3FCGA

Crystal structure analysis of the middle domain of the caf1a usher
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
78
structure length
75
Chain Sequence
b'PYYQWNFAPVVRGIARTQARVEVLRDGYTVSNELVPSGPFELANLPGSGELKVIIHESDGTKQVFTVPYDTPAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F1 capsule-anchoring protein
molecule tags Membrane protein, protein transport
source organism Yersinia pestis
publication title Caf1A usher possesses a Caf1 subunit-like domain that is crucial for Caf1 fibre secretion
pubmed doi rcsb
total genus 10
structure length 75
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3fcgA00
3RFZB 3FCGA 4J3OD
chains in the Genus database with same CATH superfamily
2DIAA 1IZJA 3LNFA 1QUPA 3MBXH 1AD9B 4KKBC 4H88L 1IKFH 2W59A 3FB7A 2VB5A 2NTFB 2WQWA 2X53A 3NDZE 2OMVB 4M1CD 5CMAA 3BHBA 4M4PA 2BNQB 5BRZA 5AUMB 5JOEA 2HYMA 3LIUA 2KT6A 3MR9B 2VLRD 4JM4L 1M7IB 4R97B 2APXA 2X4OB 1LE5B 2VDKB 1G6RA 4HEPA 4IIQA 4QAWA 3P4MA 1RP8A 4JDTL 4DVRH 2BC4A 4FNLH 4OZGE 1I3GH 1KPRA 2Z4QA 1H19A 2RFXA 1H15A 3HG1D 5F9WC 2DQMA 2YPVH 2F1EA 1R3KB 5E00A 3NEOA 1XF1A 2J5WA 1E6JH 3ARPA 2NY3C 5GJSH 4DPCX 4I9WE 3SBPA 4Y4FC 4DP8X 4JO8A 2V0AA 4FHBD 4PRPB 4IDLA 4NHUA 3MX0B 4U7MA 5IROC 1UFUA 2CIKB 5C92A 3RUGA 3NFSH 4HC1L 5B3JF 2V5RA 2QLVB 3GBLA 2JIXA 4XPBL 3NZHH 3P3TA 3LKOB 4JFOA 2P43B 1UJ3C 3L5HA 1GIGL 3KPRD 3VI4A 1JOIA 1KACB 4OQ1A 2ZSWA 4JZNA 5TE7L 1W16A 5C0AE 1MFDL 1NGYA 5H35A 1MWAL 5D2LA 1E9OA 3PHOB 4NKDA 3P0VL 4UBDD 4EZLA 3HAEB 4Z3IA 1JGLH 1JXJA 1FO0A 3MI6A 15C8H 2AI0L 3OPZH 3FHAA 4J4PA 1RFDL 1AP2A 2Y23A 2A9MH 2MHAB 3SPHA 3IDJB 3FUFA 4XZUA 4B27A 4HDIB 3QHTC 5EOTA 2OXHB 3BVDB 1LM8V 2UY7B 3D25A 4PJXB 2JWYA 2WN2A 1HFUA 3KPNB 8CGTA 1GGIH 1MCCA 2C34A 3HNTL 3T2LA 3QQ3B 4J3TA 2NDFA 2HVJB 4IRSB 4M9OA 4U3HA 1S78C 1A9VA 1KFAL 5AB0A 4AK2A 2O93L 2YPVL 3P3YA 3ECBA 4PWGA 2AK1H 2AAAA 2X4PB 4Q2ZA 2R4SH 5HYIA 3WEXA 3H4HA 1ZGLA 3BD4A 4KNQA 2PR9A 3SDAB 4XB7A 3CTTA 5E95B 4Y1AA 3MOQA 2PO6A 5SX5H 2WWKT 3L54A 4KNUA 4UOZA 1P4IL 2R2HB 4YHIA 4M8VA 5CR1A 4HCFA 4I48A 4XC3H 2YQBA 1NFDE 4JFQA 3JWNH 4A2HA 4YSTA 2WN3A 2WNWA 3RGVD 4A7SA 4YQXL 3B9KA 2CJUL 1UJ3A 1ZEAL 2UZPA 3BPOB 4XNXH 5MEPB 1Y6MR 3IJHB 2VXUL 3IJHA 1FGNH 1KN2H 4JFSA 2I7OA 3GSQA 4Z0BL 1BFVH 1L9QA 4KK5D 1EZVX 3AS0A 4FADA 3NSFA 4OZHA 3TGXA 5C86A 5L8JB 4Q14A 2OK0H 1MXGA 1H3VA 1R24A 3LX9A 2Q8AL 5AVYB 2JKLA 1XZWA 1C5BH 4JRLA 1YUKB 4C4KT 1RURL 2YK1H 3NAAH 2D7MA 5GJTL 5E8OA 3VG9C 3MRQA 3O3DB 1BIHA 5L7XL 1RMFH 1FSKC 4GRLA 1BZQK 5HDQH 5F6IB 2ITCA 5MI0C 1T21A 1TO4A 3QXDA 1CN4A 5EUKB 3EAKA 1HH9A 2LGNA 1WPCA 2XKNA 1R5IB 2XPGA 2J8UE 4EN3A 1VERA 1IAII 4ODUB 2FK9A 4TS6A 2VKWA 3VWKB 4FMFA 5EF0A 3VGFA 1PYWA 3IWUA 4N3UA 5MHSD 3O3EB 4JE4B 4EUPA 1ZGLM 3EYQD 2R23A 3BPLC 1HXKA 1M1SA 4JFXA 5TPWL 4XWOC 1AE6L 3CLFL 2WPGA 4F7MB 3UJJL 4LU5L 4GBXB 4NN7C 3W9EB 4QO1B 4L1TA 4PJEB 2Y25A 2Z0UA 2E9WA 3L7EB 5GGVH 3QUML 3FTSA 4GQPH 2XDHA 3RZCC 4BFBD 4M5YL 1J0HA 4LBEA 1SFHA 5D7IA 2VLKE 2XIDA 5D55A 4PRDA 4UTBA 3NFPA 1A4KA 2BY2A 2HJLB 2NYYC 2WBJD 2Y07H 1HAWA 5CP7B 2R2BA 5IHUL 3EDFA 1T0OA 2ZT9C 3SD5A 5A43C 1S2EA 2IMNA 3FQUB 3ATBA 1TTRA 1KTKE 4ZW7A 4OD3L 1GAFL 2XN9D 2AEQH 3O6MH 1CGSL 4YWGH 2AITA 1QNZL 3PGFH 5FYKH 3MGAA 1XH3A 5HI5C 2X4OA 1KGYE 3UAJD 4CJ0A 2W0LA 3W2DL 2VDNL 3BT0A 3IDNB 1JXDA 3L4YA 2VDNB 2OI9C 2R9HC 4MYPA 3ZKXC 3ZR6A 3D30A 5DUPH 5EORL 4PJIF 5DK2B 1SUHA 2OBGA 4IHBA 5I5MA 5C08B 4PRAB 5JW5A 1ZSDA 2NY4C 4PJIB 3OV6A 1K8IA 3SDYL 2IV8A 1FE8H 3ROOB 4PJ9D 4EI5B 3G5ZA 2I07A 4G8GB 1CGXA 1YDPB 1MF2L 4OGAC 3LKNA 1FVDB 2AK4A 4FFTA 3ESVF 1GW0A 2EEDA 2D3JA 2C9SA 3EFOB 3II2A 3OKDB 3U4AA 1UT1A 1XF3A 4ZTOH 3LRMA 4LCCB 1DP0A 4Y5XB 5DO2D 3SDAA 1V3MA 3D69B 4KKNA 4F8NA 4G8GD 1TQSA 2FUQA 2HG5B 4HIXH 1QRND 3D12B 2WUBL 1I31A 2YSSA 5HDBE 5JW5B 5E1GA 5KVGE 2W94A 4I9WD 5GXBB 4TMPA 4WJG3 5DU7A 5ACZA 4MQTB 4PRBA 5T3ZD 5LDSA 3QQ3A 2WNXA 2ZD0A 1N4XH 4JGJA 1YEWA 1GHFH 2LLGA 2P5WA 3FTZA 3U1QA 4IRSD 3KLQA 4W9FC 3GMMB 2G2NA 4UV4H 5BCAA 4AEFA 1FIGH 1CLYH 1FNLA 3T6VA 2Z91A 1D7FA 2O1AA 3CHXA 2CMRL 1KN4H 2Q86B 1E5AA 1WAEA 4BYHA 4U3SA 1HL8A 4X5XB 4Y4HA 3GHEL 3ARQA 3EYQC 3S3JA 5ICYB 1Y0LB 4L29A 5I5JA 3BSHA 1MFBH 5DUJA 1AKPA 3M46A 5C7XH 3K3QA 3MPCA 3DJRA 1GJIA 2OR8A 3EDDA 3QNZB 3PAYA 4QGYA 3JXAA 1VDGA 2ESVE 3E3QE 4UTBH 2P42B 1FH5L 1OSEA 2COQA 3CSPA 3K4DA 3MRFA 2BSTA 5IGXH 5E4EB 3L2MA 4DP5X 3EYSL 3EYFB 1SHWA 5BVJA 1GCFA 2IWKA 1U9KA 2R1XA 3JUZA 4NQQA 2FT7A 2J1YA 1IIKA 1YY9C 2SODB 4M56A 4S2SB 5FA3B 3ZDYE 4P5MA 4HWZB 1L0YA 3QJFB 2E46A 2GIMA 2R9HD 4LVNC 4RAVA 1J8RA 4MD5A 4TQPA 1ZXQA 1YC8A 2EH7H 4HS8L 1T6WA 4KK5C 4XAKE 1DBBL 4N1HB 5TF1H 1RH8A 2MWCA 3ORJA 1V27A 1YEIL 2VABA 5H37A 4ETYA 3UYRL 5MEND 5SWZA 2DZEA 3R8QA 4I0PB 4O00A 2BCKA 1A2YB 3FB6A 2OSWA 4UINH 3MU3A 4WVRA 1YHPA 3AABA 3BAYA 3KPRE 5LBGA 4L5FL 2CLZB 3I75A 4WFEE 1TUPA 4KY2A 5SX4H 1B2WL 2F19H 3PWPB 4N86A 2WWKO 1A7BA 2YS4A 4IHOB 5DC2A 4L8SC 3O3BB 4PV9B 4K7PH 5IV2A 4MCYB 2EVFA 4PGJA 5DEFB 5JUEL 5J1AA 4F3FB 4M5SA 4B6ZA 5GZOA 4RGNB 4KHXH 4U1IA 1CLYL 1HNYA 3EH3B 3KPLA 1EVTC 2XG5B 4LDLB 4XX1G 2VH5H 3BDXA 3V0EA 3LQZA 6PCYA 2ERJC 3EDKA 2GQHA 1A14L 5GSVA 2QVIA 5FGCE 3JQOB 1UVQB 2P28B 3VX0A 1Z3GH 5D70H 3NTCL 2E7LC 5JPNC 1K8IB 3EOAA 2WQUA 4A1RA 2XI9A 2WUBH 1EV2E 2W65A 2ZTBA 3ESOA 2ENQA 3H2WA 2CNYA 1TXKA 1N9PA 2C5DC 1I9IL 1XHHA 4GI6A 4O9HH 3ZGIA 3HS0B 3RDTD 3EFOA 3K7UA 3SKOA 2EIMB 1Z0MA 3V4PL 3IDYC 1Z6JT 3H9HB 2V33A 4EBQL 5DS1A 3D3VD 1XAKA 2VXTH 3QS2A 5SWSB 5MERB 1RP9A 2N0KA 1U8KB 1KZYA 3CNKA 3ROOA 3GMQA 4KWUA 1YEKH 4N26A 1DBMH 4ZX4A 4PJ7E 3EJRA 3IMWA 5AOIA 4WI8A 1I9EA 4WO0A 1RZ8B 4PHXA 4KKLC 2IJ0C 1NFIA 2PTVA 4XCNB 5GS2H 4ZQKB 1DUZB 3BCFA 2D3LA 4R7NB 2PMZA 2CO7B 3NA4A 4TSCH 3MA7B 1LK2B 1MCHA 1QLEB 1ZA3A 3B2UD 4IRZL 4B5EA 3J27A 3P30H 2W9EL 1AGCA 3MV11 2GI0A 1FN4A 1JFQH 7FABH 4OUUA 1EEYA 3K2IA 5T5FH 8FABA 5AAMC 1FDLL 2IH9A 2QKIC 4HG4J 3PNWB 4YL4A 4ICXA 4LPUA 4PJ7B 1SF5A 3UTTB 5FPIA 1M05A 4XAWL 4MS8D 4YPGA 3QO1A 1XR9A 1PPIA 2WWMD 4K8RL 2R0WL 4MAYA 2CPCA 9CGTA 3LRKA 2Z92A 1QPPA 4G9FD 4P2QD 3SE3A 5AWNH 1VZHA 5KBKA 2FX8H 1XF4A 1INQA 3GNML 4YXKL 3WJJC 1JV2B 1SJEB 1G7PB 3O4LA 4HC1A 2BOBA 3K0WA 4KJYB 4MXWH 4UQ3B 1CF1A 6TAAA 3IN0A 1A8JH 1JXGA 3APCA 4JFFA 4QRPE 1F4AA 4MFHA 2VH5L 3CFDB 4YE4H 5E9DB 4QPEA 2JI2A 3WHXA 5DD5L 4B3EA 4XWGH 4FKHA 1Z3RA 5EIQA 4TUKL 5C0JB 2ZOUA 3O81A 3FB8B 3SY0B 5KS9F 5FOJA 1HZHH 3M1BB 2VRQA 3O6FC 3T4YB 2EO9A 3N91A 1SYSB 4XP9L 3RVTD 1FLRL 3GSNA 1AFVH 4HWBL 4ODSH 4KO7A 1TO5A 2W38A 2Z31A 1U6AL 4GFTB 3MV9A 2NUPA 4NN6B 5K39A 5FIEA 3TH2T 3FNKA 5B8CB 2X4NA 3WN6A 1SDDA 3PWVB 4ORZC 3PWVA 3ZW3A 1IGJB 3K74B 5JR1H 1MIMH 3OZ9L 4GRLB 5HDWA 4WY7L 5H37H 2MIZA 4DP0X 3WO4B 5E5RB 4BFEA 4GOSA 4NCDA 1I1FB 1WLHA 3WFBH 2HLAB 3NCMA 1G87A 1G9ML 1X5FA 3LZNA 5T1KB 4HWNA 3ARWA 4KU1A 1E2ZA 2V2TB 1UH3A 3ARBB 4OCYL 5DK0B 3VFRB 1PW3A 2YD2A 25C8L 4IYKA 2XN9E 3MREA 4JY6B 5LAXA 4LGPB 1AZRA 1Q0YL 2WP3O 3FFCE 3MRLB 1SVCP 5IHWA 2JKRM 1NPJA 4G6FD 4EZJA 5G55A 1Q8MA 4X0NA 3IT8D 2QFPA 3S36L 1P1ZB 4S11A 3QJVB 1XSOA 3AADB 4OUOA 4QNPF 3ZUCA 5E4AA 3HFFA 4DO5A 2MQ3A 1D7CA 5I30H 5AALA 1ET7A 1KIUA 4LP5A 4PR5B 4QDGA 3SYAA 5I75C 3DOSB 1PZ5B 3GJFK 3O8XD 5EIIA 1ZANL 4JB9L 5EBMB 2NTSP 3HNSL 4MWFA 3BFWA 4QYAA 3GMPB 1D2OA 5BPPA 5JORB 4P2RE 1ZK5A 1NC4D 2W92A 3VO0A 3MJGX 1UADC 2WM0A 1HH9B 3OHXA 2I9LB 4TNFA 5EO1A 2JJWA 4FQXB 4P23B 4XCCL 4MCYA 4LQFL 3N06B 3KBPA 4M43L 2M26A 3O2DL 2HFFB 2CMRH 2CNZA 5C0AB 4WI6A 2CLZA 3MRIA 4ELMA 2QDVA 3LVEA 2WCGA 3U25A 2ZF9A 5FUZH 3VGHA 5KBPA 4MS6A 3TYGH 1GHFL 1BXXA 5EUOF 3RTLA 2A77L 5LNGA 3TZVC 3H2QA 3U0WH 4NM4H 4X7CC 5D2LB 1AC0A 3ROLA 1MFNA 3ZZLA 2BOCB 1N26A 1PNCA 3O2VL 3IKCA 1MHEB 2OJEA 4OZGA 3C09B 3W0WA 5FKPB 1FO0B 3VXME 2WSPA 1LVEA 2G3ZA 3BUYB 2J6EH 4XVTL 3W81A 3JZ7A 2MQCA 1ZK9A 2O72A 3OPZL 1QX1A 1E43A 4LSUL 3MRRB 4ERSL 3QUZC 4GKOA 1QW8A 2X0VA 4J1UA 4ELME 2E47A 2AJUH 2LU7A 1MQKH 3GSWA 1V55B 3GM0A 3GSWB 1DSYA 2TSAA 2ZOLB 2E4TA 4CAGA 4PREB 1JBJA 4X99A 3A6BH 2ZAGA 4NYLB 1H5BB 2JIXB 3ARFB 4JFZH 1CDUA 2Y7QB 2DL2A 1USQA 3K4AA 1CICA 4Z78B 3M07A 2F5BL 5JIQA 3ZT5A 4ZPVA 3LH9A 2OMYA 2AQRA 1II4E 2YUVA 2I85A 1UA6H 1YPZA 2ZKXA 4O5LL 4EOWL 2ARJA 5CEZD 4UZUA 1YEFL 1OTTD 2FR4A 4KQ3H 4G3YH 1KBPA 1BQHG 1KXQA 2RACA 3DV6B 3MRPB 2GCYA 4TQEL 5DVOA 5BXFB 2FZ3B 4ZMWA 4LGSB 3FQ2A 2X9YA 3G6JF 1IEAB 3PL6D 5HVGB 4AIXA 3I2CL 2YC1B 5BZDA 4QRRA 3HZ3A 3JV4B 2Z91B 4W70A 3SDDD 1Z2KA 4XAKD 5EB9A 3IGAA 1YJDH 3RJOA 3LHAA 5HYSG 1OAQH 4JM4H 1JI1A 3JUYA 5ITFB 1VZIA 4S0SD 1KGXA 1PKQA 5DUML 4DH2A 1IIIA 2X6MA 3TT1H 1ZOXA 1BVKA 3DNKA 1K2DB 4FP8L 4HT1L 5E8OB 4Z0XA 5JW4M 1AACA 1B0WA 4O2EA 5E1QA 2YD3A 3F01A 3UXFA 1HHJA 1XL6A 5BMFH 2L7EA 4JANB 4XOAA 1JVLA 1PJ9A 3KNBA 4Y2OB 5ISZB 2R8SL 2BSRA 5LWYL 2BY3A 4AVIA 4E42B 2IOIA 1QSFA 2NY5C 1KJVB 4ZDHB 4B41A 3VJ6B 2IPUK 2XCMC 4UOW0 3RPIB 5IQNA 3LKSA 4HF5H 2O26U 1MVUB 2EZ0C 2C9RA 4Y4HB 5AW8B 5K93A 2XXMB 4YSSA 5JO5A 3VXSA 2WQVA 4AEEA 3WELA 4Z7UF 1U8OA 1CDHA 3FOLB 1G9MH 3FOLA 1T7YA 4V2CB 2E75C 3NCWA 3R0MA 2NNRA 4U1NB 1CDJA 3D1MC 3V5DA 1MY5A 3UG5A 3HHSA 5T3XE 4JHWL 3O9WC 4JQXC 1HILA 1LWJA 1MOEA 5SX4I 4TLTA 3LRHA 3PQYD 5D5ME 5I6PA 1C5BL 2YD5A 2ZNXA 1S5IH 4PRDB 2R1WA 4N2AA 1OANA 2FDBP 2FQEA 1I9RL 4ZW5A 2DQEL 4TV3A 3NSYA 5GRYA 1C1EL 5FXCH 4WW1B 3PP3H 1N2RB 1O9VA 5FYLD 1IQWH 4H0LC 4U1IB 1V8HA 1XO8A 5I19H 4X7SL 3WFCL 1LO2L 1CFMA 2O5NA 3GO1H 2Y5TA 4LSQH 3HC4L 4AQEB 1OPOA 3QRBA 1VSCA 4FTDA 5HHMB 4OZIF 1N8ZB 5DJZB 4AQOA 4N0RA 4BZ1H 3WKNA 3A5VA 3DI3B 3Q0HA 4HEME 3TOPA 2CBOA 4MA3B 3SYCA 4B9JA 3VFSB 1G7MB 2HJLA 2DWYA 3UTPD 4P3CH 1Y7VA 2WZ0A 1WZKA 2VZUA 4PJFF 1AIFB 1QKZL 1FVEA 1MCJA 4N0UE 1LD9B 3BO8B 1VEMA 3AQDA 4BIKA 1JF1B 1IC0A 1C7SA 4L2LA 5DA4A 4PJIE 1Q9WA 3SJVD 5HI5D 4G8AC 3TO2A 4OKDA 1JTPA 2X7LB 4FTVD 5I8OL 3NCJL 5T5FL 4PJHE 1M2OA 4WGWB 4P59H 5IW1B 5DRNA 4I3GA 3WIHL 4Z3FA 5TDPA 1RZKL 4V11A 1WISA 4KZDH 4NYLA 5K1NA 5BJTB 1IFHH 4IU3A 2Q2EB 3V6ZB 3F04A 5T3XL 1FGVL 1W0VB 1ML0A 1CU4H 1DVFA 2JTYA 4N6RB 2H8PB 3BUIA 3DTUB 4N0UB 2G60L 1IKOP 2JQMA 4HSCX 3H53A 1URLA 4L0PB 5CLTA 1JGVH 1ERNA 5DI8A 4PW9A 4KH2A 3FQYA 4FI7A 5E1AB 2QQKH 3VXUB 4PTTA 1UWGH 4BZ2H 3W0WB 1AO7D 4E0RA 1CE6A 4LP8A 2Y1VA 3RX8A 4PJHB 2AXFA 3KLLA 1AD0B 1CK0L 3IFPA 5C0BB 3ZT6A 4KVCH 2NYYD 1CR9L 1BM7A 2PO6B 4G6AD 3E9TA 3D85D 3FTGA 5IM7A 2NZ9D 4H5SA 2BNQD 4B9FA 4IMLB 3BUTA 2AQSA 1BVOA 2ESVB 3LNEA 3VTAA 3HUJF 4YBLB 5B1AB 5IB5B 4I7ZC 3VXMD 1OB1A 2A6IB 4CN6A 3ZDZE 4MNGA 1KEML 5L4IA 2IGLA 4KX8A 1I7RB 3HPLA 3MDJA 2V2WB 3WEXB 1IQDB 1TU2B 1B4LA 1DUYA 4QUOA 5B1CA 2NLJA 1QYGL 4KDWA 4HWEL 1DJHA 1A6UH 2VR9A 2GJZA 2HCZX 4QR7A 5EOCH 3MOBL 4F57L 5CWSA 1CFNA 2JKNA 3NIFF 3KR3L 3OJMB 3UBXG 4HIJB 3PL6C 3QNFA 3RFZA 1RJCA 4P4RA 2BXZA 4BE6A 1E3ZA 3NEEA 1DANU 3QG7L 1TZGL 2EDKA 4X4ZA 3T1FA 4PB0H 1NIFA 3GI9H 5JXED 1RZQA 4LL9A 1CLOH 3KGUA 5DUBB 3D33A 3GSQB 4JN1H 5GRUL 5IOKA 4RWYL 4PD4J 1VKXA 3SO5A 2Y06H 1I1AB 1SXNA 1WC7B 4OLXL 2ZYHA 1AKJB 4S1RL 3FQTA 3IDGB 4IOSA 4LSRH 3X13A 1KMGA 5LGYA 4FXGB 1OALA 1W15A 1E4XL 3WJLA 1NC2B 1P6WA 3GBMH 1IGJA 1QFWI 1DR9A 4YXLH 3GTTA 2CXKA 2AQTA 3CMOL 3PHQA 1IEBB 5FM5O 4EQ2A 4I18B 3QK0A 2ODIA 5JOFA 2CH8A 4AKPA 3HG1A 5F7HA 4QTHB 1YMME 3QDJB 3RY6C 1BX2B 1R3LA 4F24A 5JTWA 1GXEA 5IR1B 4PWKA 2GTWA 3BXNB 4U6VH 1Q0EA 3H7BA 4OLEA 4XNZB 3I3EA 1HKLL 3CFCH 3VRJB 4H8WH 4PSRA 2LFEA 2FH8A 3Q6GL 4OZHE 4Z77B 2B4CL 2IOOA 1HDMB 3BRGC 5F21B 2XBZA 4RNRA 1XBDA 1SEBA 1UKSA 3MV7B 3NGBC 5IVXE 1F18A 1PG7H 2RBLA 4OZIA 2VN7A 1F3RB 4KGLA 4E9WA 2GAZA 1MCPH 3N40P 3BUDA 4OF8A 4G8FA 4XBEL 1JF1A 1DDHA 4WFGE 5EZJA 2B39A 5CBEB 3TNNA 1P6FA 4BXSV 5ID0B 3PGCB 2Y5TB 4UM8B 1A6AB 5IVZA 2PF6A 1HZLA 3ZTDC 2E74C 1UXWA 2X4UB 3ETSA 1G6RB 4L4VD 5EFIB 3WY4A 4MA3A 2Z8SA 3WMQA 4JMNA 1QFHA 3X1FA 3UZEC 5IROD 5I5RA 1U21A 1NWPA 5JIPA 3JWNC 2ZXEB 4FZ8H 2NY5H 4RVBA 4UBDC 1WGVA 4JKLA 2UY6A 1YECL 2F68X 3EO0B 3GBML 4MZ3A 1ZA3B 5MHSE 4GG6F 4B5ZA 5LGJB 2NNCA 1UD5A 4XPGL 3K5RA 2CGZA 1O5DT 1T2QH 3SSGA 1OPGL 2IAMB 1FE8L 4DETA 1I53A 4LLAA 4WJ5A 2HX7A 3BKJH 3K0YA 1VFAA 1AQDA 5HHNB 3UZQA 4FG6D 2JKSA 3EOBB 4GXUM 4PJAB 3QXTA 3FQRA 5CIPH 2E7BA 4MJ5B 3QEQD 3QO0A 4ZQKA 3QYCA 3SQBA 4L2YA 4O2CA 4DZ8B 1WA1X 1YEGH 3FBKA 4JHUA 3CPLA 4I8DA 3WMPA 5H2BB 1HX0A 3UTPE 4UANA 4KKBD 4D0DB 2KHAA 4DO4A 5JHDD 1XCXA 4TUOB 4RMWA 1B6UA 3PWUB 3ILPA 3WDIA 2FQGA 4IQHA 3HAEH 1IARB 3VB9A 3COOA 4YWGL 1LO4L 4OB5L 4RAUB 4WEMB 4DOHB 5AB9A 4L9LB 4OCRH 2OAAA 1AZCA 1J8HA 5D2NE 3MJ6A 4PJAF 4V1DA 5IFHH 2CGYA 1IE4A 4JY4B 3S3PA 1T04A 3KPSA 2J72A 4ZJ9A 2RAMA 1YO4A 4Y7OC 4F37K 2WKOA 3T6ZA 4G3YL 1J05A 2FWSA 4R26H 1S8DA 4I48B 1IZKA 3N9GH 1TEFA 2GC4C 2L7UA 4F7TB 3MV01 3KLHD 1Z5LB 3CFEA 1CXEA 3PQYE 1KNOB 4MKTA 2PWDA 2F5BH 1JYWA 5EC2B 1JGUL 5CINL 1N5AB 4FEMA 2ZKHH 1ZVSB 3LQAC 4XNUL 3O6KL 5BO0D 1U3ZA 2BVPA 4HLZG 4IK7A 3FW6A 1C12A 3ZL2A 4WFFE 2YGPA 1A47A 1UWGL 4HU2A 4WSKA 4X2UA 4M7ZC 1MQKL 4MNGB 2BHYA 2BXYA 3LSOA 1KLUA 2O5ZH 1FFRA 3WBDA 4AE0A 4ZMZA 3ZN6A 5DQ9A 1DBKL 3GRBA 1BZOA 4P5TC 1XGYL 2GKIA 4ES8A 4LVOB 3F12A 4X5PA 3P3RA 3NACH 2XSKA 5EUKA 1KTCA 1OEZW 1GH7A 2P46B 4UM9B 1BX2A 1R3LB 1WFNA 3FT1A 4HS3B 4HPYL 1DEEB 3OM3B 4UTCA 1S46A 2WWMC 2YD8A 1T1ZB 2YN5A 1F8TH 2FLMA 4P59L 1AKJD 2VL4A 5IMOA 4Z77A 3ARGB 1UC6A 1WE5A 2UYLB 1F6AA 2OCCB 3MROB 4UM9D 1E8WA 3AWGA 3U9PH 1Q4NX 4JFTA 2J43A 3AXLB 3E8UH 1W72L 4FCHA 2DV6A 3IDMA 4NPJA 3Q13A 1RPQA 3AREA 3HVDA 3KE0A 4FNPA 1ZGLP 1CXIA 4RMQA 1QO3A 5E03A 5F2FA 1SOXA 5E6IC 2JFCA 1HWWA 3VFUA 5TDNB 3OF6A 4RRPG 5AVQB 1T7VA 2CJUH 3B7RL 4NUGL 3AQXA 4CC1A 4QD2E 2H2SD 4QLRA 1YPZF 4TVPL 3T0EE 3VXTA 1U92A 4P4KA 4KTDL 4KY1L 3TN0A 5IHBA 3HC4H 5DMIH 4QO1A 1SY6H 1XFPA 1TNNA 2FWOB 1RSYA 1PSKH 3HCVA 2QSTA 1U8HA 1X7TA 3HKZA 4E9TA 2BVTA 2GAZB 2RCSL 3WIFA 5C9JB 5EA0H 1KB5A 5DJYB 3VTMA 1TJMA 4LU5H 5KVDE 2YRZA 1EHLL 4L37B 1PYWB 2EUWA 4PRIE 2Y7LA 5DHEA 5D7IE 2NY2B 3ZIYA 3TEWA 3D7PA 2CKBL 5HI3C 1K85A 2HTKD 4KZEH 5L4JA 2WBJC 3DBSA 4FQXA 4P23A 3KYKH 4DHLA 3QQDA 5C0EB 5L9DL 1EDHA 3RX9A 1J5OH 4IRJB 5AVVB 3ZK0A 3PU7A 1YMMD 1FYTE 3QISA 5GS0L 2BVOB 5DDHB 2DQCH 4I9XA 3HKFA 4PRHA 3THMH 1AIZA 2NY6D 2F8XC 4HCGA 3H9SA 2VDOH 3MBWB 3UFIA 4FYRA 3QP3A 2OMTA 5IK3B 1HQ4A 1VFMA 4F2FA 5EFIA 3SKNA 4Y8DC 4QXGL 3SZ6A 3ZXAC 4JPWL 1ZDSA 2VUOA 2XNAB 4EI5A 4GP4B 1VPOH 1HNFA 1MWAH 4ZUSB 1KCUL 3QIBC 1YDPA 1V7NL 2ENYA 2NYKA 1CE6B 3ZL4H 3I84A 2WVVB 4UQ2B 1GR7A 3TTSA 3RL1A 4IJ3C 1VGKA 4Y9EA 1NGPL 2B1HH 3EOBA 5GGSY 4PRAA 2DD8L 5EU4A 5LNEA 4H8WC 3WGUB 3TESA 3ALXA 4HX1B 4Y4KA 1JZ3A 3DUSA 3OB0K 3IMBA 1RZKC 4GKZA 2VRAA 3HS8A 2UXVA 4HJ1A 3KL3A 4CC4C 4KV5E 2I5YH 2AGJH 1ACYL 1N64H 1JNNL 2B1AH 4IU3B 2EZ0D 4U4BA 4UILL 1XR8A 3KPOA 4PJAA 3LXUX 3SPVA 1XIWB 3Q8EA 3N42B 5EUOA 4MJJA 1J8HE 5D2NA 1LYQA 3CFTA 3LSOB 3SD2A 3V6OA 3P9MB 2I60L 2X1PA 4G8IB 4HH9A 3WY1A 1YEDA 2E56A 3H55A 3NYKA 4DK3A 2H6PB 5D7JB 5GZND 3IU3B 1I85A 1YRKA 1M3JA 1INQB 5C2UB 3B2VL 5F96L 4W9HC 2MTAA 1ETA1 1O9ZA 1HINH 2XWJB 4JCWA 2XWJA 4JG1L 4FQLL 4YDMA 2WXFA 3AT0A 1FV1B 3ZHNA 1BVKB 3GXDA 5K9JL 1BWMA 1XTLA 4HUWB 3VGGA 4DP1X 2WXGA 1G4MA 2F2HA 3MJ8B 3MJ8A 4UT6A 4L9DA 5E56A 4G80A 1RFDH 15C8L 2CCWA 1HXYA 5EZOL 4FLQA 4E9YA 5HGHB 1FFNA 4HP5A 5DD0H 1H6FA 5FYLL 5IOPA 4G5AA 1DYZA 1MLBB 3UZEA 1UWEL 4NO5A 2NSMA 5KBNC 4HIJA 4EKJA 1IJ9A 1A7QL 1IMHC 4LRIA 1OQXA 1HWHB 5AKVA 4EUPB 3U46A 4ZQTA 1CGVA 2H2PC 3DSFH 1RZJH 3V4UH 4F7KA 2WCSA 2ZJSH 2C26A 3V4VL 3W11C 1AYRA 5ADPL 4WW1A 1T21B 2PPEA 4NAJA 4NKQB 1DZBA 2VERA 1V3LA 3MLSH 4G11A 3ZRFC 3BSZH 4GG8A 1BG9A 1P5UC 1X5LA 3ZTJG 1IM3D 4YVNA 4DKAA 1BWWA 2DQDH 4HKBA 1SY6A 5C09B 4Z7NE 3VXRE 1KCLA 2Y69B 3F7LA 4X9FA 3T8MA 1BBDH 1EZVY 1V54B 4EKXA 4ZAKB 2FQFA 3RL2B 3SBQA 5KYXB 1NC2A 4LMQI 5KOVC 5BRQA 4U1LB 5HGBB 3L3OA 2XKSA 4DVRL 4K5MA 5HVFB 1LD9A 5C08D 2V8LA 2DM2A 2AV1B 2FHCA 2AV1A 4N9OB 1EDYA 3FQTB 3DWTA 1L6XA 4Z7UB 3OKYA 2HKFH 5HY9B 2AABH 3GZOA 3KM1A 3WNIA 4RFEA 2QLYA 4KXZH 5TH2B 3IB4A 2KYIA 3RVXC 4MASA 3MBWA 4XE0A 1AGEA 3HZYB 1ASOA 3QS3A 5EZLA 3QJHA 4X9HA 1U2CA 4F58L 4JB9H 2IDFA 3FHQA 4R90H 1QSEB 2DOCA 3G5VB 4FOMA 3PXHA 3DX2A 4PGCA 1AOZA 2XG5A 3LD8C 4CVXA 3IAGC 4PJGB 4RDBA 3WIFB 3N41B 4IBSA 3SGDI 1ZS8B 1U3HB 3REWA 1ZY9A 1Z9OA 1QBLH 1XIWD 2H0PA 3RI5K 4ENEC 5CAYB 2N56A 3LVTA 1YMHB 3TNNB 5ID0A 2EIKB 2V9QA 3DK2A 1BVZA 2X2UA 3T3MF 4N2GA 1HHKA 4CVUA 2F8VA 1J9QA 3VXNB 2OYLA 4PV9A 1HEJC 4YDKL 2NXZC 2EDBA 4XN4A 4B9PA 2M8XA 4XP5H 2DBLH 4NNPL 5C9JA 4YS4A 4NM8L 5J1AB 5DYOA 1YYML 2QPSA 1RLBA 4HK3J 3IRPX 2EVIA 1L9NA 4KITB 1KBVA 5D93C 2B15A 3O0LA 2XZZA 4IGBC 4NRXB 4Q6IA 5LG1A 3UPCA 4GXVL 2AJ3A 2AXHA 2DWDB 4HUMB 1WS8A 5HGDB 1R3IH 1S7SA 5I17B 3QR2A 5FECB 3GI8H 1KYOK 2HLFC 3BWSA 4JFDA 3NJLA 1CGYA 3QI9A 2EXTA 3O45B 5CJ5A 2I7SA 3QAZC 4WWKA 4GKSB 2ZOLA 4BHUA 5IMMA 4K5NA 2AXFB 4BFNA 1IRAY 3V0JA 4R4BB 3B6SB 4I88A 2YIHA 3VI4B 3D0VA 2ZKHL 2J73A 5CN1A 3RFRA 3JWNE 1LK3L 3MRDB 3GMNB 3UGEA 3FJTA 4UV4L 3FMGL 5EN2A 4P2CG 2QQLL 1RUAL 4E0RB 2ZOTA 4IEFB 5FECA 3K71A 1J1XL 1K5NA 4XXWC 2QKSA 3F5WA 5DVNA 1YA5A 3KLHC 3SJVB 4KJWC 1N7MH 3UGXA 1A4CA 4GKSA 2AVGA 2CO6A 4G9DB 2OULB 1IC1A 4F7EA 5KANI 2ADIA 5J12B 2QGEA 4YVUA 3IGKA 4NOBA 5IQOA 3KEHA 4OCWH 4U3SB 1BZ9B 1TSRA 4YGVB 2GJZB 4W9GC 1F1DA 5KBMA 3ABKB 1ASQA 4GG6E 3QJXA 4OLZH 1HS6A 2DJUA 3T08A 3V95A 1F1GA 4HMDA 4YHKH 3C2AH 3NBNA 4LAQL 3HPLB 1CS6A 4PP1C 5DRZB 4XP6H 4ZFZA 4R96B 1MCSA 3T0ED 4GXVH 2BOLA 3UTSA 1FRGL 4Y16D 1B0RB 2ZXBA 4O2EB 4TNWK 1OKEA 4K9JA 4JZOB 3ARDC 5IUSA 1HK6A 5CU5A 1S8DB 4RZCB 4KZDL 3H56A 4Q7DA 4ZUTA 2CR0A 2PWHA 2ZP0T 2AJVH 1LP9A 1BM3H 1E4XI 5KW9H 4FFWD 3ULVC 3RVVC 3P1VA 1WZLA 1ECZA 3LH2H 4BWWA 4NQEA 3IETA 4L8CA 5LBSL 4DIXA 1U3NA 1COBA 2XWTA 2WSDA 4UOJA 5FO2A 4ZX5A 3L5WA 3L95B 1A1MB 1AZNA 3AY4C 2CRIA 3S35X 3UDWC 3MXVL 3QUXA 5KBDA 2VITA 3G6JE 3KGRA 4BEIA 2BWIA 5JW4R 4P4KB 4AYGA 5CN3A 4K8RC 4J28A 1A4BA 4HAKA 1TMCB 5IJCC 1JZ4A 1BF2A 3E38A 2CGRL 3QFDA 2DKMA 2ZXDA 1JGIA 1GY1A 3SIKA 1NKGA 2R2BB 3FCSA 3B2MA 4GNKB 3S37L 4M4RB 3S5LB 5JIIA 4P46C 2FT6A 5E8PB 4UZGA 4TULL 4FRWA 5JHMA 3ULVE 4X98B 2AMUA 2WVTA 3NQKA 2GTZB 5FW6A 1AR1B 1G1OA 1T5WB 5GGRY 2ED8A 5B4MD 1MFCL 4PMEA 5AOKA 3L4XA 1BAFL 1BGXL 1GOGA 4MAYC 2CGRH 1LP9F 1YQVH 3P11L 5F9JB 1I8IB 3GS0A 1G84A 3U7YL 3QA3B 3UJTL 3RWFB 1KGIA 5HYSB 4PVMA 3H3BC 4FQ2L 4J3OD 3KGSA 3TFKD 3CVHA 3IJ9A 4R8WH 3BUYA 2J5LC 1VAHA 5FGBA 2ZUVA 5IB4A 2WVSA 2XIIA 3KVDD 3OAYH 1NFDF 3CG8A 4LASL 5GJTH 2IDTA 5I1EL 3VD2A 4QHKJ 2GSMB 4M93B 2QHRL 2WBXA 4P2RA 5E2VL 2LU4A 4R0LB 1NCIA 4DPAX 2YXMA 2CXGA 4ADJA 3LEXA 3QQXA 3TCTA 4K94L 3QUXC 4CNIB 3GLZA 3GSRB 3HUJE 4B95C 2G5BA 1XGTB 2IH8A 3EYUH 4BQ9A 2XYBA 1QA9B 4XCFH 1HOEA 1NCOA 1DUZA 4R7NA 4XNXL 5KVEE 4WUKL 2NQCA 4IEFA 3K71B 1NCCL 3WS6A 2X05A 2R2EB 2A4ZA 1QBMH 1HHGA 2Y6SC 2MCAA 3MGTA 1UM6H 5J13B 4G83A 2JB6B 2BO0A 4ZYKB 3MOBH 4F57H 2GUYA 1K9TA 2H6UA 3RL1B 1RVFL 4R2GB 5CGYD 3VGAC 2XIBA 3CZUB 5C0JA 4JDVB 3FU3A 5I74C 2D7NA 4F1SA 1QRNA 4MB5A 4UV7L 1SM3H 2G3MA 4P5KA 1S3KL 4ZD3H 4HBCL 5E1IA 5KEZA 3B8YA 4XNYH 1D9KB 3O4LB 5AVTB 3MACL 2FEEL 1ACYH 1N64L 2B1AL 5E0QA 5BS0E 1PG7W 1JCKA 1MUJB 4JO2H 3UYPB 1RUKL 1WBYA 1NOAA 3Q3GA 2GG1A 4XHQA 3TWYA 3FMGH 4N87A 5TFSH 1TTAA 4EEEA 1X5HA 3I6LE 4UIKH 3VH8G 3DIDA 2DH3A 3P4OB 2XWBA 3ZSTA 3GS4A 1WT5A 5DVMA 4IIQC 2E9IA 1RHHB 1FF5A 1NCAH 3N1PC 5F89A 3F00A 1JXFA 1KCUH 1D5ZB 5E6RB 1UH4A 2PXYD 1I7RA 3JV4A 4R84A 1OP3H 3U46B 4WTXA 2ENJA 3U2SA 1J5IA 1GIGH 3ZHLA 3NSDA 4XPHL 3NOIA 4K71C 1JZ7A 1ID2A 3FU5A 2P7TA 3QDGB 1HE7A 5I1GH 3DETD 4KMTH 5ABAA 1IM3B 5HSFA 2X3CA 1P7QD 4M9PA 1EAQA 1F2XK 1OGAB 1Q90A 4LVHB 4AITA 4JX0A 4WO4B 5TDNA 4JRYB 1BXVA 4YHOH 1J5OL 4D8PA 1UEYA 2A77H 2D03H 4QMEA 3TYGL 2YZ8A 1IGTB 4WLCA 3AROA 5LB1A 4BZ1A 1CGSH 4LFHD 3C75A 4N8CH 2HLAA 4QRUA 4ZFOB 5DVPA 1JS4A 2NW3B 5DURB 4Z3GA 4L8DB 5T33L 2IG2H 4TN9A 3ULUD 4G8FB 4Z7OE 1AH1A 2KI6A 4XCCH 4YXHH 1QO3B 1NAKH 2C1OB 3O6LL 4RGOL 5IMOB 1JD9A 1T1YB 3GSOB 3P2TA 4L4TE 4BCXA 1R3KA 2XTJE 5E00B 4OZFH 3LQZB 4TUJB 3SODB 4JKWA 2P4AB 3M17B 5D1QD 4GQ9L 4IBZA 1SOSA 2APSA 5E5MA 5CCHE 1NOLA 4YHPB 4APQD 4LIQL 4YBHA 2EE3A 2VITB 5FM4A 3VFPA 4PGEB 4AGLA 3EHBC 2YGVA 3MC0A 3VXPB 1TJHH 3TO2B 2HLEB 2L3BA 4C54A 1I75A 5LQBL 5EU6B 3O3AB 1QA9A 3GI8L 4KXAA 3V79C 2VC2L 4XVJH 25C8H 1M7IA 1MRCL 5CHNB 1AIFA 4JFED 2R0ZH 3ARVA 1S9VB 4HKXB 3BLPX 1JIBA 5CBAA 3CCHB 4ADGA 1RZFL 2IFGA 1ADQH 2X6BA 3GQFA 3WDHA 1XV8A 4OZIE 4GIAA 3U48A 1Q9WB 4JGMA 5I6MA 2V3DA 3IFLH 1QD0A 1GTNA 3TA3C 2UXTA 4HOZA 4W4OC 5D1ZD 1NKOA 1OK0A 1C08A 4NUQA 2R0ZL 2E8ZA 1UACH 4G9FA 3ETTA 5AW2B 5KTEH 2DQHL 3MCLL 3ZRSA 1INEL 1F3DH 4KNTA 1SDYA 3CVHB 4H40A 3RTQA 1R34A 4JHVA 3T5WA 4ODSL 2R0KH 3V7AG 4G43A 4Q9BA 3HE6C 4BJLA 4APQB 4ABUA 1P7HL 5I1KL 3UMNA 4JFDD 1ZSDB 2V3EA 3GJFA 2H6OA 1FSKB 3RNQA 1MAML 1CF8H 4WNQA 1XL4A 1O5PA 3AU0A 3UBHA 1KWGA 4I2XE 4KV5F 1CD8A 3FH8A 5LHDA 2FD6L 2I9TA 4P07A 4PI2A 1ED3A 1DFBH 4NS0A 4TTGA 2D9CA 3BJ91 4U1KB 1LXMA 5IVXF 3D34A 1S7XB 3IRZA 4RCAA 1NMCC 4ALAH 4AG4L 1WV7T 2OYMA 3B7YA 4HBCH 3KJ6H 1KBGH 3QO0B 5IFHL 5L2KE 3DMMA 1FI8C 5EU7C 3WG7B 4IRZA 4GFXA 2BDNL 1GJWA 4OFYA 1P5VA 1UZGA 1FVCB 2IH1B 3C9NA 1YC7A 3EOYG 3FSAA 3FFOA 4LHJB 4GLRH 4XO9A 3PHSA 1CD1A 3UCRA 2N4IA 2AGJL 4NIYE 1IC5L 1NCCH 1DE4B 3OC5A 5F1IA 4EOWH 2CJSA 5I1LB 1K2DA 2W5PA 4Z0XB 2XETA 3P40A 5FO7A 3QEQE 1B3IA 3BEVA 3S5YA 5JPMC 4WDIA 2V5YA 1GW6A 3L1EA 2DYRB 4OLVL 3V4PA 3DOHA 1EEUA 1TKWA 1TZOA 3V10A 2MEJB 4WU7B 2F7QA 2PCPB 1WBZA 2QELA 2OS7A 4LDEB 1KC5L 2X1OA 5DO2C 3PWJA 4LCWB 3PGDA 5CJ8A 1HSBB 2H32A 2DAVA 2WTOA 4B9KC 1V7NH 4G2AA 2CSPA 1DLFL 2QHRH 2IADB 1PX3A 2C3GA 4XRCB 1FNEA 4R96A 3Q1SL 5I6XB 4Q52A 3NZHL 4OLWH 4Q89A 3SOBH 2NY4D 4MJIB 3GM8A 3KS0J 3OL2A 3T0BA 4YGAB 4KTEH 5TFSL 4YHYB 4BM7A 3GEWB 4W4NA 2OI9B 3ZKXB 3QHZL 4POZD 4QHUB 4HOWA 5MENA 3NTCH 2FHBA 4PY8J 4A6YA 3MACH 2W0FB 5B38G 2DWEB 4R83A 4IKIA 1ZVNA 5BRPA 5J0BA 1JE6A 4FTVB 3S4SA 2RR3A 5D7JD 1OV8A 4CGUB 1T80A 3H42H 4NO0A 4DP7X 1DTUA 4PJBF 4EI5C 5JOFB 1IC4L 2DB8A 1PCXA 3M8OH 2NOYA 1L9TA 2UZXB 4FFZA 2FRGP 2UZYA 3O2DH 2VDOB 4CVXB 2EC9U 3BXNA 4R6UA 4W9KC 4IBUA 4I4WB 1GOFA 3LN4A 3LV3A 4P49A 5I6KA 4MRCA 4HOMA 1GYVA 2M2DA 5I16A 2BW5A 5T1MA 1CT8B 3CVDA 3V5KA 4B7LA 1Q9OB 2R1WB 3WY2A 5KJ7E 4ODVL 1A3RL 3CZKA 1QATA 1PY9A 3MFFB 2SEBB 2XYCA 3IMRA 3T0EA 4IKLA 2HN7B 4BH8B 5KVEH 4R5XA 3D05A 4NCC1 3EG9B 1THAA 3GGWB 3RILA 4GUPB 4NENA 2HG0A 4DEWA 1BJ1H 1I7TA 3BGMB 3EO9H 1NMAH 4DWHA 4DQOL 4ZS6D 4YHZH 5DZPA 1KOAA 4BQBA 4GSXA 4LOEA 4XWOD 3VXNA 2RHEA 5KW9L 5KTEL 2Q8BL 5IV2B 2PP7A 1E65A 3EO1A 3MLUL 3VWKD 2O61B 4IRSA 4XPTH 3HI6H 2BPBA 5DHDA 2KL6A 3AS2A 3F6IA 1B4JH 4Y2DA 1XF3B 3DX3A 4JM2D 3U0PB 5EU7E 4PG2C 5TDOA 3GJFB 4KI5E 4L4TD 1KYUA 1TENA 4WY7H 4ZMXA 2PW1B 3OWRA 4UTBL 4BFGA 5AOZA 5JW3H 1M6OA 3ZX1A 4OIIL 5CSBA 1KJ2B 1U3JA 1CFQA 2E9JA 2OR9L 5FK9A 1MHCA 2VXVH 4XX5A 5ICUA 1J11A 3CH8A 5IBTH 4KRMB 4LCIL 4OLZL 1AFVL 1R75A 1P2CA 1T66C 4WWKD 3HMWH 4GJTB 3L1OH 3ARDD 4LPWA 5B7FA 3HG3A 4TULH 1QYGH 4FLSA 4JDVA 1IFGA 1S5HA 1X6NA 3BAEH 4Z7WB 1OOWA 1T5XA 3MMEA 4QCIB 2YGQA 3Q2WA 2OP4L 3MUY1 4YGVA 3WFHB 4D0DA 1KTDA 4H0IA 5KSBF 4NQSA 3GSXB 1KULA 3J07A 3OLEA 1KXVA 4U1GB 2XZAH 3AM8C 4YPGB 4NZ8A 3UH8A 1GY2A 2CO6B 3VQ1C 4OCNC 1AXSB 1JG9A 4ZMYA 5ANMB 5HVHB 2GEEA 4FQXD 4MCNA 4P23D 4S0HA 2AJXL 4Y16C 3U9PL 2GJJA 3TZVA 2AEPL 5B3JE 5GQBA 2WB1A 3SE8H 4PGDB 1F6LL 2HVJA 2Q9OA 1QSZA 4RGNC 4WHYG 5FCUL 2XV3A 3E6HB 3H1ZA 3E6HA 4HYTB 4JO1L 3VQMA 1E42A 2N7BA 3VXUD 4Z3JA 5J6HB 5I9QB 3SKJH 3P30L 1K3IA 2JV6A 2H9GA 4GXUN 2DL9A 1I8LC 1UHVA 3D06A 4HXAL 1FFOB 3EGDB 5ALBH 1JFHA 5KZCB 1SLUA 1NQBA 4P9HL 1DCLA 1G7PA 4W6XB 5CGYC 3SN6N 5BW7C 3RTQC 3BUBA 3H3PL 4KJYA 2B14A 3C8KB 1H8OA 1QHQA 2EE0A 2K8QA 3EYOB 4FJZA 3HE6A 3WIHH 4AVHA 2OMWB 4XPAH 2F5AH 1X5YA 4OGQC 3FT4A 2OMZB 3DV4A 4EDXA 4W1TA 2DWTA 3BCDA 3IJ7A 2R15A 2B2XL 1SDAB 5CF3A 3T6QC 5C3TA 4OTXH 1IM3A 5DJXB 2OZ4A 1QKZH 3BKCL 4OM1H 4DK5A 5DMJB 2AAVA 2VSDA 3N9GL 1Z3GL 1OHQA 3W82A 3U2SB 4MNHB 3FTVA 1F4XL 1CIUA 3VRJA 1FL5B 1JXKA 3OAYK 2ITCB 1S3KH 3X12B 1GSMA 1NAMA 1OSPH 2FWOA 1VEOA 3DROB 2QADD 1I85C 4JFPB 1CVRA 1R1CA 5ADOH 4LFHG 3BFQG 1F11A 1W9XA 1PJWA 1MCPL 3QGVA 5ENWA 1XB8A 3GUFA 1EPFA 1R9FA 2J55A 1JHLH 4JJ5A 5BVPH 4OQTH 5AUMA 3L3HA 1FPTH 3L4ZA 3V5KB 3GXTA 4GXFA 5F7FA 1KBBA 4Y8AA 3WKML 3Q6FA 3TU6A 5D9SA 2A6KB 3ZJAA 4U1LA 2F53E 3AXLA 4UF7C 4JPKL 2VR4A 1AXTH 2HN7A 4BH8A 1CWVA 1G6RL 3KPMA 4LOUD 2F54D 4OIFA 1R0AH 2X5PA 4H13C 2BP0A 1FFTB 1KXTA 2Y7SA 1JPSH 5DGRA 3JZYA 1NEZA 4G1MA 5C0BA 1AGDA 1Q9OA 3CZGA 4Q97A 2BWDA 1WA0X 4DUXA 5J6GB 4NNPH 3X11B 2OMTB 5DC0A 2X9WA 5IK3A 3MFFA 5A2AA 4L3CB 3KEDA 2QPUA 3PJSA 4AYFA 4HIIA 5C8JB 4XVSH 1MCBA 5HPOA 1MW1A 3MCG1 3QI9B 4NWUL 4RGNE 5J3HC 5J6SA 3V0VB 1A1NB 1MIEH 3GS7A 3OLGA 1ET8A 4NN6C 1N8OE 4X6DF 3S0PA 3RFZC 3MKKA 3FZUC 3BW9B 5J1TC 3LEXB 5IGXL 1R5WB 1PFCA 1XGPB 1XZ0B 3NP4A 1XX9C 4G8EB 3MNZA 2MCPH 2P44B 3UPAA 4YFDB 3IS0X 5DQJA 3LKPB 5CEXB 3BZEA 4Y4KD 1BFTA 2J12B 2O30A 4ZO9A 4NN5B 5SX5K 4AYFB 4WTWA 1YQVL 2R7EA 4MB4A 5ESVA 1BQLL 1WIUA 3ATEA 4FXKC 3EYVB 4AGNA 2BCMA 2NY0C 2NY1C 4YC2B 1E3FA 1HYSC 5F71A 4GAYB 4PJ9B 3G5XB 3BN9D 1QP1A 2QPDB 3HBQA 2A9AA 1P9MC 1PG7L 2FYYB 3BWAA 5F44A 5GGUB 4NP4H 3F64A 3I3BA 2AJSL 1PCSA 4WWKB 2VDPB 1HCVA 3F6JA 3Q6GH 3OJDB 4MD4B 5B22A 2NY6B 3B34A 3MXVH 1EAPB 4RGMC 5F1IB 2P8PB 1HE8A 9PCYA 2H0FA 4BGDA 5HJ3B 4TQIA 3PIQB 4ECNA 4MDIA 4U0RB 4RIRA 3QNYA 5I2IA 3CMOH 1OLZA 5E1HB 2GJPA 5CD5D 1L0XA 3FYIB 4M6AA 4MAUL 3BC9A 5EEWA 1AHMA 1M53A 1PZ2A 1U8CA 2APWA 2P5WB 1MF2H 1HCYA 4JM2F 4L1BA 1OF2B 5IQ9A 2GHWB 3L3KB 3I6KB 4L3EA 2Q87A 3LS5H 1XF5A 3ML9A 1VJSA 2WHVA 4LKXB 3SE3C 4BFFA 5DQ9B 2B8OT 3LAFA 2FT8A 3C6SB 3G9AB 2I9LA 2KPNA 4FXTA 2P7TB 2OZ4H 3QDGA 2CO1A 3C5ZD 5IESL 1QRNE 4YDLC 2EDTA 4S1DC 3C09C 2ZWNA 2HFTA 2MQ0A 3BVNA 3INOA 4KRPB 4E41B 1DJZA 2WLLA 4JFPA 2ZWSA 2PCFB 2VIRB 4M6NH 4WKZA 4AVJA 4EIUA 3U6RA 3IFNH 1IC5H 2P24A 3NH7L 1TTGA 3W37A 3K72B 4DZBB 3K72A 1BAGA 4DZBA 3M7FB 3DIVA 2F0CA 3K1DA 1TITA 3OZKA 1QNZH 3PGFL 2QV4A 3ILDA 4LPCA 4QT5B 5EOCL 3O6FA 1IAMA 3ZUNC 4FA8A 3ABGA 1N5YH 4GG6A 1XSJA 1AHWC 2VLLB 4MMXC 4PH8A 4XMTA 5ECGA 5EO9B 5IZ7A 3NIDB 3N1GC 1ADQA 5F0PB 1K5WA 4Y19A 3JV6B 3RGVB 4OV6F 1X6LA 2G4EA 3GBNL 1ORSB 2XZAL 1S9XA 5AAWA 4W68A 3DV4B 4EDXB 2WTRB 5J57B 3FO0H 4ZXBD 3D39A 5IW3A 3WUWB 4BDVA 4CC4A 5GGQH 4YL9A 2OMBA 3GO1L 5CBAB 3RA7H 1TSHA 3CFUA 3TBSA 4IBLT 4LEOB 5FO8B 2BZDA 3EF4A 3QUMH 4JQXA 4O2FA 1BOGA 1NGPH 1FZKA 3FQRB 3OXSA 4PGEA 3C12A 3AM8A 3E8UL 4HKBB 3PUCA 4PWJA 4NHCH 1M1XA 2F53A 4NWTH 5D2LF 2N1KA 3ZT7A 4U1MB 3X12A 3ZKNC 4B53A 2A38A 4H20H 7PAZA 4E9LA 2FUTA 2OR9H 4HJGB 1B4RA 4OJYA 3VFVA 5DHVB 4DO6A 1A1OA 3FUNA 3B4NA 4JKPL 3TEZA 2J44A 3MRBB 4I87A 4U33A 1OE2A 3O0RL 2DQCL 3P0YL 4G1MB 5F1SA 3OG4B 4P99A 2ZX5A 5GGTA 1IV8A 3TN0C 4I85A 1RZKH 2DQFB 4WFHE 2RQEA 5GGRA 1E8XA 3MUGB 1AHWA 2B3IA 3F7QA 5I8OH 3GHBH 4KK8C 4M6OH 4LHUG 5BZWB 5DHVH 2XHNA 4C47A 3IKCB 3CZJA 2DM4A 4Z5RB 3UABA 3VRIA 2GSGA 4JFFB 3EOTH 3Q44A 3EYVA 3AY4A 2WMPB 5DFVC 4A2GA 1WEJH 3CDGB 3DHJA 2RCSH 1NBYB 5JHLA 5D1XB 3UL4A 4N2MA 4PY7B 1T5XB 1OY3B 5A2BA 2VLJB 2MCMA 4TUKH 8PAZA 3RA7L 4FQ1L 2F53D 3BZEB 2WJ7A 1N59B 4BZ1L 2PETA 2OXGA 2FATH 5DR5H 5DYOB 3FFCA 4UT9L 1P84K 5J11C 3MBED 1INDL 5DJ8A 1XZ0A 4G8EA 3GLEA 1EA9C 4Y9FA 4ZZFA 4F7TA 4U6HA 4ZUVB 1AQKH 4XCNA 1YEEH 4TOYH 2MSPA 4Y4KB 2PKDA 3MRQB 3O3DA 4LPYA 4PVLA 4L8BA 1ODAA 3HE7D 2WXQA 4KXDA 5B1JC 1OTUC 3UTZB 5LXVA 4HIHB 3L3DA 4BUQA 4KH9A 1I1YB 4WI3A 2OTWA 1X5GA 3MOAH 3TASA 5FGRA 3OAUL 4M8QB 2J8UA 4XCEA 1P4BH 4HJ0C 2OJZL 1F8TL 2RTTA 4RAUA 1RSFA 2X12A 3D51A 5E4OA 1NL0L 4OCSH 1UZ8A 5EZPA 4Y1AB 2V3FA 5EPMB 4JPVL 2W8CA 3QUMA 3AREB 3OXRA 1ZT7B 3V4UL 1ZT7A 2FCBA 3O8XB 2YRPA 1FC1A 5JLZA 3G6DL 1QEWA 1I1YA 1KXQE 2OJ1A 5F0MB 3RBSA 1O0VA 3CUPA 1J86A 1UJ3B 3GFUA 2HRLA 1GZPA 2DI9A 5C09A 3ARGA 3MLPA 4IDJH 1UB5B 3APNA 3OB0H 4RISL 5LLIC 1SF3A 3G6DH 4LKCB 4N90D 1HAUA 5EWIL 5I1IL 4ZMNA 1EERB 2A2QT 4LSUH 1T6BX 2VDML 2B08A 5KSVA 3AB0C 3T2NL 2WKGA 1J5CA 2J6EL 3BOVA 2QR0B 3PDDA 3WN5C 3OKEB 1YNTA 4UDUA 1MJ8H 3BPCB 3WEOA 3QYMA 1Y18A 1S78D 3BAKA 4G72B 1X5AA 4OBSA 1H15B 1X44A 2WD0A 3UAFA 5IG7A 4L0ZA 2FO8A 3LJ3A 2AEWA 2H5UA 4TSAL 4A67A 2R1YA 3U1SL 1JZIA 4WUUD 2WJ5A 3DUUB 1FHGA 5ALCL 4DGWC 4EI6B 1Q0XH 3PV6A 1SJHA 1ZLDA 5IT2H 4ZNEE 2JKWA 4FHKA 5AKTA 1FJ1A 3VD5A 3FB6B 3FQNA 1JGDB 4PJBA 1A21A 3O4OC 5EN3A 1PF3A 1FO0H 3KPPB 2HRHA 2ORBL 3DI2B 3D2UA 3S5ZA 2EAEA 3SDAC 4PJXE 3QULA 3MROA 1INDH 3L7FA 3QWRD 4PSPA 1F5WA 1G5GA 1YEJL 1U8LA 5A2CA 1O9WA 1UA6L 2DQFA 1DFBL 1IAIM 1KTLA 1DSWA 1EEYB 4DUWA 5I28A 1EGJL 3GXFA 5BZWA 1MKFA 1N2RA 3D9AH 2WXMA 3R4DA 4P57A 3KYNA 3O9WA 1XXFC 3KD4A 1E90A 3RZWA 2K8MA 4DKTA 3BRDA 1CFSB 4KAQL 1S7WA 4LARH 2KDYA 2BFVH 4JJ5B 3TO4C 4C4KO 3VNZA 5A2IH 2HT3C 3UTOA 3MLZL 5T8IA 2J2ZA 1HNGA 4Q58C 1PLAA 3BT2H 2YAOA 4KMQA 5E5MB 3ULVF 1Z9SA 3BMWA 4X6BA 4LSDA 2Q7NA 3ZE1B 5GZOC 1S7TA 3K6OA 4XO8A 2KERA 1CYGA 4PJEF 2O5XL 3HA0A 2BNRA 1C16A 3CX5J 2ITFA 2FBOJ 4XXDA 3WDJA 4YSCA 3KXFA 4LL4A 1GMEA 2FTAA 2CM6A 3RYMA 4NBYB 3F7VA 4NX0A 4PGBA 3KLAB 2JCCF 5A16A 1E8ZA 5FK9B 1J1PL 5DJCB 4OF0A 4UQBA 1ROCA 5DJ0A 5HYFA 5DD1H 1U6AH 3C60B 1RZGB 1YG9A 4KVNL 5DF0A 4UUJB 1CGUA 3MZTA 1P4UA 3UG3A 2J25A 4M43H 4JFHD 3MBEC 1E40A 2JJTA 1LEIB 4YEFA 3N55A 1U8PB 3N0AA 1XXDC 3ULUH 3S37H 1FUNA 4UQIM 2YSSB 2BNUA 1MHCB 3VTTA 2P5EB 1PBYA 2VWEE 1EBPA 4XMWA 5GGQL 2XV2A 3P0GB 1ZVYA 2PLTA 2CBQA 3HPJA 1BQHA 3WIIL 3AXHA 1I7UB 3A67H 2LTQB 2BMKB 1F0LA 3OKLB 4JPSA 1NLBL 4GMSL 4XNZC 2HJFA 4KROB 5GRWA 5EF1A 3CZLA 1E4KC 2KZBA 35C8L 3S6CA 2H9GB 5C0GB 3QHFL 3SQBB 5KUMA 4DZ8A 2P3YA 4OTXL 2AERT 4KHTL 1B0RA 2ETWA 2R29L 5CLWA 1U8OB 1DBJH 1ADWA 4QY8A 4H8HA 2VABB 1MN4A 5C0AD 1MHPH 2JKIS 2OCJA 3MLTA 3ULAB 5I1AA 2EDJA 3FU0A 1AI1H 5CJXA 3HI5H 4JFEB 4EDWH 2VJXA 3K6FA 3KXFE 3TPKA 5JOPD 3LNHA 2P9RA 3FQWB 4FNTA 1CG9A 4EIBA 4C56D 2E7DA 1D5MA 3ARYA 4TSCL 1C5DB 1G7JB 1QLRA 1G9NC 3G5WA 5C71A 3AT9A 5LCVH 2DLIA 3WGVB 4MD4A 3ZTNL 4QRTA 1JDDA 4QRTB 1GC1H 4PP2B 1RJYA 2HRPL 5L2KA 1JWMA 2A74B 1A22B 2HAZA 2JJTC 1ROWA 3IRCA 4HMEA 3ZE1F 4X4KA 4D8PB 4CU7A 3G7TA 4ZNCD 4N5EC 4FQIL 1FLRH 4HWBH 4K9EL 1AMXA 3SE8L 4NZUH 3MRCA 5IHHA 4A7QA 5M95B 1EJOH 1RLWA 5HYJE 1NFDB 3QH3B 1ZLEA 3SCMA 4IGBD 4HS3A 1JZFA 1NPUA 4ZOBA 4C57C 4R9HA 4HISA 4W9DC 1IB5A 1WTGT 1BMZA 3VD9A 1KBWA 1KEMH 2XX0A 4MMYB 1XBRA 4FAAB 5FAAA 5B7MA 4YDZA 4XMLH 4WWID 1OAZH 4GUQA 4PG9A 5DEZA 5L8LB 4OGAD 2FSEB 1GGBH 2WXLA 1G7QB 3CZFA 1OXYA 3GYRA 2CUIA 3SO3B 4R7VA 4JE0A 5BV7L 1CYXA 3F7PC 2QTEA 4JR9L 3BZFA 2R4RH 2JKTM 4A66A 1QSFD 1V7MH 3C8DA 1AGDB 1WAAA 2ATPA 1CICB 4Z78A 3TLRA 1H6EA 1DLHA 2DQEH 1LQBC 2R0LH 3D69A 4AC2A 2ZNWA 1AGBB 2AFNA 2CO7A 5JORA 2N01B 1GS7A 2QQKL 3W3BA 2E7HA 3SDDB 4NFDA 2JI1A 1R3IL 1CBJA 1WWWX 1HQRA 1A1NA 2WYHA 1CDBA 2UWEA 4EXPX 4FLOA 4XN9A 4Y1SA 3X2QB 2HT4C 1AZZC 2YA0A 3KPMB 4NOFA 2BVEA 3I9IA 3DX7A 1KIPB 2FO4B 5IF0A 2BP0B 3DRQB 5G2NA 1A9EA 1HHIB 3NESA 1KGCD 4NZRH 4WNJA 4EIZC 3DIFA 4HKJB 3VSVA 1TZAA 3MV7E 2DDQH 1JVOA 3EBGA 4Y9BA 3GPEA 5I6OA 3QC6X 5ICXB 1U8NA 4RESB 4ZPTB 1PX8A 3SDDA 4WUUE 2YPLA 3DBXB 3NJMA 1L3WA 2ZKMX 3N43F 3N04A 4UT7L 4JM2A 5KJRH 2UX7A 4X6BB 1DBJL 2CO4A 5EO0B 3ZKSD 1I3RA 1G0XA 5E9DD 5B3NA 1P0SE 2ICEA 3MQIA 1A6WH 4I3SL 4F2ME 1BD2B 4A7GA 3GSRA 3FUKA 4X7TB 1HL4A 2CLRB 2V2WA 4P5TB 4DGVL 2QADB 3LRLA 2Y2WA 5AL0A 5DVKA 2XKUA 5C0GA 3MV8A 1WYJA 1R0AL 2ICWI 3QQDB 1NLBH 4GMSH 4J3XA 3LS4L 2VLKD 1V3JA 5DZNA 3BQUA 1BQHB 1DQLH 3AUWB 2WLKA 5DTFA 2R2EA 4IKKA 2NY1D 3VWJB 4ADIA 2WGXA 2A6DA 2YEQA 1Q9LB 3WL9A 1DL7H 5KVFH 4KHXL 1WUZA 2V7HA 4QF1A 1FO0L 4IRJD 4Z1PA 4IU2B 3J2PA 2BERA 2XFXB 1UG9A 2CDEB 2PWFA 2DIBA 2ZPKH 5IT2L 3FT0A 3H0TA 3JWDL 5DS2A 1MCWM 1M56B 2VM4A 3F62A 2XWZA 1RZPA 5F7EH 1JK8A 4Z7QE 2DN7A 1X3DA 2GBAA 4HCIA 1ZE3H 4WI2A 5ID1A 1M9WA 5DEGB 2R56H 4X4MA 5CJBA 1SFDA 1RJYB 1ZPLA 4PJAE 1KT2A 4NQXB 3T0VA 4ZFZB 2ZCLL 3U30C 1FNAA 1TJGL 4MD5B 1CTOA 2Z92B 1QRNB 3BKCH 3FSZA 4OM1L 4R3SA 3T2PA 4OT1H 4CN4A 3AS3A 5D7JA 1E28B 2UUDH 2XFXA 2XZQL 5DRXA 4GBXA 4TNWF 3W9EA 4GS7B 1NBZA 1YCSA 2GTQA 2X4TA 4JFZL 3WIHA 5LG6A 3ARFD 2GTWB 4RISH 3OX8B 4ZOCA 1XWVA 1AO7E 2X4NB 1Z9PA 1J1OH 1JMXA 4TLSA 2NY2C 5D2NB 1Y07A 1DBAL 4G6JL 3EXJA 4PBWD 1KYFA 4XBGA 3DMMB 3LDBC 3T2OA 3VFGL 4NQXA 5KYUB 2VDPL 5JIKA 3IBOA 1YEDB 1NCGA 3T4YA 1CQKA 4EN3C 5G4NA 1FORL 1KGJA 3ARXA 1MLBA 1FVEB 1MREH 3TBWB 2ZSVB 3O2DA 1TZHB 2NR6D 3FQ1A 1CCZA 2XWCA 3GUTB 2OV0A 3O8XA 4HV8B 4PS8A 1QZ1A 1NBQA 4KOCA 3GSOA 3SKOB 5SWZD 4IBYA 1NGWB 4JPIB 5JW4N 1MW2A 2L7QA 3CIQA 2EDWA 3TX4A 4M5TA 4GBXD 2LV4A 1DJYA 2NSXA 1YLBB 2K7PA 3G04A 5BZXA 1WO2A 2BDNH 4QRUB 2QKIB 4ZMQA 3L5IA 5E8EB 2PPAA 3E1ZA 3I2CH 4YHLH 4L3AA 3HR5B 4JHZA 3LZRA 2ZP9A 3H85A 4WAFA 4ALAL 4LLYA 3QWNA 4RFNB 4F15B 1WZ1L 2ZX8A 3NIFE 5I1CL 4HQQL 4C56E 2E9GA 4Y16A 4N0FB 3GXNA 4FFZH 5F7DA 2H41A 5D6DA 4Y19E 3PNWA 1NAML 2AK4B 4TVUA 4YX2H 5LAPA 5HYQB 2YPLB 3DBXA 3HG5A 2C8NA 1SMOA 5H37G 3ULVL 4WHTA 2IQ9H 4YFEA 5E8DH 1MLCB 3HMWL 5H94B 3FN9A 1LO5B 5DJAA 4EVNA 4HOXA 1B6DA 4PIBA 2HMID 1U92B 1O6TA 2QQNH 4LXFA 4UOQA 4X42A 4PJFE 5IQLA 5CJQL 3KPNA 1U8HB 3PDOB 4H5SB 1AQHA 3L9RA 3US1A 2FR4B 4YHPA 3VRIB 2LW3A 4KQ4L 1KY6A 4NENB 4M6MH 2Y3AA 4R7XA 1I3RB 5I71C 1U95A 2WWOA 2LHAA 3NPSB 4UB0L 1EFQA 3B8SA 5I16B 2YEZA 2CUMA 5ANHA 2YMTA 1E7UA 3KYNB 2YSTA 5DFTA 2AXGB 4OVUA 4HKJA 3BFOA 2E7MA 3KDMA 2V7NB 4G6KH 1K3ZA 1RJLB 1TQWA 4V2BA 3X14B 1X5IA 4ZPTA 3U0WL 1KLGA 2Q8BH 4P5KB 1Q94A 3FXIC 1WFUA 4N0YH 3EJTA 3NCJH 5H35B 1OT4A 1U58B 3QIWC 2B0SL 1PAZA 3DX8B 5ITFA 1TJHL 1A9EB 1HHIA 3I9GL 5HJDA 2Q8AH 1NSNH 2VLME 1HXMB 1TZ8A 4LNRB 4CKQA 1NLDH 3ETBF 4AGQA 1SDDB 2ADJB 3US0A 4Q6IB 4X9IA 2Y2YA 1L9PA 4F33A 1J12A 3ELAT 4PRIB 1SYVA 4RBPK 4XTRD 3GJFH 2PPFA 3NJVA 4LEEA 4PWEA 2Y07L 2ZUQB 4PBXA 5FDYA 4P5TD 5D4HA 5AG9A 2DEWX 1WBXB 1EGJA 3BJLA 3W57A 4UTAH 4QJ4B 2HPOA 4HIPA 2K0RA 2PYEE 2CLVA 3QORA 4UT9H 4U4IA 4KKZA 2GCYB 1MCRA 1C12B 2BSSA 4YDVB 4DNLA 2WLIB 2WXPA 2WLIA 4RSVA 1VFOA 4FQ1H 5CP3A 4NXKA 1LO2H 1BFSA 4Y88A 4N1CA 2F8OA 1NEPA 3T3ME 2VLJA 3BRFA 3KJ4C 3BN3B 3EJJX 4ZMAT 4WU7A 3C5XA 1BDYA 1L5GA 3TCLB 3QIBA 1A6VL 1JPFB 4FI8A 1QVOA 5HD8C 1G1YA 2XN9A 3PWJB 4LCWA 3F3HA 4RGND 5DZAA 3TVMC 1KSRA 1FDLH 1RUMH 2VN3A 1KJMA 3H7BB 4YE0A 4LPTA 2OMVA 1CD1B 1GGIL 2KDGA 2IADA 4JUTA 5BOPA 4JGNA 5AW6B 4FA7B 1QASA 1ZLSL 1YPZE 2XACC 2XWEA 2GPZA 5KANG 3WFBL 5IHZA 3BEVB 2BSTB 3ZE0E 2AHIA 3OB8A 3KWTA 4XPHH 5C2BL 2OMXA 3U6XS 2JB5H 1KB5H 5KOMC 5L2KB 1U3HC 1QEWB 4TXVB 3RWCB 3LKQB 2EH8L 3RE0A 4PGZA 3VUAA 4OIBA 2NR6A 4IM8A 5I1LA 5E4IA 3SDXE 1LWRA 5D2LE 5T1LB 4ACTA 2FBRA 5I5IA 1AGFA 1EO8H 3US9A 4ZAKA 1NCBH 1KTRL 3A4AA 3P69A 4FKEA 3U0TA 4J3OF 2PXYA 5E7BA 3PQYB 2CRMA 3TBWA 1X9RA 3DJSA 3MRJA 5J56B 2FECL 4ZDHA 5LUMA 3QUYA 2Q6WB 5BS0D 4WO4D 4KTGA 4XO4A 3MRIB 2D7QA 2VMFA 4JZJC 4MXWL 5KYUA 3VI3B 4MSWB 4ELMB 5LGJA 4LF3B 4ONHA 3V6OC 3MRMA 1ZLUK 3MNVB 5CP7A 3VGDA 4BV1A 2EDNA 3WJJA 5GS1B 4WCYL 4I77H 4N2NA 4BUGA 1BPLB 3DVFA 4MBRA 5GHWL 3QAZB 4Y2LA 1NCTA 4WIQA 4PJGA 2E59A 4CGTA 1N5YL 1LP9B 1D7BA 1OIOA 2ATKA 3H8NA 4AVKA 4XMXA 2Q1EA 4B96A 1AQ8A 4QT5A 2IIJA 2W81C 3M45A 5F3FA 3WNOA 5JPMA 2PR4L 3L4TA 4H0HB 5FKAB 3RKDD 2I5YL 3G6JA 1NGXB 2E86A 4G5ZL 3LPGA 1ULVA 3O3BA 5IMKB 2CDGA 2FD6H 1FVDA 3KPPA 3U79A 1JUFA 2JKJA 3ISWA 1NBCA 3UYRH 5KSAB 2QGCA 2Z93A 5E0FA 4NQEE 4F5CA 1XR9B 2ZAIA 4JZNB 3ZMRA 2HJKB 1KYDA 1CFSA 4FL4B 3HN5A 3NIGE 1EHAA 2MRYA 1UXWB 4UDTB 1DBML 4A04A 4ZFFA 2IXQA 2XU9A 1RZIB 1JJUA 5EU6D 3WXVL 4ES9A 2X2JA 5HXMA 1UACL 5E8PA 1DQDH 1A66A 2C1PA 4XCYB 2BS71 4LEXH 5E5UB 2UV3A 1S7TB 1GGCL 4NO3A 3T71A 1S7WB 1UB6B 4FZ8L 2WIMA 4JG0H 5HHOA 4TVPD 3FQXA 3S2CA 35C8H 3IPBA 3P9MA 5F7KC 3ASNB 4LAJH 5GS0H 1WBXA 3GRGA 1HJCA 3A24A 2A4CA 1FAIH 3ARDB 1KLGB 1IJNA 1BEYH 1P4LB 1S7UA 1VFBA 1BLNB 2FBJH 3G08A 4KZEL 2XVGA 5HHMD 1T83A 5JQ6L 5LN4A 5EEUA 4XBMA 1GMIA 3FRUA 2IFFL 4H25A 1A3ZA 1W72A 1LNUB 3VXRA 2R69H 3FFDB 1I8MA 4DESA 4UMGA 4XE5B 4AIZB 4D9QE 2VJ8A 5ICXA 5HI4C 3SGKC 1ETB1 3QEHB 3PY9A 2VOTA 2C3VA 4G80B 1S7VB 5FWQA 2COVD 4GPVA 4LSVL 3IVKB 4P2YA 1FZJB 4WW2A 4HJJL 3QWRA 3L9YA 2J20A 3HC0A 3RDTB 4JFEE 1KY7A 1DQLL 2ZICA 3H9SD 4Z95L 4WI7A 4TVPH 1KCRL 5C07A 1LEKA 4QJ3B 1N4XL 2J8UB 4XCEB 2OTUB 3N44F 3AAZA 4UINL 5SWZE 3GMMA 5TE4H 2A3TA 3QO1B 4U6HB 1IQDA 4RETB 5DQJB 1ZLWH 4DGVH 3FPYA 2UVEA 4HIEB 1T22A 3D08A 4LLVA 4ZS7H 5TF1L 4AL8L 5CEZH 4HK3N 3DRTA 3RVVD 2LT9A 2P80A 5L2JB 3S36H 4N9GB 4P46B 1Q1JH 2IQAB 2XJLA 3QJOA 4NWUH 1PLBA 3PWNA 4YDJB 2XPGB 5F3BB 4LSRL 3WTVA 3GIVB 3RGBA 5I0VA 1MUJA 3CQQA 2FWLB 2EYSA 4O02L 2EVGA 2W9LA 4AT6A 4PEEA 4M61B 3FT4B 2AJZA 3GMPA 2NX5D 2NLJB 2DYSB 2BRRH 3GMLA 4BK5C 1F86A 2OMUA 3B5GA 4D3CL 3QT2A 1RHHA 2Z65C 4G59C 5HHXH 3L3OB 3AWFA 1KJ2L 4BQCA 1MIML 1CIDA 2HX8A 3WD5L 1LMKA 2VDNH 4GO6B 3I9PA 1ZHKA 2X42A 1NICA 1DN0A 3U4EA 4Z76B 2NY7L 3GTNA 1WBYB 2ZQKA 1MJ7L 2YA1A 4MGXA 4AUYA 3JBG7 1BQSA 1J0ZA 3DTDA 5T1LD 1TFPA 3WHE1 5C70A 4G6MH 2AJZB 1OP3K 1GGTA 1VIWA 1EDQA 3CFKB 5FF6B 2FSDA 4F3FA 1GAFH 3FTWA 5IJBC 2QZ5A 4WEBL 5EV7A 3ARBA 4GKNA 4YZFF 1KCSH 2FIKB 1FLTX 4GSRA 4HLZH 1MAKA 4ODTL 4JN2B 3RWGA 3IMVA 1YYLL 4K3DL 3VG0H 5MP6L 3GUTA 4NQCD 1O6SA 3CK0L 3FTUA 2AXWA 2BVQA 3HNVH 3IGUA 1E9PA 2DMHA 4Q9RL 5F6HI 5FFLA 3QQ9C 2EDDA 1MJ8L 3MUJA 1L0PA 4M5YH 3VSTA 4K3DH 3VG0L 1SM3L 1W0WA 3GHPA 2MFNA 2OZNA 4ZUWB 1RZIA 5C0BE 3NN8A 5AENA 3CQFA 1BZDA 3OAWA 1W8EA 4A6YB 3VGAB 2WTRA 2X70A 5EZIL 1AC6A 2BWQA 2DTSA 1T4KB 1GRWA 1ONQA 3BWUF 2ITEA 4U2ZA 3PJSB 3QCUL 4AEHH 1HVXA 4XNQB 1QLEH 2HRPH 1LDPL 4PRBB 4IRZH 3IJYB 1BXUA 3EBIA 3N6YA 4H8PA 5DJ6A 2HUEA 1BZEA 4NFBA 2A5UA 1IFHL 3A6OA 4Y5XA 3BI9X 5F9AC 1I8IA 1NDTA 3HI6L 4TVSa 2ISDA 5MI0B 3QA3A 1ND0B 4L4VB 3ZDWA 1ACXA 5F88A 2GVYA 2H6PA 2I69A 1MHHB 5ERWA 3FS9A 4PJ7A 3VSUA 1TEGA 1TVBB 4R7DA 1PVHA 4OCMC 2VMCA 1TQTA 1RUPH 2WIIB 2JJVA 3DHUA 4EQ3A 2LR4A 1JPTL 3BE1H 1TDQA 4KC3B 4XVUD 1LK2A 4QJ5B 2VLJD 1AHKA 3RHWK 1I8LA 4DSYA 1I7ZA 1JCVA 2ZG2A 3MV8B 5C0CD 4M5ZL 1FGNL 1KIQB 3L9RB 3T4AC 2M1KA 2VR8A 4N2DA 4YDLB 4X8JA 4TUOA 2BSRB 2IH3B 4QRAA 1VEPA 1OE3A 4PU2A 4G7YL 2I25N 2EIZB 3V6FA 1CL7L 3RZCA 1D5BB 2CE6A 2WIIA 5IVOA 3LKSB 4AQ1C 2F54B 2KLSA 1MCDA 2H3NB 1KCWA 1A0QL 3B37A 4JVWA 5CD5C 1KDJA 5DFWH 3FUDA 3HG2A 4OAWB 3VXSB 3NRQA 2Q7YB 4D9RE 1XGQB 1OARL 3WV0A 2Y7OA 5IBTL 5EUOE 3K8LA 3NZSA 3I6GB 2VR7A 4FFVC 3RY6A 2R39A 2VE6B 3UDWA 4DEPC 5IVXB 2BK8A 4TVPE 4F9LA 3QHZH 4EZKA 2R2CA 4QI3A 4KI5D 1YEIH 5EBLB 1HHJB 1WVZA 3MGOB 1YNLH 4HHWA 2X0UA 1ZHLB 4OAWA 4Z7WF 3SGEH 4LSSH 1Y6NR 4M6ML 1RZJL 1A7OL 3ABZA 4YAQB 5ESQB 4ATTA 3ZLQC 5L88H 1I3UA 2Q10A 1GOHA 4L0YA 4OZ4A 2R23B 4Y2DC 3QDMA 1MVUA 4PS4L 5CS7A 4F7CA 4P04A 2HT3D 4HAFA 3SQRA 4G42B 3TPUA 3T4AA 2IQ9L 2W95A 3ZPDA 2IAMC 5BS0B 3VCLA 1MCLA 1R5IA 2Y5QA 1X4XA 1BF8A 4PRHE 2PCYA 5CM1A 3ARGD 1EGJH 4L3ED 3ZTCC 2VXUH 4PRNA 2A1WL 4I5BB 3UX9B 1F58H 1O6SB 1DVYA 2M83A 5KVGH 4XBGB 5DT1H 4AM0A 4AL8C 1JWMB 5DUMH 5KSBA 1DCEA 4NCC2 5SV3A 3S98A 4WI0B 3MODH 5FFOA 2QEJA 1SLWA 1G7JA 4JG9A 4QOKD 4KQ0A 4P9MH 3GHEH 5FYJH 4PS7A 1DO5A 3S2AA 5BQDA 1QSVA 4ZW3A 4K3EH 4CBPA 2A74A 1OAKH 1FJ1B 1E4WL 1KXTB 1MFAH 1WITA 4JO3L 1UCTA 4ODHH 1CYWA 2J8HA 2C7UA 2AJ3B 1XSIA 3L7FB 2R1YB 3CSYA 4DN3H 2JE8A 2NX5E 3DUUA 2DLHA 3Q6FB 4BSVB 4XNQA 4Y9GA 5L0QC 1KB9J 2NW3A 2CRZA 1ZTXH 1ECYA 3KLDA 3QCVH 5D1ZI 5C3IA 1JERA 1NMCB 2WXOA 4X8GA 4AW7A 3OKEA 4YZWA 1HEZB 5E6UB 4BFIA 3SBRA 4OFVA 3DLQR 4U6XB 3MNZB 3TJHD 2V17H 1CI5A 1G6VK 5H94A 4HXBH 5FYKE 1PAMA 4X0KB 5LDUA 3U2JA 3Q8BA 3QUZD 2EH8H 2WQSA 5E4EC 4DGUA 5IM7B 1H5BA 3ARFA 5L88L 5CD3B 2AQNA 4PGCB 5DHXB 1ZT4B 3L5JA 1HXMA 1OGSA 3LXBA 4BSWB 1MCOL 1REIA 2KMWA 1FFPA 3JV5A 3MLXL 5F1KC 1CE1H 2B5IC 1KXHA 2FHFA 4BCYA 3HZVA 4AMXA 1PZBA 2MHAA 1IAIL 3QQ4A 4L9LA 3PWLA 1TJGH 1ZD6A 4LVOC 4JGUA 3D85A 3V0GA 4LHUA 3QIUD 1F4WH 3DA0A 2IC2A 3X17A 4JY4A 4P2OA 4R4FL 3WNMA 5C0IA 3R1GH 1HHHB 1E9OB 3H9YA 3TWCL 4I0PC 1B9ZA 4XN5A 5C0BD 1SXCA 2ZXWB 1GC1C 3BLKA 2LVCA 3JWDH 3KL0A 4QHNA 5ILTL 5LBSA 2XVBA 3SDCC 3TXAA 4A38A 1I8MB 4GEIA 1NJ9A 3ARGC 5EH1A 3F2LA 2FEDC 1RJZA 4N6RA 1QLFA 1DVQA 5AAWC 5MEPA 2FYVA 2XXGA 4MTMA 5E8NA 3WYRA 4FJYA 4P3CL 2C3HA 3BIBX 4M3HA 4FFWC 1I1FA 4PJDE 5KVFL 4YMPA 5SV4A 3SY6A 3ZQ9A 1JK9B 4F58H 1LWHA 1JNHB 4N85A 5DMIL 1E5YA 3FRPA 2LU5A 3BKYL 4MNQE 4GUOA 2X28A 5IEHB 3FBQA 3P2DA 3FFCB 4XR8C 1F3JA 1LGVA 4IS6B 4H2AA 4TYUA 3SKUD 5JIDA 1XGTA 3F05A 3ZZ1A 3ESMA 1G9MC 12E8H 3TURA 3WNJA 3Q2VA 1QFUL 5T33H 1YN6B 1I9RH 1E5BA 3D3VE 5KYYA 1NBZB 3I9GH 3UBXI 1KIUB 3UROR 5IB1B 5KJRL 1YYCA 4MQXD 3RNKB 4QHUA 5DHMC 1EHKB 1EXUA 5CUSL 1MZYA 2IBGA 2OSYA 2Y2TA 2W07B 3IDYB 2OTUA 1UKTA 1QOKA 3NJNA 4GAYA 3BHBB 5GRJH 2EIEA 1WCBB 4WK4B 2WBJB 3JYBA 5DURD 2NXZD 1F56A 3ARZA 3DYPA 4NJ9H 1W2KT 3OJVC 4P2OC 3T0EC 4DERA 4I2XA 4K94C 5C97A 2GYSA 1YN6A 4XMKL 1WH0A 3UIZA 4PJEA 2WO2B 1P7KB 1BJ1J 1P7KA 2VE6A 2X3AA 2Y1ZA 4OZFG 4HV8A 4YLQT 4N2CA 4BFOA 4WRLA 3DXAD 3KDPB 2ICEC 4G7VH 4OLYL 5B39B 1EO5A 1UUSA 4OD1L 4HUWA 1P84J 3ARUA 5F9JA 4FFYL 5ANMA 4PLKC 1JZ8A 3PNRB 2R8SH 4PFEA 3CH1B 3VDBA 2MOGA 5TK4A 3C6LB 4PW3A 1A7PH 4K5LA 5C07E 1U91A 1GPOH 3HG1B 5HGGS 2XKNB 2NX5A 4RX4A 1A02N 3QXUA 2PXYB 1JV5A 1SJVA 4AENB 3ZDYF 1BFOA 3SHSA 3VACA 3OXSB 3NCCB 1L9MA 2CPUA 4PUBH 4PJDF 3L4WA 3QUYB 2NW2B 2Q6WA 2XVLA 2PTTB 4UQEA 2WLZA 1YEHH 3FO0L 2Y36H 4P8QA 3T77B 4HZAA 4FQLH 4U1MA 1A4AA 4LKXA 4G42A 2ARJQ 4OGYL 2FLBT 1NCNA 1S9WA 2X9ZA 3ILEA 4OD2B 3TPUB 3GBNH 3MRMB 1DQJA 2JLLA 3N0PB 2EO7A 1YN7B 3QFJB 4I18A 5AVZB 1JSYA 4YHLL 4MS8C 4XXWA 5FX3A 4ELMF 5AAPA 4JRYD 3OD3A 4BKTC 3A21A 3ZMEA 5FV1L 1ZAGA 1TZIB 4PAZA 5DJDA 2NMSA 3GGWA 2Z93B 3EFDH 5KSBE 4N8CL 1AMYA 2AK1L 2ZXGA 5CEYB 4F92B 3CN0A 3ZHFA 43C9B 3KPSD 3CFMA