE5B 5DJYA 2CIKB 3BCFA 4OZHA 4OT1H 3IETA 4CW1B 1DVUA 2EH8H 3CSYA 1D9KA 4JHWL 3ATBA 2A6JB 1I1RA 3NAAL 2VDRB 1N3NA 2AHIA 2E59A 2XZAL 1NCCH 5T3XL 2EC9U 1F6FB 5I16B 1HXMB 2DD8H 1Y18B 4MCZB 3SPGA 3ULUE 3RGVB 2ITEA 5CCJA 5FS5A 1XCXA 2MNUA 1ND0B 5CEXA 3CUPA 3VU2A 4PJDE 2VDNL 4PJDB 4PP2A 5FIEA 5FYLE 4YSCA 3VFOB 1QO3B 2NX5A 1Z2KA 3KWWB 1T0PB 1Z5LA 4L8SA 5DMYA 3T65A 2WZPD 2ADIB 4JE4B 5I1JL 4LVHB 3S37H 4IGBA 3RB5A 3EOBA 1RUAH 1J5IA 1V3LA 3LQAL 4HH9A 4YHKL 2Y1AA 3EO0A 2J8UF 2WMPB 4WV1B 4D0DB 5K69A 4WFGE 3CFEA 3T0EE 3CVHL 3T0EB 1HHGB 2OTWB 4HMCA 5GRWA 4FKHA 4LSRL 2WCGA 3CVIL 3CXHK 2B2XL 3ESUF 4GRLC 4XZUB 3RWIA 5JR1H 4HIXH 1ZHKA 1DZ0A 5EO0B 4LLYA 1FO0B 3D69B 4I5BA 4JY5L 3BPNC 3TNMA 5LDUA 2Q7NA 4NN5B 4X5XA 3H42H 3C5XA 5JA8B 4LQFL 4W9FC 4GG8B 2WYTA 3VXMA 3QAZC 3ZE0F 2X1XR 3FRUB 1IQWL 1A9EB 1ITCA 5B3NA 4PRPA 5DFVD 3C5JB 3DETD 4RFEA 5CU9A 1DUZB 2Y2TA 2XICA 3H1ZA 1HJBC 1JTPA 3Q8CA 3IE4A 4Z8FH 3L9RA 4FQXD 4S1DC 4Y4FC 3ISYA 3ZZ1A 1KFGA 3L7FB 4YFLF 1S9YB 1OAUL 3MLSH 1HI6A 4OCLC 5EOQL 1VERA 5T1DL 3VFGH 1T21A 3P73A 4HBCL 3Q7JA 3S0PA 5DK2B 3BKYL 4HD5A 2AV1A 1OQOA 2NTSP 3DX1A 3Q6GL 3MYZA 2H45A 4JHVA 4OVVA 4LSSL 2RAMA 1UD8A 3UPCA 2V3EA 3C60C 2DQEL 2ED8A 2DQGL 2HTKC 1EZSA 4H2AA 4FL4B 4AGNA 4H5SA 2EYTA 1KBPA 2JI3A 3RTQB 1CLVA 1SVBA 2YZ1A 2QFPA 1WHPA 5FECA 5HYEA 4ATWA 4PMFA 2I60H 3H9HA 4S1QL 4P2CG 2B4CH 3D9AH 2DM4A 1HTYA 3QZMA 4LVOC 1J0IA 5JPNC 2D31B 2VISA 4JRYE 2AGJH 4JRYB 4TUJB 5TQ2H 4FD0A 1ZLUK 4XPFL 5JMRA 5FYJL 3IMRA 1KB5B 3NGBB 1B3JA 4PR5A 5I6OA 2X1OA 2XN9A 4XBGA 3L1OL 4KHXL 4BXSV 4EI6B 5C0JB 5CR8A 2Y23A 3MJ8B 1KXVA 2GSIA 3X11A 1RK1A 3GRGA 4KXZH 2VSKB 5EHFA 1BZ7B 3FUEA 3QJHA 4ZQTA 2BFGA 2VDRH 5TDNA 1OP3H 4MNQA 4M03A 1GKEA 3FB6B 4R97B 1PZAA 4WO4D 5LCVL 4K15A 1T2QL 2DWEB 5E1QA 1G7MA 3X12B 5J57B 2P80A 5E4EB 1EIBA 4JGNA 4U6XB 4IOSA 4PJ7A 1FV1B 5D2LE 5D2LB 3EYVB 5K59F 1KXQA 2UUDH 2H9GA 3T0AA 4PYGA 1B90A 1OGAA 4G2AA 3G6JF 1E8WA 1J0KA 2NY0B 4OF6A 4ZW3A 4HH8A 2XWTB 2GHZA 4HIEA 1PEZA 1NC2B 3E2HC 5T33H 3V4VL 3SN6N 4BZYA 3AREB 5F3FA 2GJZA 5B1JC 1ECYA 2ADGA 3SDAB 1X9QA 4KTEL 3L1EA 5D1QD 2WKOF 1F86A 4XODA 5CN1A 2JCCA 4NSKB 2XJKA 5DUJA 2Z65C 3GXDA 5AW9B 3CPUA 4FJZA 4HHAA 1NC4B 2MMXA 3LN5A 3NCYP 3QHFH 4YR6B 3WLWC 1FO0H 1NAMB 3CFJA 3SY0A 2NZ9D 3N1MC 2NYZA 2UZXA 1EGJH 2P26A 3W81A 4H8UA 1OOWA 5K5YA 2X6VA 1FH2A 4LQ1A 1HVXA 4NQCA 1NCNA 3QZLA 5T1KD 2VZTA 2FO4A 4F9PA 1YRKA 4NO3B 2DYPA 1RZJC 3U9PH 3CSFA 2XJLA 4P4KB 3VVVA 4H26B 2OMZA 3ZSTA 3L48A 2R9HD 3FQNA 1CO1A 3F7KA 4ABUA 5JPMA 4HWBL 1T6BX 1JUFA 2A5UA 3P2TA 4RBPK 4WW1A 3BMVA 1G7QB 4DHLA 3BWSA 4KRPB 5D2NE 4FNSA 5D2NB 3QEGH 4JG0L 1AQMA 5FUZL 1QFWI 2CDFA 2WWMC 1CLOH 1CFVL 2BO0A 2QLYA 3KYOA 4IMLB 4UZSA 1ADWA 4ZFOB 3RAJL 1ZEAL 2XQYG 2QGBA 3PL6C 1R46A 3FH5A 1SBBA 4AYDC 1NCHA 2A83B 3BP7B 4ODBD 4L2YA 5EBGA 3UFIA 3SDXE 3SDXB 2XZQH 4C57C 2MKWA 2NY6C 4Y1AE 4N4YB 4Y1AB 1KC5L 3R8BB 1FNEA 1I4FB 2WLYA 1A6VH 3H2PA 4OCSH 4MMYB 5A3ID 4JFPA 2E9WA 3IGFA 4ZTPH 5CJQH 1S3KH 2O4EA 4EIGB 1F13A 1UCTA 3RJQB 1W8OA 5A2AA 4HLZH 2V2XB 4PWEA 2DYSB 3VH8A 4KVCL 2VN3A 3TEYA 1AR2A 2COVD 1IT9L 2X89A 1B4JL 1CDIA 4X8JA 3OKDB 3HTLX 2R2HA 2AJ3A 1AIFB 4KKZA 3MRFB 4FN0A 3I9GH 2X4TB 1T0MB 3FYIB 4L4JA 2VUYA 3IU4H 1SJEA 2RIKA 2WBJC 1LWRA 2XC8A 3JWNC 3ERXA 2ZUQB 4RCAA 5H37A 3RUGA 3V0GA 3QEHB 4JRLA 2DMHA 2X4QB 2ZE0A 1ORQA 3QNXA 1BIIB 4NS0A 3Q2CA 3IKCB 1E9OA 3DOIA 4ORGB 1TQUA 4TSBH 3JBG7 2G60L 2AK1H 2ARJB 3ZX1A 4AQ8A 1F6AB 5C7ZA 3FU8A 1AHKA 1CGUA 1XZ0A 1BAWA 3VMPA 4PJIE 4PJIB 3RJOA 1DVQA 4NXSA 4O51A 3ISWA 3MACH 2DWDB 2WW8A 3TEXA 1S7QB 3O2VH 2XYBA 4AGLA 3HBZA 4UOQA 3WDIA 5E9DA 1MRDL 1U33A 1KPRA 5K33A 4J2QA 5EF2A 1BYNA 4E41A 1NAMH 4W9JC 1NM9A 4KGLA 3ZE1F 1OT2A 2ZUWA 4EPSA 4WZ9A 5HTSA 4C58B 5FWQA 3PE9A 5LG6A 1P9MC 4Q4IA 5E8EB 2YGQA 1N5AA 2R27A 1LD9A 3HN8A 5KVMC 3QUMA 3E7JA 4JVUA 1UOWA 2R1YA 3IRPX 1KIUA 1SEQL 5KBPA 1FVEB 2PYFA 4DK5A 4HJUA 4BSVB 2BJML 1JGDB 3B9KD 5JORA 4Q2ZA 2W65A 1QZ1A 1IEAA 2AJYL 2X09A 3O8XB 4Q6YA 2NY7L 4WDIA 2UZIL 1I85C 2AMGA 4NO5A 3VRIB 1BQHA 1E50A 4N2EA 1ADQH 1FNSL 5IW6A 1ORSB 4MLIA 4ERSH 3PIQA 2MEJB 3DYOA 1CTMA 3QUKB 4OFKA 2FX7L 3LPGA 5CWSA 3HW7A 4G42B 4GRLA 5DMIL 1T1WA 5EZIL 2NCMA 3VI3A 3U6XS 1MH5B 3MCLL 2OZ4H 1UM5L 1ZLEA 3ASOB 1FORL 3V4PB 4A1RA 2APWA 4XCYB 1CXLA 2DOCA 1CXIA 1WTLA 3V0WH 5I1DA 1U91B 3HN3A 4JMNA 1T0NB 4TOYL 4TULL 4JANA 3OHMB 4IKLA 3MR9A 2ORBH 4KDWA 3JTSB 1H6UA 3S3CB 1RIHL 4N9OB 3TTSA 3KYKH 4YDIH 1S7WB 4MNGA 3O45A 3OKMA 4F27A 1WA2X 2NUTA 3EW3B 1YEIL 1AGCB 4Y4HB 1E4HA 5I76B 5K1NA 3V6ZA 1A4CA 4KKQA 4N0RA 4QWWD 3L9YA 4Y4FA 5FO7B 3D2UD 3DX8B 4F3FA 1IGJA 4ZS6C 5AYTA 3A3YB 1AZZC 4P23C 2HT2C 1BQLH 4TTDD 4CMHC 3LOWA 5FGCB 5FGCE 4OTXH 1SVZA 4MB4A 3VFRB 2XWXA 5F93C 4YZWA 1JPGA 4RMRA 3FUFA 3QXTA 2B1HL 4U3XA 1Z5YD 1BZQK 3F5WA 1VAHA 3BDYH 3GMLB 4APQC 2PO6B 3C60A 4QXUL 3UROR 1GS8A 4HA1A 2QBWA 4EI5C 1EMTL 3S35X 4B95C 2OYMA 4PJ5A 4N2OA 3A4FA 2BIHA 1II4E 2YKLH 4TUOB 4GINA 1QRKA 2A99A 3CFBB 3NJGA 1YCSA 3KLLA 3KNBB 1RZKH 2YPVH 4LL4A 4RRPG 1XO8A 4XNYL 4M02A 2Y22A 2FATH 2AJSL 3ARDC 4M7LH 5DQJB 5TDOA 1KCVH 3IF1B 4F5CA 2F58L 3SQBB 5JNYA 4BFOA 1GSMA 3FU7B 1IM3A 3WGVB 4BQ8A 4OZIB 4OZIE 2WP3T 4JPVL 2Q3XA 3CVBA 5L7XH 1Y6KR 5HI3D 4BH7A 1E42A 5DURD 1GTFA 2ZXEB 2ICEA 2L7JA 1CG9B 2D2CC 1T04A 4LHUB 1IQDA 5DSCA 4MDJA 4LLDB 1JZ2A 2D9QB 3NJIA 2BXYA 3PF2A 1K5WA 1V8HA 4D3CL 2NYKA 4EZKA 3DOHA 1G1KA 1LEKB 4NFCA 5B38G 3DROB 4PY7A 5AVRB 4OBSA 5B1JA 1MRFL 1T7ZA 1PL3A 5TE7H 1MFNA 1ZJAA 2JQAA 1XMWA 4NO0B 1QFWL 3O11A 5ITFA 2JB5L 3EFDH 4TPRL 3S3PA 1RCYA 2VLKA 5I6KA 2BMKB 4BFIA 4WK2B 3V7AE 2NNAA 1HJCA 3WNNA 3IDGA 1JZ3A 2WWKO 2YOCA 5IUCA 2H26B 3MFFB 3O2DL 5KSBE 5KSBB 2NY4C 1DTUA 4JKPL 4UOJA 3LKRA 4BHUI 1CICC 4B50A 4O02B 2H1LM 1CFSA 3HZVB 1KYOK 5F7MC 2X88A 3BEVB 4GKSA 4ZPVB 4FXGC 1KTRL 4S0TD 3ARBA 1YMHB 5GRYA 3BKML 3ZDYF 1RZPA 2Z1KA 1QX1A 4MVBD 4HWEH 1HCYA 2GJ6B 1DBAL 2GJ6E 3HN5A 1TZGH 3QDJB 4H20L 5I15L 1UA7A 2GSMB 3CPLA 3W0WD 3V8OA 2P24B 1OAKH 4U1LA 1U8NA 4HLJA 1DE4A 1QWHA 3BDBA 1TEGA 2AJXL 3DUSB 4LOFA 1T66D 4HKZA 2XFXA 1GY2A 4X0KB 1X5YA 3RJDA 3SE9H 1UFUA 2DTML 4D94A 4HC1L 4OI8A 1ZPUA 1QYGH 3DI2B 1HQRA 3PL6A 3TZVB 4I2XE 4I2XB 4ODWB 5D1XC 1MF2H 5E4OA 1YDPA 4F7CB 5E6YA 3GB7B 4XOEA 4I48B 4N8CL 1MQKL 3NFNA 3GK8H 3F7YB 4KHTL 4LFHG 4DN3H 5JIIA 3J8F7 4MMZC 4I4WB 4LPXA 3BDXA 2B7DT 1UKTA 3H3PL 1BAFH 8FABB 3JZ7A 4EUPG 1B2WH 4UAHA 1MCSA 2P5PA 3MRJB 3MV8A 4KTDH 3QYMA 4JN1H 4U1IA 3AGWA 4OZGA 3WGUB 1IB5A 3GZKA 5J1TC 1DFXA 4WI4A 4DP2X 2HUHA 2L3BA 1M7DA 4JRXD 5DUPL 3RBGA 3HC4H 4I0PB 3Q1EA 1OSPH 1NPJA 1O7DC 1SMAA 5EEXA 4MJ6B 4NCC1 1PQZB 1X4XA 2WBJA 2XCMC 2J6EH 1JRHI 4Z5RB 2Z8SA 5GPRA 4P2RA 4TSCH 4UM9D 4CNIA 4X6FB 3GRWH 4PW9A 1KIQA 2G9HA 1L0XA 3RWCA 2B14A 4M8RA 1DLHA 3GINA 2PPCA 4PRBB 5IBLD 3DHPA 1DSYA 3ETBF 4YHOL 3D48R 2OKMA 5A2JH 3IFLH 5EN2A 3AZUA 2BNQD 4G70B 3GJEB 5AVZB 1SYVB 2FWUA 3LQMA 4G9FA 1WWAX 2CBOA 3UYRH 4PLKC 2FJFA 5FV1L 3TBSA 3JWDC 1I8MB 4K23L 4OQTL 3QG6A 2CH8A 2TAAA 3AS0A 3OZLA 4M1GH 5KVFE 1GMEA 4DEUA 4DKDC 3V2AR 3WKYA 3NSFA 4BZ2H 2HG0A 3BO8B 1E43A 3FUNA 2NCEA 2GBUA 4X7SH 2HKAA 2ZCLL 3QPXL 4ZMNA 2DM3A 3MOAL 1SJMA 4LPVA 4H13C 1CD8A 5JIMA 2DQFA 5HJ3B 2R0ZL 1QSFE 1QSFB 3P1VA 4IMKC 5CJ5A 5CBAA 4KVNH 1CGWA 4JQXC 2VXUL 2JJWA 1KBGH 1CE6B 1N70A 1M53A 5JW5B 2OQJA 1C1EL 1I85A 1JV2A 3GSRB 5BVJA 5LGJA 1RXLA 1XZWA 3KPLA 2DEXX 4OV5B 2N1KA 4D0BB 3BXNA 1JWSA 2G5RA 4EJ1C 1HESA 3MRHB 1WFNA 3QUXB 1L5GB 1AGBB 1I9JL 3G08B 1TJIH 3DIFB 3KWTA 1CDGA 3LEYH 1IC5H 1F0LA 4MJ2A 4XE5B 3V4UH 3PJSA 3QIBD 1MAKA 3LHPH 1MLBB 1PKQE 1PKQB 3WFCL 3Q2NA 2XTLA 2OYKA 2KPWA 2BNRD 3G6DL 1Y7VA 3KPMB 1X5GA 4QHNB 4ZZKA 2L8AA 2YD0A 2GUOB 2RJMA 3KXFD 1K8IA 3LAFA 2WZ5A 3NVQA 3B2UC 4P5TD 3WY1A 4KKLD 4XPTL 2WWOA 4F37F 2XT1B 4I3SL 4I1NB 1B88A 4JFEE 4JFEB 3PWUA 2WXJA 4OUUA 5IVZB 1HN1A 1MREH 1A6UL 4IBWA 3WHXB 4P23A 4G7YH 2WC7A 1U9KA 4PJXA 3DBXB 4NN7B 1S7SB 4FCAA 3ELAT 5FA3B 5D7KE 4XCCH 3HC2A 3UTTD 1UJTA 4KKBD 5FDYA 3REWA 4F15C 1OTTC 3SKJL 4APQA 2QGEA 2CM5A 1T1ZA 3OLEA 1B0GA 1G6RL 1SXAA 4L4VA 1B0WA 5E70A 1E5ZA 5SX5H 4W4OA 4NQTA 5DC0A 4LU5L 4WV1C 4ETQB 4N0UE 4N0UB 3S5LB 2MQ0A 2VLME 3QI9B 1L0QA 2ZOKA 4WRLA 5LBSH 2EVHA 1KJ2L 1HWGB 5BRZD 4HOWA 5EBMA 2X2UA 4B9PA 5E95B 5IEKA 3NIFF 4U1SA 3JYBA 5FO9A 1TZHA 2OL3A 3H85A 4LGSB 5ERWB 5FYKE 1P7KA 1DQTA 5KVFH 3PV6A 5MHSE 4NN5C 3ZHNA 1NCDL 4XWGL 3MREA 1KN4H 2QELA 3QIUC 1QW8A 3BUIA 5BXFA 3QEQE 3QEQB 1D5IH 1VEMA 3I6SA 1ZSDA 2FBRA 1T1XA 3CXDL 2PP7A 3GMNA 1A3ZA 3MUGA 1F58H 2ALAA 1TKWB 2Y5EA 3PNWA 2H6PB 4Y2OB 5IIEA 2XWDA 3LHAA 3TT3H 3ZE2E 3ZE2B 4MQ7A 5BRPA 4LLUB 1BX2B 4I18B 3OG6B 1JNHB 4N8UA 3OKNB 5CEZL 5E6RB 2MPAH 5K59E 4WWPA 3L3JA 5IW3A 1FHNA 1FGVL 3P11H 4HGKC 1HL4A 3H0TA 3EGDA 4FQ1H 4QCIB 5I1GL 4ZX4A 1RJYB 1KJMA 1TXKA 5LAXB 2FEDD 2Q8AL 3JSSA 5FO8B 2XKUA 2BP8B 3ULSB 3FFCD 1GC1C 1H3VA 4QOKD 1W0VA 3BGFB 2CKBB 3HZ3A 1N0LA 2G3XA 4FL4C 5B38B 1NGPL 3HBGA 3BUYB 3L5JA 4CILA 1KF9B 1UA6L 1JPTH 3MOQA 5A1AA 5HPMB 2I27N 2LOEA 3BQVA 1R47A 4Y9CA 2VXTL 3ROLB 1BJMA 3IS1X 2Q20A 1IC7H 4MX7B 1FLRL 4OCWL 5C86A 4J7RA 3ZGHA 1KIPA 4A68A 4DJMA 4R7NB 1AO7A 3PWJA 4M8QA 1ZOXA 4MNHA 1K8DA 1RKRA 2F7PA 3S36L 4HJTA 1XIWD 4LBEB 4U3HA 1UYWL 1CF8L 5T1LD 1CICA 4HJJH 2QHLA 3KVQA 4DK3A 3PHAA 2UWEF 2X6UA 1E28B 1NFDA 4FXGA 3T77A 4QRRD 4ZOCA 1I3RA 3DK2A 5IGXH 1C08B 1FYTE 1FYTB 3QT2A 1E3FA 1XF3A 3K1KC 3VXTA 1A4JA 4R97C 4X5PA 2P5EE 2P5EB 3GSVB 3EGSA 3OR7A 4HEPA 2X38A 4OGXL 4GQZA 4OM0L 3F01A 1WAAA 2HLEB 5E4EC 3U9WA 4X4ME 2NPLX 1J10A 2N56A 4UT9A 1DDTA 2AQNA 4KPHH 3WD5H 3FBKA 3OMIB 2IDFA 3TIEB 4B6ZA 1S5IH 1U6AL 1R3IL 1DVFA 5FKPB 1LHZA 5CD3B 5F7AA 4QXGH 5D1XA 2RQEA 4ZMZA 1XR8B 3SBWC 4KAQL 3UAFA 4ELKA 4HMEA 1BFOA 1JRHL 3VXUE 3VXUB 1ZVHA 1A7QL 3WNKA 3EJYC 4UI2A 3F3HA 3SDAC 3LPOA 1HWHB 4ODSL 2X3CA 4MMZA 1N5YL 4U4IA 5KJRL 2IALB 4ZQKB 1TPXB 3KPQB 4BA8A 1WG3A 2G75A 3S2CA 1H9DA 4AUUA 2VLRA 3HLAA 1RZFL 4I87A 4K4KA 5FYKH 1O5DT 5GS0L 2H3NA 4GG6E 4N22A 4GG6B 1LQBC 1JK8B 4I3RL 4DCQB 5HSFA 5BQ7B 1SOXA 4IRJD 5FB8B 4FS0A 2BNUA 3DVGB 5FCSH 4ZUVB 3BVWA 4UINL 4K3HA 5TF0A 3TGXA 3HG1E 3HG1B 5IBTL 2F9BT 1K3ZA 4OKVB 3OZ9H 43C9A 4HLEA 3C6EA 3K71B 3QDMA 1SMDA 2NY2D 5JYMA 1ILUA 1E5AA 5AL8A 3MN8A 4XXWC 4UIKL 5I82A 5FDWA 4N8VA 1G7IA 4JUSA 4R83A 1NIBA 4ZO8A 1QRNA 2WZAA 4R0LC 4BK5C 3MLYL 2IWKA 3B7TA 2WZ6A 2GHWB 3JT0A 2JKWA 1I75A 3HZKB 3CHPA 4HIJB 1U3HD 5J6HA 1AY1H 4X50A 1CXFA 2EH7H 4AEIL 2CKBH 1RUPH 3ES6B 4WW2F 2JFCA 3B7SA 4K0OA 2FDBP 4UIMB 2WCSA 3UMTA 1RAMA 4NUJA 3TWCH 4U6HA 5GIRB 5EZOH 1V55B 2YPLA 4OI9A 1IE4A 5IMOB 3WOVA 3TTYA 1XSJA 4LOUD 1LP9E 1LP9B 3GPEA 5J3HD 3Q8BA 3K6NA 3QQ3B 3D4ZA 2AQ2A 4AK1A 1TTAA 2UXGA 5DUBB